3NPPA

Crystal structure of a pfam duf1093 family protein (bsu39620) from bacillus subtilis at 2.15 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKVKAKGKYVETWEEVKFEDMPDSVQSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pfam DUF1093 family protein
publication title Crystal structure of a Pfam DUF1093 family protein (BSU39620) from Bacillus subtilis at 2.15 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 14
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nppA00
2K5WA 2K5QA 3NPPA
chains in the Genus database with same CATH superfamily
1Y8NB 2UXCL 2ZTEA 1PFMA 3RD4A 1TR5A 3URYA 3CF5A 4Y52H 5DEHA 2RDHA 4B3SQ 4GKJL 1L0YB 1A0IA 3I73A 1GM5A 3HZXA 2I46A 4H02A 1U0LA 3NPPA 2QILA 1E2VA 1TY2A 1PYBA 2BH8A 3K0XA 2KHSA 5KYIA 3CCMA 3GTMH 5JEAG 4LFAL 1XTCD 2X6LA 4LUOA 1WTPA 2E5LL 2UUBQ 1SYFA 1A2UA 3NWTA 1OXXK 3CMAA 4DAVA 1SR3A 1ONLA 4ZKBB 2B29A 1GD7A 2XRSD 3KF8B 4A3JB 3GTQH 1UE1A 1SBBB 4OGQC 1Y1VG 1FGBD 4X66Q 3IFDA 3J7AF 1KQSA 2YV5A 2XN9C 1FGUA 2K1BA 3CCEA 4ODGA 5M5XH 2WFWA 1N34Q 2MJ8A 1F9RA 1SJED 3KLWA 4IZ8A 4RKLA 2LSSA 2AKWB 2WACA 1VF5C 4CJ2C 1PRTB 2NVTH 2RF4A 2GVAA 2UUCL 1HNWQ 5C5MA 2UUAQ 5M3MB 3BDLA 5CR3A 1HQMC 4IN3A 5M5WB 3H3VH 1DZ1A 2IX0A 1TQOA 4A3EB 1I4GA 3CRLC 4IUUA 2QA4A 1WTHA 1IBLQ 4JC0A 5GQOA 2VQEL 2F0VA 1KABA 1LUZA 1QB5D 5M3MH 4DUYL 5JVH3 4BA2I 2R7ZB 1CKOA 1JQYD 1IBKQ 2E2IB 2ZM6L 1SNCA 3OOCA 4KD4A 3CC4A 3X3NA 3FPPA 3HOXH 2B2TC 2ZTDA 4C3IB 2F3WA 2AUJD 1HXYD 1D6EC 3Q8DA 4K0KL 2XIWA 4DKAC 3Q23A 5C3EG 5I6YA 1MKHA 3DUZA 3VR4A 3L0OA 4A3FB 1KDCA 5CYUA 1FJGQ 4P2CB 3VR6A 4DV6L 1Q46A 2AQ3B 1EY7A 1G8ZD 4LFCL 4HMIA 3J81E 4LJZC 2RCNA 3TP7A 3PUWA 1HFGA 3T1YL 1EY0A 1VQMA 2R92B 3MA2B 1AZQA 2RHQB 2R93B 1S5CD 4BY1G 3BS1A 4HIKA 4HJ7A 3TBIB 1PVOA 3DWQA 4HIDA 3VDYA 4IO9A 3LX0A 1QZHA 4GNXC 3HOYG 1ZKOA 2PZTA 3JAMc 1TWCH 4J8QA 1GUWA 1TWHH 3ND9A 5IT9c 2F0OA 2RDFA 1YNND 4DV0L 1C9OA 4UPAA 5A35A 3U9OA 1EY5A 4FO2A 3GQBA 2EPBA 3DHQA 3BDOA 4K8JA 4H13C 2IX3A 4R4IA 4EGVA 1N36L 3JC66 4RCOA 2A8VA 2FMCA 1I4PA 4FXDA 1I94Q 2ZXPA 5NUCA 2PCFB 4DV7Q 2K5DA 3TP8A 1E3PA 3BYYB 5IYCG 4YHHL 5IWAQ 3J80i 2L4NA 3G7LA 3F2BA 4I7AA 4HMJA 4ABNA 1BF4A 3R8BA 1Q12A 3EQLC 3BVMA 2QEJC 4C3JH 4F8MA 4JI8Q 1H9SB 1VDZA 1F2LA 1A8VA 1B53A 3M85A 1XPOA 3GTPB 4B3ML 3GO5A 2KBNA 2R3ZA 3PO2H 2PW7A 1AEXA 3SE0A 1F2YA 1JCKB 3NSWA 5M5YB 2K5WA 3H3VI 2JE6I 1U4MA 4KN4C 2I5HA 1VQEA 3VYTA 2JA7H 4IUQA 1TIID 4X3TA 1KLUD 2JSOA 4RAUC 4BWGB 4LF8Q 5FO8B 1WCMB 2Q2IA 2MO1A 5AJ3Q 1EQQA 4FDBA 4OWWB 1J9OA 1BQQT 5C0XJ 2EY6A 5BN4A 2K7VA 2KJXA 1UE5A 4QY7A 4ZRZA 3HOZB 3I72A 1ENFA 1QILA 1YHBA 1PFNA 4JOIC 4IALA 1SMYD 3MXPA 1NBWA 2N55A 4IJLA 3GTGB 4X6AH 4K5XA 1G2SA 4JI4L 3HKSA 2AHOB 5K36H 4J1MA 1IL2A 1O7YA 2NVQB 4UHVA 2R6GA 1HA5A 1QNKA 3OWFA 5FLMH 3GTGH 3KF6B 3E0JA 3PUVA 3HEJA 1QJOA 3VA7A 3TS0A 2DNEA 1WVLA 3GTOH 2NUCA 1VQDA 4CHTB 1BR9A 1KXLA 3PMFA 1B50A 2E2JB 2C5CA 2PNRC 1EFID 2O2LD 5C3XA 4OONA 4RGTA 4V190 3V2TA 2WP8J 4O0AA 4LK1C 2YTVA 1Q1EA 4KY7A 2AQ1B 2I5MX 1NMGA 4ZK9B 1PZID 3UDXA 5IYBG 2JJQA 1NMFA 3SK6A 1NJIC 5CBAE 4IFDH 5L37A 5C4JB 1YNNC 4B9XA 2PW5A 5ELNA 1E2ZA 3FHWA 4A93H 4NMZA 4MN3A 3PGZA 4A3KH 3SVMA 5BR8L 3I4LA 3H91A 2O5IC 4EQ5A 3CCLA 2VQFL 1Q90A 3J80E 1N32L 1RHPA 2QDLA 5ELFA 4A3DH 3W5OA 1I5FA 2EY5A 3KDFB 3LGJA 4ZAIA 5C44G 4JYAQ 4DR2Q 2E75C 3F8TA 1EFWA 4C3HB 2BA0A 5D14A 3HOVH 4M8AA 4OWTB 4LF5L 2IX1A 5K36G 2ID0A 1C4QA 3S17H 3GTLH 3NBIA 1G291 2GVBA 3OSOA 3D4WA 3SK5A 2K50A 4B9WA 3S1MH 2MQHA 4DR6Q 1X54A 4DV1Q 1B4OA 4X64Q 1SYDA 2HCCA 1RL2A 1EIGA 2BDOA 4LF4L 1SE8A 4YWMA 2RBMA 5DLQE 5LHY1 1K8OA 1H9KA 1X56A 3D4RA 4P71A 2Y0SG 3I56A 1ET6A 4Y7NH 1TWGB 2Q2UA 1OXTA 5FKAC 2PNHA 3SK4A 4ALPA 3ER0A 4NXML 2PO4A 4CKCA 2NVYB 2F1MA 2RCFA 3HOUB 2Q8RE 5IGDA 3OTOL 3K5NA 1RKNA 3F2DA 3P75A 1VQIA 4A93G 2DJFC 5G3LF 2OTLA 2WV6D 2EJGC 2NTSA 1A62A 3TRZA 4DV5L 3UE1A 2NB0A 3GV6A 4DA2A 1VQ9A 2BH2A 1WJJA 1X65A 2E74C 2F0TA 4HJ5A 4QIWE 4JI0Q 2VUMB 1KAAA 3DM3A 1L1OA 2RA4A 1TY0A 2KENA 1Q8IA 5J22A 5FK9C 2L12A 5I4DA 4J15A 5KYLA 3I55A 2VUMH 5LMNW 1EOVA 4JBKA 5LMNL 1NUCA 2H4OA 2PI2A 3CCJA 4A3IG 3SHLA 2B63H 5KNBA 4GLXA 3NP8A 1WTRA 1UAPA 4JI6L 4TRDA 1IYVA 3S2HB 3S14B 1G6PA 3SK8A 1F9QA 4KJOA 2KCNA 1CT1D 5IGEA 2K6AA 3E6ZX 4NKLA 3MXNA 4DR4Q 3S1NB 4CKEA 1SEBD 2RKSA 4GNXB 1HNZQ 1Y8PB 4XQNA 4RKBA 1HJPA 2BDNA 1WTOA 1CSQA 3KF8A 5LL6X 1LTBD 5DM63 2K05A 2DGYA 4GN5A 1KL9A 2B2YA 4A4IA 3PO3B 2F0SA 1RODA 2LKVA 3CRKC 4RHRA 3RR5A 3PQIA 1VQCA 3JAML 1L0WA 2JEAI 1X3GA 2JA8B 2M2LA 1SYEA 5A2QL 2RSOA 2KQ3A 2I5LX 4LUZA 5EKIA 3TREA 4A3MH 1N9WA 1ILQA 2UUBL 4CBVA 3ERSX 4IOAA 1LT5D 2PI2E 3PUYA 1Z47A 4X65Q 4OIKA 3D31A 2RHSB 5CGKA 1PHJA 2L5TA 3S2DB 1PH2A 3AU7A 3OW2A 1DCZA 1WFQA 1X3EA 5EGTA 3WOEA 1RIPA 1R4QB 1VF7A 1N34L 1VQBA 1ASZA 4RGOS 2ZTCA 1XX8A 3EN2A 1TS3A 2M9VA 2XGTA 3S1QB 3E3XA 1G51A 1VQLA 4N9TA 3W3AA 2B39A 2G5DA 3H0GH 1SXTA 4PNYA 1HNWL 3NTIA 2A74C 5C0XG 2UUAL 4HN7A 1N8RC 4A3GB 3KBGA 1O78A 1VMPA 3Q24A 3GTKH 1STEA 4HR7B 1IBLL 3TMEA 1P16A 4GZYC 1J5EQ 3E5SA 3I4NB 2Z4IA 3PF5A 4UY8C 2XRQD 1EWHA 1I6HB 1I50B 3M4QA 1UUPA 4A3GH 2EJMA 2LXKA 3KBXA 2ZJRA 1IBKL 1PA6A 1AH9A 4IURA 1STBA 2EOTA 4A3MG 4BY7B 1LTAD 1F2MA 4YY3Q 1XNRQ 4F88A 1PZKD 1STGA 1PH6A 2AQ2B 4QCLA 2JA5B 2FMMA 3W1BA 5IODA 1FJGL 4IUTA 4KHPQ 1Q86C 1K83H 4DUZQ 3DEPA 1Q7YC 1SE3A 1JB3A 2MNAA 5G3LD 1XMQL 5EQ0A 1K8MA 2PMZB 2TMPA 4CJ1B 1ICWA 1VQKA 1X9NA 3RZOH 4FF1A 3AFQA 1Y1WG 1K28A 3NWSA 1EYCA 3E9IA 5COYA 4A3BH 2EXDA 3KK7A 2L55A 2K28A 1YITA 2WAQB 1MBYA 4A3CH 1MI2A 2PZWA 1GOZA 4L6TB 4OO1G 1FVIA 3I4MH 1G2TA 1RDPD 3MXUA 3KYHC 4IQZA 4NXNQ 4BBSB 4E6IA 1GVPA 1OO9B 3S16H 1SNOA 2ASBA 1DJRD 1LTSD 2G9DA 1SDFA 4RHSA 2X6GA 2OF1A 5D65A 3U4VA 1SFOB 1I94L 2LY7A 3FKIB 5I9OA 4JV5Q 4DV7L 2F03A 1CZGA 4BBSH 4ID6A 1PV4A 4MTNA 1W6KA 2A6EC 3IRBA 1PH8A 3I4OA 4BBRG 5IWAL 2DJGC 2KUMA 3Q22A 1PTOC 4GOPC 1WTQA 4QF4A 2LS01 4DV4Q 4RWSC 1H95A 4DAYA 3AEVA 1F77A 2F0KA 1G6ZA 4XIGS 2ZT9C 1D5MC 4JI8L 3CQZH 1CQFA 3EROA 3HKZB 5EKLA 5GADC 5CV8A 3OMGA 5C4XH 3A8KE 1TWFH 3LWUA 4QUFA 1B3QA 1YHQA 1I3QB 1HZAA 2NYZD 4G4KA 2EYMA 3RUZA 4FNFA 4XQQA 4DK1A 1MGSA 4KK7A 3G48A 4LF8L 1SYBA 3LWEA 3K7AB 3L2PA 5AJ3L 1HZ9A 4OO1I 3I4MG 2NZ1D 4QJFA 1HPCA 4G7ZC 3PCOB 5M3FB 4P72A 4FF2A 4L63B 2Q8TA 2WB1B 4HCEA 2F4IA 4LMQD 3G6JB 5C3EB 2HCIA 2EDGA 4A3JH 2CHBD 5J3BA 2PQEA 4UDUC 2QKIC 2F0IA 3K81C 3NEMA 4CDCC 1GO3E 2G9HD 4BXXG 3BVGA 1PFSA 5CV4A 2LMCB 2J7ZA 2E8GA 3U9SA 3PF4A 3I2ZA 2B2VA 4IFDJ 3CXCA 1B70B 1UE7A 2JA6G 2OQ0A 4BY1B 3VR2A 1LTID 4XTCS 2B2WC 2DN8A 3VYSA 2ES2A 2SNMA 1II3A 4CDEC 1KTKA 3HOYB 4RFBA 5GAEC 1FNVA 2F0GA 4ZKCB 1PYWD 3P7JA 2ATWA 5M5WH 4A3EH 1YNJC 1SNQA 4JPBW 3MFYA 1UE6A 1R4PB 2NZHA 4GN3B 3T51B 1VQ4A 5C4ZA 1O7LA 1IL8A 2R7ZH 1KDBA 4FF3A 2RVLA 2E2IH 2MUYA 1U9RA 3T13A 4C3IH 4U673 1IHZA 2IJ0A 4JYAL 1XXGA 4OWXB 4DR2L 2YTYA 4YWLA 3CPFA 2IL8A 5C3WA 4KLKA 4A3JG 4A3FH 2CWAA 5ELBA 4A3LH 1U5KA 3T53B 1IKLA 1KNAA 4KTAA 1EY6A 4DR6L 2Q2HA 4CGYB 4JI5Q 4DV3Q 4N8X1 1BNZA 1BBWA 1LO5D 3OPOA 4X64L 4CJ0B 2IY5B 5LL6S 4AQYQ 2R92H 2PQAB 2R93H 5JPNC 3S9WA 1EQRA 3ERQA 3JAMi 1YJNA 4DR7Q 1BCPF 1PMRA 3MTSA 1TKWB 5KNDA 5M3MG 4QL5A 3MWYW 1XNQQ 4CDDC 3UE0A 2K04A 3NUCA 1H9MA 5IIFA 3IL8A 4A3EG 1V8QA 2MHVA 2NVXB 4KD3A 3H09A 4JI2L 2V4DA 3CHBD 5BN3A 1JOQA 3QWNA 2HQLA 3HOXG 4P74A 4HIOA 2R7ZG 4IUVA 3T1HL 2F0LA 3M7NA 1A3TA 1JE4A 3GDEA 1KD1C 2D0PA 3BZCA 2F0FA 1QZGA 2R7FA 1GHJA 4EQOA 1CHQD 1SAPA 4C3IG 2K01A 4MHEA 4DNIA 3C2PA 1B2TA 2VS1A 2XSCA 3J7A5 3GP7A 2NBFA 1JC7A 5FLXE 4R8IA 4A3FG 2PZUA 5ISRA 2UXDQ 3C46A 4JI0L 2VB3X 2X69A 2VW9A 4R1JA 1M90C 4AYBB 4L5RC 4AH6A 4FF4A 3J80c 2OTJA 4GN4B 1HNXQ 3C3LA 1VQ5A 3MEFA 3I3CA 4P73A 2HHHQ 2K4KA 1MSGA 1BO0A 2JP1A 4NDXA 3GTPH 2XWJB 3S1RB 1JMCA 4APVA 5FO7B 4DU9A 1IXRA 1CA5A 3M3YB 1ICFB 3HRZC 2SOBA 2ICEC 2VL6A 4PZ8A 3D3RA 5M5YH 1ENCA 3N52A 4LAAA 1FYCA 1NTGA 2ZXOA 5DNFA 4JI1Q 1EQTA 1DD2A 1W3SA 2OXPA 1TWAB 4DR4L 1WCMH 3M3YH 3NTKA 4MTKA 4QUCA 1PXUA 2N8NA 1B8AA 2MO0A 1HNZL 2KA7A 3K0YA 3HOZH 1TS2A 2H5XA 3M9BA 4DN4M 5EAYA 1S4ZA 5C44B 1QNUA 4FP5D 3NTHA 3ULLA 4DPGA 1CKNB 2BE5C 4C3JG 2QDBA 3RN5A 2SDFA 2NVQH 1A2TA 5JJZA 4OIJA 3HS0C 3JAME 4YCVA 2JK8A 3PO2G 3SGIA 3FPUB 5IT9E 3QO2A 2KOLA 5IP9H 1GUOA 1PTOF 2JA7G 3ONAB 2E2JH 2Y0SB 1XYIA 2N49A 1PTOB 4X65L 4GOPB 1ZXTA 4L5QA 3V96A 1GJXA 1HZBA 2KHJA 1HR0W 2RSNA 4IJHA 1MJEA 2B2UC 4EQPA 5EBDA 1TXYA 1B7YB 1C7YA 1AW7A 4PMCA 5C4JH 3QB3A 2E2DC 3CCRA 1DGSA 1FD7D 1WI5A 4RGNA 4C2MB 4O2DA 3MVVA 2CKZB 4WJ3M 1VQJA 2CQOA 3PSIA 4NW2A 4CDFC 1Q82C 1TU2B 1HTPA 4O42A 1RTNA 2YYZA 1SNPA 1S40A 4K0KQ 2FINB 5FLMG 1PLFA 2IPKD 4JBMA 2F0PA 4POGA 2OQKA 1M8AA 4C3HH 5ELOA 1J5EL 2OEOA 2HIVA 3AQQA 4LFCQ 1HQRD 1S5DD 3TSSA 1TS4A 4DXFA 5ELEA 1B9NA 2UU9Q 4XT3B 4GLVB 4ZQ3A 1K3RA 1XNRL 4HEDA 1IW7C 1V1PA 4MZ9A 4HJ8A 1L1OC 4A3IB 4IFDG 5IYDH 4F87A 1STHA 3CCQA 1EOTA 4KHPL 5D3DA 1EYGA 1TWGH 5IGCA 3DMUA 1JOOA 3D8GA 4A3KG 1EEID 2O5JC 2NVYH 4BS9A 2BCOA 2CW0C 3HOUH 1BXTA 5JJLA 5I9PA 4WORA 4A3DG 1QG7A 1KC8C 3A0JA 3HOVG 2E76C 4JI7Q 3VA5A 1KAWA 1LLRD 4DNTB 3CPWA 4ZYSA 3IAYA 3DXJC 5E1FA 3ULJA 3RLFA 1QVFA 5IY0A 1BDOA 3EVQA 3S15B 1AE2A 4DK3C 4R4CA 1SN8A 3A55A 4XT1B 2PMZE 1K8GA 3PUXA 4NXNL 4LUVA 1MIUA 3DM1A 4DFAA 1V1OA 2B2YC 2HDMA 1CHPD 2HDLA 1NE3A 4IFDI 5T1GA 4JV5L 4XYOA 2F3VA 5JVG3 4JI3Q 3I7FA 1E0BA 2QCPX 1YJ9A 2EVBA 3H3VC 2WAQE 4IUPA 4KY6A 3S2HH 1R9TB 3S14H 4DV4L 2I07B 3BZKA 3ICEA 3A56A 3KOJA 3QOLA 4DK6C 1Q1BA 3A7LA 3HOUG 5IGBA 3RN2A 3S1NH 4A76A 4IOCA 5LMUL 2BOSA 5E4WC 2E2HB 3R93A 2D5DA 4PG3A 1Y8OB 4YIJA 1WYDA 2M00A 5DM73 4DR5Q 2N3SA 4LF7Q 3W1GA 1W6JA 2A19A 4B3SL 1Z7TA 3J7YW 4RGMA 1XMOQ 3HGBA 4OX9Q 2YU9B 1YEZA 3BU2A 1IBMQ 3PO3H 1S5ED 4RG1A 1YI2A 2EYFA 5E3FA 2F0QA 1EIFA 2VUMG 4XQJA 3BZDB 2QF7A 4OHJA 1C0AA 3HKZE 1X3PA 3TEHB 2JA8H 4FXGC 2A6ED 5J39A 2B63G 1B1ZA 1LT3D 1PTOD 4X66L 1GUTA 1HUMA 2EYOA 1HR0Q 2QW7A 1BCPC 1PYSB 1I4QA 1SJHD 3RZDB 3S2DH 4X62Q 2MP1A 1KLGD 5EPKA 2A6HC 1CI3M 4ULLA 2LFNA 1CZWA 4KKSA 4QB4A 4KY5A 2Z8LA 3UDIA 4TKOB 5GROA 1CFMA 3A5ZB 3S1QH 2C35B 1PDQA 1I4XA 2WB1E 1Y1WB 1U4LA 1HUNA 5JJIA 2F0EA 2GA4B 4WJ4A 3J80L 1IZ6A 1GKHA 3W2DA 3K7UC 3QG1A 4DAMA 2Z4HA 1LTLA 1HCZA 3I4NH 3OHXC 2JYOA 1JWSD 1I6HH 1I50H 3HG9A 3H15A 4FVMA 3PIOA 3BJUA 3P20A 3STBC 5HURA 5F2DA 3M4OB 1KHIA 1KIXA 3CAMA 4BY7H 2Q2TA 1PH9A 3HOWB 5HY6A 1CK1A 1CKMA 4TSSA 5CC4A 1CUKA 1NY4A 1IKMA 3GV3A 3BDCA 1EYDA 4PV1C 2JA5H 1X6OA 2L15A 4OL7A 1FNUA 4BBRB 1SROA 3O13A 3UDFA 3HOWH 1DOLA 3EFXD 2QEXA 4J6HA 4FXKC 4JI5L 4DV3L 3H0GG 2XTIA 2K5NA 4HIMA 4LFBQ 1EIHA 4QIWB 2K75A 4AQYL 2Z6KA 1NR4A 1HFNA 1YNJD 5KNCA 1WTXA 1CA6A 4DR7L 3TP5A 1VQ7A 3A8JE 4NPSA 3UDGA 4YWKA 4L5SA 1BKBA 3D0FA 1QCBD 1P8LA 1XNQL 3AYHB 3K5LA 1V1QA 2JXMB 3I90A 4A3GG 2AUKA 2R61A 1H9SA 3D6CA 1PZJD 1JWMD 2J0TD 2F0HA 3VYRA 4G57A 5GAGC 1RF2D 2UXBQ 1JWUD 5AFWA 3ZYYX 3LNNA 4R8NA 4ZUJA 1VQNA 4XDXA 3J7ZC 4JK1C 1Z9FA 3PV0A 5JEAH 3K57A 2K5HA 1Y1VB 3KJOA 1M4VA 1JE5A 2H1EA 3T56B 1SFOH 3GTJB 1FNWA 3FKIH 2OCEA 2VZAA 2UXDL 1H9JA 2K32A 4TQUS 2FFKB 4OXPA 1E24A 4DXGA 1HZCA 3E0EA 4IUNA 1HNXL 1D1IA 2Q8IB 5D3IB 3NXWA 2HHHL 1L1OB 1TVXA 2WKCA 2JA6B 1X32A 2CWPA 1O80A 2XVSA 3NK9A 3J81c 1XPUA 1D5ZC 1X3QA 4A3BG 4ME3A 2CCZA 1A15A 2Z9HA 3NHHA 2A68C 2NTTA 2CH4A 1EEFD 4K6DA 3KF6A 1TT2A 1I3QH 3G71A 4A3CG 1CKNA 1C8CA 2B2VC 1DYQA 4JI1L 1TS5A 3PIO3 2OT2A 4AYBE 5CORA 5IP7H 3GTMB 3K7AH 1W2BA 2WAQG 2EYJA 1ZYRC 2XNAC 4ILWA 2N88A 4PQXA 5ELDA 3MXNB 3M4YA 3OMCA 3OW7A 3SEBA 1MD2D 2MFIA 4DR3Q 1RD9D 4BBSG 5CV6A 5M3FH 3GTQB 1JR0D 4GOPA 4WFN3 4LNQA 1CM9A 2KHIA 1VQPA 4DR1Q 2JQOA 5KIXA 4NB3A 2K52A 3CP0A 3FKIG 2NZOA 2F0DA 3SDZA 4X3KA 5C3EH 5M5XB 4LF9Q 4JBWA 3AB9A 2ZXRA 1OTCA 4GKKQ 4HCSA 4R9WA 4ZCKA 3F2CA 4LW1A 2OWOA 1N33Q 5C4HA 3K5OA 5C4XG 2NVTB 3KDFA 4LF6Q 2Z0SA 1WOCA 5CBEE 1PRTF 4XYQA 5H1SE 2F4VQ 3HKZG 3CCSA 4BY1H 2N78A 3WOFA 5FLXc 4O1NA 1JT8A 1QOHA 1VQFA 1HA6A 1ESRA 3HOYH 1CQVA 2D9UA 5C5LA 2NN6H 1E2WA 2ENBA 1EL0A 1B9MA 2WKDA 3C1EA 2EE1A 3AFPA 3AMUA 4ZUIA 5IP7G 1KDAA 3HOXB 3KFUA 3K8AA 4UP7A 1J8IA 1E1OA 1SNMA 1VS0A 2BE5D 3L9AX 1ML0D 3CD6A 2Y0SE 2P5ZX 2L1BA 5EBCA 4KV6A 5M3FG 4OEMB 2A69C 3S24A 3CCVA 2WB1G 2MGSA 1SE4A 1VQ6A 1LTGD 3FDTA 3WDNA 4S3SA 4DV1L 1L2FA 4DGZA 3DEOA 3RLOA 5IYCH 2B2WA 2YTXA 4PMWA 3CC2A 2PYKA 1D8LA 1X55A 5I2YA 4V0BA 2EJFC 3IKJA 2K33A 3FRPB 2UU9L 3KUPA 4QGUA 5FO9B 3NQIA 1XTDA 3GD7A 3X3MA 1TWCB 5E7NA 1XMQQ 3PUZA 2JN4A 1PH1A 5I2XA 1BCPB 1TWHB 3V05A 3OYYA 1KRSA 1OXUA 2HIXA 1LT6D 2AWNA 5IE8A 1S72A 4B3RQ 1F9SA 3OIQA 2B2TA 4R4TA 3R3OA 1JOKA 2NN6G 3M4PA 5ELCA 5JJKA 1EQVA 1NCVA 4C1NK 3ND8A 2NVXH 3A8IE 3NBHB 3F1ZA 3MXGA 3DLLA 1AFPA 4K2KA 1JJ2A 1GXDC 1OXVA 2VNUD 3I91A 1VQOA 1HRJA 2KEDA 4NP5A 2B8GA 5CV5A 1UWVA 4JI7L 1SYGA 4RA8A 4A3LG 5JAVA 1NSNS 4G7HC 2HT1A 2F0UA 3KLSX 2Z1CA 3MZ5A 3P1HA 4UAIA 1QUQB 1K9MC 4GNXA 2B3GA 2EY1A 3FP9A 4C3JB 1A3UA 1IW7D 5C6AA 2R92G 4WJWA 5I6WA 4B3TQ 2R93G 1YVCA 3PO2B 1SRUA 5IGFA 3VYUA 2HD3A 1CSPA 1B3AA 4LWCA 3TQYA 1DONA 3MC0B 1SE2A 3J81j 2JA7B 4DV2Q 3BVZA 4DNRB 3E9HA 2CW0D 2UXCQ 3S1RH 1V9PA 2O4XA 3H94A 3MHBA 2NN6I 1GUNA 4JI3L 1JJCB 4DAPA 4GKJQ 1NR2A 2CQAA 3FEWX 3SR1A 3FMCA 3J7AV 1QWYA 3B6YA 3QIAA 4HJ9A 3RNUA 2D0OA 4JBJA 5IYBH 1S5FD 4M1UB 1LYLA 1SLJA 1TWAH 4YCWA 3VR5A 1PH3A 3ULPA 4LFAQ 3TP6A 1YBYA 2BA1A 2E5LQ 1F2ZA 1Q3LA 4DAYB 1JB7A 4DR5L 1AZPA 2RDGA 4JVZA 1B44D 1QVGA 4LF7L 5GAHC 1UNSA 4QQBX 1ZEQX 4K8IA 2JEBI 1YNXA 4Q0FA 1XMOL 1K73C 1KRTA 1D5XC 4XXEA 4POFA 4OX9L 5C44H 1E1TA 5EKKA 5T1IA 3D4DA 1IBML 5A2QE 4F7XA 1FR3A 1VMCA 2L9HA 2KCMA 3GTOB 3NE5B 2FXQA 3KLRA 4AYBG 1Q81C 4R4OA 3IFTA 1MJCA 2EYHA 2KCCA 4N9PA 2CVRA 1PH5A 1PRTD 4KMUC 2UUCQ 1Z6HA 4EX5A 2ZJPA 1D7QA 1S5BD 3NELA 2VXWA 4IPGA 2K5QA 2WIIB 4RH6A 4G7OC 4HTHA 1HR0L 1ASYA 1GUGA 4JOIA 1WCMG 1PTOH 1EZ6A 4K6LA 3HFZB 2VQEQ 4K5WA 1EWIA 4X62L 4A93B 4DUYQ 1NNXA 4MNOA 2CH4W 4A3KB 2D2CC 1V43A 3NQTA 3HOZG 2F0MA 2ZM6Q 1LACA 2C9OA 1HH2P 4AIMA 4A3DB 4PMBA 1E7ZA 4C2MH 5CMDA 2Z6BA 3QR8A 1EU4A 1LTTD 3HOVB 4PZ6A 3RMHA 2VB2X 1G91A 3S17B 3GTLB 2A5HA 3EBEA 1T9HA 4DV6Q 1T5XD 3S1MB 1EY8A 4X3SA 1VQ8A 1VQHA 2AWOA 3J81L 1AP0A 2DNCA 1GUSA 1BUVT 3UI2A 2EZVA 2RQXA 5IP9G 3T1YQ 3R2TA 4YY3L 1BCPD 3C1FA 1KNEA 3QOJA 1EY9A 4Y7NB 4A75A 1LT4D 2B2UA 2A6HD 2I0QA 1I4RA 4KJNA 2LXJA 3U4ZA 1IYJB 1D2BA 4R4QA 5EPLA 2J4XA 4KN7C 4DUZL 3CU7A 4DV0Q 1K0RA 4A3IH 1E22A 4JW0A 3K5MA 1M1KC 1PH7A 4MIUA 3NENA 2XWBB 1UEBA 2K5VA 1S3OA 4JI2Q 1I4HA 4LFBL 1X3FA 4H7BA 4DK0A 1K8AC 1JORA 1L0XB 4WRDA 2L0CA 4K2LA 1N36Q 4ME5A 3KJPA 3A54A 3T1HQ 2IW3A 4C3HG 3T16A 4KHVA 2L11A 1WD1A 1HHVA 4YHHQ 5JEAJ 3D6WA 3QJYA 3STBD 1A63A 3EA6A 4JCVE 1SMYC 3I70A 5TSSA 1F9PA 1XWEA 2FHTA 3BYTB 1RJTA 2DY7A 4H44C 5FLXL 2UXBL 3S15H 2HQEA 2F3IA 4GS3A 5KRUA 3A7AB 2VY3A 1O7IA 2KEEA 4P75A 4B3MQ 4RMFA 5IYDG 2B63B 2EYLA 2F0WA 4KI0A 1PRTC 3DWPA 4YCUA 2A1AA 2SEBD 2DY8A 4HSVA 3MEHA 2K14A 1WTVA 2KVMA 3MFGA 5IOCA 4HSPA 1DM0B 5HGQA 1XJVA 1ESFA 3MAQA 1UEAB 3CW2C 2CFMA 4UP9A 1R9TH 1WD0A 2K03A 3G4SA 1QE6A 3TS2A 1DXMA 1GHKA 1XPRA 2E2HH 1STAA 1RTOA 3K59A 2EXZA 3TN2A 2F52A 2EY2A 4JI4Q 5FJ8H 5C0XH 5EPJA 1YZ6A 1T5EA 3KLSA 3Q6SA 2ZJQA 2ICIA 4C1NI 2YU9H 1K3BC 4C56C 1ILPA 1H9RA 1LV9A 3TZUA 1IYUA 3G6EA 1ENAA 4A3MB 4I65A 3TDQA 4BA1I 3CKIB 2PPBC 5EJWA 2HUGA 3K80C 2KECA 4U68A 5IT9L 3R2IA 4PZ7A 4TVAB 4DR3L 4OELB 1BBUA 3A74A 1YJWA 2V1CC 1EWCA 2GN5A 2D62A 4HAEA 4DR1L 3Q0AA 3M7GA 3L3OC 2FJ2A 5KEEA 4KKTA 1AN8A 4LF9L 1EIYB 5BN5A 4Z9CB 1WTWA 4GKKL 1CTMA 4X3UA 1PFBA 3RZDH 2A68D 4GLAC 1N33L 5BR8Q 3H0GB 3N6RA 4LF6L 1D1KA 2QGQA 2KCTA 1FL0A 3CC7A 1A3VA 1YHAA 4L8JA 2VQFQ 1N32Q 5CV9A 1NAPA 1EZ8A 2F4VL 4EVOA 2EYPA 2B8FA 4ZLTF 3GTKB 1STYA 3U58A 1Y1WH 1ZYRD 3PO3G 5KGUA 5FJ8G 4KHZA 4DF7A 4LF5Q 4L5TA 1LTRD 2ALYB 3EIVA 5M9OA 2EIFA 3VR3A 3PIPA 2Z6KC 2PQAA 1BOSA 3HP3A 3OIPA 1AE3A 2JA8G 4RCNA 1QVCA 1J6QA 2TSSA 4LF4Q 3ITPA 1U4RA 1VQGA 3WWVA 4OO1H 4K14A 3K6OA 4K5VA 2R7DA 3TZDA 5HGTA 3M4OH 1K83B 1LM0A 2AMCB 1ET9A 4NXMQ 1RCVD 4EQNA 3NBHA 3EJIA 3OTOQ 1JICA 4FYDA 4BBRH 3DWAA 1VQAA 1EY4A 2IT1A 3RZOB 3A5UA 1JJGA 1EUJA 2SNSA 4DV5Q 1SMXA 1OXSC 2F0JA 1DOKA 5JOBA 4A3BB 1EU3A 4KKUA 5JPMC 2DUDA 1BVSA 3FVQA 4QMGA 4CKBA 3K58A 1A6XA 1VCIA 2IWHA 2F0NA 5C0XI 1SYCA 4B3RL 3I8ZA 4I7ZC 1QUQA 1SSOA 2WINB 3RLNA 4H0LC 3I4NG 2IHEA 1K0SA 1V1PB 4N8FA 3I4MB 4JG2A 1MSHA 2A73B 3L7ZC 1EYAA 2A69D 4HJAA 1YIJA 1HTLD 1PH4A 1DOMA 3CCUA 3S16B 1Q8KA 3F2UA 5FOBB 1O7ZA 3ZJYC 3H6MA 5E4XA 4BY7G 3SXHA 5IGGA 3T4AC 2NWGA 5LMNQ 2IHFA 3BG3A 3OWEB 2JA5G 2EQSA 2MPMA 5CV7A 1BBXC 1C48A 1Y1VH 4JI6Q 3U50C 3HOWG 1I6VC 3GTJH 1Y14B 1LABA 3CQZB 5J1ZA 4IPCA 4B3TL 4BXXH 4IPDA 1STNA 2JA9A 5C4XB 3CMEA 3J81i 1TWFB 4IPHA 5K5PA 4B08A 1Y69U 2JA6H 5LMUQ 1U4PA 4UP8A 5DAUA 4Q5VA 4DV2L 3PIP3 1SNDA 1MHWC
chains in the Genus database with same CATH topology
1Y8NB 1PFMA 3RD4A 1TR5A 3URYA 5DEHA 2RDHA 1L0YB 3I73A 3HZXA 2I46A 3NPPA 2QILA 1E2VA 1TY2A 2KHSA 5KYIA 5JEAG 1XTCD 2X6LA 1WTPA 1SYFA 1A2UA 3NWTA 1OXXK 4DAVA 1ONLA 4ZKBB 2XRSD 4A3JB 1SBBB 4OGQC 1FGBD 3IFDA 3J7AF 2XN9C 2K1BA 4ODGA 2MJ8A 1F9RA 1SJED 4IZ8A 4RKLA 2WACA 1VF5C 4CJ2C 1PRTB 5C5MA 5M3MB 3BDLA 5CR3A 1HQMC 4IN3A 5M5WB 1DZ1A 2IX0A 1TQOA 4A3EB 1I4GA 3CRLC 4IUUA 2F0VA 1KABA 1QB5D 5JVH3 4BA2I 2R7ZB 1JQYD 2E2IB 1SNCA 3OOCA 4KD4A 3X3NA 3FPPA 2B2TC 4C3IB 2F3WA 2AUJD 1HXYD 1D6EC 2XIWA 3Q23A 5I6YA 3DUZA 3VR4A 4A3FB 1KDCA 5CYUA 4P2CB 3VR6A 2AQ3B 1EY7A 1G8ZD 4HMIA 3J81E 4LJZC 3TP7A 3PUWA 1HFGA 1EY0A 2R92B 3MA2B 1AZQA 2R93B 1S5CD 3BS1A 3TBIB 3DWQA 3LX0A 1ZKOA 2PZTA 4J8QA 1GUWA 3ND9A 2F0OA 2RDFA 1YNND 5A35A 3U9OA 1EY5A 4FO2A 3GQBA 2EPBA 3DHQA 3BDOA 4K8JA 4H13C 2IX3A 4EGVA 4RCOA 2FMCA 1I4PA 4FXDA 2ZXPA 5NUCA 2PCFB 2K5DA 3TP8A 3BYYB 2L4NA 3G7LA 4HMJA 4ABNA 1BF4A 3R8BA 1Q12A 3EQLC 3BVMA 2QEJC 4F8MA 1H9SB 1VDZA 1F2LA 1B53A 3M85A 3GTPB 3GO5A 2R3ZA 2PW7A 1AEXA 3SE0A 1F2YA 1JCKB 3NSWA 5M5YB 2K5WA 2JE6I 1U4MA 4KN4C 3VYTA 4IUQA 1TIID 4X3TA 1KLUD 2JSOA 4RAUC 4BWGB 5FO8B 1WCMB 1J9OA 1BQQT 5C0XJ 2EY6A 5BN4A 2K7VA 2KJXA 4ZRZA 3HOZB 3I72A 1ENFA 1QILA 1PFNA 4IALA 1SMYD 3MXPA 2N55A 3GTGB 4K5XA 1G2SA 5K36H 4J1MA 2NVQB 1O7YA 2R6GA 1HA5A 1QNKA 3OWFA 3E0JA 3PUVA 3HEJA 1QJOA 3VA7A 2DNEA 1WVLA 2NUCA 4CHTB 1BR9A 3PMFA 1B50A 2E2JB 2C5CA 2PNRC 1EFID 2O2LD 5C3XA 4RGTA 4V190 3V2TA 2WP8J 4LK1C 1Q1EA 4KY7A 2AQ1B 4ZK9B 1PZID 3SK6A 5CBAE 4IFDH 5C4JB 1YNNC 4B9XA 2PW5A 1E2ZA 4NMZA 4MN3A 3SVMA 3I4LA 3H91A 2O5IC 1Q90A 3J80E 1RHPA 5ELFA 2EY5A 4ZAIA 2E75C 4C3HB 2BA0A 5D14A 4M8AA 2IX1A 5K36G 2ID0A 1C4QA 3NBIA 1G291 3OSOA 3D4WA 3SK5A 4B9WA 1B4OA 1SYDA 2HCCA 1EIGA 2BDOA 2RBMA 5LHY1 1K8OA 1H9KA 3D4RA 1ET6A 1TWGB 5FKAC 1OXTA 3SK4A 2PO4A 4CKCA 2NVYB 2F1MA 3HOUB 2Q8RE 5IGDA 3K5NA 1RKNA 3P75A 5G3LF 2WV6D 2EJGC 2NTSA 2NB0A 3GV6A 4DA2A 2E74C 2F0TA 2VUMB 1KAAA 2RA4A 1TY0A 1Q8IA 5J22A 5FK9C 2L12A 5I4DA 5KYLA 1NUCA 2H4OA 3SHLA 5KNBA 3NP8A 1WTRA 1UAPA 4TRDA 1IYVA 3S2HB 3S14B 3SK8A 1F9QA 4KJOA 5IGEA 1CT1D 2KCNA 2K6AA 3E6ZX 4NKLA 3MXNA 3S1NB 4CKEA 1SEBD 2RKSA 1Y8PB 4XQNA 4RKBA 2BDNA 1WTOA 3KF8A 5LL6X 1LTBD 5DM63 2K05A 2B2YA 3PO3B 2F0SA 1RODA 2LKVA 3CRKC 4RHRA 3JAML 2JEAI 2JA8B 2M2LA 1SYEA 5A2QL 2RSOA 2KQ3A 5EKIA 1ILQA 4CBVA 1LT5D 3PUYA 1Z47A 4OIKA 3D31A 5CGKA 2L5TA 3S2DB 3AU7A 1DCZA 5EGTA 3WOEA 1R4QB 1VF7A 4RGOS 1XX8A 1TS3A 2M9VA 3S1QB 4N9TA 3W3AA 2B39A 1SXTA 4PNYA 3NTIA 2A74C 5C0XG 4HN7A 4A3GB 3KBGA 1O78A 1VMPA 3Q24A 1STEA 4HR7B 3TMEA 4GZYC 3E5SA 3I4NB 2Z4IA 2XRQD 1EWHA 1I6HB 1I50B 1UUPA 2EJMA 3KBXA 4IURA 1STBA 2EOTA 4BY7B 1LTAD 1F2MA 4F88A 1PZKD 1STGA 2AQ2B 4QCLA 2JA5B 2FMMA 5IODA 4IUTA 3DEPA 1SE3A 1JB3A 5G3LD 5EQ0A 1K8MA 2PMZB 2TMPA 4CJ1B 1ICWA 4FF1A 3NWSA 1EYCA 5COYA 3KK7A 2L55A 2K28A 2WAQB 1MBYA 1MI2A 2PZWA 1GOZA 4L6TB 4OO1G 1G2TA 1RDPD 3MXUA 4IQZA 4BBSB 4E6IA 1OO9B 1SNOA 1DJRD 1LTSD 2G9DA 1SDFA 4RHSA 2X6GA 2OF1A 5D65A 1SFOB 2LY7A 3FKIB 5I9OA 2F03A 1CZGA 4ID6A 1W6KA 2A6EC 2KUMA 3Q22A 1PTOC 1WTQA 4QF4A 2LS01 4RWSC 4DAYA 1F77A 2F0KA 1G6ZA 4XIGS 2ZT9C 1D5MC 1CQFA 3EROA 3HKZB 5EKLA 5CV8A 3OMGA 3A8KE 3LWUA 4QUFA 1I3QB 2NYZD 4G4KA 2EYMA 3RUZA 4FNFA 4XQQA 4DK1A 1MGSA 4KK7A 1SYBA 3LWEA 3K7AB 4OO1I 2NZ1D 1HPCA 4G7ZC 5M3FB 4FF2A 4L63B 2Q8TA 2WB1B 4HCEA 2F4IA 4LMQD 3G6JB 5C3EB 2HCIA 2EDGA 2CHBD 2PQEA 4UDUC 2QKIC 2F0IA 2G9HD 3BVGA 5CV4A 2LMCB 2J7ZA 3U9SA 2B2VA 4IFDJ 4BY1B 3VR2A 1LTID 4XTCS 2B2WC 2DN8A 3VYSA 2SNMA 1II3A 3HOYB 1KTKA 4RFBA 1FNVA 2F0GA 4ZKCB 1PYWD 3P7JA 1YNJC 1SNQA 3MFYA 1R4PB 3T51B 5C4ZA 1O7LA 1IL8A 1KDBA 4FF3A 2RVLA 2MUYA 1U9RA 3T13A 4U673 1IHZA 2IJ0A 1XXGA 2IL8A 5C3WA 5ELBA 3T53B 1IKLA 1KNAA 4KTAA 1EY6A 4CGYB 1BNZA 1LO5D 3OPOA 4CJ0B 5LL6S 5JPNC 3S9WA 3ERQA 1BCPF 1PMRA 3MTSA 1TKWB 5KNDA 3MWYW 2K04A 3NUCA 1H9MA 5IIFA 3IL8A 2NVXB 1V8QA 2MHVA 4KD3A 3H09A 2V4DA 3CHBD 5BN3A 1JOQA 3QWNA 4IUVA 2F0LA 3M7NA 1A3TA 1JE4A 2F0FA 1GHJA 4EQOA 1CHQD 1SAPA 4C3IG 2K01A 4MHEA 3C2PA 1B2TA 2XSCA 3GP7A 2NBFA 1JC7A 5FLXE 4R8IA 2PZUA 5ISRA 3C46A 2VB3X 2X69A 4AYBB 4FF4A 3C3LA 3I3CA 1MSGA 1BO0A 2JP1A 4NDXA 2XWJB 3S1RB 5FO7B 4DU9A 1CA5A 3M3YB 3HRZC 2SOBA 2ICEC 3D3RA 1ENCA 3N52A 4LAAA 1FYCA 5DNFA 2ZXOA 1EQTA 1DD2A 2OXPA 1TWAB 3NTKA 4QUCA 1PXUA 2KA7A 3K0YA 1TS2A 4DN4M 1S4ZA 5C44B 1QNUA 4FP5D 3NTHA 2BE5C 4C3JG 2QDBA 2SDFA 1A2TA 5JJZA 4OIJA 3HS0C 3JAME 3FPUB 5IT9E 3QO2A 2KOLA 1GUOA 1PTOF 3ONAB 2Y0SB 1XYIA 1PTOB 1ZXTA 3V96A 1GJXA 2RSNA 2B2UC 4EQPA 5EBDA 1AW7A 4PMCA 3QB3A 2E2DC 1FD7D 4RGNA 4C2MB 3MVVA 4NW2A 1TU2B 1HTPA 4O42A 1RTNA 2YYZA 1SNPA 2FINB 1PLFA 2IPKD 2F0PA 1M8AA 2OEOA 1HQRD 1S5DD 3TSSA 1TS4A 4DXFA 5ELEA 1B9NA 4XT3B 4ZQ3A 4HEDA 1IW7C 1V1PA 4A3IB 4IFDG 4F87A 1STHA 1EOTA 5D3DA 5IGCA 3DMUA 1JOOA 3D8GA 1EEID 2O5JC 4BS9A 2BCOA 2CW0C 1BXTA 5I9PA 4WORA 1QG7A 2E76C 3VA5A 1LLRD 4DNTB 4ZYSA 3IAYA 3DXJC 5E1FA 3RLFA 1BDOA 3EVQA 3S15B 3A55A 4XT1B 3PUXA 3DM1A 4DFAA 1V1OA 2B2YC 2HDMA 1CHPD 2HDLA 4IFDI 5T1GA 4XYOA 2F3VA 5JVG3 1E0BA 2QCPX 2EVBA 3H3VC 4IUPA 4KY6A 1R9TB 2I07B 3A56A 3QOLA 1Q1BA 3A7LA 5IGBA 2BOSA 5E4WC 2E2HB 3R93A 2D5DA 1Y8OB 4YIJA 2M00A 5DM73 1W6JA 1Z7TA 3J7YW 4RGMA 3HGBA 2YU9B 1S5ED 2EYFA 5E3FA 2F0QA 4XQJA 3BZDB 2QF7A 4OHJA 1X3PA 4FXGC 2A6ED 5J39A 1B1ZA 1LT3D 1PTOD 1GUTA 1HUMA 2EYOA 1BCPC 1I4QA 1SJHD 3RZDB 2MP1A 1KLGD 5EPKA 2A6HC 1CI3M 4ULLA 2LFNA 1CZWA 4KKSA 4QB4A 4KY5A 2Z8LA 4TKOB 1CFMA 1PDQA 1I4XA 1Y1WB 1U4LA 1HUNA 2F0EA 2GA4B 3J80L 3W2DA 3QG1A 2Z4HA 1HCZA 3OHXC 2JYOA 1JWSD 3HG9A 4FVMA 3P20A 5HURA 5F2DA 3M4OB 3HOWB 1CK1A 5CC4A 4TSSA 1IKMA 3GV3A 3BDCA 1EYDA 4PV1C 4OL7A 1FNUA 4BBRB 3O13A 1DOLA 3EFXD 4J6HA 4FXKC 1EIHA 4QIWB 1NR4A 1HFNA 1YNJD 5KNCA 1WTXA 1CA6A 3TP5A 3A8JE 1QCBD 3K5LA 2JXMB 3I90A 2AUKA 2R61A 1H9SA 3D6CA 1PZJD 1JWMD 2J0TD 2F0HA 3VYRA 4G57A 1RF2D 1JWUD 5AFWA 3ZYYX 3LNNA 4R8NA 4ZUJA 4XDXA 4JK1C 3PV0A 5JEAH 3K57A 1Y1VB 1M4VA 2H1EA 3T56B 3GTJB 1FNWA 1H9JA 2K32A 4TQUS 2FFKB 4DXGA 4IUNA 1D1IA 2Q8IB 5D3IB 3NXWA 1TVXA 2WKCA 2JA6B 1X32A 1O80A 2XVSA 3NK9A 1D5ZC 1X3QA 1A15A 3NHHA 2A68C 2NTTA 1EEFD 4K6DA 1TT2A 1C8CA 2B2VC 1DYQA 1TS5A 3PIO3 2OT2A 5CORA 3GTMB 2EYJA 1ZYRC 2XNAC 4ILWA 2N88A 4PQXA 5ELDA 3M4YA 3OMCA 3OW7A 3SEBA 1MD2D 1RD9D 5CV6A 3GTQB 1JR0D 4WFN3 1CM9A 5KIXA 2F0DA 3SDZA 4X3KA 5M5XB 4JBWA 3AB9A 2ZXRA 4HCSA 4R9WA 5C4HA 3K5OA 2NVTB 5CBEE 1PRTF 4XYQA 3WOFA 4O1NA 1QOHA 1HA6A 1ESRA 1CQVA 2D9UA 5C5LA 2NN6H 1E2WA 2ENBA 1EL0A 1B9MA 2WKDA 3C1EA 2EE1A 3AMUA 4ZUIA 1KDAA 3HOXB 1J8IA 1SNMA 2BE5D 3L9AX 1ML0D 2L1BA 5EBCA 4KV6A 2A69C 2MGSA 1SE4A 1LTGD 3FDTA 3WDNA 4S3SA 4DGZA 3DEOA 2B2WA 4PMWA 2PYKA 5I2YA 4V0BA 2EJFC 3IKJA 2K33A 3FRPB 3KUPA 5FO9B 3NQIA 3GD7A 3X3MA 1TWCB 3PUZA 5I2XA 1BCPB 1TWHB 3V05A 1OXUA 1LT6D 2AWNA 1F9SA 3OIQA 2B2TA 3R3OA 1JOKA 2NN6G 5ELCA 1EQVA 1NCVA 4C1NK 3ND8A 3A8IE 3MXGA 1AFPA 4K2KA 1GXDC 1OXVA 2VNUD 3I91A 1HRJA 2KEDA 4NP5A 2B8GA 5CV5A 1SYGA 4RA8A 5JAVA 1NSNS 4G7HC 2F0UA 3KLSX 2Z1CA 3MZ5A 3P1HA 4UAIA 2EY1A 4C3JB 1A3UA 1IW7D 5C6AA 4WJWA 5I6WA 3PO2B 5IGFA 3VYUA 1B3AA 1DONA 3MC0B 1SE2A 2JA7B 3BVZA 4DNRB 2CW0D 2O4XA 3H94A 3MHBA 2NN6I 1GUNA 4DAPA 1NR2A 2CQAA 3FEWX 3SR1A 3FMCA 3J7AV 1QWYA 3QIAA 1S5FD 4M1UB 3VR5A 3TP6A 2BA1A 1F2ZA 1Q3LA 1AZPA 2RDGA 1B44D 1UNSA 1ZEQX 4K8IA 2JEBI 4Q0FA 1D5XC 4XXEA 5EKKA 5T1IA 3D4DA 5A2QE 4F7XA 1FR3A 1VMCA 2L9HA 3GTOB 3NE5B 3KLRA 3IFTA 2EYHA 2KCCA 4N9PA 2CVRA 1PRTD 4KMUC 1Z6HA 1S5BD 2VXWA 2K5QA 2WIIB 4RH6A 4G7OC 4HTHA 1GUGA 1PTOH 1EZ6A 4K6LA 4K5WA 4A93B 4A3KB 2D2CC 1V43A 3NQTA 2F0MA 1LACA 2C9OA 4A3DB 4PMBA 5CMDA 1EU4A 1LTTD 3HOVB 3RMHA 2VB2X 1G91A 3S17B 3GTLB 2A5HA 1T5XD 3S1MB 1EY8A 4X3SA 2AWOA 3J81L 1AP0A 2DNCA 1GUSA 1BUVT 3UI2A 2EZVA 2RQXA 3R2TA 1BCPD 3C1FA 1KNEA 3QOJA 1EY9A 4Y7NB 1LT4D 2B2UA 2A6HD 1I4RA 4KJNA 1D2BA 5EPLA 2J4XA 4KN7C 3CU7A 3K5MA 4MIUA 2XWBB 1I4HA 4H7BA 4DK0A 1JORA 1L0XB 4WRDA 2L0CA 4K2LA 4ME5A 3A54A 2IW3A 4C3HG 3T16A 4KHVA 2L11A 1WD1A 1HHVA 5JEAJ 3D6WA 3QJYA 3EA6A 1SMYC 3I70A 5TSSA 1F9PA 1XWEA 2FHTA 3BYTB 1RJTA 2DY7A 4H44C 5FLXL 2HQEA 5KRUA 3A7AB 2KEEA 2B63B 2EYLA 2F0WA 4KI0A 1PRTC 3DWPA 2SEBD 2DY8A 4HSVA 3MEHA 1WTVA 2KVMA 3MFGA 5IOCA 4HSPA 1DM0B 1ESFA 3MAQA 1UEAB 1WD0A 2K03A 1QE6A 1DXMA 1GHKA 1STAA 1RTOA 3K59A 2EXZA 3TN2A 2EY2A 5C0XH 5EPJA 1T5EA 3KLSA 3Q6SA 2ICIA 4C1NI 4C56C 1ILPA 1H9RA 1LV9A 3TZUA 1IYUA 4A3MB 1ENAA 4I65A 3TDQA 4BA1I 3CKIB 2PPBC 5EJWA 2HUGA 2KECA 4U68A 5IT9L 3R2IA 1EWCA 4HAEA 2D62A 3Q0AA 3M7GA 3L3OC 2FJ2A 5KEEA 4KKTA 1AN8A 5BN5A 4Z9CB 1WTWA 1CTMA 4X3UA 1PFBA 2A68D 3H0GB 3N6RA 1D1KA 1A3VA 4L8JA 5CV9A 1NAPA 1EZ8A 4EVOA 2EYPA 2B8FA 4ZLTF 3GTKB 1STYA 1ZYRD 5KGUA 4KHZA 4DF7A 1LTRD 5M9OA 3VR3A 3HP3A 1BOSA 3OIPA 4RCNA 2TSSA 3ITPA 1U4RA 4OO1H 4K14A 3K6OA 4K5VA 3TZDA 5HGTA 1K83B 1ET9A 1RCVD 4EQNA 3NBHA 3EJIA 1JICA 4FYDA 3DWAA 1EY4A 2IT1A 3RZOB 2SNSA 1OXSC 2F0JA 1DOKA 5JOBA 4A3BB 1EU3A 4KKUA 5JPMC 3FVQA 4QMGA 4CKBA 3K58A 1A6XA 1VCIA 2IWHA 2F0NA 5C0XI 1SYCA 3I8ZA 4I7ZC 1SSOA 2WINB 4H0LC 1V1PB 3I4MB 1MSHA 2A73B 3L7ZC 1EYAA 2A69D 1HTLD 1DOMA 3S16B 3F2UA 5FOBB 1O7ZA 3H6MA 5E4XA 3SXHA 5IGGA 3T4AC 2NWGA 3BG3A 3OWEB 2MPMA 5CV7A 1BBXC 1C48A 1I6VC 1LABA 3CQZB 5J1ZA 1STNA 5C4XB 1TWFB 5K5PA 4B08A 1Y69U 1U4PA 5DAUA 4Q5VA 3PIP3 1SNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5W A;  2K5Q A;  3NPP A; 
#chains in the Genus database with same CATH topology
 1Y8N B;  2UXC L;  2ZTE A;  1PFM A;  3RD4 A;  1TR5 A;  3URY A;  3CF5 A;  4Y52 H;  5DEH A;  2RDH A;  4B3S Q;  4GKJ L;  1L0Y B;  1A0I A;  3I73 A;  1GM5 A;  3HZX A;  2I46 A;  4H02 A;  1U0L A;  3NPP A;  2QIL A;  1E2V A;  1TY2 A;  1PYB A;  2BH8 A;  3K0X A;  2KHS A;  5KYI A;  3CCM A;  3GTM H;  5JEA G;  4LFA L;  1XTC D;  2X6L A;  4LUO A;  1WTP A;  2E5L L;  2UUB Q;  1SYF A;  1A2U A;  3NWT A;  1OXX K;  3CMA A;  4DAV A;  1SR3 A;  1ONL A;  4ZKB B;  2B29 A;  1GD7 A;  2XRS D;  3KF8 B;  4A3J B;  3GTQ H;  1UE1 A;  1SBB B;  4OGQ C;  1Y1V G;  1FGB D;  4X66 Q;  3IFD A;  3J7A F;  1KQS A;  2YV5 A;  2XN9 C;  1FGU A;  2K1B A;  3CCE A;  4ODG A;  5M5X H;  2WFW A;  1N34 Q;  2MJ8 A;  1F9R A;  1SJE D;  3KLW A;  4IZ8 A;  4RKL A;  2LSS A;  2AKW B;  2WAC A;  1VF5 C;  4CJ2 C;  1PRT B;  2NVT H;  2RF4 A;  2GVA A;  2UUC L;  1HNW Q;  5C5M A;  2UUA Q;  5M3M B;  3BDL A;  5CR3 A;  1HQM C;  4IN3 A;  5M5W B;  3H3V H;  1DZ1 A;  2IX0 A;  1TQO A;  4A3E B;  1I4G A;  3CRL C;  4IUU A;  2QA4 A;  1WTH A;  1IBL Q;  4JC0 A;  5GQO A;  2VQE L;  2F0V A;  1KAB A;  1LUZ A;  1QB5 D;  5M3M H;  4DUY L;  5JVH 3;  4BA2 I;  2R7Z B;  1CKO A;  1JQY D;  1IBK Q;  2E2I B;  2ZM6 L;  1SNC A;  3OOC A;  4KD4 A;  3CC4 A;  3X3N A;  3FPP A;  3HOX H;  2B2T C;  2ZTD A;  4C3I B;  2F3W A;  2AUJ D;  1HXY D;  1D6E C;  3Q8D A;  4K0K L;  2XIW A;  4DKA C;  3Q23 A;  5C3E G;  5I6Y A;  1MKH A;  3DUZ A;  3VR4 A;  3L0O A;  4A3F B;  1KDC A;  5CYU A;  1FJG Q;  4P2C B;  3VR6 A;  4DV6 L;  1Q46 A;  2AQ3 B;  1EY7 A;  1G8Z D;  4LFC L;  4HMI A;  3J81 E;  4LJZ C;  2RCN A;  3TP7 A;  3PUW A;  1HFG A;  3T1Y L;  1EY0 A;  1VQM A;  2R92 B;  3MA2 B;  1AZQ A;  2RHQ B;  2R93 B;  1S5C D;  4BY1 G;  3BS1 A;  4HIK A;  4HJ7 A;  3TBI B;  1PVO A;  3DWQ A;  4HID A;  3VDY A;  4IO9 A;  3LX0 A;  1QZH A;  4GNX C;  3HOY G;  1ZKO A;  2PZT A;  3JAM c;  1TWC H;  4J8Q A;  1GUW A;  1TWH H;  3ND9 A;  5IT9 c;  2F0O A;  2RDF A;  1YNN D;  4DV0 L;  1C9O A;  4UPA A;  5A35 A;  3U9O A;  1EY5 A;  4FO2 A;  3GQB A;  2EPB A;  3DHQ A;  3BDO A;  4K8J A;  4H13 C;  2IX3 A;  4R4I A;  4EGV A;  1N36 L;  3JC6 6;  4RCO A;  2A8V A;  2FMC A;  1I4P A;  4FXD A;  1I94 Q;  2ZXP A;  5NUC A;  2PCF B;  4DV7 Q;  2K5D A;  3TP8 A;  1E3P A;  3BYY B;  5IYC G;  4YHH L;  5IWA Q;  3J80 i;  2L4N A;  3G7L A;  3F2B A;  4I7A A;  4HMJ A;  4ABN A;  1BF4 A;  3R8B A;  1Q12 A;  3EQL C;  3BVM A;  2QEJ C;  4C3J H;  4F8M A;  4JI8 Q;  1H9S B;  1VDZ A;  1F2L A;  1A8V A;  1B53 A;  3M85 A;  1XPO A;  3GTP B;  4B3M L;  3GO5 A;  2KBN A;  2R3Z A;  3PO2 H;  2PW7 A;  1AEX A;  3SE0 A;  1F2Y A;  1JCK B;  3NSW A;  5M5Y B;  2K5W A;  3H3V I;  2JE6 I;  1U4M A;  4KN4 C;  2I5H A;  1VQE A;  3VYT A;  2JA7 H;  4IUQ A;  1TII D;  4X3T A;  1KLU D;  2JSO A;  4RAU C;  4BWG B;  4LF8 Q;  5FO8 B;  1WCM B;  2Q2I A;  2MO1 A;  5AJ3 Q;  1EQQ A;  4FDB A;  4OWW B;  1J9O A;  1BQQ T;  5C0X J;  2EY6 A;  5BN4 A;  2K7V A;  2KJX A;  1UE5 A;  4QY7 A;  4ZRZ A;  3HOZ B;  3I72 A;  1ENF A;  1QIL A;  1YHB A;  1PFN A;  4JOI C;  4IAL A;  1SMY D;  3MXP A;  1NBW A;  2N55 A;  4IJL A;  3GTG B;  4X6A H;  4K5X A;  1G2S A;  4JI4 L;  3HKS A;  2AHO B;  5K36 H;  4J1M A;  1IL2 A;  1O7Y A;  2NVQ B;  4UHV A;  2R6G A;  1HA5 A;  1QNK A;  3OWF A;  5FLM H;  3GTG H;  3KF6 B;  3E0J A;  3PUV A;  3HEJ A;  1QJO A;  3VA7 A;  3TS0 A;  2DNE A;  1WVL A;  3GTO H;  2NUC A;  1VQD A;  4CHT B;  1BR9 A;  1KXL A;  3PMF A;  1B50 A;  2E2J B;  2C5C A;  2PNR C;  1EFI D;  2O2L D;  5C3X A;  4OON A;  4RGT A;  4V19 0;  3V2T A;  2WP8 J;  4O0A A;  4LK1 C;  2YTV A;  1Q1E A;  4KY7 A;  2AQ1 B;  2I5M X;  1NMG A;  4ZK9 B;  1PZI D;  3UDX A;  5IYB G;  2JJQ A;  1NMF A;  3SK6 A;  1NJI C;  5CBA E;  4IFD H;  5L37 A;  5C4J B;  1YNN C;  4B9X A;  2PW5 A;  5ELN A;  1E2Z A;  3FHW A;  4A93 H;  4NMZ A;  4MN3 A;  3PGZ A;  4A3K H;  3SVM A;  5BR8 L;  3I4L A;  3H91 A;  2O5I C;  4EQ5 A;  3CCL A;  2VQF L;  1Q90 A;  3J80 E;  1N32 L;  1RHP A;  2QDL A;  5ELF A;  4A3D H;  3W5O A;  1I5F A;  2EY5 A;  3KDF B;  3LGJ A;  4ZAI A;  5C44 G;  4JYA Q;  4DR2 Q;  2E75 C;  3F8T A;  1EFW A;  4C3H B;  2BA0 A;  5D14 A;  3HOV H;  4M8A A;  4OWT B;  4LF5 L;  2IX1 A;  5K36 G;  2ID0 A;  1C4Q A;  3S17 H;  3GTL H;  3NBI A;  1G29 1;  2GVB A;  3OSO A;  3D4W A;  3SK5 A;  2K50 A;  4B9W A;  3S1M H;  2MQH A;  4DR6 Q;  1X54 A;  4DV1 Q;  1B4O A;  4X64 Q;  1SYD A;  2HCC A;  1RL2 A;  1EIG A;  2BDO A;  4LF4 L;  1SE8 A;  4YWM A;  2RBM A;  5DLQ E;  5LHY 1;  1K8O A;  1H9K A;  1X56 A;  3D4R A;  4P71 A;  2Y0S G;  3I56 A;  1ET6 A;  4Y7N H;  1TWG B;  2Q2U A;  1OXT A;  5FKA C;  2PNH A;  3SK4 A;  4ALP A;  3ER0 A;  4NXM L;  2PO4 A;  4CKC A;  2NVY B;  2F1M A;  2RCF A;  3HOU B;  2Q8R E;  5IGD A;  3OTO L;  3K5N A;  1RKN A;  3F2D A;  3P75 A;  1VQI A;  4A93 G;  2DJF C;  5G3L F;  2OTL A;  2WV6 D;  2EJG C;  2NTS A;  1A62 A;  3TRZ A;  4DV5 L;  3UE1 A;  2NB0 A;  3GV6 A;  4DA2 A;  1VQ9 A;  2BH2 A;  1WJJ A;  1X65 A;  2E74 C;  2F0T A;  4HJ5 A;  4QIW E;  4JI0 Q;  2VUM B;  1KAA A;  3DM3 A;  1L1O A;  2RA4 A;  1TY0 A;  2KEN A;  1Q8I A;  5J22 A;  5FK9 C;  2L12 A;  5I4D A;  4J15 A;  5KYL A;  3I55 A;  2VUM H;  5LMN W;  1EOV A;  4JBK A;  5LMN L;  1NUC A;  2H4O A;  2PI2 A;  3CCJ A;  4A3I G;  3SHL A;  2B63 H;  5KNB A;  4GLX A;  3NP8 A;  1WTR A;  1UAP A;  4JI6 L;  4TRD A;  1IYV A;  3S2H B;  3S14 B;  1G6P A;  3SK8 A;  1F9Q A;  4KJO A;  2KCN A;  1CT1 D;  5IGE A;  2K6A A;  3E6Z X;  4NKL A;  3MXN A;  4DR4 Q;  3S1N B;  4CKE A;  1SEB D;  2RKS A;  4GNX B;  1HNZ Q;  1Y8P B;  4XQN A;  4RKB A;  1HJP A;  2BDN A;  1WTO A;  1CSQ A;  3KF8 A;  5LL6 X;  1LTB D;  5DM6 3;  2K05 A;  2DGY A;  4GN5 A;  1KL9 A;  2B2Y A;  4A4I A;  3PO3 B;  2F0S A;  1ROD A;  2LKV A;  3CRK C;  4RHR A;  3RR5 A;  3PQI A;  1VQC A;  3JAM L;  1L0W A;  2JEA I;  1X3G A;  2JA8 B;  2M2L A;  1SYE A;  5A2Q L;  2RSO A;  2KQ3 A;  2I5L X;  4LUZ A;  5EKI A;  3TRE A;  4A3M H;  1N9W A;  1ILQ A;  2UUB L;  4CBV A;  3ERS X;  4IOA A;  1LT5 D;  2PI2 E;  3PUY A;  1Z47 A;  4X65 Q;  4OIK A;  3D31 A;  2RHS B;  5CGK A;  1PHJ A;  2L5T A;  3S2D B;  1PH2 A;  3AU7 A;  3OW2 A;  1DCZ A;  1WFQ A;  1X3E A;  5EGT A;  3WOE A;  1RIP A;  1R4Q B;  1VF7 A;  1N34 L;  1VQB A;  1ASZ A;  4RGO S;  2ZTC A;  1XX8 A;  3EN2 A;  1TS3 A;  2M9V A;  2XGT A;  3S1Q B;  3E3X A;  1G51 A;  1VQL A;  4N9T A;  3W3A A;  2B39 A;  2G5D A;  3H0G H;  1SXT A;  4PNY A;  1HNW L;  3NTI A;  2A74 C;  5C0X G;  2UUA L;  4HN7 A;  1N8R C;  4A3G B;  3KBG A;  1O78 A;  1VMP A;  3Q24 A;  3GTK H;  1STE A;  4HR7 B;  1IBL L;  3TME A;  1P16 A;  4GZY C;  1J5E Q;  3E5S A;  3I4N B;  2Z4I A;  3PF5 A;  4UY8 C;  2XRQ D;  1EWH A;  1I6H B;  1I50 B;  3M4Q A;  1UUP A;  4A3G H;  2EJM A;  2LXK A;  3KBX A;  2ZJR A;  1IBK L;  1PA6 A;  1AH9 A;  4IUR A;  1STB A;  2EOT A;  4A3M G;  4BY7 B;  1LTA D;  1F2M A;  4YY3 Q;  1XNR Q;  4F88 A;  1PZK D;  1STG A;  1PH6 A;  2AQ2 B;  4QCL A;  2JA5 B;  2FMM A;  3W1B A;  5IOD A;  1FJG L;  4IUT A;  4KHP Q;  1Q86 C;  1K83 H;  4DUZ Q;  3DEP A;  1Q7Y C;  1SE3 A;  1JB3 A;  2MNA A;  5G3L D;  1XMQ L;  5EQ0 A;  1K8M A;  2PMZ B;  2TMP A;  4CJ1 B;  1ICW A;  1VQK A;  1X9N A;  3RZO H;  4FF1 A;  3AFQ A;  1Y1W G;  1K28 A;  3NWS A;  1EYC A;  3E9I A;  5COY A;  4A3B H;  2EXD A;  3KK7 A;  2L55 A;  2K28 A;  1YIT A;  2WAQ B;  1MBY A;  4A3C H;  1MI2 A;  2PZW A;  1GOZ A;  4L6T B;  4OO1 G;  1FVI A;  3I4M H;  1G2T A;  1RDP D;  3MXU A;  3KYH C;  4IQZ A;  4NXN Q;  4BBS B;  4E6I A;  1GVP A;  1OO9 B;  3S16 H;  1SNO A;  2ASB A;  1DJR D;  1LTS D;  2G9D A;  1SDF A;  4RHS A;  2X6G A;  2OF1 A;  5D65 A;  3U4V A;  1SFO B;  1I94 L;  2LY7 A;  3FKI B;  5I9O A;  4JV5 Q;  4DV7 L;  2F03 A;  1CZG A;  4BBS H;  4ID6 A;  1PV4 A;  4MTN A;  1W6K A;  2A6E C;  3IRB A;  1PH8 A;  3I4O A;  4BBR G;  5IWA L;  2DJG C;  2KUM A;  3Q22 A;  1PTO C;  4GOP C;  1WTQ A;  4QF4 A;  2LS0 1;  4DV4 Q;  4RWS C;  1H95 A;  4DAY A;  3AEV A;  1F77 A;  2F0K A;  1G6Z A;  4XIG S;  2ZT9 C;  1D5M C;  4JI8 L;  3CQZ H;  1CQF A;  3ERO A;  3HKZ B;  5EKL A;  5GAD C;  5CV8 A;  3OMG A;  5C4X H;  3A8K E;  1TWF H;  3LWU A;  4QUF A;  1B3Q A;  1YHQ A;  1I3Q B;  1HZA A;  2NYZ D;  4G4K A;  2EYM A;  3RUZ A;  4FNF A;  4XQQ A;  4DK1 A;  1MGS A;  4KK7 A;  3G48 A;  4LF8 L;  1SYB A;  3LWE A;  3K7A B;  3L2P A;  5AJ3 L;  1HZ9 A;  4OO1 I;  3I4M G;  2NZ1 D;  4QJF A;  1HPC A;  4G7Z C;  3PCO B;  5M3F B;  4P72 A;  4FF2 A;  4L63 B;  2Q8T A;  2WB1 B;  4HCE A;  2F4I A;  4LMQ D;  3G6J B;  5C3E B;  2HCI A;  2EDG A;  4A3J H;  2CHB D;  5J3B A;  2PQE A;  4UDU C;  2QKI C;  2F0I A;  3K81 C;  3NEM A;  4CDC C;  1GO3 E;  2G9H D;  4BXX G;  3BVG A;  1PFS A;  5CV4 A;  2LMC B;  2J7Z A;  2E8G A;  3U9S A;  3PF4 A;  3I2Z A;  2B2V A;  4IFD J;  3CXC A;  1B70 B;  1UE7 A;  2JA6 G;  2OQ0 A;  4BY1 B;  3VR2 A;  1LTI D;  4XTC S;  2B2W C;  2DN8 A;  3VYS A;  2ES2 A;  2SNM A;  1II3 A;  4CDE C;  1KTK A;  3HOY B;  4RFB A;  5GAE C;  1FNV A;  2F0G A;  4ZKC B;  1PYW D;  3P7J A;  2ATW A;  5M5W H;  4A3E H;  1YNJ C;  1SNQ A;  4JPB W;  3MFY A;  1UE6 A;  1R4P B;  2NZH A;  4GN3 B;  3T51 B;  1VQ4 A;  5C4Z A;  1O7L A;  1IL8 A;  2R7Z H;  1KDB A;  4FF3 A;  2RVL A;  2E2I H;  2MUY A;  1U9R A;  3T13 A;  4C3I H;  4U67 3;  1IHZ A;  2IJ0 A;  4JYA L;  1XXG A;  4OWX B;  4DR2 L;  2YTY A;  4YWL A;  3CPF A;  2IL8 A;  5C3W A;  4KLK A;  4A3J G;  4A3F H;  2CWA A;  5ELB A;  4A3L H;  1U5K A;  3T53 B;  1IKL A;  1KNA A;  4KTA A;  1EY6 A;  4DR6 L;  2Q2H A;  4CGY B;  4JI5 Q;  4DV3 Q;  4N8X 1;  1BNZ A;  1BBW A;  1LO5 D;  3OPO A;  4X64 L;  4CJ0 B;  2IY5 B;  5LL6 S;  4AQY Q;  2R92 H;  2PQA B;  2R93 H;  5JPN C;  3S9W A;  1EQR A;  3ERQ A;  3JAM i;  1YJN A;  4DR7 Q;  1BCP F;  1PMR A;  3MTS A;  1TKW B;  5KND A;  5M3M G;  4QL5 A;  3MWY W;  1XNQ Q;  4CDD C;  3UE0 A;  2K04 A;  3NUC A;  1H9M A;  5IIF A;  3IL8 A;  4A3E G;  1V8Q A;  2MHV A;  2NVX B;  4KD3 A;  3H09 A;  4JI2 L;  2V4D A;  3CHB D;  5BN3 A;  1JOQ A;  3QWN A;  2HQL A;  3HOX G;  4P74 A;  4HIO A;  2R7Z G;  4IUV A;  3T1H L;  2F0L A;  3M7N A;  1A3T A;  1JE4 A;  3GDE A;  1KD1 C;  2D0P A;  3BZC A;  2F0F A;  1QZG A;  2R7F A;  1GHJ A;  4EQO A;  1CHQ D;  1SAP A;  4C3I G;  2K01 A;  4MHE A;  4DNI A;  3C2P A;  1B2T A;  2VS1 A;  2XSC A;  3J7A 5;  3GP7 A;  2NBF A;  1JC7 A;  5FLX E;  4R8I A;  4A3F G;  2PZU A;  5ISR A;  2UXD Q;  3C46 A;  4JI0 L;  2VB3 X;  2X69 A;  2VW9 A;  4R1J A;  1M90 C;  4AYB B;  4L5R C;  4AH6 A;  4FF4 A;  3J80 c;  2OTJ A;  4GN4 B;  1HNX Q;  3C3L A;  1VQ5 A;  3MEF A;  3I3C A;  4P73 A;  2HHH Q;  2K4K A;  1MSG A;  1BO0 A;  2JP1 A;  4NDX A;  3GTP H;  2XWJ B;  3S1R B;  1JMC A;  4APV A;  5FO7 B;  4DU9 A;  1IXR A;  1CA5 A;  3M3Y B;  1ICF B;  3HRZ C;  2SOB A;  2ICE C;  2VL6 A;  4PZ8 A;  3D3R A;  5M5Y H;  1ENC A;  3N52 A;  4LAA A;  1FYC A;  1NTG A;  2ZXO A;  5DNF A;  4JI1 Q;  1EQT A;  1DD2 A;  1W3S A;  2OXP A;  1TWA B;  4DR4 L;  1WCM H;  3M3Y H;  3NTK A;  4MTK A;  4QUC A;  1PXU A;  2N8N A;  1B8A A;  2MO0 A;  1HNZ L;  2KA7 A;  3K0Y A;  3HOZ H;  1TS2 A;  2H5X A;  3M9B A;  4DN4 M;  5EAY A;  1S4Z A;  5C44 B;  1QNU A;  4FP5 D;  3NTH A;  3ULL A;  4DPG A;  1CKN B;  2BE5 C;  4C3J G;  2QDB A;  3RN5 A;  2SDF A;  2NVQ H;  1A2T A;  5JJZ A;  4OIJ A;  3HS0 C;  3JAM E;  4YCV A;  2JK8 A;  3PO2 G;  3SGI A;  3FPU B;  5IT9 E;  3QO2 A;  2KOL A;  5IP9 H;  1GUO A;  1PTO F;  2JA7 G;  3ONA B;  2E2J H;  2Y0S B;  1XYI A;  2N49 A;  1PTO B;  4X65 L;  4GOP B;  1ZXT A;  4L5Q A;  3V96 A;  1GJX A;  1HZB A;  2KHJ A;  1HR0 W;  2RSN A;  4IJH A;  1MJE A;  2B2U C;  4EQP A;  5EBD A;  1TXY A;  1B7Y B;  1C7Y A;  1AW7 A;  4PMC A;  5C4J H;  3QB3 A;  2E2D C;  3CCR A;  1DGS A;  1FD7 D;  1WI5 A;  4RGN A;  4C2M B;  4O2D A;  3MVV A;  2CKZ B;  4WJ3 M;  1VQJ A;  2CQO A;  3PSI A;  4NW2 A;  4CDF C;  1Q82 C;  1TU2 B;  1HTP A;  4O42 A;  1RTN A;  2YYZ A;  1SNP A;  1S40 A;  4K0K Q;  2FIN B;  5FLM G;  1PLF A;  2IPK D;  4JBM A;  2F0P A;  4POG A;  2OQK A;  1M8A A;  4C3H H;  5ELO A;  1J5E L;  2OEO A;  2HIV A;  3AQQ A;  4LFC Q;  1HQR D;  1S5D D;  3TSS A;  1TS4 A;  4DXF A;  5ELE A;  1B9N A;  2UU9 Q;  4XT3 B;  4GLV B;  4ZQ3 A;  1K3R A;  1XNR L;  4HED A;  1IW7 C;  1V1P A;  4MZ9 A;  4HJ8 A;  1L1O C;  4A3I B;  4IFD G;  5IYD H;  4F87 A;  1STH A;  3CCQ A;  1EOT A;  4KHP L;  5D3D A;  1EYG A;  1TWG H;  5IGC A;  3DMU A;  1JOO A;  3D8G A;  4A3K G;  1EEI D;  2O5J C;  2NVY H;  4BS9 A;  2BCO A;  2CW0 C;  3HOU H;  1BXT A;  5JJL A;  5I9P A;  4WOR A;  4A3D G;  1QG7 A;  1KC8 C;  3A0J A;  3HOV G;  2E76 C;  4JI7 Q;  3VA5 A;  1KAW A;  1LLR D;  4DNT B;  3CPW A;  4ZYS A;  3IAY A;  3DXJ C;  5E1F A;  3ULJ A;  3RLF A;  1QVF A;  5IY0 A;  1BDO A;  3EVQ A;  3S15 B;  1AE2 A;  4DK3 C;  4R4C A;  1SN8 A;  3A55 A;  4XT1 B;  2PMZ E;  1K8G A;  3PUX A;  4NXN L;  4LUV A;  1MIU A;  3DM1 A;  4DFA A;  1V1O A;  2B2Y C;  2HDM A;  1CHP D;  2HDL A;  1NE3 A;  4IFD I;  5T1G A;  4JV5 L;  4XYO A;  2F3V A;  5JVG 3;  4JI3 Q;  3I7F A;  1E0B A;  2QCP X;  1YJ9 A;  2EVB A;  3H3V C;  2WAQ E;  4IUP A;  4KY6 A;  3S2H H;  1R9T B;  3S14 H;  4DV4 L;  2I07 B;  3BZK A;  3ICE A;  3A56 A;  3KOJ A;  3QOL A;  4DK6 C;  1Q1B A;  3A7L A;  3HOU G;  5IGB A;  3RN2 A;  3S1N H;  4A76 A;  4IOC A;  5LMU L;  2BOS A;  5E4W C;  2E2H B;  3R93 A;  2D5D A;  4PG3 A;  1Y8O B;  4YIJ A;  1WYD A;  2M00 A;  5DM7 3;  4DR5 Q;  2N3S A;  4LF7 Q;  3W1G A;  1W6J A;  2A19 A;  4B3S L;  1Z7T A;  3J7Y W;  4RGM A;  1XMO Q;  3HGB A;  4OX9 Q;  2YU9 B;  1YEZ A;  3BU2 A;  1IBM Q;  3PO3 H;  1S5E D;  4RG1 A;  1YI2 A;  2EYF A;  5E3F A;  2F0Q A;  1EIF A;  2VUM G;  4XQJ A;  3BZD B;  2QF7 A;  4OHJ A;  1C0A A;  3HKZ E;  1X3P A;  3TEH B;  2JA8 H;  4FXG C;  2A6E D;  5J39 A;  2B63 G;  1B1Z A;  1LT3 D;  1PTO D;  4X66 L;  1GUT A;  1HUM A;  2EYO A;  1HR0 Q;  2QW7 A;  1BCP C;  1PYS B;  1I4Q A;  1SJH D;  3RZD B;  3S2D H;  4X62 Q;  2MP1 A;  1KLG D;  5EPK A;  2A6H C;  1CI3 M;  4ULL A;  2LFN A;  1CZW A;  4KKS A;  4QB4 A;  4KY5 A;  2Z8L A;  3UDI A;  4TKO B;  5GRO A;  1CFM A;  3A5Z B;  3S1Q H;  2C35 B;  1PDQ A;  1I4X A;  2WB1 E;  1Y1W B;  1U4L A;  1HUN A;  5JJI A;  2F0E A;  2GA4 B;  4WJ4 A;  3J80 L;  1IZ6 A;  1GKH A;  3W2D A;  3K7U C;  3QG1 A;  4DAM A;  2Z4H A;  1LTL A;  1HCZ A;  3I4N H;  3OHX C;  2JYO A;  1JWS D;  1I6H H;  1I50 H;  3HG9 A;  3H15 A;  4FVM A;  3PIO A;  3BJU A;  3P20 A;  3STB C;  5HUR A;  5F2D A;  3M4O B;  1KHI A;  1KIX A;  3CAM A;  4BY7 H;  2Q2T A;  1PH9 A;  3HOW B;  5HY6 A;  1CK1 A;  1CKM A;  4TSS A;  5CC4 A;  1CUK A;  1NY4 A;  1IKM A;  3GV3 A;  3BDC A;  1EYD A;  4PV1 C;  2JA5 H;  1X6O A;  2L15 A;  4OL7 A;  1FNU A;  4BBR B;  1SRO A;  3O13 A;  3UDF A;  3HOW H;  1DOL A;  3EFX D;  2QEX A;  4J6H A;  4FXK C;  4JI5 L;  4DV3 L;  3H0G G;  2XTI A;  2K5N A;  4HIM A;  4LFB Q;  1EIH A;  4QIW B;  2K75 A;  4AQY L;  2Z6K A;  1NR4 A;  1HFN A;  1YNJ D;  5KNC A;  1WTX A;  1CA6 A;  4DR7 L;  3TP5 A;  1VQ7 A;  3A8J E;  4NPS A;  3UDG A;  4YWK A;  4L5S A;  1BKB A;  3D0F A;  1QCB D;  1P8L A;  1XNQ L;  3AYH B;  3K5L A;  1V1Q A;  2JXM B;  3I90 A;  4A3G G;  2AUK A;  2R61 A;  1H9S A;  3D6C A;  1PZJ D;  1JWM D;  2J0T D;  2F0H A;  3VYR A;  4G57 A;  5GAG C;  1RF2 D;  2UXB Q;  1JWU D;  5AFW A;  3ZYY X;  3LNN A;  4R8N A;  4ZUJ A;  1VQN A;  4XDX A;  3J7Z C;  4JK1 C;  1Z9F A;  3PV0 A;  5JEA H;  3K57 A;  2K5H A;  1Y1V B;  3KJO A;  1M4V A;  1JE5 A;  2H1E A;  3T56 B;  1SFO H;  3GTJ B;  1FNW A;  3FKI H;  2OCE A;  2VZA A;  2UXD L;  1H9J A;  2K32 A;  4TQU S;  2FFK B;  4OXP A;  1E24 A;  4DXG A;  1HZC A;  3E0E A;  4IUN A;  1HNX L;  1D1I A;  2Q8I B;  5D3I B;  3NXW A;  2HHH L;  1L1O B;  1TVX A;  2WKC A;  2JA6 B;  1X32 A;  2CWP A;  1O80 A;  2XVS A;  3NK9 A;  3J81 c;  1XPU A;  1D5Z C;  1X3Q A;  4A3B G;  4ME3 A;  2CCZ A;  1A15 A;  2Z9H A;  3NHH A;  2A68 C;  2NTT A;  2CH4 A;  1EEF D;  4K6D A;  3KF6 A;  1TT2 A;  1I3Q H;  3G71 A;  4A3C G;  1CKN A;  1C8C A;  2B2V C;  1DYQ A;  4JI1 L;  1TS5 A;  3PIO 3;  2OT2 A;  4AYB E;  5COR A;  5IP7 H;  3GTM B;  3K7A H;  1W2B A;  2WAQ G;  2EYJ A;  1ZYR C;  2XNA C;  4ILW A;  2N88 A;  4PQX A;  5ELD A;  3MXN B;  3M4Y A;  3OMC A;  3OW7 A;  3SEB A;  1MD2 D;  2MFI A;  4DR3 Q;  1RD9 D;  4BBS G;  5CV6 A;  5M3F H;  3GTQ B;  1JR0 D;  4GOP A;  4WFN 3;  4LNQ A;  1CM9 A;  2KHI A;  1VQP A;  4DR1 Q;  2JQO A;  5KIX A;  4NB3 A;  2K52 A;  3CP0 A;  3FKI G;  2NZO A;  2F0D A;  3SDZ A;  4X3K A;  5C3E H;  5M5X B;  4LF9 Q;  4JBW A;  3AB9 A;  2ZXR A;  1OTC A;  4GKK Q;  4HCS A;  4R9W A;  4ZCK A;  3F2C A;  4LW1 A;  2OWO A;  1N33 Q;  5C4H A;  3K5O A;  5C4X G;  2NVT B;  3KDF A;  4LF6 Q;  2Z0S A;  1WOC A;  5CBE E;  1PRT F;  4XYQ A;  5H1S E;  2F4V Q;  3HKZ G;  3CCS A;  4BY1 H;  2N78 A;  3WOF A;  5FLX c;  4O1N A;  1JT8 A;  1QOH A;  1VQF A;  1HA6 A;  1ESR A;  3HOY H;  1CQV A;  2D9U A;  5C5L A;  2NN6 H;  1E2W A;  2ENB A;  1EL0 A;  1B9M A;  2WKD A;  3C1E A;  2EE1 A;  3AFP A;  3AMU A;  4ZUI A;  5IP7 G;  1KDA A;  3HOX B;  3KFU A;  3K8A A;  4UP7 A;  1J8I A;  1E1O A;  1SNM A;  1VS0 A;  2BE5 D;  3L9A X;  1ML0 D;  3CD6 A;  2Y0S E;  2P5Z X;  2L1B A;  5EBC A;  4KV6 A;  5M3F G;  4OEM B;  2A69 C;  3S24 A;  3CCV A;  2WB1 G;  2MGS A;  1SE4 A;  1VQ6 A;  1LTG D;  3FDT A;  3WDN A;  4S3S A;  4DV1 L;  1L2F A;  4DGZ A;  3DEO A;  3RLO A;  5IYC H;  2B2W A;  2YTX A;  4PMW A;  3CC2 A;  2PYK A;  1D8L A;  1X55 A;  5I2Y A;  4V0B A;  2EJF C;  3IKJ A;  2K33 A;  3FRP B;  2UU9 L;  3KUP A;  4QGU A;  5FO9 B;  3NQI A;  1XTD A;  3GD7 A;  3X3M A;  1TWC B;  5E7N A;  1XMQ Q;  3PUZ A;  2JN4 A;  1PH1 A;  5I2X A;  1BCP B;  1TWH B;  3V05 A;  3OYY A;  1KRS A;  1OXU A;  2HIX A;  1LT6 D;  2AWN A;  5IE8 A;  1S72 A;  4B3R Q;  1F9S A;  3OIQ A;  2B2T A;  4R4T A;  3R3O A;  1JOK A;  2NN6 G;  3M4P A;  5ELC A;  5JJK A;  1EQV A;  1NCV A;  4C1N K;  3ND8 A;  2NVX H;  3A8I E;  3NBH B;  3F1Z A;  3MXG A;  3DLL A;  1AFP A;  4K2K A;  1JJ2 A;  1GXD C;  1OXV A;  2VNU D;  3I91 A;  1VQO A;  1HRJ A;  2KED A;  4NP5 A;  2B8G A;  5CV5 A;  1UWV A;  4JI7 L;  1SYG A;  4RA8 A;  4A3L G;  5JAV A;  1NSN S;  4G7H C;  2HT1 A;  2F0U A;  3KLS X;  2Z1C A;  3MZ5 A;  3P1H A;  4UAI A;  1QUQ B;  1K9M C;  4GNX A;  2B3G A;  2EY1 A;  3FP9 A;  4C3J B;  1A3U A;  1IW7 D;  5C6A A;  2R92 G;  4WJW A;  5I6W A;  4B3T Q;  2R93 G;  1YVC A;  3PO2 B;  1SRU A;  5IGF A;  3VYU A;  2HD3 A;  1CSP A;  1B3A A;  4LWC A;  3TQY A;  1DON A;  3MC0 B;  1SE2 A;  3J81 j;  2JA7 B;  4DV2 Q;  3BVZ A;  4DNR B;  3E9H A;  2CW0 D;  2UXC Q;  3S1R H;  1V9P A;  2O4X A;  3H94 A;  3MHB A;  2NN6 I;  1GUN A;  4JI3 L;  1JJC B;  4DAP A;  4GKJ Q;  1NR2 A;  2CQA A;  3FEW X;  3SR1 A;  3FMC A;  3J7A V;  1QWY A;  3B6Y A;  3QIA A;  4HJ9 A;  3RNU A;  2D0O A;  4JBJ A;  5IYB H;  1S5F D;  4M1U B;  1LYL A;  1SLJ A;  1TWA H;  4YCW A;  3VR5 A;  1PH3 A;  3ULP A;  4LFA Q;  3TP6 A;  1YBY A;  2BA1 A;  2E5L Q;  1F2Z A;  1Q3L A;  4DAY B;  1JB7 A;  4DR5 L;  1AZP A;  2RDG A;  4JVZ A;  1B44 D;  1QVG A;  4LF7 L;  5GAH C;  1UNS A;  4QQB X;  1ZEQ X;  4K8I A;  2JEB I;  1YNX A;  4Q0F A;  1XMO L;  1K73 C;  1KRT A;  1D5X C;  4XXE A;  4POF A;  4OX9 L;  5C44 H;  1E1T A;  5EKK A;  5T1I A;  3D4D A;  1IBM L;  5A2Q E;  4F7X A;  1FR3 A;  1VMC A;  2L9H A;  2KCM A;  3GTO B;  3NE5 B;  2FXQ A;  3KLR A;  4AYB G;  1Q81 C;  4R4O A;  3IFT A;  1MJC A;  2EYH A;  2KCC A;  4N9P A;  2CVR A;  1PH5 A;  1PRT D;  4KMU C;  2UUC Q;  1Z6H A;  4EX5 A;  2ZJP A;  1D7Q A;  1S5B D;  3NEL A;  2VXW A;  4IPG A;  2K5Q A;  2WII B;  4RH6 A;  4G7O C;  4HTH A;  1HR0 L;  1ASY A;  1GUG A;  4JOI A;  1WCM G;  1PTO H;  1EZ6 A;  4K6L A;  3HFZ B;  2VQE Q;  4K5W A;  1EWI A;  4X62 L;  4A93 B;  4DUY Q;  1NNX A;  4MNO A;  2CH4 W;  4A3K B;  2D2C C;  1V43 A;  3NQT A;  3HOZ G;  2F0M A;  2ZM6 Q;  1LAC A;  2C9O A;  1HH2 P;  4AIM A;  4A3D B;  4PMB A;  1E7Z A;  4C2M H;  5CMD A;  2Z6B A;  3QR8 A;  1EU4 A;  1LTT D;  3HOV B;  4PZ6 A;  3RMH A;  2VB2 X;  1G91 A;  3S17 B;  3GTL B;  2A5H A;  3EBE A;  1T9H A;  4DV6 Q;  1T5X D;  3S1M B;  1EY8 A;  4X3S A;  1VQ8 A;  1VQH A;  2AWO A;  3J81 L;  1AP0 A;  2DNC A;  1GUS A;  1BUV T;  3UI2 A;  2EZV A;  2RQX A;  5IP9 G;  3T1Y Q;  3R2T A;  4YY3 L;  1BCP D;  3C1F A;  1KNE A;  3QOJ A;  1EY9 A;  4Y7N B;  4A75 A;  1LT4 D;  2B2U A;  2A6H D;  2I0Q A;  1I4R A;  4KJN A;  2LXJ A;  3U4Z A;  1IYJ B;  1D2B A;  4R4Q A;  5EPL A;  2J4X A;  4KN7 C;  4DUZ L;  3CU7 A;  4DV0 Q;  1K0R A;  4A3I H;  1E22 A;  4JW0 A;  3K5M A;  1M1K C;  1PH7 A;  4MIU A;  3NEN A;  2XWB B;  1UEB A;  2K5V A;  1S3O A;  4JI2 Q;  1I4H A;  4LFB L;  1X3F A;  4H7B A;  4DK0 A;  1K8A C;  1JOR A;  1L0X B;  4WRD A;  2L0C A;  4K2L A;  1N36 Q;  4ME5 A;  3KJP A;  3A54 A;  3T1H Q;  2IW3 A;  4C3H G;  3T16 A;  4KHV A;  2L11 A;  1WD1 A;  1HHV A;  4YHH Q;  5JEA J;  3D6W A;  3QJY A;  3STB D;  1A63 A;  3EA6 A;  4JCV E;  1SMY C;  3I70 A;  5TSS A;  1F9P A;  1XWE A;  2FHT A;  3BYT B;  1RJT A;  2DY7 A;  4H44 C;  5FLX L;  2UXB L;  3S15 H;  2HQE A;  2F3I A;  4GS3 A;  5KRU A;  3A7A B;  2VY3 A;  1O7I A;  2KEE A;  4P75 A;  4B3M Q;  4RMF A;  5IYD G;  2B63 B;  2EYL A;  2F0W A;  4KI0 A;  1PRT C;  3DWP A;  4YCU A;  2A1A A;  2SEB D;  2DY8 A;  4HSV A;  3MEH A;  2K14 A;  1WTV A;  2KVM A;  3MFG A;  5IOC A;  4HSP A;  1DM0 B;  5HGQ A;  1XJV A;  1ESF A;  3MAQ A;  1UEA B;  3CW2 C;  2CFM A;  4UP9 A;  1R9T H;  1WD0 A;  2K03 A;  3G4S A;  1QE6 A;  3TS2 A;  1DXM A;  1GHK A;  1XPR A;  2E2H H;  1STA A;  1RTO A;  3K59 A;  2EXZ A;  3TN2 A;  2F52 A;  2EY2 A;  4JI4 Q;  5FJ8 H;  5C0X H;  5EPJ A;  1YZ6 A;  1T5E A;  3KLS A;  3Q6S A;  2ZJQ A;  2ICI A;  4C1N I;  2YU9 H;  1K3B C;  4C56 C;  1ILP A;  1H9R A;  1LV9 A;  3TZU A;  1IYU A;  3G6E A;  1ENA A;  4A3M B;  4I65 A;  3TDQ A;  4BA1 I;  3CKI B;  2PPB C;  5EJW A;  2HUG A;  3K80 C;  2KEC A;  4U68 A;  5IT9 L;  3R2I A;  4PZ7 A;  4TVA B;  4DR3 L;  4OEL B;  1BBU A;  3A74 A;  1YJW A;  2V1C C;  1EWC A;  2GN5 A;  2D62 A;  4HAE A;  4DR1 L;  3Q0A A;  3M7G A;  3L3O C;  2FJ2 A;  5KEE A;  4KKT A;  1AN8 A;  4LF9 L;  1EIY B;  5BN5 A;  4Z9C B;  1WTW A;  4GKK L;  1CTM A;  4X3U A;  1PFB A;  3RZD H;  2A68 D;  4GLA C;  1N33 L;  5BR8 Q;  3H0G B;  3N6R A;  4LF6 L;  1D1K A;  2QGQ A;  2KCT A;  1FL0 A;  3CC7 A;  1A3V A;  1YHA A;  4L8J A;  2VQF Q;  1N32 Q;  5CV9 A;  1NAP A;  1EZ8 A;  2F4V L;  4EVO A;  2EYP A;  2B8F A;  4ZLT F;  3GTK B;  1STY A;  3U58 A;  1Y1W H;  1ZYR D;  3PO3 G;  5KGU A;  5FJ8 G;  4KHZ A;  4DF7 A;  4LF5 Q;  4L5T A;  1LTR D;  2ALY B;  3EIV A;  5M9O A;  2EIF A;  3VR3 A;  3PIP A;  2Z6K C;  2PQA A;  1BOS A;  3HP3 A;  3OIP A;  1AE3 A;  2JA8 G;  4RCN A;  1QVC A;  1J6Q A;  2TSS A;  4LF4 Q;  3ITP A;  1U4R A;  1VQG A;  3WWV A;  4OO1 H;  4K14 A;  3K6O A;  4K5V A;  2R7D A;  3TZD A;  5HGT A;  3M4O H;  1K83 B;  1LM0 A;  2AMC B;  1ET9 A;  4NXM Q;  1RCV D;  4EQN A;  3NBH A;  3EJI A;  3OTO Q;  1JIC A;  4FYD A;  4BBR H;  3DWA A;  1VQA A;  1EY4 A;  2IT1 A;  3RZO B;  3A5U A;  1JJG A;  1EUJ A;  2SNS A;  4DV5 Q;  1SMX A;  1OXS C;  2F0J A;  1DOK A;  5JOB A;  4A3B B;  1EU3 A;  4KKU A;  5JPM C;  2DUD A;  1BVS A;  3FVQ A;  4QMG A;  4CKB A;  3K58 A;  1A6X A;  1VCI A;  2IWH A;  2F0N A;  5C0X I;  1SYC A;  4B3R L;  3I8Z A;  4I7Z C;  1QUQ A;  1SSO A;  2WIN B;  3RLN A;  4H0L C;  3I4N G;  2IHE A;  1K0S A;  1V1P B;  4N8F A;  3I4M B;  4JG2 A;  1MSH A;  2A73 B;  3L7Z C;  1EYA A;  2A69 D;  4HJA A;  1YIJ A;  1HTL D;  1PH4 A;  1DOM A;  3CCU A;  3S16 B;  1Q8K A;  3F2U A;  5FOB B;  1O7Z A;  3ZJY C;  3H6M A;  5E4X A;  4BY7 G;  3SXH A;  5IGG A;  3T4A C;  2NWG A;  5LMN Q;  2IHF A;  3BG3 A;  3OWE B;  2JA5 G;  2EQS A;  2MPM A;  5CV7 A;  1BBX C;  1C48 A;  1Y1V H;  4JI6 Q;  3U50 C;  3HOW G;  1I6V C;  3GTJ H;  1Y14 B;  1LAB A;  3CQZ B;  5J1Z A;  4IPC A;  4B3T L;  4BXX H;  4IPD A;  1STN A;  2JA9 A;  5C4X B;  3CME A;  3J81 i;  1TWF B;  4IPH A;  5K5P A;  4B08 A;  1Y69 U;  2JA6 H;  5LMU Q;  1U4P A;  4UP8 A;  5DAU A;  4Q5V A;  4DV2 L;  3PIP 3;  1SND A;  1MHW C; 
#chains in the Genus database with same CATH homology
 1Y8N B;  1PFM A;  3RD4 A;  1TR5 A;  3URY A;  5DEH A;  2RDH A;  1L0Y B;  3I73 A;  3HZX A;  2I46 A;  3NPP A;  2QIL A;  1E2V A;  1TY2 A;  2KHS A;  5KYI A;  5JEA G;  1XTC D;  2X6L A;  1WTP A;  1SYF A;  1A2U A;  3NWT A;  1OXX K;  4DAV A;  1ONL A;  4ZKB B;  2XRS D;  4A3J B;  1SBB B;  4OGQ C;  1FGB D;  3IFD A;  3J7A F;  2XN9 C;  2K1B A;  4ODG A;  2MJ8 A;  1F9R A;  1SJE D;  4IZ8 A;  4RKL A;  2WAC A;  1VF5 C;  4CJ2 C;  1PRT B;  5C5M A;  5M3M B;  3BDL A;  5CR3 A;  1HQM C;  4IN3 A;  5M5W B;  1DZ1 A;  2IX0 A;  1TQO A;  4A3E B;  1I4G A;  3CRL C;  4IUU A;  2F0V A;  1KAB A;  1QB5 D;  5JVH 3;  4BA2 I;  2R7Z B;  1JQY D;  2E2I B;  1SNC A;  3OOC A;  4KD4 A;  3X3N A;  3FPP A;  2B2T C;  4C3I B;  2F3W A;  2AUJ D;  1HXY D;  1D6E C;  2XIW A;  3Q23 A;  5I6Y A;  3DUZ A;  3VR4 A;  4A3F B;  1KDC A;  5CYU A;  4P2C B;  3VR6 A;  2AQ3 B;  1EY7 A;  1G8Z D;  4HMI A;  3J81 E;  4LJZ C;  3TP7 A;  3PUW A;  1HFG A;  1EY0 A;  2R92 B;  3MA2 B;  1AZQ A;  2R93 B;  1S5C D;  3BS1 A;  3TBI B;  3DWQ A;  3LX0 A;  1ZKO A;  2PZT A;  4J8Q A;  1GUW A;  3ND9 A;  2F0O A;  2RDF A;  1YNN D;  5A35 A;  3U9O A;  1EY5 A;  4FO2 A;  3GQB A;  2EPB A;  3DHQ A;  3BDO A;  4K8J A;  4H13 C;  2IX3 A;  4EGV A;  4RCO A;  2FMC A;  1I4P A;  4FXD A;  2ZXP A;  5NUC A;  2PCF B;  2K5D A;  3TP8 A;  3BYY B;  2L4N A;  3G7L A;  4HMJ A;  4ABN A;  1BF4 A;  3R8B A;  1Q12 A;  3EQL C;  3BVM A;  2QEJ C;  4F8M A;  1H9S B;  1VDZ A;  1F2L A;  1B53 A;  3M85 A;  3GTP B;  3GO5 A;  2R3Z A;  2PW7 A;  1AEX A;  3SE0 A;  1F2Y A;  1JCK B;  3NSW A;  5M5Y B;  2K5W A;  2JE6 I;  1U4M A;  4KN4 C;  3VYT A;  4IUQ A;  1TII D;  4X3T A;  1KLU D;  2JSO A;  4RAU C;  4BWG B;  5FO8 B;  1WCM B;  1J9O A;  1BQQ T;  5C0X J;  2EY6 A;  5BN4 A;  2K7V A;  2KJX A;  4ZRZ A;  3HOZ B;  3I72 A;  1ENF A;  1QIL A;  1PFN A;  4IAL A;  1SMY D;  3MXP A;  2N55 A;  3GTG B;  4K5X A;  1G2S A;  5K36 H;  4J1M A;  2NVQ B;  1O7Y A;  2R6G A;  1HA5 A;  1QNK A;  3OWF A;  3E0J A;  3PUV A;  3HEJ A;  1QJO A;  3VA7 A;  2DNE A;  1WVL A;  2NUC A;  4CHT B;  1BR9 A;  3PMF A;  1B50 A;  2E2J B;  2C5C A;  2PNR C;  1EFI D;  2O2L D;  5C3X A;  4RGT A;  4V19 0;  3V2T A;  2WP8 J;  4LK1 C;  1Q1E A;  4KY7 A;  2AQ1 B;  4ZK9 B;  1PZI D;  3SK6 A;  5CBA E;  4IFD H;  5C4J B;  1YNN C;  4B9X A;  2PW5 A;  1E2Z A;  4NMZ A;  4MN3 A;  3SVM A;  3I4L A;  3H91 A;  2O5I C;  1Q90 A;  3J80 E;  1RHP A;  5ELF A;  2EY5 A;  4ZAI A;  2E75 C;  4C3H B;  2BA0 A;  5D14 A;  4M8A A;  2IX1 A;  5K36 G;  2ID0 A;  1C4Q A;  3NBI A;  1G29 1;  3OSO A;  3D4W A;  3SK5 A;  4B9W A;  1B4O A;  1SYD A;  2HCC A;  1EIG A;  2BDO A;  2RBM A;  5LHY 1;  1K8O A;  1H9K A;  3D4R A;  1ET6 A;  1TWG B;  5FKA C;  1OXT A;  3SK4 A;  2PO4 A;  4CKC A;  2NVY B;  2F1M A;  3HOU B;  2Q8R E;  5IGD A;  3K5N A;  1RKN A;  3P75 A;  5G3L F;  2WV6 D;  2EJG C;  2NTS A;  2NB0 A;  3GV6 A;  4DA2 A;  2E74 C;  2F0T A;  2VUM B;  1KAA A;  2RA4 A;  1TY0 A;  1Q8I A;  5J22 A;  5FK9 C;  2L12 A;  5I4D A;  5KYL A;  1NUC A;  2H4O A;  3SHL A;  5KNB A;  3NP8 A;  1WTR A;  1UAP A;  4TRD A;  1IYV A;  3S2H B;  3S14 B;  3SK8 A;  1F9Q A;  4KJO A;  5IGE A;  1CT1 D;  2KCN A;  2K6A A;  3E6Z X;  4NKL A;  3MXN A;  3S1N B;  4CKE A;  1SEB D;  2RKS A;  1Y8P B;  4XQN A;  4RKB A;  2BDN A;  1WTO A;  3KF8 A;  5LL6 X;  1LTB D;  5DM6 3;  2K05 A;  2B2Y A;  3PO3 B;  2F0S A;  1ROD A;  2LKV A;  3CRK C;  4RHR A;  3JAM L;  2JEA I;  2JA8 B;  2M2L A;  1SYE A;  5A2Q L;  2RSO A;  2KQ3 A;  5EKI A;  1ILQ A;  4CBV A;  1LT5 D;  3PUY A;  1Z47 A;  4OIK A;  3D31 A;  5CGK A;  2L5T A;  3S2D B;  3AU7 A;  1DCZ A;  5EGT A;  3WOE A;  1R4Q B;  1VF7 A;  4RGO S;  1XX8 A;  1TS3 A;  2M9V A;  3S1Q B;  4N9T A;  3W3A A;  2B39 A;  1SXT A;  4PNY A;  3NTI A;  2A74 C;  5C0X G;  4HN7 A;  4A3G B;  3KBG A;  1O78 A;  1VMP A;  3Q24 A;  1STE A;  4HR7 B;  3TME A;  4GZY C;  3E5S A;  3I4N B;  2Z4I A;  2XRQ D;  1EWH A;  1I6H B;  1I50 B;  1UUP A;  2EJM A;  3KBX A;  4IUR A;  1STB A;  2EOT A;  4BY7 B;  1LTA D;  1F2M A;  4F88 A;  1PZK D;  1STG A;  2AQ2 B;  4QCL A;  2JA5 B;  2FMM A;  5IOD A;  4IUT A;  3DEP A;  1SE3 A;  1JB3 A;  5G3L D;  5EQ0 A;  1K8M A;  2PMZ B;  2TMP A;  4CJ1 B;  1ICW A;  4FF1 A;  3NWS A;  1EYC A;  5COY A;  3KK7 A;  2L55 A;  2K28 A;  2WAQ B;  1MBY A;  1MI2 A;  2PZW A;  1GOZ A;  4L6T B;  4OO1 G;  1G2T A;  1RDP D;  3MXU A;  4IQZ A;  4BBS B;  4E6I A;  1OO9 B;  1SNO A;  1DJR D;  1LTS D;  2G9D A;  1SDF A;  4RHS A;  2X6G A;  2OF1 A;  5D65 A;  1SFO B;  2LY7 A;  3FKI B;  5I9O A;  2F03 A;  1CZG A;  4ID6 A;  1W6K A;  2A6E C;  2KUM A;  3Q22 A;  1PTO C;  1WTQ A;  4QF4 A;  2LS0 1;  4RWS C;  4DAY A;  1F77 A;  2F0K A;  1G6Z A;  4XIG S;  2ZT9 C;  1D5M C;  1CQF A;  3ERO A;  3HKZ B;  5EKL A;  5CV8 A;  3OMG A;  3A8K E;  3LWU A;  4QUF A;  1I3Q B;  2NYZ D;  4G4K A;  2EYM A;  3RUZ A;  4FNF A;  4XQQ A;  4DK1 A;  1MGS A;  4KK7 A;  1SYB A;  3LWE A;  3K7A B;  4OO1 I;  2NZ1 D;  1HPC A;  4G7Z C;  5M3F B;  4FF2 A;  4L63 B;  2Q8T A;  2WB1 B;  4HCE A;  2F4I A;  4LMQ D;  3G6J B;  5C3E B;  2HCI A;  2EDG A;  2CHB D;  2PQE A;  4UDU C;  2QKI C;  2F0I A;  2G9H D;  3BVG A;  5CV4 A;  2LMC B;  2J7Z A;  3U9S A;  2B2V A;  4IFD J;  4BY1 B;  3VR2 A;  1LTI D;  4XTC S;  2B2W C;  2DN8 A;  3VYS A;  2SNM A;  1II3 A;  3HOY B;  1KTK A;  4RFB A;  1FNV A;  2F0G A;  4ZKC B;  1PYW D;  3P7J A;  1YNJ C;  1SNQ A;  3MFY A;  1R4P B;  3T51 B;  5C4Z A;  1O7L A;  1IL8 A;  1KDB A;  4FF3 A;  2RVL A;  2MUY A;  1U9R A;  3T13 A;  4U67 3;  1IHZ A;  2IJ0 A;  1XXG A;  2IL8 A;  5C3W A;  5ELB A;  3T53 B;  1IKL A;  1KNA A;  4KTA A;  1EY6 A;  4CGY B;  1BNZ A;  1LO5 D;  3OPO A;  4CJ0 B;  5LL6 S;  5JPN C;  3S9W A;  3ERQ A;  1BCP F;  1PMR A;  3MTS A;  1TKW B;  5KND A;  3MWY W;  2K04 A;  3NUC A;  1H9M A;  5IIF A;  3IL8 A;  2NVX B;  1V8Q A;  2MHV A;  4KD3 A;  3H09 A;  2V4D A;  3CHB D;  5BN3 A;  1JOQ A;  3QWN A;  4IUV A;  2F0L A;  3M7N A;  1A3T A;  1JE4 A;  2F0F A;  1GHJ A;  4EQO A;  1CHQ D;  1SAP A;  4C3I G;  2K01 A;  4MHE A;  3C2P A;  1B2T A;  2XSC A;  3GP7 A;  2NBF A;  1JC7 A;  5FLX E;  4R8I A;  2PZU A;  5ISR A;  3C46 A;  2VB3 X;  2X69 A;  4AYB B;  4FF4 A;  3C3L A;  3I3C A;  1MSG A;  1BO0 A;  2JP1 A;  4NDX A;  2XWJ B;  3S1R B;  5FO7 B;  4DU9 A;  1CA5 A;  3M3Y B;  3HRZ C;  2SOB A;  2ICE C;  3D3R A;  1ENC A;  3N52 A;  4LAA A;  1FYC A;  5DNF A;  2ZXO A;  1EQT A;  1DD2 A;  2OXP A;  1TWA B;  3NTK A;  4QUC A;  1PXU A;  2KA7 A;  3K0Y A;  1TS2 A;  4DN4 M;  1S4Z A;  5C44 B;  1QNU A;  4FP5 D;  3NTH A;  2BE5 C;  4C3J G;  2QDB A;  2SDF A;  1A2T A;  5JJZ A;  4OIJ A;  3HS0 C;  3JAM E;  3FPU B;  5IT9 E;  3QO2 A;  2KOL A;  1GUO A;  1PTO F;  3ONA B;  2Y0S B;  1XYI A;  1PTO B;  1ZXT A;  3V96 A;  1GJX A;  2RSN A;  2B2U C;  4EQP A;  5EBD A;  1AW7 A;  4PMC A;  3QB3 A;  2E2D C;  1FD7 D;  4RGN A;  4C2M B;  3MVV A;  4NW2 A;  1TU2 B;  1HTP A;  4O42 A;  1RTN A;  2YYZ A;  1SNP A;  2FIN B;  1PLF A;  2IPK D;  2F0P A;  1M8A A;  2OEO A;  1HQR D;  1S5D D;  3TSS A;  1TS4 A;  4DXF A;  5ELE A;  1B9N A;  4XT3 B;  4ZQ3 A;  4HED A;  1IW7 C;  1V1P A;  4A3I B;  4IFD G;  4F87 A;  1STH A;  1EOT A;  5D3D A;  5IGC A;  3DMU A;  1JOO A;  3D8G A;  1EEI D;  2O5J C;  4BS9 A;  2BCO A;  2CW0 C;  1BXT A;  5I9P A;  4WOR A;  1QG7 A;  2E76 C;  3VA5 A;  1LLR D;  4DNT B;  4ZYS A;  3IAY A;  3DXJ C;  5E1F A;  3RLF A;  1BDO A;  3EVQ A;  3S15 B;  3A55 A;  4XT1 B;  3PUX A;  3DM1 A;  4DFA A;  1V1O A;  2B2Y C;  2HDM A;  1CHP D;  2HDL A;  4IFD I;  5T1G A;  4XYO A;  2F3V A;  5JVG 3;  1E0B A;  2QCP X;  2EVB A;  3H3V C;  4IUP A;  4KY6 A;  1R9T B;  2I07 B;  3A56 A;  3QOL A;  1Q1B A;  3A7L A;  5IGB A;  2BOS A;  5E4W C;  2E2H B;  3R93 A;  2D5D A;  1Y8O B;  4YIJ A;  2M00 A;  5DM7 3;  1W6J A;  1Z7T A;  3J7Y W;  4RGM A;  3HGB A;  2YU9 B;  1S5E D;  2EYF A;  5E3F A;  2F0Q A;  4XQJ A;  3BZD B;  2QF7 A;  4OHJ A;  1X3P A;  4FXG C;  2A6E D;  5J39 A;  1B1Z A;  1LT3 D;  1PTO D;  1GUT A;  1HUM A;  2EYO A;  1BCP C;  1I4Q A;  1SJH D;  3RZD B;  2MP1 A;  1KLG D;  5EPK A;  2A6H C;  1CI3 M;  4ULL A;  2LFN A;  1CZW A;  4KKS A;  4QB4 A;  4KY5 A;  2Z8L A;  4TKO B;  1CFM A;  1PDQ A;  1I4X A;  1Y1W B;  1U4L A;  1HUN A;  2F0E A;  2GA4 B;  3J80 L;  3W2D A;  3QG1 A;  2Z4H A;  1HCZ A;  3OHX C;  2JYO A;  1JWS D;  3HG9 A;  4FVM A;  3P20 A;  5HUR A;  5F2D A;  3M4O B;  3HOW B;  1CK1 A;  5CC4 A;  4TSS A;  1IKM A;  3GV3 A;  3BDC A;  1EYD A;  4PV1 C;  4OL7 A;  1FNU A;  4BBR B;  3O13 A;  1DOL A;  3EFX D;  4J6H A;  4FXK C;  1EIH A;  4QIW B;  1NR4 A;  1HFN A;  1YNJ D;  5KNC A;  1WTX A;  1CA6 A;  3TP5 A;  3A8J E;  1QCB D;  3K5L A;  2JXM B;  3I90 A;  2AUK A;  2R61 A;  1H9S A;  3D6C A;  1PZJ D;  1JWM D;  2J0T D;  2F0H A;  3VYR A;  4G57 A;  1RF2 D;  1JWU D;  5AFW A;  3ZYY X;  3LNN A;  4R8N A;  4ZUJ A;  4XDX A;  4JK1 C;  3PV0 A;  5JEA H;  3K57 A;  1Y1V B;  1M4V A;  2H1E A;  3T56 B;  3GTJ B;  1FNW A;  1H9J A;  2K32 A;  4TQU S;  2FFK B;  4DXG A;  4IUN A;  1D1I A;  2Q8I B;  5D3I B;  3NXW A;  1TVX A;  2WKC A;  2JA6 B;  1X32 A;  1O80 A;  2XVS A;  3NK9 A;  1D5Z C;  1X3Q A;  1A15 A;  3NHH A;  2A68 C;  2NTT A;  1EEF D;  4K6D A;  1TT2 A;  1C8C A;  2B2V C;  1DYQ A;  1TS5 A;  3PIO 3;  2OT2 A;  5COR A;  3GTM B;  2EYJ A;  1ZYR C;  2XNA C;  4ILW A;  2N88 A;  4PQX A;  5ELD A;  3M4Y A;  3OMC A;  3OW7 A;  3SEB A;  1MD2 D;  1RD9 D;  5CV6 A;  3GTQ B;  1JR0 D;  4WFN 3;  1CM9 A;  5KIX A;  2F0D A;  3SDZ A;  4X3K A;  5M5X B;  4JBW A;  3AB9 A;  2ZXR A;  4HCS A;  4R9W A;  5C4H A;  3K5O A;  2NVT B;  5CBE E;  1PRT F;  4XYQ A;  3WOF A;  4O1N A;  1QOH A;  1HA6 A;  1ESR A;  1CQV A;  2D9U A;  5C5L A;  2NN6 H;  1E2W A;  2ENB A;  1EL0 A;  1B9M A;  2WKD A;  3C1E A;  2EE1 A;  3AMU A;  4ZUI A;  1KDA A;  3HOX B;  1J8I A;  1SNM A;  2BE5 D;  3L9A X;  1ML0 D;  2L1B A;  5EBC A;  4KV6 A;  2A69 C;  2MGS A;  1SE4 A;  1LTG D;  3FDT A;  3WDN A;  4S3S A;  4DGZ A;  3DEO A;  2B2W A;  4PMW A;  2PYK A;  5I2Y A;  4V0B A;  2EJF C;  3IKJ A;  2K33 A;  3FRP B;  3KUP A;  5FO9 B;  3NQI A;  3GD7 A;  3X3M A;  1TWC B;  3PUZ A;  5I2X A;  1BCP B;  1TWH B;  3V05 A;  1OXU A;  1LT6 D;  2AWN A;  1F9S A;  3OIQ A;  2B2T A;  3R3O A;  1JOK A;  2NN6 G;  5ELC A;  1EQV A;  1NCV A;  4C1N K;  3ND8 A;  3A8I E;  3MXG A;  1AFP A;  4K2K A;  1GXD C;  1OXV A;  2VNU D;  3I91 A;  1HRJ A;  2KED A;  4NP5 A;  2B8G A;  5CV5 A;  1SYG A;  4RA8 A;  5JAV A;  1NSN S;  4G7H C;  2F0U A;  3KLS X;  2Z1C A;  3MZ5 A;  3P1H A;  4UAI A;  2EY1 A;  4C3J B;  1A3U A;  1IW7 D;  5C6A A;  4WJW A;  5I6W A;  3PO2 B;  5IGF A;  3VYU A;  1B3A A;  1DON A;  3MC0 B;  1SE2 A;  2JA7 B;  3BVZ A;  4DNR B;  2CW0 D;  2O4X A;  3H94 A;  3MHB A;  2NN6 I;  1GUN A;  4DAP A;  1NR2 A;  2CQA A;  3FEW X;  3SR1 A;  3FMC A;  3J7A V;  1QWY A;  3QIA A;  1S5F D;  4M1U B;  3VR5 A;  3TP6 A;  2BA1 A;  1F2Z A;  1Q3L A;  1AZP A;  2RDG A;  1B44 D;  1UNS A;  1ZEQ X;  4K8I A;  2JEB I;  4Q0F A;  1D5X C;  4XXE A;  5EKK A;  5T1I A;  3D4D A;  5A2Q E;  4F7X A;  1FR3 A;  1VMC A;  2L9H A;  3GTO B;  3NE5 B;  3KLR A;  3IFT A;  2EYH A;  2KCC A;  4N9P A;  2CVR A;  1PRT D;  4KMU C;  1Z6H A;  1S5B D;  2VXW A;  2K5Q A;  2WII B;  4RH6 A;  4G7O C;  4HTH A;  1GUG A;  1PTO H;  1EZ6 A;  4K6L A;  4K5W A;  4A93 B;  4A3K B;  2D2C C;  1V43 A;  3NQT A;  2F0M A;  1LAC A;  2C9O A;  4A3D B;  4PMB A;  5CMD A;  1EU4 A;  1LTT D;  3HOV B;  3RMH A;  2VB2 X;  1G91 A;  3S17 B;  3GTL B;  2A5H A;  1T5X D;  3S1M B;  1EY8 A;  4X3S A;  2AWO A;  3J81 L;  1AP0 A;  2DNC A;  1GUS A;  1BUV T;  3UI2 A;  2EZV A;  2RQX A;  3R2T A;  1BCP D;  3C1F A;  1KNE A;  3QOJ A;  1EY9 A;  4Y7N B;  1LT4 D;  2B2U A;  2A6H D;  1I4R A;  4KJN A;  1D2B A;  5EPL A;  2J4X A;  4KN7 C;  3CU7 A;  3K5M A;  4MIU A;  2XWB B;  1I4H A;  4H7B A;  4DK0 A;  1JOR A;  1L0X B;  4WRD A;  2L0C A;  4K2L A;  4ME5 A;  3A54 A;  2IW3 A;  4C3H G;  3T16 A;  4KHV A;  2L11 A;  1WD1 A;  1HHV A;  5JEA J;  3D6W A;  3QJY A;  3EA6 A;  1SMY C;  3I70 A;  5TSS A;  1F9P A;  1XWE A;  2FHT A;  3BYT B;  1RJT A;  2DY7 A;  4H44 C;  5FLX L;  2HQE A;  5KRU A;  3A7A B;  2KEE A;  2B63 B;  2EYL A;  2F0W A;  4KI0 A;  1PRT C;  3DWP A;  2SEB D;  2DY8 A;  4HSV A;  3MEH A;  1WTV A;  2KVM A;  3MFG A;  5IOC A;  4HSP A;  1DM0 B;  1ESF A;  3MAQ A;  1UEA B;  1WD0 A;  2K03 A;  1QE6 A;  1DXM A;  1GHK A;  1STA A;  1RTO A;  3K59 A;  2EXZ A;  3TN2 A;  2EY2 A;  5C0X H;  5EPJ A;  1T5E A;  3KLS A;  3Q6S A;  2ICI A;  4C1N I;  4C56 C;  1ILP A;  1H9R A;  1LV9 A;  3TZU A;  1IYU A;  4A3M B;  1ENA A;  4I65 A;  3TDQ A;  4BA1 I;  3CKI B;  2PPB C;  5EJW A;  2HUG A;  2KEC A;  4U68 A;  5IT9 L;  3R2I A;  1EWC A;  4HAE A;  2D62 A;  3Q0A A;  3M7G A;  3L3O C;  2FJ2 A;  5KEE A;  4KKT A;  1AN8 A;  5BN5 A;  4Z9C B;  1WTW A;  1CTM A;  4X3U A;  1PFB A;  2A68 D;  3H0G B;  3N6R A;  1D1K A;  1A3V A;  4L8J A;  5CV9 A;  1NAP A;  1EZ8 A;  4EVO A;  2EYP A;  2B8F A;  4ZLT F;  3GTK B;  1STY A;  1ZYR D;  5KGU A;  4KHZ A;  4DF7 A;  1LTR D;  5M9O A;  3VR3 A;  3HP3 A;  1BOS A;  3OIP A;  4RCN A;  2TSS A;  3ITP A;  1U4R A;  4OO1 H;  4K14 A;  3K6O A;  4K5V A;  3TZD A;  5HGT A;  1K83 B;  1ET9 A;  1RCV D;  4EQN A;  3NBH A;  3EJI A;  1JIC A;  4FYD A;  3DWA A;  1EY4 A;  2IT1 A;  3RZO B;  2SNS A;  1OXS C;  2F0J A;  1DOK A;  5JOB A;  4A3B B;  1EU3 A;  4KKU A;  5JPM C;  3FVQ A;  4QMG A;  4CKB A;  3K58 A;  1A6X A;  1VCI A;  2IWH A;  2F0N A;  5C0X I;  1SYC A;  3I8Z A;  4I7Z C;  1SSO A;  2WIN B;  4H0L C;  1V1P B;  3I4M B;  1MSH A;  2A73 B;  3L7Z C;  1EYA A;  2A69 D;  1HTL D;  1DOM A;  3S16 B;  3F2U A;  5FOB B;  1O7Z A;  3H6M A;  5E4X A;  3SXH A;  5IGG A;  3T4A C;  2NWG A;  3BG3 A;  3OWE B;  2MPM A;  5CV7 A;  1BBX C;  1C48 A;  1I6V C;  1LAB A;  3CQZ B;  5J1Z A;  1STN A;  5C4X B;  1TWF B;  5K5P A;  4B08 A;  1Y69 U;  1U4P A;  5DAU A;  4Q5V A;  3PIP 3;  1SND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...