3NPPA

Crystal structure of a pfam duf1093 family protein (bsu39620) from bacillus subtilis at 2.15 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
87
structure length
87
Chain Sequence
b'GRFNPFIHQQDVYVQIDRDGRHLSPGGTEYTLDGYNASGKKEEVTFFAGKELRKNAYLKVKAKGKYVETWEEVKFEDMPDSVQSKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pfam DUF1093 family protein
publication title Crystal structure of a Pfam DUF1093 family protein (BSU39620) from Bacillus subtilis at 2.15 A resolution
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 14
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nppA00
2K5QA 2K5WA 3NPPA
chains in the Genus database with same CATH superfamily
2NUCA 2WAQB 5M3MB 3VR4A 4HSPA 4QY7A 1B2TA 1TQOA 1WI5A 1PDQA 1MJEA 3MAQA 4WRDA 3NUCA 2KECA 2NZOA 2F0GA 2BDNA 4RCNA 2B2WC 1F2LA 2A74C 2HCCA 3GTPB 3S1MB 4DUZL 1RTNA 4JBKA 1DZ1A 4B3SQ 1JOKA 1UE6A 4CDEC 3BDOA 4X3SA 4XT1B 2UXDQ 3UE1A 2F0UA 3PO2B 1F2YA 4WJWA 5GAEC 1HZBA 1K9MC 3HOWB 4J8QA 4X62Q 1AN8A 3SEBA 5F2DA 3FKIG 4BXXH 3MTSA 4KKUA 1BBWA 5D3DA 1SFOB 1O80A 2AQ2B 5EQ0A 5C6AA 3C46A 4OIKA 4A3KH 4JI2L 2FMMA 4UP8A 2JP1A 3RZDB 1X65A 2JA6B 1LM0A 2ZTEA 4DU9A 4DK0A 2NVQH 5AJ3Q 3Q24A 4XYOA 1DXMA 2IL8A 3CCSA 1JB3A 2JK8A 1GKHA 1GM5A 3J81i 4IUUA 4BS9A 5IWAQ 2V4DA 2QDBA 4DV6Q 3CU7A 5LHY1 4KI0A 1XMOQ 3J7AF 4A93H 3PUWA 5IODA 4DK6C 2CCZA 4LFBQ 3S2DB 3UDXA 5DM73 4F8MA 5M5WB 1EFID 1QNKA 1VQHA 1YEZA 3H6MA 4K2KA 2MO1A 5IYDH 3KJOA 2WINB 4A3EB 2DY7A 4DR7Q 3RR5A 1BCPC 5D3IB 3E0EA 3VR5A 1XNQL 4A3BG 4OO1H 2O5IC 1QZGA 1N34L 5KYIA 2VZAA 3A5UA 4K5VA 1GHJA 3LWUA 2R61A 4BA2I 1Q3LA 2SDFA 2AWOA 1WFQA 5E3FA 2K50A 4PMCA 4KY5A 2LFNA 2HT1A 2VQEL 4Q0FA 3R8BA 1TU2B 4RKLA 4IUVA 1S5CD 2Z4HA 4C2MH 4ZRZA 1CSPA 1I4PA 2JJQA 3FKIB 1OXVA 2J7ZA 4JI4Q 3K8AA 1YNNC 2FHTA 2CH4A 5FO7B 3TREA 5JJIA 2OWOA 4DV3Q 3BVMA 3EVQA 2VQFL 1ICFB 3M85A 4RG1A 1Y1WH 1PH6A 4OX9Q 1A6XA 2F0WA 3IKJA 4QMGA 2YYZA 1RCVD 4I65A 4LF8L 2JA8G 4PZ8A 3I91A 2EY6A 2K7VA 1WTVA 3H09A 2K03A 4JYAL 3J7ZC 2K4KA 1Z9FA 4HR7B 2EYHA 1Q86C 5TSSA 2RHSB 4A3MG 4ZKCB 4HIDA 4K14A 4A3BB 4C3JB 1BVSA 3KYHC 1DCZA 1K8OA 3PIOA 1K83H 1SJED 2JXMB 1DJRD 2PMZE 2MP1A 4JG2A 4YCWA 3HRZC 3SVMA 1VQCA 4LF5L 2E2IH 1I5FA 1Y14B 2K1BA 5CV7A 4DA2A 2Z1CA 5GROA 5L37A 3KFUA 4A3DB 1OO9B 3T1YL 2R7FA 1FVIA 1TY0A 1N32L 3D6CA 3CKIB 3DWAA 1Y8OB 1D5MC 4IOAA 2UXBL 1DGSA 1SNCA 3FPPA 4JI8L 2XVSA 3D4DA 4UHVA 3HEJA 4JV5Q 3L2PA 3MEHA 1MBYA 3W2DA 2VXWA 1ET9A 2ZXPA 4Q5VA 2AHOB 3NTHA 5CYUA 1L0WA 1KLGD 4G4KA 5CBEE 3HKZE 1YI2A 5C4XG 3H0GG 1PHJA 5FK9C 3KF8B 3HOXG 1BR9A 2IHFA 1HA5A 4IURA 2IX0A 2RDFA 1CHQD 5I6YA 1GUTA 1PFMA 4A3IH 4B3SL 3GTLB 1AP0A 4FO2A 2L4NA 2PW5A 4YY3Q 2UXDL 1VMPA 2OF1A 3KF8A 4IFDI 1H9JA 2BE5C 2F4VL 5KGUA 3S2HH 3RZOH 1ILQA 4X62L 3TQYA 4LF7Q 1N36L 3S1QB 2GA4B 4BBRH 4A3MB 2L55A 4LUVA 3I4NG 1B53A 4HTHA 4AYBE 1NTGA 4C56C 1TWAB 4RAUC 2UUBQ 4OELB 1VQFA 4ALPA 4WFN3 1NR4A 1E2VA 4KJOA 3PMFA 2RDGA 1TS5A 4DV5Q 4GOPB 5AJ3L 4DR5Q 2RKSA 3CC7A 1VQLA 1XPUA 1NUCA 3HGBA 5M5YH 1XTCD 4HN7A 2E75C 2QF7A 1TY2A 3UDIA 5IWAL 1W3SA 2PCFB 4GOPA 4NXML 4DV6L 1DYQA 4LF4Q 2QEXA 1W6JA 1BO0A 4DUYQ 2K5DA 1CA5A 2XNAC 1XJVA 1U4MA 3DMUA 1XMOL 1ESFA 1KTKA 4HAEA 1XMQQ 1Y1VB 4LFBL 4N9PA 1HNZQ 4ID6A 4F87A 5IGCA 5HY6A 5C4XB 3X3MA 5LL6X 1ET6A 3HOXB 4BY7H 1IYJB 1JE4A 1MD2D 3I8ZA 2N3SA 2Z6KC 1HNXQ 3CC2A 3J80E 4NPSA 3VA5A 1EU3A 1UNSA 2YTXA 3GTKB 2Y0SE 2ZT9C 1Q81C 5CMDA 1B44D 5IP7H 1VQMA 1LV9A 3EA6A 3HOVG 1EQRA 4TKOB 3GQBA 2EYJA 4EGVA 3GTGH 5E4XA 1UWVA 3MXPA 4CGYB 2CH4W 5CBAE 2F0OA 4G7HC 2V1CC 3CCEA 5AFWA 2N8NA 1KAAA 5DEHA 3S16B 3BZCA 4HJ9A 3HOYH 2JYOA 3KF6B 4QIWE 1IBLQ 1CM9A 4PV1C 1JJGA 4DV3L 1ENCA 1AH9A 2B2UC 2F0PA 4K5XA 3VDYA 1Z47A 3F2BA 4OX9L 4OWXB 3KF6A 4FF2A 1JWMD 1VQOA 1CK1A 1EOTA 3GTOH 5C3EB 2NB0A 3D0FA 4KV6A 2WV6D 2PQAB 3F8TA 4UPAA 3OTOQ 1XPRA 4Y7NB 3OIQA 4ZUJA 1S3OA 3KJPA 3DXJC 3GTMB 1DOKA 2PQAA 5K5PA 3C1FA 2N55A 1C7YA 1RIPA 1JWSD 5BN3A 4GKJQ 4ZCKA 4G7OC 1EYDA 4L6TB 1YHBA 2NTSA 4WJ4A 3DLLA 3ONAB 2E2JH 3S14B 1AE2A 4C3HG 2AUJD 2JA5H 3RD4A 4QL5A 1KIXA 2YTVA 1GJXA 4RKBA 4NW2A 2O4XA 3LNNA 4PG3A 2QKIC 4GKKQ 1XWEA 2HDMA 4MN3A 4ZLTF 1D1KA 3VR2A 1SEBD 4B9WA 1SNOA 4KHZA 2JA7B 3E5SA 3S15B 2FINB 3CRKC 2YU9H 1NJIC 2AKWB 2XWBB 3RMHA 4JI5Q 4A3FB 4B08A 3A7LA 1Y69U 1WTQA 1WTRA 4EVOA 3QJYA 4JV5L 2ASBA 3BJUA 1PZKD 1ENFA 2L1BA 3T16A 2N78A 3RN2A 3AMUA 3MFYA 1Q7YC 5CORA 2KQ3A 1G6PA 2R6GA 3EBEA 4IPCA 5K36H 2UU9L 4XTCS 5CV8A 4ABNA 5NUCA 1EWHA 5G3LF 3WWVA 3HS0C 1NY4A 5FLMH 3Q22A 1D5XC 2DGYA 1EL0A 5DNFA 1FYCA 4YY3L 1PFBA 3VA7A 1HQMC 2TMPA 5H1SE 2KA7A 3OW7A 4RGTA 5HURA 4FXKC 4LF7L 4C3IG 1X3QA 4X3TA 2F3VA 2F3IA 4HIOA 4R4CA 3J81c 2E76C 5ELBA 5JEAJ 3CQZH 3KUPA 4R4OA 1JB7A 2KCNA 2VS1A 1MSHA 1I6VC 4C3HB 1F77A 1ZYRD 2NBFA 2CWPA 4LW1A 1EY7A 1FGUA 4LMQD 3HZXA 4DV5L 5IT9E 4LF6Q 1HCZA 2AQ1B 4A3JH 2ATWA 1EY6A 4FNFA 2CW0D 1FL0A 4HCSA 2NVTB 4LFAQ 1RKNA 2G5DA 1RDPD 1KC8C 2GVAA 4LF4L 1YJ9A 4DUYL 1XXGA 1IKLA 1X32A 1L1OC 1LTRD 4J1MA 3QIAA 1E22A 1I4RA 5M3MH 1XMQL 4R8NA 1HNWL 3M7NA 2B3GA 3DEPA 1HNZL 3K5OA 2Q8RE 1ONLA 4AQYQ 1Q90A 5FJ8G 2EYFA 2NN6H 3P1HA 1IL2A 4DV7L 5EPKA 3GTPH 1LTAD 1HRJA 3S1MH 5J1ZA 4B3TQ 4RWSC 1HNXL 3BVGA 1CZWA 1CQFA 3PO2H 3HOWH 2HCIA 4IFDH 3LX0A 1QZHA 1ZEQX 3TBIB 3RLNA 3Q0AA 3QB3A 1O7LA 2EIFA 3TZUA 4GLXA 1II3A 3I4OA 2F0VA 3X3NA 1SFOH 5IGGA 1X3EA 3DUZA 2VQFQ 2K5HA 1KQSA 2B2VA 2QCPX 2Z0SA 5FOBB 4A75A 3E3XA 3RZDH 2JA6H 2BDOA 1IBLL 4YIJA 4CKCA 3HOUG 3J81j 2SNSA 1NCVA 5COYA 4X66Q 4LF8Q 2OQKA 4G57A 2KCCA 3PIPA 4IZ8A 1B8AA 2M00A 1I4HA 1WTPA 4FF1A 2VUMG 1C0AA 3ITPA 1TIID 5IOCA 4JYAQ 4DR4Q 1TS3A 1TT2A 1O7YA 1S5BD 4IFDJ 3NWSA 2R92G 1GUOA 3S2DH 3MXUA 3TN2A 5M5WH 1AE3A 2F3WA 1XPOA 1KRSA 2DNCA 1EY8A 1LO5D 4DK3C 3K57A 4A3EH 2RHQB 4DGZA 4GKJL 5D14A 2CFMA 3H3VH 1L0XB 5BN4A 1XNRQ 3TP8A 3TZDA 1PFNA 3OW2A 3W5OA 1L1OB 3M4PA 4F88A 1AZQA 3P20A 3DWQA 2OXPA 1TS2A 5C4ZA 2K5VA 3H3VC 2RBMA 1VQ5A 5A2QL 4IO9A 1TWCB 1G91A 3LGJA 1KHIA 4B3RQ 3FP9A 4R4QA 4X6AH 1J5EQ 2VNUD 3I4MB 3UI2A 3CCRA 3FKIH 2NVXB 4K2LA 1ICWA 4JI5L 1K3BC 2PYKA 3HKZG 3WDNA 1K8MA 1PZID 3O13A 1CQVA 2PNRC 1SE4A 4RA8A 3PGZA 4FYDA 2B8GA 1JCKB 2HHHQ 2K75A 2A8VA 4DR2Q 1B50A 1OXSC 2L12A 1JJCB 3F2UA 2CKZB 3J80i 2F4VQ 3FMCA 2VUMB 2EYMA 1YBYA 3HOZG 4ZKBB 1WTXA 1V43A 1N36Q 1RJTA 3HFZB 3M7GA 1PH8A 2R3ZA 2C35B 4IUTA 3A5ZB 2B63B 4AYBG 4UP7A 3CF5A 3A74A 2R92B 1J8IA 1LYLA 2VB2X 1SXTA 2PMZB 1YVCA 1G8ZD 2XGTA 3K5NA 2CQAA 2E2DC 1M90C 2F0SA 4A3BH 4B3MQ 3I73A 4C3JH 3PO3G 1FNUA 3NK9A 5EBCA 3MZ5A 5IP9G 2J0TD 3CMEA 1B3QA 1VF7A 4BY1G 4POGA 2PZWA 1HFGA 4DNTB 4IALA 4LF6L 4NXMQ 1QNUA 4HJ7A 2KBNA 4XYQA 3JAMc 4A3DH 1DD2A 1SR3A 2QDLA 3G7LA 3PSIA 4DAYB 4LFAL 2KUMA 3FDTA 1I4QA 2FJ2A 1TXYA 5I2YA 1FNVA 2C9OA 2HDLA 5FLXL 1SYCA 4DAYA 3E9IA 2NZ1D 2VL6A 1KABA 1AZPA 4JI0L 2KENA 3A7AB 3S1RB 1H95A 2A6EC 3TP7A 1HH2P 4AQYL 1VQ6A 2Y0SG 1F9RA 1MKHA 3U50C 1B7YB 2ID0A 1C4QA 2ALYB 3NQIA 4GLAC 3VYUA 4B3TL 1UEBA 3GTLH 2PQEA 4A3KG 1R4QB 2F0DA 5I6WA 2A68D 4HMJA 5EPLA 4N8FA 2EY1A 4I7ZC 1I6HB 1RD9D 2WB1E 1R9TB 4MZ9A 4LJZC 2KVMA 3EQLC 3S1QH 1IW7D 3OWFA 3EFXD 2EPBA 4KN4C 2M9VA 4A3GG 4A3MH 2RSNA 2QGQA 1KAWA 1JE5A 2CQOA 3A55A 1TWAH 3KBGA 3AYHB 4EQOA 1U5KA 2JN4A 3J7YW 4A93G 2PPBC 4KD3A 4JK1C 2D2CC 3TS0A 1EQQA 4X66L 1VMCA 5IYDG 2LY7A 1G6ZA 1WYDA 4YWMA 1VQEA 3PF4A 1B70B 1ASZA 5J22A 2RCNA 2F0LA 4DR4L 2K33A 2WAQE 2F0FA 4K6DA 4RCOA 3IRBA 4CJ0B 2VY3A 4PZ6A 4GOPC 4FF3A 1IYUA 3NTIA 3BDCA 4IJLA 1U9RA 3NELA 3CRLC 4C1NI 1H9MA 1Y1VH 3PUVA 4OL7A 1W2BA 2B2TA 1STYA 3RLFA 2KJXA 1PH5A 3U9OA 1EEFD 4TSSA 5GADC 5C4XH 1PTOD 2ZTDA 1OXXK 1YIJA 2K52A 3HOXH 2N88A 3S17B 2F0NA 1Q1EA 1XNRL 3K5MA 2E2HB 1U0LA 3FPUB 3GTKH 1QVFA 3K58A 3GTJB 1NNXA 4ODGA 1VQDA 4YWLA 4O2DA 5JPMC 2IX3A 4B3RL 1WD0A 4X3KA 1J5EL 2E5LQ 4A3GB 1KDCA 1PYWD 2XRQD 1B9NA 3HG9A 2JSOA 5T1GA 3OMGA 2H4OA 3S16H 4A3CH 2CVRA 3AU7A 4M8AA 3D6WA 4JI7L 1YNJD 2UU9Q 5C44G 4A76A 5DM63 2HHHL 2HQLA 5EAYA 2JA8B 1RODA 1SROA 4DR2L 1U4RA 1VQKA 1DONA 1RTOA 1EFWA 3OYYA 2L0CA 4AIMA 2MGSA 5C3EH 4H0LC 2UUCQ 3CCJA 1VQBA 4KKTA 1XYIA 1LT5D 2GVBA 4Y7NH 4KHVA 3GTMH 1A2TA 2EE1A 5JOBA 2VB3X 1I3QB 5CR3A 2K6AA 4P71A 3NQTA 1BF4A 2K28A 1IL8A 1L2FA 4YHHQ 4O1NA 1P8LA 1BKBA 2HIXA 3VYTA 1JC7A 1JOQA 4NDXA 2B2YA 1UE7A 4GN5A 3S14H 4B3ML 1E7ZA 1S72A 2ZJPA 2ZJQA 1EZ6A 2VW9A 3NXWA 3TEHB 1WVLA 4FXDA 1EU4A 1SYBA 1ZKOA 2NTTA 3S1NB 3NBIA 3TP5A 2R7DA 1A63A 2JA7H 1GOZA 3S15H 3T51B 1IBML 3ZYYX 4PNYA 4ZQ3A 1HNWQ 2AMCB 1SYGA 4A3FH 5JVG3 1VQ4A 4H13C 2MO0A 3D8GA 5JJLA 3I3CA 1FGBD 3W3AA 1STBA 3H0GB 3MVVA 2OTLA 1TWGB 4DV7Q 2B39A 5KYLA 4A3LG 5C44B 4QCLA 1EOVA 3ICEA 4BBRG 3L7ZC 4GN3B 3BYTB 3PUXA 3J80L 4M1UB 1LTBD 3NENA 5M9OA 1GUSA 3K59A 1SYEA 2IY5B 4HSVA 1A0IA 1SSOA 3K7AB 4FXGC 5BN5A 3I4NB 1BBUA 3R3OA 2MJ8A 3P7JA 5CC4A 1V9PA 2I5LX 2UXCQ 1ML0D 2X69A 2DUDA 3K80C 2HQEA 3VYSA 3BS1A 1CKOA 1OXUA 1PRTD 1V8QA 4DXGA 1EQTA 4C3HH 4BBSG 1C48A 3CMAA 1IZ6A 2EZVA 2D9UA 2F1MA 4LUOA 4RGMA 2H5XA 5CV4A 5KEEA 5ELCA 1YNXA 2RF4A 1G51A 2NVTH 4DKAC 1DOMA 2YV5A 1VF5C 1FD7D 1GUNA 4GNXB 1PH4A 1SE3A 2A68C 4L8JA 3K0XA 1H9KA 4CJ1B 2EYLA 2JEAI 3WOEA 3J7AV 3OSOA 3J81E 2NVYH 1N9WA 4GNXA 1CZGA 1IW7C 4DAMA 3S24A 4IUQA 4DR6Q 1BXTA 2ZM6Q 1XX8A 1IKMA 3ER0A 3W1GA 4FDBA 4BWGB 1ASYA 1JWUD 4JBWA 4CDFC 1LABA 4CKBA 4ZYSA 4P75A 1PH1A 2RCFA 5IY0A 2DJGC 5KRUA 1GO3E 2XSCA 2X6GA 3HOYG 3M4YA 5C3WA 3HOVB 4L5RC 1S4ZA 4FP5D 1C9OA 1CSQA 4KHPQ 1WCMG 2Q2HA 4MHEA 4EQ5A 1UEAB 3URYA 1MGSA 2E5LL 3F2DA 1PZJD 2A73B 2DN8A 5JEAH 4O0AA 5KNCA 4JW0A 1A3VA 4ILWA 4BBSB 2P5ZX 2B2VC 1BNZA 1K0RA 1D8LA 2XWJB 4KKSA 5EJWA 1STHA 5LMNQ 2QA4A 3I2ZA 4LFCQ 1EEID 1OXTA 1W6KA 2R93G 2A69D 2WKCA 5C0XG 1LTLA 2UUCL 1LTSD 2OTJA 1HPCA 5JVH3 1FR3A 1VQ8A 2XN9C 3ERQA 1HXYD 4NP5A 4IPGA 1STEA 1VQGA 5IYBG 2QILA 4XQNA 1B3AA 4QGUA 1EYCA 3A8JE 2MNAA 3QOLA 3U9SA 1GXDC 4V0BA 3RUZA 4DAVA 2LXKA 1LT6D 4YHHL 5J39A 1K8GA 2ES2A 3SK8A 1BDOA 4X64Q 1IXRA 2EXZA 2RDHA 4DV2Q 3I4LA 3I56A 2RQXA 2G9HD 3U4VA 1YNJC 5IT9L 5J3BA 1BBXC 2EJFC 4IOCA 1BCPD 4DV0Q 1K3RA 3I7FA 1H9RA 1PMRA 1I94Q 4K8IA 1AFPA 4JOIA 3BG3A 4P73A 4KTAA 4X65Q 2EY5A 1CUKA 2EJMA 1WCMB 1TWCH 4LF9Q 2Q2TA 2O2LD 2BCOA 2MFIA 3MEFA 3I4MH 4KLKA 3U58A 2NVYB 3EN2A 4ZAIA 2NVXH 4L63B 5K36G 3QG1A 3VYRA 3EIVA 5I2XA 5C5LA 1JJ2A 4JI0Q 1NBWA 3V2TA 1GVPA 5FLMG 3G71A 1RF2D 5ELEA 4UP9A 3MC0B 4JC0A 3M3YB 1HZAA 2ZXOA 4R1JA 1SRUA 3C1EA 1J6QA 3AEVA 1QWYA 2R93B 2D0OA 4R4TA 1YHAA 3NEMA 3T56B 1YJNA 2VUMH 1V1PB 3KDFB 1B4OA 4C3IB 2NYZD 1PH2A 1F9SA 3H91A 1YHQA 2B63H 2R92H 1PTOB 4J6HA 1V1PA 3H94A 3KDFA 3CD6A 1YITA 3DEOA 4ZUIA 4A3JG 2UXCL 1X3PA 3GP7A 2ZXRA 3N52A 1FJGQ 5IYCH 4CDCC 2R7ZG 1GUGA 3IAYA 1D7QA 1T9HA 1AW7A 2F0KA 2WAQG 5M3MG 5EKKA 4K6LA 5HGQA 1O7ZA 3S9WA 4U673 4ULLA 5C4JB 3DM1A 4GS3A 1FNWA 4XQJA 4PQXA 4HJ8A 1V1OA 5A35A 2EQSA 1F9PA 3FRPB 1SAPA 1B9MA 2IW3A 1K28A 3PO2G 4QB4A 2XRSD 3K81C 3G4SA 1QUQB 4DR6L 1O7IA 2ZM6L 4JI3Q 1EY4A 1DOLA 3S1RH 1JMCA 2K5NA 1PRTC 2HIVA 2AQ3B 2LMCB 1QUQA 1HUNA 4H02A 1VQNA 1IHZA 4OHJA 3JAME 1E1TA 1HR0Q 1UE1A 4HIMA 1KL9A 3KBXA 5JJZA 2G9DA 3D31A 5M5XB 2JA6G 1PVOA 1IYVA 1I6HH 5LL6S 4DFAA 5M3FG 4KHPL 4OXPA 1Y8PB 1R9TH 3I70A 1STGA 3PQIA 3SXHA 3W1BA 4OEMB 1XTDA 5GAGC 1X3FA 5GAHC 1SLJA 3ND9A 4JI7Q 2YTYA 4JI6L 3SGIA 1NR2A 1SN8A 3HOUB 2R7ZB 3GV3A 1B1ZA 3ULJA 1TWHB 4NMZA 2Q2UA 1LT3D 3MA2B 1A8VA 4JI1Q 5LMNL 4ME5A 4LNQA 4LFCL 2IWHA 1I50B 2FMCA 3A8IE 3R2IA 3NWTA 4A3EG 1PA6A 4LK1C 1CKMA 2I5HA 1ZXTA 3C3LA 3R93A 2PW7A 2H1EA 3T13A 1Q8IA 1PH3A 3NHHA 5LMUQ 4JCVE 3ULLA 2I07B 2L15A 3TS2A 1PYBA 3SK5A 5C3XA 1WD1A 1HA6A 2F03A 3BVZA 2IHEA 1PV4A 2ZJRA 2B2TC 3CCUA 1WTOA 5ISRA 3L3OC 2KHIA 3GV6A 4LAAA 4DXFA 3E0JA 2WKDA 4X64L 1TWFB 2D5DA 2EVBA 5CV9A 4N8X1 3STBD 3RNUA 3S17H 4DV2L 2EXDA 2E2HH 3IL8A 1N33L 2DJFC 2F0TA 4DV0L 1I94L 3GTJH 1QJOA 1IBMQ 2A69C 2B8FA 1D1IA 4X65L 5M3FB 2QW7A 1PFSA 1EIFA 3TMEA 4LF9L 1PRTB 3HKZB 1D2BA 4A3GH 1AEXA 4QJFA 2JE6I 1QB5D 4DNRB 1Z6HA 3T1HQ 2K32A 3UE0A 2WACA 1EIGA 3JC66 4KJNA 2PI2E 4KY6A 1IBKQ 1UE5A 5FKAC 4IJHA 5LMNW 1VQJA 1ZYRC 1SE8A 2EYOA 4BXXG 4F7XA 2I0QA 5FLXE 5C0XI 3DHQA 3VR6A 2MQHA 5BR8Q 2JA8H 2M2LA 3HOZB 5EKIA 1Q8KA 2OQ0A 4P74A 5IGBA 3GTQB 3T53B 3A56A 4CDDC 4V190 2PO4A 1JOOA 2L5TA 1Q1BA 2ENBA 2CW0C 5JJKA 2KHJA 5I9OA 2DY8A 4BA1I 4AYBB 4KK7A 3PIO3 1Q12A 4N9TA 4C3JG 2Q8IB 1Q82C 4LWCA 2EJGC 2A1AA 3KLSX 5CGKA 1D5ZC 3KLRA 4DN4M 4XQQA 1HTPA 2F0QA 1EUJA 1F9QA 1HZCA 2AWNA 1I3QH 4NXNL 1JORA 2I46A 3AB9A 1JICA 2BH2A 3CC4A 5E4WC 4A3DG 4U68A 1EIHA 3M4OB 1I4XA 4EQNA 3PO3B 1FJGL 2RA4A 4DAPA 4BY1B 1UAPA 3LWEA 1F2MA 2B2YC 3FHWA 4UDUC 1HHVA 1PH9A 1M8AA 3CPWA 2F0IA 3A8KE 3KK7A 2B2WA 3S1NH 1WJJA 3QOJA 3F1ZA 4OO1G 1HTLD 1BUVT 1E2ZA 3PV0A 3QWNA 3Q8DA 1G2TA 4LUZA 1X56A 3MXNB 2CWAA 3NP8A 1YZ6A 4RFBA 3CP0A 2NWGA 1PXUA 3CCQA 3NPPA 3MXNA 3BZKA 1N8RC 2Y0SB 2A5HA 4H44C 2BH8A 3H0GH 4XIGS 2BA0A 3G6JB 5EPJA 1TWGH 3TDQA 3CAMA 4JI3L 5C44H 1X54A 3A0JA 4JPBW 4POFA 3TSSA 5FLXc 4DR1Q 1NAPA 4CBVA 4A3KB 4MTKA 4RGOS 4JVZA 2LSSA 4ME3A 1HR0L 2NVQB 1DM0B 4KD4A 1Y1WG 1MJCA 2Q8TA 2WFWA 4QIWB 1HUMA 2UUAQ 2FXQA 4DV4Q 3G6EA 3K7AH 3I4NH 1LUZA 3D3RA 5IGEA 2KCTA 4G7ZC 3AQQA 1S40A 4A93B 4IPDA 1BCPB 3Q23A 1OTCA 4L5QA 1SYFA 2D62A 3UDFA 1KDBA 4XXEA 1SYDA 3FEWX 5C5MA 1MHWC 3B6YA 3UDGA 3SHLA 1Y1VG 3NBHB 4JI1L 2NN6I 4HJ5A 4RHSA 3HP3A 5IIFA 1PH7A 2F0EA 3MFGA 3CHBD 5C4HA 4L5SA 3NBHA 3NSWA 4UAIA 1YJWA 1SJHD 3HKSA 1M4VA 3NE5B 4E6IA 5FO8B 3U4ZA 2IJ0A 4YCUA 3AFQA 4DR3Q 3MWYW 2F52A 1EWCA 1CTMA 2Z9HA 5LMUL 1CA6A 1GUWA 4C2MB 3GDEA 4GNXC 1SDFA 2OCEA 1Z7TA 2E74C 4A3LH 2KEDA 3CCMA 2F0MA 4CJ2C 5IE8A 1KNAA 2E8GA 1G291 3QO2A 1SBBB 2AUKA 1E24A 3OIPA 1HR0W 3AFPA 5KIXA 3I55A 1CFMA 4A3CG 1Y1WB 4OWWB 3PUZA 4K0KQ 4R4IA 3HOVH 4FF4A 2JEBI 2J4XA 2NZHA 3D4WA 1K0SA 1CT1D 3SK6A 4A3IG 4UY8C 1S5DD 2K5QA 4H7BA 3N6RA 5C3EG 1TR5A 1GHKA 1SMXA 2F0HA 3BDLA 2I5MX 2A6HD 1EIYB 3T1HL 1VQ9A 1PTOF 2MPMA 2X6LA 4RH6A 4BBSH 1IBKL 4QUFA 1HJPA 1EWIA 2ICEC 5DAUA 3V05A 4MTNA 3CPFA 2KEEA 3STBC 3H3VI 4K8JA 4EQPA 5BR8L 3JAMi 1SNQA 4DR7L 3CXCA 2ZTCA 3P75A 3I72A 4GN4B 1G2SA 1K83B 4HJAA 5ELDA 1RL2A 3FVQA 1D6EC 5ELFA 2CHBD 2E2IB 4IPHA 4DF7A 2K14A 2TSSA 1RHPA 5G3LD 2Z8LA 5E7NA 3PCOB 4ZK9B 3D4RA 4JBMA 3PUYA 4WORA 2EOTA 1UUPA 2JA7G 1TVXA 1V1QA 1SMYD 4TRDA 4I7AA 2K01A 1NMGA 1LLRD 5I9PA 1Q46A 2RSOA 4A3FG 4JI4L 4DNIA 3L9AX 4OWTB 1HQRD 1PYSB 4HEDA 4CHTB 1QE6A 1F2ZA 4RGNA 4PMBA 2SNMA 1S5ED 1WCMH 4BY7G 4JOIC 1NMFA 1MIUA 4YCVA 3CCVA 4A3IB 4IQZA 1U4LA 1E3PA 2HD3A 3T4AC 4CKEA 3J81L 1E1OA 1K73C 3QR8A 1O78A 3SDZA 1KRTA 3S2HB 5ELNA 3M4QA 4RMFA 3RZOB 1JR0D 5IP7G 1ENAA 3NTKA 4DV1Q 3ULPA 3CW2C 2MUYA 1CKNB 3ZJYC 2JA9A 2KOLA 4BBRB 2WP8J 1ESRA 3K7UC 5CV6A 4PZ7A 1LT4D 5KNDA 1LTID 3M3YH 1TS4A 4DR1L 1CKNA 2XTIA 2R93H 2SOBA 5EGTA 1CI3M 2MHVA 4NB3A 5C0XH 3BU2A 5T1IA 1QVCA 3K0YA 2IX1A 4C3IH 2KHSA 3Q6SA 3M9BA 2L9HA 5IYBH 4S3SA 2UUAL 5M5YB 1VQPA 3L0OA 1PTOH 3J80c 1R4PB 4DV4L 2JQOA 3K6OA 5ELOA 2DNEA 4JI6Q 2PNHA 3ND8A 1QOHA 1H9SB 2EYPA 3OWEB 1SE2A 1SNDA 2IT1A 3BYYB 5FO9B 5CV5A 1STAA 4QF4A 1PTOC 4PMWA 1A3UA 1NE3A 1H9SA 3IFTA 2IPKD 5JPNC 4OO1I 2Z4IA 3MXGA 4QQBX 2BA1A 5D65A 1VQAA 3GO5A 5C0XJ 4MNOA 4O42A 1T5XD 4R9WA 4C1NK 5C4JH 4BY7B 3E6ZX 4XDXA 2Z6KA 4DUZQ 3CCLA 3OMCA 2SEBD 1NSNS 1VCIA 2JA5G 3SK4A 1K8AC 1HZ9A 2LXJA 2FFKB 1GD7A 1KNEA 1EYAA 1QG7A 3RLOA 4DR3L 1TKWB 1PRTF 1VDZA 1KDAA 5FJ8H 3GTGB 1X6OA 5E1FA 1MI2A 4HIKA 2XIWA 1N33Q 2N49A 1L0YB 4K5WA 1BOSA 2B29A 4JI2Q 3R2TA 4HCEA 4X3UA 4OONA 3HOYB 5I4DA 1VS0A 4HMIA 5IGDA 5JEAG 2A6ED 2B2UA 1E2WA 1LACA 2L11A 2UUBL 3BZDB 5M5XH 4K0KL 3RN5A 1WOCA 3PIP3 4L5TA 4B9XA 3GTOB 4DR5L 1QCBD 5HGTA 1X9NA 4QUCA 3KLSA 5EBDA 2A19A 3PF5A 2PZUA 4R8IA 1WTHA 4RHRA 1QILA 1YNND 1VQIA 4OGQC 1EQVA 3HOUH 2QEJC 5DLQE 2R7ZH 2LKVA 1TWHH 3DWPA 1LTGD 2WB1G 5GQOA 1EY9A 4P72A 3A54A 2ICIA 5EKLA 4KN7C 1STNA 1XNQQ 1I50H 4TVAB 2O5JC 4DK1A 1A2UA 4KMUC 1WTWA 2E2JB 1EYGA 2RVLA 3KOJA 1N34Q 2OEOA 1KD1C 4WJ3M 2Q2IA 2JA5B 3SR1A 4JBJA 3EROA 4GLVB 4MIUA 3F2CA 4NXNQ 3SE0A 4KY7A 2VQEQ 3OOCA 4GZYC 4IUNA 2KCMA 1Y8NB 1A62A 2YU9B 4EX5A 3ERSX 2A6HC 2D0PA 1QVGA 1ILPA 4DPGA 3E9HA 3I4MG 1JQYD 2EDGA 1TWFH 4IN3A 3J7A5 4A4IA 4TQUS 1KXLA 3WOFA 1HFNA 1I4GA 1SNPA 2OT2A 4P2CB 4Y52H 4Z9CB 2K05A 1X55A 1MSGA 1EY5A 3VR3A 2NN6G 4XT3B 1S5FD 3MHBA 5M3FH 1SNMA 4J15A 1VQ7A 5IT9c 4FVMA 2GN5A 3TRZA 3C2PA 2F0JA 4APVA 3HOWG 2Z6BA 2PI2A 1LTTD 3OPOA 1KLUD 3OTOL 4DV1L 4OIJA 4IUPA 4IFDG 1CHPD 3KLWA 2LS01 1M1KC 2B63G 3H15A 1P16A 2EY2A 2WB1B 1J9OA 1SMYC 1E0BA 2K04A 1BCPF 2F4IA 3CQZB 3HOZH 3I90A 1PLFA 2C5CA 3JAML 3G48A 3GTQH 4AH6A 5KNBA 1T5EA 5IYCG 3K5LA 2BOSA 2K5WA 3OHXC 1X3GA 3IFDA 4LF5Q 5IGFA 3DM3A 1JT8A 4A3JB 4NKLA 3EJIA 3TP6A 1A3TA 1U4PA 2BE5D 2PZTA 3T1YQ 3GD7A 2WIIB 1A15A 5JAVA 1EY0A 5A2QE 4GKKL 1N32Q 1BQQT 2HUGA 1C8CA 2UXBQ 4JI8Q 3M4OH 1L1OA 3PO3H 4YWKA 5IP9H 3V96A 4BY1H 1EZ8A
chains in the Genus database with same CATH topology
2NUCA 2WAQB 5M3MB 3VR4A 4HSPA 1B2TA 1TQOA 1PDQA 3MAQA 4WRDA 3NUCA 2KECA 2F0GA 2BDNA 4RCNA 2B2WC 1F2LA 2A74C 2HCCA 3GTPB 3S1MB 1RTNA 1DZ1A 1JOKA 3BDOA 4X3SA 4XT1B 2F0UA 3PO2B 1F2YA 4WJWA 3HOWB 4J8QA 1AN8A 3SEBA 5F2DA 3MTSA 4KKUA 5D3DA 1SFOB 1O80A 2AQ2B 5EQ0A 5C6AA 3C46A 4OIKA 2FMMA 2JP1A 3RZDB 2JA6B 4DU9A 4DK0A 3Q24A 4XYOA 1DXMA 2IL8A 1JB3A 4IUUA 4BS9A 2V4DA 2QDBA 3CU7A 5LHY1 4KI0A 3J7AF 3PUWA 5IODA 3S2DB 5DM73 4F8MA 5M5WB 1EFID 1QNKA 3H6MA 4K2KA 2WINB 4A3EB 2DY7A 1BCPC 5D3IB 3VR5A 4OO1H 2O5IC 5KYIA 4K5VA 1GHJA 3LWUA 2R61A 4BA2I 1Q3LA 2SDFA 2AWOA 5E3FA 4PMCA 4KY5A 2LFNA 4Q0FA 3R8BA 1TU2B 4RKLA 4IUVA 1S5CD 2Z4HA 4ZRZA 1I4PA 3FKIB 1OXVA 2J7ZA 1YNNC 2FHTA 5FO7B 3BVMA 3EVQA 3M85A 1A6XA 2F0WA 3IKJA 4QMGA 2YYZA 1RCVD 4I65A 3I91A 2EY6A 2K7VA 1WTVA 3H09A 2K03A 4HR7B 2EYHA 5TSSA 4ZKCB 4K14A 4A3BB 4C3JB 1DCZA 1K8OA 1SJED 2JXMB 1DJRD 2MP1A 3HRZC 3SVMA 2K1BA 5CV7A 4DA2A 2Z1CA 4A3DB 1OO9B 1TY0A 3D6CA 3CKIB 3DWAA 1Y8OB 1D5MC 1SNCA 3FPPA 2XVSA 3D4DA 3HEJA 3MEHA 1MBYA 3W2DA 2VXWA 1ET9A 2ZXPA 4Q5VA 3NTHA 5CYUA 1KLGD 4G4KA 5CBEE 5FK9C 1BR9A 1HA5A 4IURA 2IX0A 2RDFA 1CHQD 5I6YA 1GUTA 1PFMA 3GTLB 1AP0A 4FO2A 2L4NA 2PW5A 1VMPA 2OF1A 3KF8A 4IFDI 1H9JA 2BE5C 5KGUA 1ILQA 3S1QB 2GA4B 4A3MB 2L55A 1B53A 4HTHA 4C56C 1TWAB 4RAUC 4WFN3 1NR4A 1E2VA 4KJOA 3PMFA 2RDGA 1TS5A 2RKSA 1NUCA 3HGBA 1XTCD 4HN7A 2E75C 2QF7A 1TY2A 2PCFB 1DYQA 1W6JA 1BO0A 1CA5A 2K5DA 2XNAC 1U4MA 3DMUA 1ESFA 1KTKA 4HAEA 1Y1VB 4N9PA 4ID6A 4F87A 5IGCA 5C4XB 3X3MA 5LL6X 1ET6A 3HOXB 1JE4A 1MD2D 3I8ZA 3J80E 3VA5A 1EU3A 1UNSA 3GTKB 2ZT9C 5CMDA 1B44D 1LV9A 3EA6A 4TKOB 3GQBA 2EYJA 4EGVA 5E4XA 3MXPA 4CGYB 5CBAE 2F0OA 4G7HC 5AFWA 1KAAA 5DEHA 3S16B 2JYOA 1CM9A 4PV1C 1ENCA 2B2UC 2F0PA 4K5XA 1Z47A 4FF2A 1JWMD 1CK1A 1EOTA 5C3EB 2NB0A 4KV6A 2WV6D 4Y7NB 3OIQA 4ZUJA 3DXJC 3GTMB 1DOKA 5K5PA 3C1FA 2N55A 1JWSD 5BN3A 4G7OC 1EYDA 4L6TB 2NTSA 3ONAB 3S14B 4C3HG 2AUJD 3RD4A 1GJXA 4RKBA 4NW2A 2O4XA 3LNNA 2QKIC 1XWEA 2HDMA 4MN3A 4ZLTF 1D1KA 3VR2A 1SEBD 4B9WA 1SNOA 4KHZA 2JA7B 3E5SA 3S15B 2FINB 3CRKC 2XWBB 3RMHA 4A3FB 4B08A 3A7LA 1Y69U 1WTQA 1WTRA 4EVOA 3QJYA 1PZKD 1ENFA 2L1BA 3T16A 3AMUA 3MFYA 5CORA 2KQ3A 2R6GA 5K36H 4XTCS 5CV8A 4ABNA 5NUCA 1EWHA 5G3LF 3HS0C 3Q22A 1D5XC 1EL0A 5DNFA 1FYCA 1PFBA 3VA7A 1HQMC 2TMPA 2KA7A 3OW7A 5HURA 4RGTA 4FXKC 4C3IG 1X3QA 4X3TA 2F3VA 2E76C 5ELBA 5JEAJ 3KUPA 2KCNA 1MSHA 4C3HB 1I6VC 1F77A 1ZYRD 2NBFA 1EY7A 4LMQD 3HZXA 5IT9E 1HCZA 2AQ1B 1EY6A 4FNFA 2CW0D 4HCSA 2NVTB 1RKNA 1RDPD 1XXGA 1IKLA 1X32A 1LTRD 4J1MA 3QIAA 1I4RA 4R8NA 3M7NA 3DEPA 3K5OA 2Q8RE 1ONLA 1Q90A 2EYFA 2NN6H 3P1HA 5EPKA 1LTAD 1HRJA 5J1ZA 4RWSC 3BVGA 1CZWA 1CQFA 2HCIA 4IFDH 3LX0A 1ZEQX 3TBIB 3Q0AA 3QB3A 1O7LA 3TZUA 1II3A 2F0VA 3X3NA 5IGGA 3DUZA 2B2VA 2QCPX 5FOBB 2BDOA 4YIJA 4CKCA 2SNSA 1NCVA 5COYA 4G57A 2KCCA 4IZ8A 2M00A 1I4HA 1WTPA 4FF1A 3ITPA 1TIID 5IOCA 1TS3A 1TT2A 1O7YA 1S5BD 4IFDJ 3NWSA 1GUOA 3MXUA 3TN2A 2F3WA 2DNCA 1EY8A 1LO5D 3K57A 4DGZA 5D14A 1L0XB 5BN4A 3TP8A 3TZDA 1PFNA 4F88A 1AZQA 3P20A 3DWQA 2OXPA 1TS2A 5C4ZA 3H3VC 2RBMA 5A2QL 1TWCB 1G91A 2VNUD 3I4MB 3UI2A 2NVXB 4K2LA 1ICWA 2PYKA 3WDNA 1K8MA 1PZID 3O13A 1CQVA 2PNRC 1SE4A 4RA8A 4FYDA 2B8GA 1JCKB 1B50A 1OXSC 2L12A 3F2UA 3FMCA 2VUMB 2EYMA 4ZKBB 1WTXA 1V43A 1RJTA 3M7GA 2R3ZA 4IUTA 2B63B 2R92B 1J8IA 2VB2X 1SXTA 2PMZB 1G8ZD 3K5NA 2CQAA 2E2DC 2F0SA 3I73A 1FNUA 3NK9A 5EBCA 3MZ5A 2J0TD 1VF7A 2PZWA 1HFGA 4DNTB 4IALA 1QNUA 4XYQA 1DD2A 3G7LA 2KUMA 3FDTA 1I4QA 2FJ2A 5I2YA 1FNVA 2C9OA 2HDLA 5FLXL 1SYCA 4DAYA 2NZ1D 1KABA 1AZPA 3A7AB 3S1RB 2A6EC 3TP7A 1F9RA 2ID0A 1C4QA 3NQIA 3VYUA 2PQEA 1R4QB 5I6WA 2F0DA 2A68D 4HMJA 5EPLA 2EY1A 4I7ZC 1I6HB 1RD9D 1R9TB 4LJZC 2KVMA 3EQLC 1IW7D 3OWFA 3EFXD 2EPBA 4KN4C 2M9VA 2RSNA 3A55A 3KBGA 4EQOA 3J7YW 2PPBC 4KD3A 4JK1C 2D2CC 1VMCA 2LY7A 1G6ZA 5J22A 2F0LA 2K33A 4FF3A 2F0FA 4K6DA 4RCOA 4CJ0B 1IYUA 3NTIA 3BDCA 1U9RA 3CRLC 4C1NI 1H9MA 3PUVA 4OL7A 2B2TA 1STYA 3RLFA 2KJXA 3U9OA 1EEFD 4TSSA 1PTOD 1OXXK 2N88A 3S17B 2F0NA 1Q1EA 3K5MA 2E2HB 3FPUB 3K58A 3GTJB 4ODGA 5JPMC 2IX3A 1WD0A 4X3KA 4A3GB 1KDCA 1PYWD 2XRQD 1B9NA 3HG9A 2JSOA 5T1GA 3OMGA 2H4OA 2CVRA 3AU7A 4M8AA 3D6WA 1YNJD 5DM63 2JA8B 1RODA 1U4RA 1DONA 1RTOA 2L0CA 2MGSA 4H0LC 4KKTA 1XYIA 1LT5D 4KHVA 1A2TA 2EE1A 5JOBA 2VB3X 1I3QB 5CR3A 2K6AA 3NQTA 1BF4A 2K28A 1IL8A 4O1NA 3VYTA 1JC7A 1JOQA 4NDXA 2B2YA 1EZ6A 3NXWA 1WVLA 4FXDA 1EU4A 1SYBA 1ZKOA 2NTTA 3S1NB 3NBIA 3TP5A 1GOZA 3T51B 3ZYYX 4PNYA 4ZQ3A 1SYGA 5JVG3 4H13C 3D8GA 3I3CA 1FGBD 3W3AA 1STBA 3H0GB 3MVVA 1TWGB 2B39A 5KYLA 5C44B 4QCLA 3L7ZC 3BYTB 3PUXA 3J80L 4M1UB 1LTBD 5M9OA 1GUSA 3K59A 1SYEA 4HSVA 1SSOA 3K7AB 4FXGC 5BN5A 3I4NB 3R3OA 2MJ8A 3P7JA 5CC4A 1ML0D 2X69A 2HQEA 3VYSA 3BS1A 1OXUA 1PRTD 1V8QA 4DXGA 1EQTA 1C48A 2EZVA 2D9UA 2F1MA 4RGMA 5CV4A 5KEEA 5ELCA 1DOMA 1VF5C 1FD7D 1GUNA 1SE3A 2A68C 4L8JA 1H9KA 4CJ1B 2EYLA 2JEAI 3WOEA 3J7AV 3OSOA 3J81E 1CZGA 1IW7C 4IUQA 1BXTA 1XX8A 1IKMA 4BWGB 1JWUD 4JBWA 1LABA 4CKBA 4ZYSA 5KRUA 2XSCA 2X6GA 3M4YA 5C3WA 3HOVB 1S4ZA 4FP5D 4MHEA 1UEAB 3URYA 1MGSA 1PZJD 2A73B 2DN8A 5JEAH 5KNCA 1A3VA 4ILWA 4BBSB 2B2VC 1BNZA 2XWJB 4KKSA 5EJWA 1STHA 1EEID 1OXTA 1W6KA 2A69D 2WKCA 5C0XG 1LTSD 1HPCA 5JVH3 1FR3A 2XN9C 3ERQA 1HXYD 4NP5A 1STEA 2QILA 4XQNA 1B3AA 1EYCA 3A8JE 3QOLA 3U9SA 1GXDC 4V0BA 3RUZA 4DAVA 1LT6D 5J39A 3SK8A 1BDOA 2EXZA 2RDHA 3I4LA 2RQXA 2G9HD 1YNJC 5IT9L 1BBXC 2EJFC 1BCPD 1H9RA 1PMRA 1AFPA 4K8IA 3BG3A 4KTAA 2EY5A 2EJMA 1WCMB 2O2LD 2BCOA 2NVYB 4ZAIA 4L63B 5K36G 3QG1A 3VYRA 5I2XA 5C5LA 3V2TA 1RF2D 5ELEA 3MC0B 3M3YB 2ZXOA 3C1EA 1QWYA 2R93B 3T56B 1V1PB 1B4OA 4C3IB 2NYZD 1F9SA 3H91A 1PTOB 4J6HA 1V1PA 3H94A 3DEOA 4ZUIA 1X3PA 2ZXRA 3GP7A 3N52A 1GUGA 3IAYA 1AW7A 2F0KA 5EKKA 4K6LA 1O7ZA 3S9WA 4U673 4ULLA 5C4JB 3DM1A 1FNWA 4XQJA 4PQXA 1V1OA 5A35A 1F9PA 3FRPB 1SAPA 1B9MA 2IW3A 4QB4A 2XRSD 1EY4A 1DOLA 1PRTC 2AQ3B 2LMCB 1HUNA 1IHZA 4OHJA 3JAME 3KBXA 5JJZA 2G9DA 3D31A 5M5XB 1IYVA 5LL6S 4DFAA 1Y8PB 3I70A 1STGA 3SXHA 3ND9A 1NR2A 3HOUB 2R7ZB 3GV3A 1B1ZA 1TWHB 4NMZA 1LT3D 3MA2B 4ME5A 2IWHA 1I50B 2FMCA 3A8IE 3R2IA 3NWTA 4LK1C 1ZXTA 3C3LA 3R93A 2PW7A 2H1EA 3T13A 1Q8IA 3NHHA 2I07B 3SK5A 5C3XA 1WD1A 1HA6A 2F03A 3BVZA 2B2TC 1WTOA 5ISRA 3L3OC 3GV6A 4LAAA 4DXFA 3E0JA 2WKDA 1TWFB 2D5DA 2EVBA 5CV9A 3IL8A 2F0TA 1QJOA 2A69C 2B8FA 1D1IA 5M3FB 3TMEA 1PRTB 3HKZB 1D2BA 1AEXA 2JE6I 1QB5D 4DNRB 1Z6HA 2K32A 2WACA 1EIGA 4KJNA 4KY6A 5FKAC 1ZYRC 2EYOA 4F7XA 5FLXE 5C0XI 3DHQA 3VR6A 2M2LA 3HOZB 5EKIA 5IGBA 3GTQB 3T53B 3A56A 4V190 2PO4A 1JOOA 2L5TA 1Q1BA 2ENBA 2CW0C 5I9OA 2DY8A 4BA1I 4AYBB 4KK7A 3PIO3 1Q12A 4N9TA 4C3JG 2Q8IB 2EJGC 3KLSX 5CGKA 1D5ZC 3KLRA 4DN4M 4XQQA 1HTPA 2F0QA 1F9QA 2AWNA 1JORA 2I46A 3AB9A 1JICA 5E4WC 4U68A 1EIHA 3M4OB 1I4XA 4EQNA 3PO3B 2RA4A 4DAPA 4BY1B 1UAPA 3LWEA 1F2MA 2B2YC 4UDUC 1HHVA 1M8AA 2F0IA 3A8KE 3KK7A 2B2WA 3QOJA 4OO1G 1HTLD 1BUVT 1E2ZA 3PV0A 3QWNA 1G2TA 3NP8A 4RFBA 2NWGA 1PXUA 3NPPA 3MXNA 2Y0SB 2A5HA 4H44C 4XIGS 3TDQA 5EPJA 2BA0A 3G6JB 3TSSA 1NAPA 4CBVA 4A3KB 4RGOS 2NVQB 1DM0B 4KD4A 2Q8TA 4QIWB 1HUMA 3D3RA 5IGEA 4G7ZC 4A93B 3Q23A 1BCPB 1SYFA 2D62A 1KDBA 4XXEA 1SYDA 3FEWX 5C5MA 3SHLA 2NN6I 4RHSA 3HP3A 5IIFA 2F0EA 3MFGA 3CHBD 5C4HA 3NBHA 3NSWA 4UAIA 1SJHD 1M4VA 3NE5B 4E6IA 5FO8B 2IJ0A 3MWYW 1EWCA 1CTMA 1CA6A 1GUWA 4C2MB 1SDFA 1Z7TA 2E74C 2KEDA 2F0MA 4CJ2C 1KNAA 1G291 3QO2A 1SBBB 2AUKA 3OIPA 5KIXA 1CFMA 1Y1WB 3PUZA 4FF4A 2JEBI 2J4XA 3D4WA 1CT1D 3SK6A 1S5DD 2K5QA 4H7BA 3N6RA 1TR5A 1GHKA 2F0HA 3BDLA 2A6HD 1PTOF 2MPMA 2X6LA 4RH6A 4QUFA 2ICEC 5DAUA 3V05A 2KEEA 4K8JA 4EQPA 1SNQA 3P75A 3I72A 1G2SA 1K83B 5ELDA 3FVQA 1D6EC 5ELFA 2CHBD 2E2IB 4DF7A 2TSSA 1RHPA 5G3LD 2Z8LA 4ZK9B 3D4RA 3PUYA 4WORA 2EOTA 1UUPA 1TVXA 4TRDA 1SMYD 2K01A 1LLRD 5I9PA 2RSOA 3L9AX 1HQRD 4HEDA 4CHTB 1QE6A 1F2ZA 4RGNA 4PMBA 2SNMA 1S5ED 4A3IB 4IQZA 1U4LA 3T4AC 4CKEA 3J81L 1O78A 3SDZA 3S2HB 3RZOB 1JR0D 1ENAA 3NTKA 2MUYA 2KOLA 4BBRB 2WP8J 1ESRA 5CV6A 5KNDA 1LT4D 1LTID 1TS4A 2SOBA 5EGTA 1CI3M 2MHVA 5C0XH 5T1IA 3K0YA 2IX1A 2KHSA 3Q6SA 2L9HA 4S3SA 5M5YB 1PTOH 1R4PB 3K6OA 2DNEA 3ND8A 3OWEB 1QOHA 1H9SB 2EYPA 1SE2A 1SNDA 2IT1A 3BYYB 5FO9B 5CV5A 1STAA 4QF4A 1PTOC 4PMWA 1A3UA 1H9SA 3IFTA 2IPKD 5JPNC 4OO1I 2Z4IA 3MXGA 2BA1A 5D65A 3GO5A 5C0XJ 4O42A 1T5XD 4R9WA 4C1NK 4BY7B 3E6ZX 4XDXA 3OMCA 2SEBD 1NSNS 1VCIA 3SK4A 2FFKB 1KNEA 1EYAA 1QG7A 1TKWB 1PRTF 1VDZA 1KDAA 3GTGB 5E1FA 1MI2A 2XIWA 1L0YB 4K5WA 1BOSA 3R2TA 4HCEA 4X3UA 3HOYB 5I4DA 5IGDA 4HMIA 5JEAG 2A6ED 2B2UA 1E2WA 1LACA 2L11A 3BZDB 3PIP3 4B9XA 3GTOB 1QCBD 5HGTA 4QUCA 3KLSA 5EBDA 2PZUA 4R8IA 4RHRA 1QILA 1YNND 4OGQC 1EQVA 2QEJC 2LKVA 3DWPA 1LTGD 1EY9A 3A54A 2ICIA 5EKLA 4KN7C 1STNA 2O5JC 4DK1A 1A2UA 4KMUC 1WTWA 2E2JB 2RVLA 2OEOA 2JA5B 3SR1A 3EROA 4MIUA 3SE0A 4KY7A 3OOCA 4GZYC 4IUNA 1Y8NB 2YU9B 2A6HC 1ILPA 1JQYD 2EDGA 4IN3A 4TQUS 3WOFA 1HFNA 1I4GA 1SNPA 2OT2A 4P2CB 4Z9CB 2K05A 1MSGA 1EY5A 3VR3A 2NN6G 4XT3B 1S5FD 3MHBA 1SNMA 4FVMA 3C2PA 2F0JA 1LTTD 3OPOA 1KLUD 4OIJA 4IUPA 4IFDG 1CHPD 2LS01 2EY2A 2WB1B 1J9OA 1SMYC 1E0BA 2K04A 1BCPF 2F4IA 3CQZB 3I90A 1PLFA 2C5CA 3JAML 5KNBA 1T5EA 3K5LA 2BOSA 2K5WA 3OHXC 3IFDA 5IGFA 4A3JB 3TP6A 4NKLA 3EJIA 1A3TA 1U4PA 2BE5D 2PZTA 3GD7A 2WIIB 1A15A 5JAVA 1EY0A 5A2QE 1BQQT 2HUGA 1C8CA 3V96A 1EZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5Q A;  2K5W A;  3NPP A; 
#chains in the Genus database with same CATH topology
 2NUC A;  2WAQ B;  5M3M B;  3VR4 A;  4HSP A;  4QY7 A;  1B2T A;  1TQO A;  1WI5 A;  1PDQ A;  1MJE A;  3MAQ A;  4WRD A;  3NUC A;  2KEC A;  2NZO A;  2F0G A;  2BDN A;  4RCN A;  2B2W C;  1F2L A;  2A74 C;  2HCC A;  3GTP B;  3S1M B;  4DUZ L;  1RTN A;  4JBK A;  1DZ1 A;  4B3S Q;  1JOK A;  1UE6 A;  4CDE C;  3BDO A;  4X3S A;  4XT1 B;  2UXD Q;  3UE1 A;  2F0U A;  3PO2 B;  1F2Y A;  4WJW A;  5GAE C;  1HZB A;  1K9M C;  3HOW B;  4J8Q A;  4X62 Q;  1AN8 A;  3SEB A;  5F2D A;  3FKI G;  4BXX H;  3MTS A;  4KKU A;  1BBW A;  5D3D A;  1SFO B;  1O80 A;  2AQ2 B;  5EQ0 A;  5C6A A;  3C46 A;  4OIK A;  4A3K H;  4JI2 L;  2FMM A;  4UP8 A;  2JP1 A;  3RZD B;  1X65 A;  2JA6 B;  1LM0 A;  2ZTE A;  4DU9 A;  4DK0 A;  2NVQ H;  5AJ3 Q;  3Q24 A;  4XYO A;  1DXM A;  2IL8 A;  3CCS A;  1JB3 A;  2JK8 A;  1GKH A;  1GM5 A;  3J81 i;  4IUU A;  4BS9 A;  5IWA Q;  2V4D A;  2QDB A;  4DV6 Q;  3CU7 A;  5LHY 1;  4KI0 A;  1XMO Q;  3J7A F;  4A93 H;  3PUW A;  5IOD A;  4DK6 C;  2CCZ A;  4LFB Q;  3S2D B;  3UDX A;  5DM7 3;  4F8M A;  5M5W B;  1EFI D;  1QNK A;  1VQH A;  1YEZ A;  3H6M A;  4K2K A;  2MO1 A;  5IYD H;  3KJO A;  2WIN B;  4A3E B;  2DY7 A;  4DR7 Q;  3RR5 A;  1BCP C;  5D3I B;  3E0E A;  3VR5 A;  1XNQ L;  4A3B G;  4OO1 H;  2O5I C;  1QZG A;  1N34 L;  5KYI A;  2VZA A;  3A5U A;  4K5V A;  1GHJ A;  3LWU A;  2R61 A;  4BA2 I;  1Q3L A;  2SDF A;  2AWO A;  1WFQ A;  5E3F A;  2K50 A;  4PMC A;  4KY5 A;  2LFN A;  2HT1 A;  2VQE L;  4Q0F A;  3R8B A;  1TU2 B;  4RKL A;  4IUV A;  1S5C D;  2Z4H A;  4C2M H;  4ZRZ A;  1CSP A;  1I4P A;  2JJQ A;  3FKI B;  1OXV A;  2J7Z A;  4JI4 Q;  3K8A A;  1YNN C;  2FHT A;  2CH4 A;  5FO7 B;  3TRE A;  5JJI A;  2OWO A;  4DV3 Q;  3BVM A;  3EVQ A;  2VQF L;  1ICF B;  3M85 A;  4RG1 A;  1Y1W H;  1PH6 A;  4OX9 Q;  1A6X A;  2F0W A;  3IKJ A;  4QMG A;  2YYZ A;  1RCV D;  4I65 A;  4LF8 L;  2JA8 G;  4PZ8 A;  3I91 A;  2EY6 A;  2K7V A;  1WTV A;  3H09 A;  2K03 A;  4JYA L;  3J7Z C;  2K4K A;  1Z9F A;  4HR7 B;  2EYH A;  1Q86 C;  5TSS A;  2RHS B;  4A3M G;  4ZKC B;  4HID A;  4K14 A;  4A3B B;  4C3J B;  1BVS A;  3KYH C;  1DCZ A;  1K8O A;  3PIO A;  1K83 H;  1SJE D;  2JXM B;  1DJR D;  2PMZ E;  2MP1 A;  4JG2 A;  4YCW A;  3HRZ C;  3SVM A;  1VQC A;  4LF5 L;  2E2I H;  1I5F A;  1Y14 B;  2K1B A;  5CV7 A;  4DA2 A;  2Z1C A;  5GRO A;  5L37 A;  3KFU A;  4A3D B;  1OO9 B;  3T1Y L;  2R7F A;  1FVI A;  1TY0 A;  1N32 L;  3D6C A;  3CKI B;  3DWA A;  1Y8O B;  1D5M C;  4IOA A;  2UXB L;  1DGS A;  1SNC A;  3FPP A;  4JI8 L;  2XVS A;  3D4D A;  4UHV A;  3HEJ A;  4JV5 Q;  3L2P A;  3MEH A;  1MBY A;  3W2D A;  2VXW A;  1ET9 A;  2ZXP A;  4Q5V A;  2AHO B;  3NTH A;  5CYU A;  1L0W A;  1KLG D;  4G4K A;  5CBE E;  3HKZ E;  1YI2 A;  5C4X G;  3H0G G;  1PHJ A;  5FK9 C;  3KF8 B;  3HOX G;  1BR9 A;  2IHF A;  1HA5 A;  4IUR A;  2IX0 A;  2RDF A;  1CHQ D;  5I6Y A;  1GUT A;  1PFM A;  4A3I H;  4B3S L;  3GTL B;  1AP0 A;  4FO2 A;  2L4N A;  2PW5 A;  4YY3 Q;  2UXD L;  1VMP A;  2OF1 A;  3KF8 A;  4IFD I;  1H9J A;  2BE5 C;  2F4V L;  5KGU A;  3S2H H;  3RZO H;  1ILQ A;  4X62 L;  3TQY A;  4LF7 Q;  1N36 L;  3S1Q B;  2GA4 B;  4BBR H;  4A3M B;  2L55 A;  4LUV A;  3I4N G;  1B53 A;  4HTH A;  4AYB E;  1NTG A;  4C56 C;  1TWA B;  4RAU C;  2UUB Q;  4OEL B;  1VQF A;  4ALP A;  4WFN 3;  1NR4 A;  1E2V A;  4KJO A;  3PMF A;  2RDG A;  1TS5 A;  4DV5 Q;  4GOP B;  5AJ3 L;  4DR5 Q;  2RKS A;  3CC7 A;  1VQL A;  1XPU A;  1NUC A;  3HGB A;  5M5Y H;  1XTC D;  4HN7 A;  2E75 C;  2QF7 A;  1TY2 A;  3UDI A;  5IWA L;  1W3S A;  2PCF B;  4GOP A;  4NXM L;  4DV6 L;  1DYQ A;  4LF4 Q;  2QEX A;  1W6J A;  1BO0 A;  4DUY Q;  2K5D A;  1CA5 A;  2XNA C;  1XJV A;  1U4M A;  3DMU A;  1XMO L;  1ESF A;  1KTK A;  4HAE A;  1XMQ Q;  1Y1V B;  4LFB L;  4N9P A;  1HNZ Q;  4ID6 A;  4F87 A;  5IGC A;  5HY6 A;  5C4X B;  3X3M A;  5LL6 X;  1ET6 A;  3HOX B;  4BY7 H;  1IYJ B;  1JE4 A;  1MD2 D;  3I8Z A;  2N3S A;  2Z6K C;  1HNX Q;  3CC2 A;  3J80 E;  4NPS A;  3VA5 A;  1EU3 A;  1UNS A;  2YTX A;  3GTK B;  2Y0S E;  2ZT9 C;  1Q81 C;  5CMD A;  1B44 D;  5IP7 H;  1VQM A;  1LV9 A;  3EA6 A;  3HOV G;  1EQR A;  4TKO B;  3GQB A;  2EYJ A;  4EGV A;  3GTG H;  5E4X A;  1UWV A;  3MXP A;  4CGY B;  2CH4 W;  5CBA E;  2F0O A;  4G7H C;  2V1C C;  3CCE A;  5AFW A;  2N8N A;  1KAA A;  5DEH A;  3S16 B;  3BZC A;  4HJ9 A;  3HOY H;  2JYO A;  3KF6 B;  4QIW E;  1IBL Q;  1CM9 A;  4PV1 C;  1JJG A;  4DV3 L;  1ENC A;  1AH9 A;  2B2U C;  2F0P A;  4K5X A;  3VDY A;  1Z47 A;  3F2B A;  4OX9 L;  4OWX B;  3KF6 A;  4FF2 A;  1JWM D;  1VQO A;  1CK1 A;  1EOT A;  3GTO H;  5C3E B;  2NB0 A;  3D0F A;  4KV6 A;  2WV6 D;  2PQA B;  3F8T A;  4UPA A;  3OTO Q;  1XPR A;  4Y7N B;  3OIQ A;  4ZUJ A;  1S3O A;  3KJP A;  3DXJ C;  3GTM B;  1DOK A;  2PQA A;  5K5P A;  3C1F A;  2N55 A;  1C7Y A;  1RIP A;  1JWS D;  5BN3 A;  4GKJ Q;  4ZCK A;  4G7O C;  1EYD A;  4L6T B;  1YHB A;  2NTS A;  4WJ4 A;  3DLL A;  3ONA B;  2E2J H;  3S14 B;  1AE2 A;  4C3H G;  2AUJ D;  2JA5 H;  3RD4 A;  4QL5 A;  1KIX A;  2YTV A;  1GJX A;  4RKB A;  4NW2 A;  2O4X A;  3LNN A;  4PG3 A;  2QKI C;  4GKK Q;  1XWE A;  2HDM A;  4MN3 A;  4ZLT F;  1D1K A;  3VR2 A;  1SEB D;  4B9W A;  1SNO A;  4KHZ A;  2JA7 B;  3E5S A;  3S15 B;  2FIN B;  3CRK C;  2YU9 H;  1NJI C;  2AKW B;  2XWB B;  3RMH A;  4JI5 Q;  4A3F B;  4B08 A;  3A7L A;  1Y69 U;  1WTQ A;  1WTR A;  4EVO A;  3QJY A;  4JV5 L;  2ASB A;  3BJU A;  1PZK D;  1ENF A;  2L1B A;  3T16 A;  2N78 A;  3RN2 A;  3AMU A;  3MFY A;  1Q7Y C;  5COR A;  2KQ3 A;  1G6P A;  2R6G A;  3EBE A;  4IPC A;  5K36 H;  2UU9 L;  4XTC S;  5CV8 A;  4ABN A;  5NUC A;  1EWH A;  5G3L F;  3WWV A;  3HS0 C;  1NY4 A;  5FLM H;  3Q22 A;  1D5X C;  2DGY A;  1EL0 A;  5DNF A;  1FYC A;  4YY3 L;  1PFB A;  3VA7 A;  1HQM C;  2TMP A;  5H1S E;  2KA7 A;  3OW7 A;  4RGT A;  5HUR A;  4FXK C;  4LF7 L;  4C3I G;  1X3Q A;  4X3T A;  2F3V A;  2F3I A;  4HIO A;  4R4C A;  3J81 c;  2E76 C;  5ELB A;  5JEA J;  3CQZ H;  3KUP A;  4R4O A;  1JB7 A;  2KCN A;  2VS1 A;  1MSH A;  1I6V C;  4C3H B;  1F77 A;  1ZYR D;  2NBF A;  2CWP A;  4LW1 A;  1EY7 A;  1FGU A;  4LMQ D;  3HZX A;  4DV5 L;  5IT9 E;  4LF6 Q;  1HCZ A;  2AQ1 B;  4A3J H;  2ATW A;  1EY6 A;  4FNF A;  2CW0 D;  1FL0 A;  4HCS A;  2NVT B;  4LFA Q;  1RKN A;  2G5D A;  1RDP D;  1KC8 C;  2GVA A;  4LF4 L;  1YJ9 A;  4DUY L;  1XXG A;  1IKL A;  1X32 A;  1L1O C;  1LTR D;  4J1M A;  3QIA A;  1E22 A;  1I4R A;  5M3M H;  1XMQ L;  4R8N A;  1HNW L;  3M7N A;  2B3G A;  3DEP A;  1HNZ L;  3K5O A;  2Q8R E;  1ONL A;  4AQY Q;  1Q90 A;  5FJ8 G;  2EYF A;  2NN6 H;  3P1H A;  1IL2 A;  4DV7 L;  5EPK A;  3GTP H;  1LTA D;  1HRJ A;  3S1M H;  5J1Z A;  4B3T Q;  4RWS C;  1HNX L;  3BVG A;  1CZW A;  1CQF A;  3PO2 H;  3HOW H;  2HCI A;  4IFD H;  3LX0 A;  1QZH A;  1ZEQ X;  3TBI B;  3RLN A;  3Q0A A;  3QB3 A;  1O7L A;  2EIF A;  3TZU A;  4GLX A;  1II3 A;  3I4O A;  2F0V A;  3X3N A;  1SFO H;  5IGG A;  1X3E A;  3DUZ A;  2VQF Q;  2K5H A;  1KQS A;  2B2V A;  2QCP X;  2Z0S A;  5FOB B;  4A75 A;  3E3X A;  3RZD H;  2JA6 H;  2BDO A;  1IBL L;  4YIJ A;  4CKC A;  3HOU G;  3J81 j;  2SNS A;  1NCV A;  5COY A;  4X66 Q;  4LF8 Q;  2OQK A;  4G57 A;  2KCC A;  3PIP A;  4IZ8 A;  1B8A A;  2M00 A;  1I4H A;  1WTP A;  4FF1 A;  2VUM G;  1C0A A;  3ITP A;  1TII D;  5IOC A;  4JYA Q;  4DR4 Q;  1TS3 A;  1TT2 A;  1O7Y A;  1S5B D;  4IFD J;  3NWS A;  2R92 G;  1GUO A;  3S2D H;  3MXU A;  3TN2 A;  5M5W H;  1AE3 A;  2F3W A;  1XPO A;  1KRS A;  2DNC A;  1EY8 A;  1LO5 D;  4DK3 C;  3K57 A;  4A3E H;  2RHQ B;  4DGZ A;  4GKJ L;  5D14 A;  2CFM A;  3H3V H;  1L0X B;  5BN4 A;  1XNR Q;  3TP8 A;  3TZD A;  1PFN A;  3OW2 A;  3W5O A;  1L1O B;  3M4P A;  4F88 A;  1AZQ A;  3P20 A;  3DWQ A;  2OXP A;  1TS2 A;  5C4Z A;  2K5V A;  3H3V C;  2RBM A;  1VQ5 A;  5A2Q L;  4IO9 A;  1TWC B;  1G91 A;  3LGJ A;  1KHI A;  4B3R Q;  3FP9 A;  4R4Q A;  4X6A H;  1J5E Q;  2VNU D;  3I4M B;  3UI2 A;  3CCR A;  3FKI H;  2NVX B;  4K2L A;  1ICW A;  4JI5 L;  1K3B C;  2PYK A;  3HKZ G;  3WDN A;  1K8M A;  1PZI D;  3O13 A;  1CQV A;  2PNR C;  1SE4 A;  4RA8 A;  3PGZ A;  4FYD A;  2B8G A;  1JCK B;  2HHH Q;  2K75 A;  2A8V A;  4DR2 Q;  1B50 A;  1OXS C;  2L12 A;  1JJC B;  3F2U A;  2CKZ B;  3J80 i;  2F4V Q;  3FMC A;  2VUM B;  2EYM A;  1YBY A;  3HOZ G;  4ZKB B;  1WTX A;  1V43 A;  1N36 Q;  1RJT A;  3HFZ B;  3M7G A;  1PH8 A;  2R3Z A;  2C35 B;  4IUT A;  3A5Z B;  2B63 B;  4AYB G;  4UP7 A;  3CF5 A;  3A74 A;  2R92 B;  1J8I A;  1LYL A;  2VB2 X;  1SXT A;  2PMZ B;  1YVC A;  1G8Z D;  2XGT A;  3K5N A;  2CQA A;  2E2D C;  1M90 C;  2F0S A;  4A3B H;  4B3M Q;  3I73 A;  4C3J H;  3PO3 G;  1FNU A;  3NK9 A;  5EBC A;  3MZ5 A;  5IP9 G;  2J0T D;  3CME A;  1B3Q A;  1VF7 A;  4BY1 G;  4POG A;  2PZW A;  1HFG A;  4DNT B;  4IAL A;  4LF6 L;  4NXM Q;  1QNU A;  4HJ7 A;  2KBN A;  4XYQ A;  3JAM c;  4A3D H;  1DD2 A;  1SR3 A;  2QDL A;  3G7L A;  3PSI A;  4DAY B;  4LFA L;  2KUM A;  3FDT A;  1I4Q A;  2FJ2 A;  1TXY A;  5I2Y A;  1FNV A;  2C9O A;  2HDL A;  5FLX L;  1SYC A;  4DAY A;  3E9I A;  2NZ1 D;  2VL6 A;  1KAB A;  1AZP A;  4JI0 L;  2KEN A;  3A7A B;  3S1R B;  1H95 A;  2A6E C;  3TP7 A;  1HH2 P;  4AQY L;  1VQ6 A;  2Y0S G;  1F9R A;  1MKH A;  3U50 C;  1B7Y B;  2ID0 A;  1C4Q A;  2ALY B;  3NQI A;  4GLA C;  3VYU A;  4B3T L;  1UEB A;  3GTL H;  2PQE A;  4A3K G;  1R4Q B;  2F0D A;  5I6W A;  2A68 D;  4HMJ A;  5EPL A;  4N8F A;  2EY1 A;  4I7Z C;  1I6H B;  1RD9 D;  2WB1 E;  1R9T B;  4MZ9 A;  4LJZ C;  2KVM A;  3EQL C;  3S1Q H;  1IW7 D;  3OWF A;  3EFX D;  2EPB A;  4KN4 C;  2M9V A;  4A3G G;  4A3M H;  2RSN A;  2QGQ A;  1KAW A;  1JE5 A;  2CQO A;  3A55 A;  1TWA H;  3KBG A;  3AYH B;  4EQO A;  1U5K A;  2JN4 A;  3J7Y W;  4A93 G;  2PPB C;  4KD3 A;  4JK1 C;  2D2C C;  3TS0 A;  1EQQ A;  4X66 L;  1VMC A;  5IYD G;  2LY7 A;  1G6Z A;  1WYD A;  4YWM A;  1VQE A;  3PF4 A;  1B70 B;  1ASZ A;  5J22 A;  2RCN A;  2F0L A;  4DR4 L;  2K33 A;  2WAQ E;  2F0F A;  4K6D A;  4RCO A;  3IRB A;  4CJ0 B;  2VY3 A;  4PZ6 A;  4GOP C;  4FF3 A;  1IYU A;  3NTI A;  3BDC A;  4IJL A;  1U9R A;  3NEL A;  3CRL C;  4C1N I;  1H9M A;  1Y1V H;  3PUV A;  4OL7 A;  1W2B A;  2B2T A;  1STY A;  3RLF A;  2KJX A;  1PH5 A;  3U9O A;  1EEF D;  4TSS A;  5GAD C;  5C4X H;  1PTO D;  2ZTD A;  1OXX K;  1YIJ A;  2K52 A;  3HOX H;  2N88 A;  3S17 B;  2F0N A;  1Q1E A;  1XNR L;  3K5M A;  2E2H B;  1U0L A;  3FPU B;  3GTK H;  1QVF A;  3K58 A;  3GTJ B;  1NNX A;  4ODG A;  1VQD A;  4YWL A;  4O2D A;  5JPM C;  2IX3 A;  4B3R L;  1WD0 A;  4X3K A;  1J5E L;  2E5L Q;  4A3G B;  1KDC A;  1PYW D;  2XRQ D;  1B9N A;  3HG9 A;  2JSO A;  5T1G A;  3OMG A;  2H4O A;  3S16 H;  4A3C H;  2CVR A;  3AU7 A;  4M8A A;  3D6W A;  4JI7 L;  1YNJ D;  2UU9 Q;  5C44 G;  4A76 A;  5DM6 3;  2HHH L;  2HQL A;  5EAY A;  2JA8 B;  1ROD A;  1SRO A;  4DR2 L;  1U4R A;  1VQK A;  1DON A;  1RTO A;  1EFW A;  3OYY A;  2L0C A;  4AIM A;  2MGS A;  5C3E H;  4H0L C;  2UUC Q;  3CCJ A;  1VQB A;  4KKT A;  1XYI A;  1LT5 D;  2GVB A;  4Y7N H;  4KHV A;  3GTM H;  1A2T A;  2EE1 A;  5JOB A;  2VB3 X;  1I3Q B;  5CR3 A;  2K6A A;  4P71 A;  3NQT A;  1BF4 A;  2K28 A;  1IL8 A;  1L2F A;  4YHH Q;  4O1N A;  1P8L A;  1BKB A;  2HIX A;  3VYT A;  1JC7 A;  1JOQ A;  4NDX A;  2B2Y A;  1UE7 A;  4GN5 A;  3S14 H;  4B3M L;  1E7Z A;  1S72 A;  2ZJP A;  2ZJQ A;  1EZ6 A;  2VW9 A;  3NXW A;  3TEH B;  1WVL A;  4FXD A;  1EU4 A;  1SYB A;  1ZKO A;  2NTT A;  3S1N B;  3NBI A;  3TP5 A;  2R7D A;  1A63 A;  2JA7 H;  1GOZ A;  3S15 H;  3T51 B;  1IBM L;  3ZYY X;  4PNY A;  4ZQ3 A;  1HNW Q;  2AMC B;  1SYG A;  4A3F H;  5JVG 3;  1VQ4 A;  4H13 C;  2MO0 A;  3D8G A;  5JJL A;  3I3C A;  1FGB D;  3W3A A;  1STB A;  3H0G B;  3MVV A;  2OTL A;  1TWG B;  4DV7 Q;  2B39 A;  5KYL A;  4A3L G;  5C44 B;  4QCL A;  1EOV A;  3ICE A;  4BBR G;  3L7Z C;  4GN3 B;  3BYT B;  3PUX A;  3J80 L;  4M1U B;  1LTB D;  3NEN A;  5M9O A;  1GUS A;  3K59 A;  1SYE A;  2IY5 B;  4HSV A;  1A0I A;  1SSO A;  3K7A B;  4FXG C;  5BN5 A;  3I4N B;  1BBU A;  3R3O A;  2MJ8 A;  3P7J A;  5CC4 A;  1V9P A;  2I5L X;  2UXC Q;  1ML0 D;  2X69 A;  2DUD A;  3K80 C;  2HQE A;  3VYS A;  3BS1 A;  1CKO A;  1OXU A;  1PRT D;  1V8Q A;  4DXG A;  1EQT A;  4C3H H;  4BBS G;  1C48 A;  3CMA A;  1IZ6 A;  2EZV A;  2D9U A;  2F1M A;  4LUO A;  4RGM A;  2H5X A;  5CV4 A;  5KEE A;  5ELC A;  1YNX A;  2RF4 A;  1G51 A;  2NVT H;  4DKA C;  1DOM A;  2YV5 A;  1VF5 C;  1FD7 D;  1GUN A;  4GNX B;  1PH4 A;  1SE3 A;  2A68 C;  4L8J A;  3K0X A;  1H9K A;  4CJ1 B;  2EYL A;  2JEA I;  3WOE A;  3J7A V;  3OSO A;  3J81 E;  2NVY H;  1N9W A;  4GNX A;  1CZG A;  1IW7 C;  4DAM A;  3S24 A;  4IUQ A;  4DR6 Q;  1BXT A;  2ZM6 Q;  1XX8 A;  1IKM A;  3ER0 A;  3W1G A;  4FDB A;  4BWG B;  1ASY A;  1JWU D;  4JBW A;  4CDF C;  1LAB A;  4CKB A;  4ZYS A;  4P75 A;  1PH1 A;  2RCF A;  5IY0 A;  2DJG C;  5KRU A;  1GO3 E;  2XSC A;  2X6G A;  3HOY G;  3M4Y A;  5C3W A;  3HOV B;  4L5R C;  1S4Z A;  4FP5 D;  1C9O A;  1CSQ A;  4KHP Q;  1WCM G;  2Q2H A;  4MHE A;  4EQ5 A;  1UEA B;  3URY A;  1MGS A;  2E5L L;  3F2D A;  1PZJ D;  2A73 B;  2DN8 A;  5JEA H;  4O0A A;  5KNC A;  4JW0 A;  1A3V A;  4ILW A;  4BBS B;  2P5Z X;  2B2V C;  1BNZ A;  1K0R A;  1D8L A;  2XWJ B;  4KKS A;  5EJW A;  1STH A;  5LMN Q;  2QA4 A;  3I2Z A;  4LFC Q;  1EEI D;  1OXT A;  1W6K A;  2R93 G;  2A69 D;  2WKC A;  5C0X G;  1LTL A;  2UUC L;  1LTS D;  2OTJ A;  1HPC A;  5JVH 3;  1FR3 A;  1VQ8 A;  2XN9 C;  3ERQ A;  1HXY D;  4NP5 A;  4IPG A;  1STE A;  1VQG A;  5IYB G;  2QIL A;  4XQN A;  1B3A A;  4QGU A;  1EYC A;  3A8J E;  2MNA A;  3QOL A;  3U9S A;  1GXD C;  4V0B A;  3RUZ A;  4DAV A;  2LXK A;  1LT6 D;  4YHH L;  5J39 A;  1K8G A;  2ES2 A;  3SK8 A;  1BDO A;  4X64 Q;  1IXR A;  2EXZ A;  2RDH A;  4DV2 Q;  3I4L A;  3I56 A;  2RQX A;  2G9H D;  3U4V A;  1YNJ C;  5IT9 L;  5J3B A;  1BBX C;  2EJF C;  4IOC A;  1BCP D;  4DV0 Q;  1K3R A;  3I7F A;  1H9R A;  1PMR A;  1I94 Q;  4K8I A;  1AFP A;  4JOI A;  3BG3 A;  4P73 A;  4KTA A;  4X65 Q;  2EY5 A;  1CUK A;  2EJM A;  1WCM B;  1TWC H;  4LF9 Q;  2Q2T A;  2O2L D;  2BCO A;  2MFI A;  3MEF A;  3I4M H;  4KLK A;  3U58 A;  2NVY B;  3EN2 A;  4ZAI A;  2NVX H;  4L63 B;  5K36 G;  3QG1 A;  3VYR A;  3EIV A;  5I2X A;  5C5L A;  1JJ2 A;  4JI0 Q;  1NBW A;  3V2T A;  1GVP A;  5FLM G;  3G71 A;  1RF2 D;  5ELE A;  4UP9 A;  3MC0 B;  4JC0 A;  3M3Y B;  1HZA A;  2ZXO A;  4R1J A;  1SRU A;  3C1E A;  1J6Q A;  3AEV A;  1QWY A;  2R93 B;  2D0O A;  4R4T A;  1YHA A;  3NEM A;  3T56 B;  1YJN A;  2VUM H;  1V1P B;  3KDF B;  1B4O A;  4C3I B;  2NYZ D;  1PH2 A;  1F9S A;  3H91 A;  1YHQ A;  2B63 H;  2R92 H;  1PTO B;  4J6H A;  1V1P A;  3H94 A;  3KDF A;  3CD6 A;  1YIT A;  3DEO A;  4ZUI A;  4A3J G;  2UXC L;  1X3P A;  3GP7 A;  2ZXR A;  3N52 A;  1FJG Q;  5IYC H;  4CDC C;  2R7Z G;  1GUG A;  3IAY A;  1D7Q A;  1T9H A;  1AW7 A;  2F0K A;  2WAQ G;  5M3M G;  5EKK A;  4K6L A;  5HGQ A;  1O7Z A;  3S9W A;  4U67 3;  4ULL A;  5C4J B;  3DM1 A;  4GS3 A;  1FNW A;  4XQJ A;  4PQX A;  4HJ8 A;  1V1O A;  5A35 A;  2EQS A;  1F9P A;  3FRP B;  1SAP A;  1B9M A;  2IW3 A;  1K28 A;  3PO2 G;  4QB4 A;  2XRS D;  3K81 C;  3G4S A;  1QUQ B;  4DR6 L;  1O7I A;  2ZM6 L;  4JI3 Q;  1EY4 A;  1DOL A;  3S1R H;  1JMC A;  2K5N A;  1PRT C;  2HIV A;  2AQ3 B;  2LMC B;  1QUQ A;  1HUN A;  4H02 A;  1VQN A;  1IHZ A;  4OHJ A;  3JAM E;  1E1T A;  1HR0 Q;  1UE1 A;  4HIM A;  1KL9 A;  3KBX A;  5JJZ A;  2G9D A;  3D31 A;  5M5X B;  2JA6 G;  1PVO A;  1IYV A;  1I6H H;  5LL6 S;  4DFA A;  5M3F G;  4KHP L;  4OXP A;  1Y8P B;  1R9T H;  3I70 A;  1STG A;  3PQI A;  3SXH A;  3W1B A;  4OEM B;  1XTD A;  5GAG C;  1X3F A;  5GAH C;  1SLJ A;  3ND9 A;  4JI7 Q;  2YTY A;  4JI6 L;  3SGI A;  1NR2 A;  1SN8 A;  3HOU B;  2R7Z B;  3GV3 A;  1B1Z A;  3ULJ A;  1TWH B;  4NMZ A;  2Q2U A;  1LT3 D;  3MA2 B;  1A8V A;  4JI1 Q;  5LMN L;  4ME5 A;  4LNQ A;  4LFC L;  2IWH A;  1I50 B;  2FMC A;  3A8I E;  3R2I A;  3NWT A;  4A3E G;  1PA6 A;  4LK1 C;  1CKM A;  2I5H A;  1ZXT A;  3C3L A;  3R93 A;  2PW7 A;  2H1E A;  3T13 A;  1Q8I A;  1PH3 A;  3NHH A;  5LMU Q;  4JCV E;  3ULL A;  2I07 B;  2L15 A;  3TS2 A;  1PYB A;  3SK5 A;  5C3X A;  1WD1 A;  1HA6 A;  2F03 A;  3BVZ A;  2IHE A;  1PV4 A;  2ZJR A;  2B2T C;  3CCU A;  1WTO A;  5ISR A;  3L3O C;  2KHI A;  3GV6 A;  4LAA A;  4DXF A;  3E0J A;  2WKD A;  4X64 L;  1TWF B;  2D5D A;  2EVB A;  5CV9 A;  4N8X 1;  3STB D;  3RNU A;  3S17 H;  4DV2 L;  2EXD A;  2E2H H;  3IL8 A;  1N33 L;  2DJF C;  2F0T A;  4DV0 L;  1I94 L;  3GTJ H;  1QJO A;  1IBM Q;  2A69 C;  2B8F A;  1D1I A;  4X65 L;  5M3F B;  2QW7 A;  1PFS A;  1EIF A;  3TME A;  4LF9 L;  1PRT B;  3HKZ B;  1D2B A;  4A3G H;  1AEX A;  4QJF A;  2JE6 I;  1QB5 D;  4DNR B;  1Z6H A;  3T1H Q;  2K32 A;  3UE0 A;  2WAC A;  1EIG A;  3JC6 6;  4KJN A;  2PI2 E;  4KY6 A;  1IBK Q;  1UE5 A;  5FKA C;  4IJH A;  5LMN W;  1VQJ A;  1ZYR C;  1SE8 A;  2EYO A;  4BXX G;  4F7X A;  2I0Q A;  5FLX E;  5C0X I;  3DHQ A;  3VR6 A;  2MQH A;  5BR8 Q;  2JA8 H;  2M2L A;  3HOZ B;  5EKI A;  1Q8K A;  2OQ0 A;  4P74 A;  5IGB A;  3GTQ B;  3T53 B;  3A56 A;  4CDD C;  4V19 0;  2PO4 A;  1JOO A;  2L5T A;  1Q1B A;  2ENB A;  2CW0 C;  5JJK A;  2KHJ A;  5I9O A;  2DY8 A;  4BA1 I;  4AYB B;  4KK7 A;  3PIO 3;  1Q12 A;  4N9T A;  4C3J G;  2Q8I B;  1Q82 C;  4LWC A;  2EJG C;  2A1A A;  3KLS X;  5CGK A;  1D5Z C;  3KLR A;  4DN4 M;  4XQQ A;  1HTP A;  2F0Q A;  1EUJ A;  1F9Q A;  1HZC A;  2AWN A;  1I3Q H;  4NXN L;  1JOR A;  2I46 A;  3AB9 A;  1JIC A;  2BH2 A;  3CC4 A;  5E4W C;  4A3D G;  4U68 A;  1EIH A;  3M4O B;  1I4X A;  4EQN A;  3PO3 B;  1FJG L;  2RA4 A;  4DAP A;  4BY1 B;  1UAP A;  3LWE A;  1F2M A;  2B2Y C;  3FHW A;  4UDU C;  1HHV A;  1PH9 A;  1M8A A;  3CPW A;  2F0I A;  3A8K E;  3KK7 A;  2B2W A;  3S1N H;  1WJJ A;  3QOJ A;  3F1Z A;  4OO1 G;  1HTL D;  1BUV T;  1E2Z A;  3PV0 A;  3QWN A;  3Q8D A;  1G2T A;  4LUZ A;  1X56 A;  3MXN B;  2CWA A;  3NP8 A;  1YZ6 A;  4RFB A;  3CP0 A;  2NWG A;  1PXU A;  3CCQ A;  3NPP A;  3MXN A;  3BZK A;  1N8R C;  2Y0S B;  2A5H A;  4H44 C;  2BH8 A;  3H0G H;  4XIG S;  2BA0 A;  3G6J B;  5EPJ A;  1TWG H;  3TDQ A;  3CAM A;  4JI3 L;  5C44 H;  1X54 A;  3A0J A;  4JPB W;  4POF A;  3TSS A;  5FLX c;  4DR1 Q;  1NAP A;  4CBV A;  4A3K B;  4MTK A;  4RGO S;  4JVZ A;  2LSS A;  4ME3 A;  1HR0 L;  2NVQ B;  1DM0 B;  4KD4 A;  1Y1W G;  1MJC A;  2Q8T A;  2WFW A;  4QIW B;  1HUM A;  2UUA Q;  2FXQ A;  4DV4 Q;  3G6E A;  3K7A H;  3I4N H;  1LUZ A;  3D3R A;  5IGE A;  2KCT A;  4G7Z C;  3AQQ A;  1S40 A;  4A93 B;  4IPD A;  1BCP B;  3Q23 A;  1OTC A;  4L5Q A;  1SYF A;  2D62 A;  3UDF A;  1KDB A;  4XXE A;  1SYD A;  3FEW X;  5C5M A;  1MHW C;  3B6Y A;  3UDG A;  3SHL A;  1Y1V G;  3NBH B;  4JI1 L;  2NN6 I;  4HJ5 A;  4RHS A;  3HP3 A;  5IIF A;  1PH7 A;  2F0E A;  3MFG A;  3CHB D;  5C4H A;  4L5S A;  3NBH A;  3NSW A;  4UAI A;  1YJW A;  1SJH D;  3HKS A;  1M4V A;  3NE5 B;  4E6I A;  5FO8 B;  3U4Z A;  2IJ0 A;  4YCU A;  3AFQ A;  4DR3 Q;  3MWY W;  2F52 A;  1EWC A;  1CTM A;  2Z9H A;  5LMU L;  1CA6 A;  1GUW A;  4C2M B;  3GDE A;  4GNX C;  1SDF A;  2OCE A;  1Z7T A;  2E74 C;  4A3L H;  2KED A;  3CCM A;  2F0M A;  4CJ2 C;  5IE8 A;  1KNA A;  2E8G A;  1G29 1;  3QO2 A;  1SBB B;  2AUK A;  1E24 A;  3OIP A;  1HR0 W;  3AFP A;  5KIX A;  3I55 A;  1CFM A;  4A3C G;  1Y1W B;  4OWW B;  3PUZ A;  4K0K Q;  4R4I A;  3HOV H;  4FF4 A;  2JEB I;  2J4X A;  2NZH A;  3D4W A;  1K0S A;  1CT1 D;  3SK6 A;  4A3I G;  4UY8 C;  1S5D D;  2K5Q A;  4H7B A;  3N6R A;  5C3E G;  1TR5 A;  1GHK A;  1SMX A;  2F0H A;  3BDL A;  2I5M X;  2A6H D;  1EIY B;  3T1H L;  1VQ9 A;  1PTO F;  2MPM A;  2X6L A;  4RH6 A;  4BBS H;  1IBK L;  4QUF A;  1HJP A;  1EWI A;  2ICE C;  5DAU A;  3V05 A;  4MTN A;  3CPF A;  2KEE A;  3STB C;  3H3V I;  4K8J A;  4EQP A;  5BR8 L;  3JAM i;  1SNQ A;  4DR7 L;  3CXC A;  2ZTC A;  3P75 A;  3I72 A;  4GN4 B;  1G2S A;  1K83 B;  4HJA A;  5ELD A;  1RL2 A;  3FVQ A;  1D6E C;  5ELF A;  2CHB D;  2E2I B;  4IPH A;  4DF7 A;  2K14 A;  2TSS A;  1RHP A;  5G3L D;  2Z8L A;  5E7N A;  3PCO B;  4ZK9 B;  3D4R A;  4JBM A;  3PUY A;  4WOR A;  2EOT A;  1UUP A;  2JA7 G;  1TVX A;  1V1Q A;  1SMY D;  4TRD A;  4I7A A;  2K01 A;  1NMG A;  1LLR D;  5I9P A;  1Q46 A;  2RSO A;  4A3F G;  4JI4 L;  4DNI A;  3L9A X;  4OWT B;  1HQR D;  1PYS B;  4HED A;  4CHT B;  1QE6 A;  1F2Z A;  4RGN A;  4PMB A;  2SNM A;  1S5E D;  1WCM H;  4BY7 G;  4JOI C;  1NMF A;  1MIU A;  4YCV A;  3CCV A;  4A3I B;  4IQZ A;  1U4L A;  1E3P A;  2HD3 A;  3T4A C;  4CKE A;  3J81 L;  1E1O A;  1K73 C;  3QR8 A;  1O78 A;  3SDZ A;  1KRT A;  3S2H B;  5ELN A;  3M4Q A;  4RMF A;  3RZO B;  1JR0 D;  5IP7 G;  1ENA A;  3NTK A;  4DV1 Q;  3ULP A;  3CW2 C;  2MUY A;  1CKN B;  3ZJY C;  2JA9 A;  2KOL A;  4BBR B;  2WP8 J;  1ESR A;  3K7U C;  5CV6 A;  4PZ7 A;  1LT4 D;  5KND A;  1LTI D;  3M3Y H;  1TS4 A;  4DR1 L;  1CKN A;  2XTI A;  2R93 H;  2SOB A;  5EGT A;  1CI3 M;  2MHV A;  4NB3 A;  5C0X H;  3BU2 A;  5T1I A;  1QVC A;  3K0Y A;  2IX1 A;  4C3I H;  2KHS A;  3Q6S A;  3M9B A;  2L9H A;  5IYB H;  4S3S A;  2UUA L;  5M5Y B;  1VQP A;  3L0O A;  1PTO H;  3J80 c;  1R4P B;  4DV4 L;  2JQO A;  3K6O A;  5ELO A;  2DNE A;  4JI6 Q;  2PNH A;  3ND8 A;  1QOH A;  1H9S B;  2EYP A;  3OWE B;  1SE2 A;  1SND A;  2IT1 A;  3BYY B;  5FO9 B;  5CV5 A;  1STA A;  4QF4 A;  1PTO C;  4PMW A;  1A3U A;  1NE3 A;  1H9S A;  3IFT A;  2IPK D;  5JPN C;  4OO1 I;  2Z4I A;  3MXG A;  4QQB X;  2BA1 A;  5D65 A;  1VQA A;  3GO5 A;  5C0X J;  4MNO A;  4O42 A;  1T5X D;  4R9W A;  4C1N K;  5C4J H;  4BY7 B;  3E6Z X;  4XDX A;  2Z6K A;  4DUZ Q;  3CCL A;  3OMC A;  2SEB D;  1NSN S;  1VCI A;  2JA5 G;  3SK4 A;  1K8A C;  1HZ9 A;  2LXJ A;  2FFK B;  1GD7 A;  1KNE A;  1EYA A;  1QG7 A;  3RLO A;  4DR3 L;  1TKW B;  1PRT F;  1VDZ A;  1KDA A;  5FJ8 H;  3GTG B;  1X6O A;  5E1F A;  1MI2 A;  4HIK A;  2XIW A;  1N33 Q;  2N49 A;  1L0Y B;  4K5W A;  1BOS A;  2B29 A;  4JI2 Q;  3R2T A;  4HCE A;  4X3U A;  4OON A;  3HOY B;  5I4D A;  1VS0 A;  4HMI A;  5IGD A;  5JEA G;  2A6E D;  2B2U A;  1E2W A;  1LAC A;  2L11 A;  2UUB L;  3BZD B;  5M5X H;  4K0K L;  3RN5 A;  1WOC A;  3PIP 3;  4L5T A;  4B9X A;  3GTO B;  4DR5 L;  1QCB D;  5HGT A;  1X9N A;  4QUC A;  3KLS A;  5EBD A;  2A19 A;  3PF5 A;  2PZU A;  4R8I A;  1WTH A;  4RHR A;  1QIL A;  1YNN D;  1VQI A;  4OGQ C;  1EQV A;  3HOU H;  2QEJ C;  5DLQ E;  2R7Z H;  2LKV A;  1TWH H;  3DWP A;  1LTG D;  2WB1 G;  5GQO A;  1EY9 A;  4P72 A;  3A54 A;  2ICI A;  5EKL A;  4KN7 C;  1STN A;  1XNQ Q;  1I50 H;  4TVA B;  2O5J C;  4DK1 A;  1A2U A;  4KMU C;  1WTW A;  2E2J B;  1EYG A;  2RVL A;  3KOJ A;  1N34 Q;  2OEO A;  1KD1 C;  4WJ3 M;  2Q2I A;  2JA5 B;  3SR1 A;  4JBJ A;  3ERO A;  4GLV B;  4MIU A;  3F2C A;  4NXN Q;  3SE0 A;  4KY7 A;  2VQE Q;  3OOC A;  4GZY C;  4IUN A;  2KCM A;  1Y8N B;  1A62 A;  2YU9 B;  4EX5 A;  3ERS X;  2A6H C;  2D0P A;  1QVG A;  1ILP A;  4DPG A;  3E9H A;  3I4M G;  1JQY D;  2EDG A;  1TWF H;  4IN3 A;  3J7A 5;  4A4I A;  4TQU S;  1KXL A;  3WOF A;  1HFN A;  1I4G A;  1SNP A;  2OT2 A;  4P2C B;  4Y52 H;  4Z9C B;  2K05 A;  1X55 A;  1MSG A;  1EY5 A;  3VR3 A;  2NN6 G;  4XT3 B;  1S5F D;  3MHB A;  5M3F H;  1SNM A;  4J15 A;  1VQ7 A;  5IT9 c;  4FVM A;  2GN5 A;  3TRZ A;  3C2P A;  2F0J A;  4APV A;  3HOW G;  2Z6B A;  2PI2 A;  1LTT D;  3OPO A;  1KLU D;  3OTO L;  4DV1 L;  4OIJ A;  4IUP A;  4IFD G;  1CHP D;  3KLW A;  2LS0 1;  1M1K C;  2B63 G;  3H15 A;  1P16 A;  2EY2 A;  2WB1 B;  1J9O A;  1SMY C;  1E0B A;  2K04 A;  1BCP F;  2F4I A;  3CQZ B;  3HOZ H;  3I90 A;  1PLF A;  2C5C A;  3JAM L;  3G48 A;  3GTQ H;  4AH6 A;  5KNB A;  1T5E A;  5IYC G;  3K5L A;  2BOS A;  2K5W A;  3OHX C;  1X3G A;  3IFD A;  4LF5 Q;  5IGF A;  3DM3 A;  1JT8 A;  4A3J B;  4NKL A;  3EJI A;  3TP6 A;  1A3T A;  1U4P A;  2BE5 D;  2PZT A;  3T1Y Q;  3GD7 A;  2WII B;  1A15 A;  5JAV A;  1EY0 A;  5A2Q E;  4GKK L;  1N32 Q;  1BQQ T;  2HUG A;  1C8C A;  2UXB Q;  4JI8 Q;  3M4O H;  1L1O A;  3PO3 H;  4YWK A;  5IP9 H;  3V96 A;  4BY1 H;  1EZ8 A; 
#chains in the Genus database with same CATH homology
 2NUC A;  2WAQ B;  5M3M B;  3VR4 A;  4HSP A;  1B2T A;  1TQO A;  1PDQ A;  3MAQ A;  4WRD A;  3NUC A;  2KEC A;  2F0G A;  2BDN A;  4RCN A;  2B2W C;  1F2L A;  2A74 C;  2HCC A;  3GTP B;  3S1M B;  1RTN A;  1DZ1 A;  1JOK A;  3BDO A;  4X3S A;  4XT1 B;  2F0U A;  3PO2 B;  1F2Y A;  4WJW A;  3HOW B;  4J8Q A;  1AN8 A;  3SEB A;  5F2D A;  3MTS A;  4KKU A;  5D3D A;  1SFO B;  1O80 A;  2AQ2 B;  5EQ0 A;  5C6A A;  3C46 A;  4OIK A;  2FMM A;  2JP1 A;  3RZD B;  2JA6 B;  4DU9 A;  4DK0 A;  3Q24 A;  4XYO A;  1DXM A;  2IL8 A;  1JB3 A;  4IUU A;  4BS9 A;  2V4D A;  2QDB A;  3CU7 A;  5LHY 1;  4KI0 A;  3J7A F;  3PUW A;  5IOD A;  3S2D B;  5DM7 3;  4F8M A;  5M5W B;  1EFI D;  1QNK A;  3H6M A;  4K2K A;  2WIN B;  4A3E B;  2DY7 A;  1BCP C;  5D3I B;  3VR5 A;  4OO1 H;  2O5I C;  5KYI A;  4K5V A;  1GHJ A;  3LWU A;  2R61 A;  4BA2 I;  1Q3L A;  2SDF A;  2AWO A;  5E3F A;  4PMC A;  4KY5 A;  2LFN A;  4Q0F A;  3R8B A;  1TU2 B;  4RKL A;  4IUV A;  1S5C D;  2Z4H A;  4ZRZ A;  1I4P A;  3FKI B;  1OXV A;  2J7Z A;  1YNN C;  2FHT A;  5FO7 B;  3BVM A;  3EVQ A;  3M85 A;  1A6X A;  2F0W A;  3IKJ A;  4QMG A;  2YYZ A;  1RCV D;  4I65 A;  3I91 A;  2EY6 A;  2K7V A;  1WTV A;  3H09 A;  2K03 A;  4HR7 B;  2EYH A;  5TSS A;  4ZKC B;  4K14 A;  4A3B B;  4C3J B;  1DCZ A;  1K8O A;  1SJE D;  2JXM B;  1DJR D;  2MP1 A;  3HRZ C;  3SVM A;  2K1B A;  5CV7 A;  4DA2 A;  2Z1C A;  4A3D B;  1OO9 B;  1TY0 A;  3D6C A;  3CKI B;  3DWA A;  1Y8O B;  1D5M C;  1SNC A;  3FPP A;  2XVS A;  3D4D A;  3HEJ A;  3MEH A;  1MBY A;  3W2D A;  2VXW A;  1ET9 A;  2ZXP A;  4Q5V A;  3NTH A;  5CYU A;  1KLG D;  4G4K A;  5CBE E;  5FK9 C;  1BR9 A;  1HA5 A;  4IUR A;  2IX0 A;  2RDF A;  1CHQ D;  5I6Y A;  1GUT A;  1PFM A;  3GTL B;  1AP0 A;  4FO2 A;  2L4N A;  2PW5 A;  1VMP A;  2OF1 A;  3KF8 A;  4IFD I;  1H9J A;  2BE5 C;  5KGU A;  1ILQ A;  3S1Q B;  2GA4 B;  4A3M B;  2L55 A;  1B53 A;  4HTH A;  4C56 C;  1TWA B;  4RAU C;  4WFN 3;  1NR4 A;  1E2V A;  4KJO A;  3PMF A;  2RDG A;  1TS5 A;  2RKS A;  1NUC A;  3HGB A;  1XTC D;  4HN7 A;  2E75 C;  2QF7 A;  1TY2 A;  2PCF B;  1DYQ A;  1W6J A;  1BO0 A;  1CA5 A;  2K5D A;  2XNA C;  1U4M A;  3DMU A;  1ESF A;  1KTK A;  4HAE A;  1Y1V B;  4N9P A;  4ID6 A;  4F87 A;  5IGC A;  5C4X B;  3X3M A;  5LL6 X;  1ET6 A;  3HOX B;  1JE4 A;  1MD2 D;  3I8Z A;  3J80 E;  3VA5 A;  1EU3 A;  1UNS A;  3GTK B;  2ZT9 C;  5CMD A;  1B44 D;  1LV9 A;  3EA6 A;  4TKO B;  3GQB A;  2EYJ A;  4EGV A;  5E4X A;  3MXP A;  4CGY B;  5CBA E;  2F0O A;  4G7H C;  5AFW A;  1KAA A;  5DEH A;  3S16 B;  2JYO A;  1CM9 A;  4PV1 C;  1ENC A;  2B2U C;  2F0P A;  4K5X A;  1Z47 A;  4FF2 A;  1JWM D;  1CK1 A;  1EOT A;  5C3E B;  2NB0 A;  4KV6 A;  2WV6 D;  4Y7N B;  3OIQ A;  4ZUJ A;  3DXJ C;  3GTM B;  1DOK A;  5K5P A;  3C1F A;  2N55 A;  1JWS D;  5BN3 A;  4G7O C;  1EYD A;  4L6T B;  2NTS A;  3ONA B;  3S14 B;  4C3H G;  2AUJ D;  3RD4 A;  1GJX A;  4RKB A;  4NW2 A;  2O4X A;  3LNN A;  2QKI C;  1XWE A;  2HDM A;  4MN3 A;  4ZLT F;  1D1K A;  3VR2 A;  1SEB D;  4B9W A;  1SNO A;  4KHZ A;  2JA7 B;  3E5S A;  3S15 B;  2FIN B;  3CRK C;  2XWB B;  3RMH A;  4A3F B;  4B08 A;  3A7L A;  1Y69 U;  1WTQ A;  1WTR A;  4EVO A;  3QJY A;  1PZK D;  1ENF A;  2L1B A;  3T16 A;  3AMU A;  3MFY A;  5COR A;  2KQ3 A;  2R6G A;  5K36 H;  4XTC S;  5CV8 A;  4ABN A;  5NUC A;  1EWH A;  5G3L F;  3HS0 C;  3Q22 A;  1D5X C;  1EL0 A;  5DNF A;  1FYC A;  1PFB A;  3VA7 A;  1HQM C;  2TMP A;  2KA7 A;  3OW7 A;  5HUR A;  4RGT A;  4FXK C;  4C3I G;  1X3Q A;  4X3T A;  2F3V A;  2E76 C;  5ELB A;  5JEA J;  3KUP A;  2KCN A;  1MSH A;  4C3H B;  1I6V C;  1F77 A;  1ZYR D;  2NBF A;  1EY7 A;  4LMQ D;  3HZX A;  5IT9 E;  1HCZ A;  2AQ1 B;  1EY6 A;  4FNF A;  2CW0 D;  4HCS A;  2NVT B;  1RKN A;  1RDP D;  1XXG A;  1IKL A;  1X32 A;  1LTR D;  4J1M A;  3QIA A;  1I4R A;  4R8N A;  3M7N A;  3DEP A;  3K5O A;  2Q8R E;  1ONL A;  1Q90 A;  2EYF A;  2NN6 H;  3P1H A;  5EPK A;  1LTA D;  1HRJ A;  5J1Z A;  4RWS C;  3BVG A;  1CZW A;  1CQF A;  2HCI A;  4IFD H;  3LX0 A;  1ZEQ X;  3TBI B;  3Q0A A;  3QB3 A;  1O7L A;  3TZU A;  1II3 A;  2F0V A;  3X3N A;  5IGG A;  3DUZ A;  2B2V A;  2QCP X;  5FOB B;  2BDO A;  4YIJ A;  4CKC A;  2SNS A;  1NCV A;  5COY A;  4G57 A;  2KCC A;  4IZ8 A;  2M00 A;  1I4H A;  1WTP A;  4FF1 A;  3ITP A;  1TII D;  5IOC A;  1TS3 A;  1TT2 A;  1O7Y A;  1S5B D;  4IFD J;  3NWS A;  1GUO A;  3MXU A;  3TN2 A;  2F3W A;  2DNC A;  1EY8 A;  1LO5 D;  3K57 A;  4DGZ A;  5D14 A;  1L0X B;  5BN4 A;  3TP8 A;  3TZD A;  1PFN A;  4F88 A;  1AZQ A;  3P20 A;  3DWQ A;  2OXP A;  1TS2 A;  5C4Z A;  3H3V C;  2RBM A;  5A2Q L;  1TWC B;  1G91 A;  2VNU D;  3I4M B;  3UI2 A;  2NVX B;  4K2L A;  1ICW A;  2PYK A;  3WDN A;  1K8M A;  1PZI D;  3O13 A;  1CQV A;  2PNR C;  1SE4 A;  4RA8 A;  4FYD A;  2B8G A;  1JCK B;  1B50 A;  1OXS C;  2L12 A;  3F2U A;  3FMC A;  2VUM B;  2EYM A;  4ZKB B;  1WTX A;  1V43 A;  1RJT A;  3M7G A;  2R3Z A;  4IUT A;  2B63 B;  2R92 B;  1J8I A;  2VB2 X;  1SXT A;  2PMZ B;  1G8Z D;  3K5N A;  2CQA A;  2E2D C;  2F0S A;  3I73 A;  1FNU A;  3NK9 A;  5EBC A;  3MZ5 A;  2J0T D;  1VF7 A;  2PZW A;  1HFG A;  4DNT B;  4IAL A;  1QNU A;  4XYQ A;  1DD2 A;  3G7L A;  2KUM A;  3FDT A;  1I4Q A;  2FJ2 A;  5I2Y A;  1FNV A;  2C9O A;  2HDL A;  5FLX L;  1SYC A;  4DAY A;  2NZ1 D;  1KAB A;  1AZP A;  3A7A B;  3S1R B;  2A6E C;  3TP7 A;  1F9R A;  2ID0 A;  1C4Q A;  3NQI A;  3VYU A;  2PQE A;  1R4Q B;  5I6W A;  2F0D A;  2A68 D;  4HMJ A;  5EPL A;  2EY1 A;  4I7Z C;  1I6H B;  1RD9 D;  1R9T B;  4LJZ C;  2KVM A;  3EQL C;  1IW7 D;  3OWF A;  3EFX D;  2EPB A;  4KN4 C;  2M9V A;  2RSN A;  3A55 A;  3KBG A;  4EQO A;  3J7Y W;  2PPB C;  4KD3 A;  4JK1 C;  2D2C C;  1VMC A;  2LY7 A;  1G6Z A;  5J22 A;  2F0L A;  2K33 A;  4FF3 A;  2F0F A;  4K6D A;  4RCO A;  4CJ0 B;  1IYU A;  3NTI A;  3BDC A;  1U9R A;  3CRL C;  4C1N I;  1H9M A;  3PUV A;  4OL7 A;  2B2T A;  1STY A;  3RLF A;  2KJX A;  3U9O A;  1EEF D;  4TSS A;  1PTO D;  1OXX K;  2N88 A;  3S17 B;  2F0N A;  1Q1E A;  3K5M A;  2E2H B;  3FPU B;  3K58 A;  3GTJ B;  4ODG A;  5JPM C;  2IX3 A;  1WD0 A;  4X3K A;  4A3G B;  1KDC A;  1PYW D;  2XRQ D;  1B9N A;  3HG9 A;  2JSO A;  5T1G A;  3OMG A;  2H4O A;  2CVR A;  3AU7 A;  4M8A A;  3D6W A;  1YNJ D;  5DM6 3;  2JA8 B;  1ROD A;  1U4R A;  1DON A;  1RTO A;  2L0C A;  2MGS A;  4H0L C;  4KKT A;  1XYI A;  1LT5 D;  4KHV A;  1A2T A;  2EE1 A;  5JOB A;  2VB3 X;  1I3Q B;  5CR3 A;  2K6A A;  3NQT A;  1BF4 A;  2K28 A;  1IL8 A;  4O1N A;  3VYT A;  1JC7 A;  1JOQ A;  4NDX A;  2B2Y A;  1EZ6 A;  3NXW A;  1WVL A;  4FXD A;  1EU4 A;  1SYB A;  1ZKO A;  2NTT A;  3S1N B;  3NBI A;  3TP5 A;  1GOZ A;  3T51 B;  3ZYY X;  4PNY A;  4ZQ3 A;  1SYG A;  5JVG 3;  4H13 C;  3D8G A;  3I3C A;  1FGB D;  3W3A A;  1STB A;  3H0G B;  3MVV A;  1TWG B;  2B39 A;  5KYL A;  5C44 B;  4QCL A;  3L7Z C;  3BYT B;  3PUX A;  3J80 L;  4M1U B;  1LTB D;  5M9O A;  1GUS A;  3K59 A;  1SYE A;  4HSV A;  1SSO A;  3K7A B;  4FXG C;  5BN5 A;  3I4N B;  3R3O A;  2MJ8 A;  3P7J A;  5CC4 A;  1ML0 D;  2X69 A;  2HQE A;  3VYS A;  3BS1 A;  1OXU A;  1PRT D;  1V8Q A;  4DXG A;  1EQT A;  1C48 A;  2EZV A;  2D9U A;  2F1M A;  4RGM A;  5CV4 A;  5KEE A;  5ELC A;  1DOM A;  1VF5 C;  1FD7 D;  1GUN A;  1SE3 A;  2A68 C;  4L8J A;  1H9K A;  4CJ1 B;  2EYL A;  2JEA I;  3WOE A;  3J7A V;  3OSO A;  3J81 E;  1CZG A;  1IW7 C;  4IUQ A;  1BXT A;  1XX8 A;  1IKM A;  4BWG B;  1JWU D;  4JBW A;  1LAB A;  4CKB A;  4ZYS A;  5KRU A;  2XSC A;  2X6G A;  3M4Y A;  5C3W A;  3HOV B;  1S4Z A;  4FP5 D;  4MHE A;  1UEA B;  3URY A;  1MGS A;  1PZJ D;  2A73 B;  2DN8 A;  5JEA H;  5KNC A;  1A3V A;  4ILW A;  4BBS B;  2B2V C;  1BNZ A;  2XWJ B;  4KKS A;  5EJW A;  1STH A;  1EEI D;  1OXT A;  1W6K A;  2A69 D;  2WKC A;  5C0X G;  1LTS D;  1HPC A;  5JVH 3;  1FR3 A;  2XN9 C;  3ERQ A;  1HXY D;  4NP5 A;  1STE A;  2QIL A;  4XQN A;  1B3A A;  1EYC A;  3A8J E;  3QOL A;  3U9S A;  1GXD C;  4V0B A;  3RUZ A;  4DAV A;  1LT6 D;  5J39 A;  3SK8 A;  1BDO A;  2EXZ A;  2RDH A;  3I4L A;  2RQX A;  2G9H D;  1YNJ C;  5IT9 L;  1BBX C;  2EJF C;  1BCP D;  1H9R A;  1PMR A;  1AFP A;  4K8I A;  3BG3 A;  4KTA A;  2EY5 A;  2EJM A;  1WCM B;  2O2L D;  2BCO A;  2NVY B;  4ZAI A;  4L63 B;  5K36 G;  3QG1 A;  3VYR A;  5I2X A;  5C5L A;  3V2T A;  1RF2 D;  5ELE A;  3MC0 B;  3M3Y B;  2ZXO A;  3C1E A;  1QWY A;  2R93 B;  3T56 B;  1V1P B;  1B4O A;  4C3I B;  2NYZ D;  1F9S A;  3H91 A;  1PTO B;  4J6H A;  1V1P A;  3H94 A;  3DEO A;  4ZUI A;  1X3P A;  2ZXR A;  3GP7 A;  3N52 A;  1GUG A;  3IAY A;  1AW7 A;  2F0K A;  5EKK A;  4K6L A;  1O7Z A;  3S9W A;  4U67 3;  4ULL A;  5C4J B;  3DM1 A;  1FNW A;  4XQJ A;  4PQX A;  1V1O A;  5A35 A;  1F9P A;  3FRP B;  1SAP A;  1B9M A;  2IW3 A;  4QB4 A;  2XRS D;  1EY4 A;  1DOL A;  1PRT C;  2AQ3 B;  2LMC B;  1HUN A;  1IHZ A;  4OHJ A;  3JAM E;  3KBX A;  5JJZ A;  2G9D A;  3D31 A;  5M5X B;  1IYV A;  5LL6 S;  4DFA A;  1Y8P B;  3I70 A;  1STG A;  3SXH A;  3ND9 A;  1NR2 A;  3HOU B;  2R7Z B;  3GV3 A;  1B1Z A;  1TWH B;  4NMZ A;  1LT3 D;  3MA2 B;  4ME5 A;  2IWH A;  1I50 B;  2FMC A;  3A8I E;  3R2I A;  3NWT A;  4LK1 C;  1ZXT A;  3C3L A;  3R93 A;  2PW7 A;  2H1E A;  3T13 A;  1Q8I A;  3NHH A;  2I07 B;  3SK5 A;  5C3X A;  1WD1 A;  1HA6 A;  2F03 A;  3BVZ A;  2B2T C;  1WTO A;  5ISR A;  3L3O C;  3GV6 A;  4LAA A;  4DXF A;  3E0J A;  2WKD A;  1TWF B;  2D5D A;  2EVB A;  5CV9 A;  3IL8 A;  2F0T A;  1QJO A;  2A69 C;  2B8F A;  1D1I A;  5M3F B;  3TME A;  1PRT B;  3HKZ B;  1D2B A;  1AEX A;  2JE6 I;  1QB5 D;  4DNR B;  1Z6H A;  2K32 A;  2WAC A;  1EIG A;  4KJN A;  4KY6 A;  5FKA C;  1ZYR C;  2EYO A;  4F7X A;  5FLX E;  5C0X I;  3DHQ A;  3VR6 A;  2M2L A;  3HOZ B;  5EKI A;  5IGB A;  3GTQ B;  3T53 B;  3A56 A;  4V19 0;  2PO4 A;  1JOO A;  2L5T A;  1Q1B A;  2ENB A;  2CW0 C;  5I9O A;  2DY8 A;  4BA1 I;  4AYB B;  4KK7 A;  3PIO 3;  1Q12 A;  4N9T A;  4C3J G;  2Q8I B;  2EJG C;  3KLS X;  5CGK A;  1D5Z C;  3KLR A;  4DN4 M;  4XQQ A;  1HTP A;  2F0Q A;  1F9Q A;  2AWN A;  1JOR A;  2I46 A;  3AB9 A;  1JIC A;  5E4W C;  4U68 A;  1EIH A;  3M4O B;  1I4X A;  4EQN A;  3PO3 B;  2RA4 A;  4DAP A;  4BY1 B;  1UAP A;  3LWE A;  1F2M A;  2B2Y C;  4UDU C;  1HHV A;  1M8A A;  2F0I A;  3A8K E;  3KK7 A;  2B2W A;  3QOJ A;  4OO1 G;  1HTL D;  1BUV T;  1E2Z A;  3PV0 A;  3QWN A;  1G2T A;  3NP8 A;  4RFB A;  2NWG A;  1PXU A;  3NPP A;  3MXN A;  2Y0S B;  2A5H A;  4H44 C;  4XIG S;  3TDQ A;  5EPJ A;  2BA0 A;  3G6J B;  3TSS A;  1NAP A;  4CBV A;  4A3K B;  4RGO S;  2NVQ B;  1DM0 B;  4KD4 A;  2Q8T A;  4QIW B;  1HUM A;  3D3R A;  5IGE A;  4G7Z C;  4A93 B;  3Q23 A;  1BCP B;  1SYF A;  2D62 A;  1KDB A;  4XXE A;  1SYD A;  3FEW X;  5C5M A;  3SHL A;  2NN6 I;  4RHS A;  3HP3 A;  5IIF A;  2F0E A;  3MFG A;  3CHB D;  5C4H A;  3NBH A;  3NSW A;  4UAI A;  1SJH D;  1M4V A;  3NE5 B;  4E6I A;  5FO8 B;  2IJ0 A;  3MWY W;  1EWC A;  1CTM A;  1CA6 A;  1GUW A;  4C2M B;  1SDF A;  1Z7T A;  2E74 C;  2KED A;  2F0M A;  4CJ2 C;  1KNA A;  1G29 1;  3QO2 A;  1SBB B;  2AUK A;  3OIP A;  5KIX A;  1CFM A;  1Y1W B;  3PUZ A;  4FF4 A;  2JEB I;  2J4X A;  3D4W A;  1CT1 D;  3SK6 A;  1S5D D;  2K5Q A;  4H7B A;  3N6R A;  1TR5 A;  1GHK A;  2F0H A;  3BDL A;  2A6H D;  1PTO F;  2MPM A;  2X6L A;  4RH6 A;  4QUF A;  2ICE C;  5DAU A;  3V05 A;  2KEE A;  4K8J A;  4EQP A;  1SNQ A;  3P75 A;  3I72 A;  1G2S A;  1K83 B;  5ELD A;  3FVQ A;  1D6E C;  5ELF A;  2CHB D;  2E2I B;  4DF7 A;  2TSS A;  1RHP A;  5G3L D;  2Z8L A;  4ZK9 B;  3D4R A;  3PUY A;  4WOR A;  2EOT A;  1UUP A;  1TVX A;  4TRD A;  1SMY D;  2K01 A;  1LLR D;  5I9P A;  2RSO A;  3L9A X;  1HQR D;  4HED A;  4CHT B;  1QE6 A;  1F2Z A;  4RGN A;  4PMB A;  2SNM A;  1S5E D;  4A3I B;  4IQZ A;  1U4L A;  3T4A C;  4CKE A;  3J81 L;  1O78 A;  3SDZ A;  3S2H B;  3RZO B;  1JR0 D;  1ENA A;  3NTK A;  2MUY A;  2KOL A;  4BBR B;  2WP8 J;  1ESR A;  5CV6 A;  5KND A;  1LT4 D;  1LTI D;  1TS4 A;  2SOB A;  5EGT A;  1CI3 M;  2MHV A;  5C0X H;  5T1I A;  3K0Y A;  2IX1 A;  2KHS A;  3Q6S A;  2L9H A;  4S3S A;  5M5Y B;  1PTO H;  1R4P B;  3K6O A;  2DNE A;  3ND8 A;  3OWE B;  1QOH A;  1H9S B;  2EYP A;  1SE2 A;  1SND A;  2IT1 A;  3BYY B;  5FO9 B;  5CV5 A;  1STA A;  4QF4 A;  1PTO C;  4PMW A;  1A3U A;  1H9S A;  3IFT A;  2IPK D;  5JPN C;  4OO1 I;  2Z4I A;  3MXG A;  2BA1 A;  5D65 A;  3GO5 A;  5C0X J;  4O42 A;  1T5X D;  4R9W A;  4C1N K;  4BY7 B;  3E6Z X;  4XDX A;  3OMC A;  2SEB D;  1NSN S;  1VCI A;  3SK4 A;  2FFK B;  1KNE A;  1EYA A;  1QG7 A;  1TKW B;  1PRT F;  1VDZ A;  1KDA A;  3GTG B;  5E1F A;  1MI2 A;  2XIW A;  1L0Y B;  4K5W A;  1BOS A;  3R2T A;  4HCE A;  4X3U A;  3HOY B;  5I4D A;  5IGD A;  4HMI A;  5JEA G;  2A6E D;  2B2U A;  1E2W A;  1LAC A;  2L11 A;  3BZD B;  3PIP 3;  4B9X A;  3GTO B;  1QCB D;  5HGT A;  4QUC A;  3KLS A;  5EBD A;  2PZU A;  4R8I A;  4RHR A;  1QIL A;  1YNN D;  4OGQ C;  1EQV A;  2QEJ C;  2LKV A;  3DWP A;  1LTG D;  1EY9 A;  3A54 A;  2ICI A;  5EKL A;  4KN7 C;  1STN A;  2O5J C;  4DK1 A;  1A2U A;  4KMU C;  1WTW A;  2E2J B;  2RVL A;  2OEO A;  2JA5 B;  3SR1 A;  3ERO A;  4MIU A;  3SE0 A;  4KY7 A;  3OOC A;  4GZY C;  4IUN A;  1Y8N B;  2YU9 B;  2A6H C;  1ILP A;  1JQY D;  2EDG A;  4IN3 A;  4TQU S;  3WOF A;  1HFN A;  1I4G A;  1SNP A;  2OT2 A;  4P2C B;  4Z9C B;  2K05 A;  1MSG A;  1EY5 A;  3VR3 A;  2NN6 G;  4XT3 B;  1S5F D;  3MHB A;  1SNM A;  4FVM A;  3C2P A;  2F0J A;  1LTT D;  3OPO A;  1KLU D;  4OIJ A;  4IUP A;  4IFD G;  1CHP D;  2LS0 1;  2EY2 A;  2WB1 B;  1J9O A;  1SMY C;  1E0B A;  2K04 A;  1BCP F;  2F4I A;  3CQZ B;  3I90 A;  1PLF A;  2C5C A;  3JAM L;  5KNB A;  1T5E A;  3K5L A;  2BOS A;  2K5W A;  3OHX C;  3IFD A;  5IGF A;  4A3J B;  3TP6 A;  4NKL A;  3EJI A;  1A3T A;  1U4P A;  2BE5 D;  2PZT A;  3GD7 A;  2WII B;  1A15 A;  5JAV A;  1EY0 A;  5A2Q E;  1BQQ T;  2HUG A;  1C8C A;  3V96 A;  1EZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...