3NPUA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
250
structure length
246
Chain Sequence
TDLKASSLRALKLMHLATDTDEKVIALCHQAKTPVGTTDAIYIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEDAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 97
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npuA00
1I2OA 2W0UA 5HWJA 4HHPA 4P2VA 4TIMA 4MVAA 2QAFA 5HWMA 3EX2A 4NUWA 1LP6A 1A5BA 4DO4A 4ADUA 3MI2A 3W7LA 1K8ZA 4YCPA 2VFIA 3STFA 3M47A 1DV7A 5CG7A 1VLWA 1PL9A 2VFHA 2CLHA 3THAA 3LLFA 1PHWA 2FQIA 4UFIA 5DELA 4FX7A 2YX0A 2A1YA 4O15A 3YPIA 4RZ4A 1AW5A 1VLIA 1XKYA 4RR4A 2QAPA 2QF7A 2ZA2A 1KA9F 1ME7A 1OJXA 2J9YA 4LS2A 3QZEA 4UFLA 1SZGA 1MEWA 1SSDA 4MPQA 1CW2A 4CNPA 4PL2A 4PCFA 3DKJA 3NQ2A 1AMKA 1JRBA 3B06A 3HPXA 3SGUA 1HFBA 5G1TA 3GIYA 1SUXA 2UV8G 3DFNA 4LC6A 4N6FA 5SWUA 1QPQA 5D2XA 1JCXA 5E0KA 1GQNA 1Q6QA 1UUOA 4A2SA 3O1NA 4MFEA 3ABQA 3R89A 4FX6M 4IOTA 4XBSA 4H6KA 3JR2A 2QUVA 4LVAA 1X6UA 2FB3A 3M44A 3NO5A 1B3OA 1EUAA 1XDMA 1ZENA 3E9AA 1WOAA 2V2DA 3TSMA 3BG9A 1OFRA 4W9TA 1DQXA 3FYOA 3PSWA 4JTUA 2ISWA 2YR1A 3DFPA 1F6KA 3BK0A 3ZFHA 3UY7A 4M7SA 3W72A 4XTDA 1H63A 1OX6A 4AMAA 3LBCA 3STGA 1LBFA 3I65A 3NOEA 3LM7A 4Z1BA 1TPVA 3C2FA 3HQ1A 4N9BA 2P10A 3H53A 4JTLA 2CZ5A 4M6VA 3TQKA 5LNRA 1H7NA 4OGZA 3DXIA 4FX8A 1TV7A 3SI9A 4JYEA 5F4WA 1VHCA 1HO1A 5LHEA 4DF0A 3LXCA 2WSYA 4IPJA 4JYDA 2R8WA 5CPNA 5H91A 4UFKA 2ZZ1A 3W1XA 2RHGA 3G0XA 3PWAA 4EF8A 4ZQOA 4IMEA 1LDCA 2BTMA 4YWIA 2BSLA 1L6WA 4NJGA 3USBA 2ATMA 1SZEA 4BF9A 3KAOA 3MWAA 4ML9A 2BWGA 4BI7A 1FCBA 3NNTA 1RQEA 3W2JA 4S2BA 3LHVA 3GYEA 3E02A 2ZTKA 1YPIA 3T40A 4HNVA 8TIMA 1YDOA 2P1FA 3TFCA 1VCGA 3G1XA 5HJLA 4JX4A 2Z0IA 3BW2A 2EKCA 1TTQA 1L6YA 1F05A 1SR9A 1S3HA 1H1ZA 1H60A 4NJJA 3W1TA 2J9XA 5AC6A 3DGRA 1K7XA 1W0MA 1VYRA 3BLEA 1TQJA 2V5BA 1RPXA 4S1FA 2WPBA 3O63A 2JKEA 5DCEA 1JCMP 5FF7A 3TQ0A 2Q8ZA 1XC4A 1JUBA 1QPRA 2QCMA 2G97A 2A7NA 4CLMA 5IM51 3FLUA 4IXHA 3L67A 1K8YA 4LW7A 2I9EA 1WDWA 5HWNA 5I3GA 4UFHA 3G22A 4BWLC 1JUEA 3UZJA 2QCDA 1XCFA 4ALDA 1CX9A 1OVDA 3KFTA 5D37A 1LRNA 2FB2A 4AWSA 3NZ1A 2XN0A 1W5NA 4HNTA 4Z1DA 4CCDA 2HSAA 1EA0A 1GJPA 3W2NA 3W83A 1YDNA 1T8XA 2GJLA 1GZGA 3IGSA 4ZQNA 1EP3A 3SJ3A 4PH6A 3W9ZA 3O6DA 5AHMA 1WYIA 1E51A 2QDHA 3GXNA 3I7SA 4ZVJA 1R47A 4JTJA 4UUIA 3LRMA 3SY5A 2VXNA 5DXYA 3CHVA 1F76A 2NX1A 3F1QA 5AHEA 3FKKA 5LNUA 3M0ZA 3KVKA 4AHOA 3SSJA 4FB7A 4RKAA 4IMCA 4MIMA 4WZHA 1LCOA 3TSDA 2WSQA 4UTUA 3C2EA 2OX1A 2ZRYA 4QISA 1Q6RA 3NYZA 3ZWSA 4G1KA 3P8IA 3VE9A 2YW3A 4MUZA 4QSHA 4FNQA 3M5YA 3GLCA 4OT7A 5KMYA 1XUZA 3GVGA 5D2TA 3MP3A 1OX4B 1ZAJA 4Z0JA 2YSWA 3QJAA 1VPXA 2HTMA 3DFQA 1TTJA 2Y7FA 4JXCA 1OYBA 3P60A 3S6DA 1KBIA 2A21A 5KZDA 5C6MA 2CLIA 5CPMA 4AB4A 3DKLA 3CEPA 3T55A 1P4CA 4JTGA 3OBKA 2JBMA 1IXNA 3R12A 1S5WA 1QFEA 3EX6A 1ME9A 1W5OA 3N73A 5AOUA 4LVFA 1D3HA 2CU0A 2VFEA 1TPB1 2R94A 4XUGA 1KM5A 2ZDRA 5BMWA 4FNPA 1XDLA 5EMUA 3T4CA 3N2XA 3EWYA 2P0OA 1GVOA 3TA6A 1GT8A 4JR5A 1SW0A 2DZSA 4XKYB 3TMQA 1M7PA 3WJWA 4UTTC 2Z2UA 2QCEA 2NV2A 4RJEA 2E1DA 5DY3A 5K9DA 3TIMA 1G4PA 1IGSA 3G8RA 3QEZA 4GUJA 3EXTA 1TPH1 3VE7A 3MJYA 2CZFA 3W2UA 1LOQA 1N55A 2A6NA 3LB0A 5DY2A 4NJKA 4BI5A 3TQVA 3JRKA 2ZRVA 5G1YA 3TJXA 1FWSA 4LOCA 4POCA 3DHFA 1LLZA 1FX6A 4ADSA 3C52A 4OQVA 1OX5A 2JGQA 4N02A 1T99A 3W7OA 4E2BA 2RFGA 3DI0A 2B7OA 3L5LA 1NEYA 2EPHA 4BFAA 3P8JA 4MZ1A 2DJLA 1H7WA 1LTDA 3NQVA 1F6PA 3LHYA 5D05A 3B05A 1PCWA 3C3NA 4BR1A 4JTTA 4GWEA 1ICQA 3TXZA 4UXDA 3IIPA 2FPTA 2QUUA 2OT1A 2ZBTA 3N9RA 3HF3A 2PCQA 3NPUA 2PE4A 1SO6A 4O52A 4JTFA 5G2IA 1F2JA 1G4SA 1LM1A 1OFBA 3K30A 2E6AA 2Q8LA 3GR8A 3DENA 2Q3RA 1GOXA 4UMAA 1U83A 3MBFA 5FF0A 4LY8A 1HUVA 2TMDA 3KRUA 4LV9A 3W87A 2NUXA 4AWTA 2PRLA 3UWYA 3W1LA 2O7SA 2C19A 4JTKA 4E0CA 1H51A 1ZCOA 4O50A 3GDRA 4WXYA 1N8FA 1SU5A 1OFDA 1WAUA 4OV9A 2A0NA 4YLWA 4YMZA 5L6UA 5F2MA 3VNDA 5CZTA 1EIXA 1JCJA 3HG4A 3JS3A 1FCUA 2ZZ7A 2J88A 5EA9A 3VKJA 2B7NA 5AYYA 3LHWA 1XM3A 3L2IA 5GVJA 3LCXA 1TPEA 3BW4A 4RXFA 5TBOA 3CQ0A 1TJRA 2ZZ6A 1N7KA 4K8EA 4LS0A 1ZAIA 3GDTA 1NF7A 4Y6GA 4O4VA 3DFSA 5I3IA 3R5EA 4LV4A 2DU2A 4Q33A 1VZWA 4NX0A 4KFPA 2W79A 3B03A 1KTCA 2GJNA 2ZTJA 3I68A 3C2VA 1TV8A 1H62A 3WK3A 4DPQA 4FNTA 4NZJA 2VEMA 4OV4A 3NL6A 1FWTA 2ZRXA 2KZHA 3IVTA 1BTMA 4Z1CA 4U4MA 5KZMA 2QJIA 1TJPA 3UQNA 3W07A 4I7UA 3W76A 1WOBA 1EWDA 2J6XA 3W7IA 1EX5A 1F74A 3S5YA 2V0TA 2YGYA 2FDSA 3C56A 1TPDA 3LERA 4JX6A 1G4TA 5FEWA 3W7RA 1F7BA 1H61A 1Y0EA 1X1ZA 2WJZA 3PF3A 3DI1A 4YL2A 1V5XA 3QPYA 3O07A 4UTWA 2ZFAA 1TPC1 1MO0A 3S1UA 2PRHA 1ALDA 4LRSA 4WY0B 1J5TA 1TQXA 3W1QA 3ZS4A 2V2HA 2EGZA 1S5VA 3THQA 3CLMA 3VI2A 3TROA 2R14A 3NPVA 2GQAA 4IPIA 3TUUA 2V9DA 4AWUA 4PFMA 3L68A 2A7RA 3P62A 5HUOA 4JDBA 5G2WA 3G24A 2NZLA 3S5OA 1KM6A 1L2UA 2CZDA 5EPDA 1DKWA 3D0CA 1FDJA 1AL7A 1OX4A 3UY8A 3ABOA 1TMHA 3QQ0A 4J9JA 4AAJA 1LOLA 1W3NA 2RKXA 3G0UA 4UTIA 3OVQA 2VEPA 4HSNA 3TSBA 3NAVA 2NLIA 3QQ1A 1GVSA 3PG8A 4FNSA 5HR6A 2FFCA 2FPVA 3HIJA 4FF7A 2NV1A 1TPWA 1W31A 3WJYA 2ZQ0A 5AHLA 3MHUA 3A5FA 4DQWA 4FHAA 1JCYA 4XKYA 5HNRA 2A2IA 4S2CA 1DBTA 3AJXA 3GKFA 3CIXA 5G4EA 5HQEA 4FXRA 1X7FA 4O13A 4ZQRA 3W7CA 3IRDA 3TC6A 5I3HA 3TC7A 3MBDA 1TO3A 4JTSA 3EX1A 1G69A 3VCRA 3MUXA 2E5DA 3DFTA 1O4UA 4IX0A 3U8GA 5LKYA 3PB0A 1M5WA 3DBPA 3S8HA 1W1ZA 2V8ZA 1RR2A 1DOSA 2X2GA 4JGDA 2NWRA 3B0VC 4UR7A 3EEGA 1BWKA 1SSGA 1ZJIA 1A5SA 4JIPA 4EOUA 4HNNA 4NVTA 2WV8A 5DXXA 1OFAA 3W86A 3NQ6A 1MZHA 2QDGA 5CSSA 3W74A 3W2LA 2Y7GA 3Q94A 3HPZA 1DJNA 2OJPA 3LHUA 3DFOA 1O5XA 2V81A 4C1KA 4FEZA 5BOOA 3UXDA 2X1SA 4ZL1A 3NQCA 3NEVA 4O16A 1QDSA 1TIMA 4GUIA 4O1AA 2QJHA 1KM4A 3GX9A 4M6QA 5AC7A 2X1RA 3QMSA 3NGJA 3W2MA 3NDOA 2AQWA 3NQAA 4KWWA 2HS6A 5HINA 4O10A 4A21A 4CQ8A 5CZSA 1TB3A 3FS2A 1EP1A 3UXAA 2V82A 2QUTA 4O1CA 3TAOA 3WJSA 1K8XA 3EX4A 1P5BA 3A21A 1B57A 1JUKA 2GVJA 3RMJA 3SW6A 1YADA 5C5YA 2QCHA 1T0OA 2DZVA 3TE9A 1GYLA 4O8RA 2IQTA 3LCIA 5EYWA 3HG3A 1H1YA 3C6CA 1OF8A 3I6RA 3P7YA 1TRIA 3Q58A 3ATYA 3NQ7A 1AK5A 4M19A 5F1UA 3ZR4A 4UC5A 4IX2A 4Q4KA 4QQ3A 2VKZG 3RK8A 2CZEA 3S1VA 2V30A 4DF1A 3O6YX 1TSIA 5DLCA 4OE7A 1H50A 1OABA 1PV8A 2PURA 5MHBA 2ZRZA 4MYXA 4WOZA 4L4LA 1RZMA 3PVFA 3RNDA 2YZRA 4TU1A 4X3ZA 5L9FA 3TNOA 3M43A 1I45A 3FOKA 2NX3A 3F4WA 3EXSA 4JX5A 2VFGA 2Z6IA 3MP5A 5C54A 1B4KA 4K7YA 3LV5A 2V2CA 1JR1A 1YLVA 1QO2A 2CLEA 1KM0A 1ZHAA 4JNMA 2NXHA 1SO3A 4MYAA 3W70A 3GK0A 3N3MA 3O6CA 4UFJA 5EY5A 2CFFA 3QC3A 2FLIA 1A50A 5IBXC 1R2RA 4O0ZA 1QOPA 4O11A 4X22A 4ADTA 3MO7A 4RX0A 2NXIA 3ZWTA 1DHPA 2JKAA 3NPXA 3M5VA 3KXQA 4WY0A 4JS3A 1CI1A 3UWWA 1O60A 1R30A 4LS1A 4LWWA 1V7YA 4NNBA 5D32A 3PB2A 5F1VA 2E6DA 1YTKA 3PY2A 1LYXA 2ISSA 3EXRA 4R53A 1KFEA 5J5RA 1QAPA 4GUHA 5FF4A 1GEQA 3PUOA 1DJQA 3EB2A 2DORA 3EX3A 1WBHA 2OZ0A 3B8DA 3LCGA 3PUDA 3SFKA 1Z44A 2VELA 1W5PA 1Z42A 3M7WA 1QMLA 3NZRA 4LTSA 4NZFA 2AGKA 4X9SA 3QFEA 5I3JA 4PEKA 5AHNA 4EF9A 2A85A 1P0KA 2ABBA 4O54A 1IXQA 5D04C 4ZMGA 1A5CA 1FXQA 2C15A 3KRZA 4AHQA 2QR6A 3BG3A 5HR7A 3NQEA 4JTIA 4ICNA 5BNKA 5KITA 3P82A 5FI8A 1R2SA 2TPSA 4IJBA 4K36A 4MY1A 4JN6A 1O94A 4HKPA 3LX9A 2O7QA 1IIGA 3MHFA 3CPRA 1FDYA 5K3VA 1WX0A 3LTPA 4CNNA 1ZFJA 1ML1A 4TMCA 1BWLA 4JY8A 4NJHA 3BARA 2X1TA 5D03A 4UCGA 5AN7A 3NXFA 4MZ8A 1OF6A 3FFSA 2VENA 1I8JA 1VCFA 3N2MA 4M6PA 3UWUA 3QH2A 1K7FA 1HL2A 1PVNA 3G3MA 3B0PA 3LCFA 4A22A 2W6RA 4TO8A 4HSOA 4MKNA 4K39A 5AB3A 1HTIA 3E49A 2Z1BA 3CTLA 5F4XA 4HT3A 3L0NA 5TQLA 4RV8A 3W22A 1GG0A 3STCA 4TMBA 4HNUA 2FPYA 4O57A 5D30A 4AF0A 3R2GA 3KX6A 4E2DA 3MHGA 4NNCA 1TREA 2HS8A 1GTHA 1ZY9A 3M5ZA 3QF0A 1W8SA 3A23A 4NX5A 4IMDA 1M6JA 2BX7A 2Y62A 4L4MA 4KWVA 4O17A 4AEOA 5D2VA 4N6EA 4QITA 4KFOA 1NSJA 2Y70A 4DXVA 3TH6A 4YXGA 4OHQA 2C13A 3RF9A 2DZXA 3G1HA 4HPXA 3PUEA 3LI0A 2GPTA 1ZALA 2E6YA 3NQGA 1KBJA 3LCHA 3BGJA 3DH7A 4YCOA 1TTPA 4FNRA 3QSRA 5C55A 3UPBA 2WSRA 2ZZ5A 4RXGA 4PA8A 3PC0A 4I7VA 3L0GA 3P5ZA 2QKFA 1JULA 4LNYA 3N34A 3OHIA 3TW6A 4DPPA 2OMAA 4O0KA 4NXKA 4Y8FA 5I3FA 3MW7A 2GVGA 1VC4A 2ISVA 4WUIA 5EL1A 4IUOA 4BWLA 3PSVA 2ABAA 1KM3A 4AXKA 1ICSA 3NL5A 5A5WA 3WK2A 4Q32A 3U2OA 1XBYA 3PBUA 1XXXA 3GAKA 3B04A 2WNZA 1H7XA 2ZA3A 5LGZA 4UNLA 4JTHA 5HUPA 1ME8A 5K7JA 1EEPA 3STEA 1S5TA 2BLEA 3KRSA 2C18A 2FIQA 3NQDA 3EWBX 1QCWA 1G4EA 1EPXA 4DBEA 1OFOA 2EHHA 3QMRA 1PE1A 2CLFA 4MY8A 3GR7A 3W3OA 1QR7A 3HO8A 3PBWA 1LOSA 3OVRA 1LBMA 1GTEA 4LT9A 3M6YA 2R91A 2WO5A 4CQ9A 1H5YA 1KM2A 4NU7A 1QPNA 3RLUA 1SFJA 3IVSA 4GXMA 4XWUA 5FEXA 3LI1A 4ZQMA 2E5BA 3HOJA 5DBTA 1K3UA 5CZ0A 3E12A 3NPWA 5F2IA 1ZAHA 3W7DA 1XBXA 2A5HA 1D3GA 4QM1A 1VYPX 4GFSA 4WD0A 1L9WA 3FJLA 1SW7A 1LLWA 3W7NA 1FCQA 3TJLA 4CNOA 5LSMA 5J5DA 4NQ1A 4HN4A 1EWEA 3UZ5A 1MSSA 4AHPA 2H6RA 2QCNA 1KTNA 1W5MA 3A5VA 4UIOA 2PC4A 3RFAA 3LRLA 1QO5A 1NF0A 1Q3NA 3IV3A 2E6FA 2WOQA 3F03K 1H7RA 3UNDA 4RLIA 1RVGA 4M7TA 4U28A 5DBUA 4Z1AA 3B4UA 5FEZA 3C2RA 4ORIA 3W7EA 3GNNA 3LBMA 2QCCA 3HG5A 4QNEA 4XTIA 3W71A 2Y85A 4PL1A 3L65A 3LV6A 1P0NA 3SIZA 3M5XA 3T78A 3TMLA 2RH9A 3GXTA 2RDWA 5EKYA 3W7KA 3G1SA 3A22A 2QJGA 3PR2A 4UTTA 1KLYA 3UWQA 3C61A 4KKXA 3LTSA 3PS7A 5BRBA 3Q37A 3HB9A 4N9CA 1OYAA 3W7MA 1VS1A 2ZZ3A 2Y7EA 3O8AA 2J24A 3L9CA 5KINA 3BW3A 5F2LA 3NL3A 1GG1A 2G5WA 3GB6A 3W7QA 2Y61A 5ABTA 4MFDA 5D09A 3W7PA 2DZUA 2H90A 3NVTA 4B5NA 5BMXA 3HPSA 1LRTA 3RLVA 3TDFA 3HBLA 3P5YA 2YCEA 3OG3A 4GJ1A 1O5KA 1W56A 1DORA 3UD6A 4Z0SA 1TPUA 4UMBA 4DF2A 4IWWA 3G0SA 5D33A 4RK8A 2QEZA 3PULA 1OK4A 4JDYA 1KFBA 2NX9A 1VJIA 2X16A 3L5MA 4ORMA 3TK7A 1KV5A 3IGXA 4EIVA 3IEBA 3E0IA 3W23A 3H55A 1KTBA 2J9ZA 2HMCA 2JK2A 4OBTA 3QRHA 4IMFA 1SO5A 1YPFA 1FWNA 4K8HA 4R7JA 3OEXA 2A7PA 3IIXA 3LXAA 2H8ZA 3W1RA 1OK6A 3C4UA 2FTPA 3HJZA 1YTDA 1GPWA 5AYXA 3R13A 4O53A 4FNUA 4QIUA 4DEFA 3W7JA 2QCLA 1WBJA 2TRSA 3TFXA 2B4GA 5KTLA 4N2YA 2GQ8A 1AW1A 4XBKA 2JKPA 1SQ7A 1VCVA 2F7FA 3GDLA 1VR6A 3W7GA 1KFCA 1DQWA 5CSRA 2BXVA 4A2RA 1C8VA 1VH7A 2WNQA 2Z6JA 5DCBA 3TAKA 2CWNA 3IIVA 3U6WA 1IIHA 2G95A 2TYSA 1L6SA 3MYOA 1TTIA 1X1OA 2RDTA 1G6CA 1AL8A 4OWGA 4ZQCA 2ZCGA 4N9DA 3SGZA 1KV8A 3TCEA 4GBUA 3KVJA 4UTLA 3MI6A 4MJMA 3FEMA 3CB8A 3EKLA 3T7VA 2DP3A 2ZRWA 4AF0B 1AG1O 2WQPA 5CZJA 1G7VA 5HMSA 4DELA 1W3IA 3INPA 3OA3A 2Y6ZA 3S5ZA 1LBLA 3L5AA 4LU0A 1K02A 3WJXA 1M7OA 2C0AA 3L0KA 1KFKA 2A6LA 1I4NA 4WX2A 2B7QA 4JTEA 3GAYA 1KFJA 6TIMA 4HPJA 3GDKA 1WXJA 3B0UX 5K2ZA 1VQTA 1FQ0A 3P74A 4IXXA 3FIGA 4MY9A 3M9YA 4K7VA 1P1XA 3BV4A 1T96A 2E77A 3ABRA 3QW3A 4D2JA 3H54A 4BI6A 5KZEA 2EAWA 1GVFA 4GUFA 5K4XA 5I3KA 5LNSA 3I7QA 3LLDA 3EWXA 6ALDA 2Y89A 1I2NA 3L66A 1J4EA 5BW6A 1YXDA 1HO4A 3EWWA 1MEIA 5DN1A 1JCNA 1QOQA 2ALDA 4UMCA 3PM6A 4MLRA 3TXVA 4BK9A 1K7EA 1VYSX 2VFDA 1PIIA 4Z08A 3NG3A 3BVJA 3PBVA 2C3ZA 1WA3A 3MMTA 5LNWA 4N9EA 4A3UA 2ATSA 4WJEA 1FY6A 2XN1A 4AH7A 2AAMA 1UB3A 1I2QA 3W2KA 5DCDA 3V1PA 4JY9A 4EVZA 2DJXA 1LZOA 2CLKA 1J2WA 4H3DA 3CT7A 3R8RA 3KVMA 3O05A 3QYQA 2ZZ4A 3FKRA 3EWUA 5T26A 1SW3A 1LRQA 3HG2A 3SECA 2ZRUA 5AHFA 5LGXA 4NXSA 1VHNA 4K37A 5FF3A 4E38A 3ANYA 2OCZA 4PC8A 2WNNA 1VRDA 2YPIA 1XBZA 1SPQA 1JRCA 1TYGA 1YYAA 4GE8A 3A9IA 4GC4A 5CPOA 1LORA 4XZ9A 2ZA1A 3IIZA 1IXPA 4FIQA 2VEKA 1WQ5A 1TRDA 4MOZA 2VFFA 1FDZA 4IQLA 3HGJA 1HG3A 3LOTA 3O16A 5K9CA 3TV8A 1FWRA 3GZ3A 4ZQPA 3V75A 1DL3A 3G18A 1QPOA 4GUGA 1JQVA 2A4AA 4HIBA 4CQAA 1YXYA 1Q6OA 3M16A 1EB3A 4IGHA 2YW4A 5FESA 2EF9A 4QJ1A 3W7HA 1ONRA 1YDVA 3GDMA 3BO9A 4O12A 3N19B 3W1PA 3LXBA 5K9XA 1IF2A 5CKSA 2OT0A 3CU2A 1QWGA 4WXZA 3W75A 3MP4A 3ATZA 5LHFA 3QPZA 3BLIA 3VFLA 4UTMA 3G1YA 4EWND 3O15A 7TIMA 3EKZA 3W1MA 2C14A 3DAQA 4MLJA 1U5JA 1FCVA 5FEPA 4ZZ9A 1SZNA 1G7UA 4O4WA 5D2YA 2H3BA 1C29A 3TX9A 1K03A 4C1LA 4UTJA 4LC8A 3P80A 3SR7A 4I9AA 1OYCA 3P61A 4PODA 1F73A 2C16A 4P61A 4IMGA 4WY0F 3ABSA 5U7SA 2CLLA 3OVPA 1W5QA 3PBYA 4FXSA 2V5LA 3N9SA 1H7PA 1JJKA 2GOUA 4UTHA 3GXPA 4O28A 1NAL1 4RZ6A 4O1DA 3N14A 2XN2A 1X8FA 3PAJA 2XFWA 2E68A 4XQ6A 1OFPA 5G4WA 4GNJA 4UTKA 1XI3A 3S5NA 3MI3A 1RQHA 4JICA 3W1UA 5E1QA 1NVMA 1XUUA 4NJIA 3O06A 1XFBA 2DZWA 4LVBA 3CWNA 5H2ZA 2QCGA 2QCFA 2B7PA 1LROA 1XL9A 1QNVA 3CEUA 4UFMA 2WKJA 4N4QA 3NR0A 1OFEA 2I14A 4LVDA 1MEHA 4NT0A 3QSTA 2VEIA 4WOQA 1UJPA 2NXGA 4TX9A 2NUWA 3LCLA 3P81A 3QMTA 1OHLA 5F2GA 4N4PA 2YFOA 3NQFA 3Q2DA 1TPFA 1B4EA 3W85A 3LCWA 5KSWA 3UWZA 3HGSA 1B9BA 4MJZA 4JYFA 2B0MA 4K38A 1AW2A 5A8GA 3TR2A 2VOMA 5AC8A 1FBAA 3UPWA 5LNVA 3IGUA 1PHQA 1SZFA 3CC1A 2DZTA 4UNKA 1FWWA 3M1ZA 4O19A 4UTWC 3G1VA 3W1AA 4Y9AA 4M5PA 1XBVA 4I7WA 3HGRA 3CM4A 4JEQA 4DO6A 2E09A 2CW6A 3LGEA 3KOFA 5IBXA 1EP2A 1ICPA 1W54A 3KVLA 3LHZA 4CCEA 3W84A 3P84A 3EWZA 3C8FA 3FYPA 1BEUA 3IVUA 3TKFA 5AYZA 5AFDA 1F5ZA 3QM3A 3BG5A 2Y7DA 3HGOA 1G67A 5EBUA 3HMJG 1JCLA 3CWOX 4CCCA 1H7OA 3OIXA 3GKAA 1PCKA 3ELFA 1SFLA 2CLMA 2I1OA 1Z48A 1FUYA 3NM3A 1UUMA 3G3DA 4H4IA 5D2WA 4GRSA 4K6AA 3WFAA 3T44A 3NQMA 2NUYA 1EUNA 1IXOA 3QW4B 1GYNA 5C2XA 5G2HA 1DVJA 1I2RA 2YFNA 1YXCA 3F4NA 1THFD 3S1XA 4LUJA 2RDUA 3G8EA 3G1AA 3KHJA 1GVQA 1RQBA 4O1BA 4O14A 1A53A 4LVGA 1ADOA 3W6YA 2Q3OA 5G5IA 3AO0A 2H8XA 1I2PA 5HULA 3G1FA 4TR9A 5E93A 2ZZ2A 1Q45A 5AHIA 3NQ8A 5LZLA 2E5CA 5CGQA 3W1NA 5K4ZA 3RU6A 3MYPA 3IIOA 5D38A 4Y90A 1O95A 2TSYA 3TU9A 4RCXA 3TW7A 2VC6A 4QNWA 2C1HA 4MZYA 2D73A 1KM1A 4UR8A 1W37A 3C2OA 4O18A 2X30A 3I7RA 1GWJA 1KFLA 3WK0A 4FO4A 1SO4A 1JQXA 3WJZA 4OU1A 1RV8A 1OFQA 3UYCA 3NL2A 1VGAA 2PRMA 3E96A 1NFBA 2G96A 1UBSA 2CLOA 4Y96A 3S1WA 3LTYA 1WV2A 2JGYA 3LDVA 3P67A 1W3TA 4QAIA 4LRTA 3C0JA 3S0CA 1MXSA 1JVNA 1Q6LA 3WK1A 2GVLA 3M41A 4PTNA 4RZ5A 1RD5A 1R46A 4R33A 2GUUA 1R2TA 2YXGA 3LHTA 3SZ8A 1ZNNA 3PG9A 3UWVA 5CPLA 1Z41A 5FF2A 1UCWA 2NWSA 2Y88A 4ONVA 1A5AA 3FA5A 2YYUA 4WQ6A 1GVRA 3W88A 2FJKA 1PS9A 1TV5A 2YDAA 3FJ6A 1BKSA 3G1DA 1TCDA 4FIRA 3LRKA 4DBDA 3NA8A 3S42A 4X2RA 4LUIA 3BGGA 2J27A 3BLFA 4JIQA 3NM1A 2YYTA 1OG0A 2F84A 5F4SA 1KLZA 2H3DA 1UASA 2BZNA 2C6QA 4A29A 3DZ1A 3L21A 1FXPA 1D9EA 3S9YA 4JD4A 2QCDB 3DU0A 2DZPA 4DO5A 1KW1A 3DHDA 3BPWA 3W73A 1YTEA 2Y63A 3CIWA 2GQ9A 4KFNA 3A24A 2LLEA 5TIMA 3GNDA 4AVFA 4NNAA 2ZYFA 4R34A 5D02A 1C9DA 5U4NA 2X1UA
chains in the Genus database with same CATH superfamily
4LUYA 1HL8A 2W0UA 3AZTA 4HHPA 3IPWA 2QAFA 3EX2A 4NUWA 1P1MA 1LP6A 3MI2A 3W7LA 3STFA 1WKDA 2Q01A 1DV7A 3MVTA 1BQCA 2WCSA 1VLWA 2CLHA 2XGZA 1EJWC 4LPCA 3WLOA 2FQIA 3PZGA 1TV2A 5JUVA 1RP8A 1J2BA 4DWSB 4GY7A 3F5KA 1S39A 2PODA 1XKYA 4YVPA 3H70A 1DJXA 2PSNA 9RUBA 1DQUA 4LS2A 1G5AA 4NZ4A 4UFLA 1MEWA 1SSDA 3M0VA 3WD3A 2A3AA 1VBRA 1XLDA 3QGAC 4YS1A 5EU9A 3S2LA 2XPKA 4YHEA 2D22A 4N0RA 5JBDA 4N6FA 4D6EA 4H9MA 3ALGA 3T05A 5FJUA 4MFEA 1SR0A 2UWFA 4IOTA 4IF2A 1UQYA 3N29A 3RXZA 1R3SA 1XG4A 5CPSA 2A3LA 1R7AA 1X6UA 3ISIX 5LIUX 3D3AA 4V1YA 3M7SA 2VRJA 3BG9A 1M7JA 1OFRA 3VDGA 4RNJA 3NSMA 2XVKA 3DFPA 4WKFA 3ABXA 4HA1A 3BK0A 1US2A 3ZFHA 4IFKB 3UY7A 4M7SA 3W72A 2XSXA 3EOSA 3PZMA 1DWHM 1SFTA 3A4WA 1TR9A 4YTSA 4WDUA 3ZT7A 5HAOA 3KS5A 1GQJA 1S2CA 2DIEA 3HQ1A 3GXMA 2QIWA 3KP1A 3TQKA 3B40A 3S2JA 3BURA 1J18A 4JTCA 1ZB5A 4AX6A 1XISA 4JYEA 3SI9A 3AXMA 1Y5WA 2FFIA 1E6RA 3OLEA 2OPJA 2WSYA 2XJ7A 4HMCA 4IPJA 4JYDA 4GACA 3NJ3A 5FOOA 1FWCC 4WGXA 4J7RA 3GG0A 3T8LA 3W1XA 2OG9A 3H2EA 4LY4A 3DG3A 4YWIA 2IW0A 1L6WA 2QYGA 3GWQA 2ATMA 5A8MA 1SZEA 4MHBA 4ML9A 4NKCA 2OQYA 3LQLA 4BI7A 2CLPA 4JKMA 1Q6DA 3GYEA 3LHVA 3TN4A 4HU0A 1Y5XA 1YPIA 2P1FA 2YB1A 3JVAA 4GA8A 4PTVA 2Z0IA 3CL8A 4LXFA 1W9XA 3O0FA 3E2RA 4PGLA 3W1TA 2R1LA 1GUVA 1W0MA 3UVIA 1VYRA 2R1NA 3MUAA 3AS1A 3BLEA 3O63A 3KHDA 4GD0A 3W02A 5KEZA 1EHNA 5FJJA 2HJPA 3WQ6A 4CLMA 3IJLA 2EBNA 3FLUA 5BXRA 1E6NA 3B8UA 2I9EA 1V4YA 3LGGA 1JUEA 1OT1A 3UZJA 2QCDA 1A5KC 1ADDA 1TVLA 3CMFA 4ALDA 2ACRA 3CAKA 3SN4A 3KFTA 5D37A 3VKCA 3R6IA 3T2OA 3B3DA 2J6VA 1NWUA 5REQA 1LUCB 4RV3A 3DESA 3UVAA 2XH7A 2EKGA 3EB3A 4IPPA 1UIOA 2FTWA 3O6DA 2QDHA 4GVGA 4HYVA 3RILA 5JIPA 3GXNA 3UR2A 3I7SA 1EC7A 4I5RA 1DEDA 3LRMA 3SY5A 3CHVA 4KEZA 1XJBA 1X39A 2J79A 3F1QA 4PE8A 3M0ZA 5M2FX 2GDUA 2V67A 4DX3A 4C5ZA 3AWNA 4MIMA 3W6MA 5H8UA 4UTUA 3M0MA 1JDEA 4A6GA 2OX1A 1Q6RA 4W93A 3ZWSA 4KGLA 1CZ1A 3VE9A 2YW3A 3M0XA 4B92A 3M5YA 5KMYA 5D2TA 3RRXA 1EJ7L 1QNQA 1OX4B 1W3JA 3QBUA 2YA0A 6REQB 1JD9A 3PHAA 4JXCA 3P60A 2A21A 5KZDA 3PJWA 3UCQA 1PX8A 3T55A 3OBKA 4HHHA 1S5WA 3ZIZA 4DI8A 1NOUA 2VFEA 3OQ8A 2R94A 4XUGA 2B31A 7CGTA 3SUUA 1ZP4A 2PEVA 5B7ZA 1XDLA 3BAIA 4F0HA 5EMUA 2DSWA 3II1A 3W28A 1GT8A 1FOBA 3TMQA 1A5MC 1UWUA 2DT2A 3WLJA 4ZE5A 2NV2A 4JL1A 4ERIA 1CGUA 3TIMA 1G4PA 4D9PA 1IGSA 1MNSA 3GD6A 1ITCA 4GUJA 3EXTA 3CAWA 4MNJA 3MJYA 1E1CA 2CZFA 3N17A 3LENA 1LOQA 4MPKA 4MNKA 4EANA 1LQ0A 3LB0A 1JDFA 4BI5A 4CD7A 2WKGA 1UA3A 1LJYA 2V3DA 3URNA 4AY8A 3C52A 1ZL1A 5LA2A 3EDEA 2O9TA 3SCTA 1RY8A 4E2BA 1WXYA 4LF2A 2WK2A 2B7OA 2OQHA 2DSKA 1B54A 4G2DA 1H7WA 2PDGA 1H3GA 4XVDA 1ZSXA 3LHYA 5D05A 2FPTA 1SMDA 2ZBTA 5HJXA 1SO6A 1CBGA 3K30A 2ZICA 3L12A 3NOYA 3MBFA 2A3HA 1HUVA 4LV9A 4M3PA 5C7VA 3W82A 4F0LA 4F4RA 5KZ6A 4E0CA 4KEMA 4OV9A 1SU5A 6CGTA 1WAUA 2A0NA 3OBAA 4ZENA 3HG4A 4HU3A 2ZZ7A 5EA9A 4M29A 2B7NA 4J27A 3DFHA 4AYSA 1ONWA 3GTIA 3BGAA 4GXPA 5TBOA 3VNZA 3CQ0A 2VMFA 2ZZ6A 1N7KA 1VZWA 4NX0A 3B8VA 3H24A 3U0HA 3I68A 1TV8A 1H62A 1D8CA 2GDVA 4NRSA 4LALA 4AIUA 3IVTA 4EXBA 1YKWA 1TJPA 3VO0A 3IGHX 1EWDA 2J6XA 4KERA 1D7FA 3BLOA 3S5YA 4FP1A 1MMFA 1YX1A 3RR1A 1R9XA 3C56A 4JX6A 4AZ5A 3MKKA 3C5QA 4XZNX 3AS2A 2Z2AA 1GW9A 4ZODA 1TPC1 1BRLB 3SIMA 1OT2A 4I9MA 4V27A 2Z25A 1TQXA 2NV9A 2QMKA 3ZS4A 5FJOA 3CLMA 3R7MA 2R14A 4ZFCA 4CGTA 2O9OA 1B31A 1HP5A 1J01A 3QXBA 5DX7A 5FKYA 1A49A 2J7GA 3S5OA 4CD6A 2BS9A 3O0KA 2CZDA 1D3CA 4L1XA 4GH1A 4AD2A 3CMGA 1DKWA 1FDJA 3UY8A 3ME3A 2RGLA 2G8ZA 2Y0FA 4S3DA 4L65A 1GKQA 1H49A 4AAJA 3W81A 1MQQA 1QHZA 3VILA 2WNWA 2BFGA 1YE4A 3TSBA 3WMSA 1QUMA 3SB0A 2J8GA 5HR6A 2JF7A 2NV1A 1W31A 3AIVA 5T91A 2Z1XA 3WQCA 1W9DM 3I3BA 5BYWA 3EMCA 2ZUVA 3TC3A 1ZJHA 2WM0A 2BOFX 3N4AA 3H2AA 5G4EA 5HQEA 1X7FA 1XS2A 4C7GA 2OQLA 1T8QA 5HQMA 3TC7A 3MB9A 1TO3A 1AMYA 4JTSA 2VDGA 3UCCA 1QNRA 3WDHA 1M5WA 1RAKA 2E0PA 4JGDA 5A2CA 4UR7A 3ZR5A 1ZJIA 4MGGA 4EOUA 1F3EA 4NVTA 4XAFA 4DLMA 3KBMA 1IWBA 3NQ6A 4LYRA 1E3ZA 5CSSA 1S2TA 3W2LA 2Y7GA 3Q94A 1DJNA 2OJPA 8RUCA 1W2VA 3LHUA 5BU6A 3UXDA 1US0A 3KEHA 2FHFA 1E3XA 4U2YA 3NEVA 2X42A 4O16A 4WLCA 2OWWA 3GX9A 4J3XA 4M6QA 4D71A 5AC7A 1PZ2A 8XIAA 3GHUA 5HNTA 1CGVA 3NGJA 1BTCA 4LYKA 5I00A 2YLAA 5HINA 4O10A 4CQ8A 3L2LA 1W8GA 1UH4A 2TODA 3VIHA 4G7FA 2CBVA 3UXAA 1K8XA 4X0VA 3RGTA 4GZJA 5AYBA 5C5YA 2DZVA 3TE9A 4TVUA 4O8RA 3VX1A 5EYWA 3HG3A 1H1YA 3OJGA 1XIJA 3C6CA 1OC7A 3T0TA 1JI2A 1GQKA 2PI6A 2ALRA 4D6DA 3ATYA 3NQ7A 3LM3A 2RDXA 1XCXA 4IX2A 4TUFA 5CBJA 1O1ZA 1CLKA 2VKZG 4FZIA 3VFCA 2CZEA 5CLWA 2HVNA 1TSIA 3S9IA 3MMUA 4OE7A 3STPA 4AVNA 4IMAA 3I10A 1H50A 4PTWA 1JF5A 4LCQA 4WOZA 3V0UA 1EGMA 4L4LA 5T8GA 2YZRA 4UQEA 3APYA 3M43A 1I45A 3BCDA 1W1A1 1MZRA 3F4WA 2D0FA 2VFGA 2Z6IA 1XH0A 3MANA 4PEEA 1B4KA 4XBJA 3QV9A 2J7CA 3G1RA 3AOFA 1YLVA 1UR4A 3NO3A 3CAVA 4MYAA 4BJHA 3W70A 2DV0A 2Z1SA 1ZU8A 2GJRA 4UQBA 3LSBA 4GHRA 3UEQA 3TYDA 3QC3A 1DTUA 1R2RA 3VIIA 4WF7A 4FOKA 4LNCA 3MO7A 4D1IA 4XIAA 4MMWA 2HRWA 4IG2B 3M0IA 1CI1A 3UWWA 1R30A 4LS1A 3BE7A 4LWWA 2J75A 1EBGA 2DGAA 1M1BA 1PB0A 4NI3A 3GH7A 4R53A 3U5UA 1KFEA 5J5RA 2ACSA 3A4AA 3IARA 2INZA 3OU8A 1JD7A 1WBHA 4GX8A 3WMBA 3VOFA 3PUDA 5CPQA 1UWIA 3DC8A 1Z44A 3E6EA 1EC9A 1TFVA 4RE4A 1XRSA 4LTSA 2D3LA 2A85A 4F9DA 2ABBA 3BG3A 1KKOA 1XPGA 3NDZA 1K9TA 1H2JA 5FI8A 1R2SA 3TTQA 2TPSA 3GTNA 4JN6A 5BCAA 2J77A 4BHYA 1H11A 4I8YA 1UUQA 4HKPA 2O7QA 4D6GA 4LYQA 3VIGA 2E1WA 3ITCA 5CSYA 1H0GA 3CPRA 4BZYA 2NQ5A 2WKLA 1LT8A 1R87A 1EZ2A 2OYMA 3TTYA 1XQLA 2WHLA 1VCFA 2XIBA 2HVOA 1KQYA 3MSYA 1K7FA 1QNOA 4AZCB 4DUXA 1NP0A 3RM9A 2XTKA 3B0PA 2OEMA 4C7FA 4RE0A 3FAXA 1S38A 2W6RA 2ZDSA 5C9RA 1HTIA 3CTLA 4HT3A 4LQ1A 1J93A 3EDJA 5TQLA 2NT1A 2Z7KA 5FAJA 1PWLA 3E0FA 1JAEA 1IWPA 4JHMA 1V3IA 3W22A 3STCA 1EJTC 3VGDA 2WBKA 1KD0A 2R1PA 1IR2A 2WMJA 3AHVA 4E2DA 3MHGA 1AJ2A 3EOUA 2ZUMA 2G3JA 4P7LA 1AVAA 2I9UA 1UWRA 2WVUA 4NX5A 3ARUA 1M6JA 4B5TA 4XSLA 4O17A 4HJWA 5GNYA 1HIZA 4KWOA 1J6PA 3A6OA 4OHQA 3G1HA 2P76A 2PD5A 1NWTA 2DT1A 3IJQA 2ZXBA 1ZALA 2E6YA 1J9YA 1NH6A 1UWQA 3WDRA 4DAFA 2BY1A 3BGJA 2R82A 4H8UA 5I3DA 3QSRA 5C55A 4E3TA 3PC0A 1JULA 1SVDA 1Z6KA 4ZXLA 3OHIA 4NXKA 5I3FA 2GVGA 1KKRA 3IK2A 3WBXA 3PSVA 1KM3A 2Z28A 2OGJA 3WK2A 4XD5A 3VKAA 1OCBA 3WH8A 3NZGA 4R9XA 1XXXA 5GJMA 1NJJA 1MUCA 2WNZA 5LGZA 1KXVA 2YXXA 4PUKA 5A6TC 3JW7A 5K7JA 3J7HA 2YDRA 1S5TA 3KRSA 3RCYA 4AFYA 3EEZA 1E5NA 1QCWA 1TWSA 1JZ3A 1OFOA 2EHHA 1PE1A 2XZ7A 1JXJA 1TR1A 1TA3A 4PRTA 1GGOA 3HO8A 3PBWA 1LOSA 3BQ6A 3OVRA 4A4AA 5C2CA 2QDDA 1TX2A 3M6YA 3WQEA 2OWXA 2XH2A 1H5YA 4NU7A 4QJ3B 3H22A 3E0VA 4W85A 1SFJA 4GXMA 5DBTA 1F8IA 1EKOA 3WLQA 1SJDA 2P3EA 5FL1A 5CZ0A 3NPWA 2XIIA 4QLKA 1ZAHA 4QLLA 1JI1A 1Q63A 2XM2A 1PKYA 4E2OA 2GSEA 2CBJA 5HK4A 1SW7A 1LLWA 5DMYA 4CNOA 1BF2A 1M01A 4BQ2A 3SAZA 4Y7EA 1LWHA 4JIEA 4CN4A 1XLBA 4DJDC 4X2PA 1MSSA 3WLLA 2H6RA 1KTNA 2VX5A 2BB0A 1NF0A 2PP3A 2E6FA 2GGHA 4HK7A 3B4UA 3W7EA 2QCCA 3TR9A 4KWSA 3W71A 2Y85A 3KBNA 3WLRA 2PZ0A 3T78A 4JCMA 4QS6A 4HCHA 2Y4SA 4QDWA 3N12A 3ZVHA 1OYAA 3MS8A 4HBKA 3O8AA 3T6CA 4C6MA 1RCOB 3BSGA 2G5WA 3GB6A 5AZ1A 1FP9A 1XR2A 3CTTA 1OINA 5A6LA 1QK2A 5ABTA 5FSDC 2PGRA 4B5NA 4H2CA 2UY2A 1PTDA 3OG3A 1O5KA 2JF6A 5BXSA 1W56A 3I4EA 3L23A 5CJNA 3UD6A 5D33A 4RK8A 1DJYA 1OK4A 1VJIA 4ORMA 1KV5A 3GBDA 4IGNA 4EIVA 2VJXA 2PFHA 2HMCA 3UFYA 4OBRA 4QRNA 2JK2A 4OBTA 3QRHA 4E5TA 4GIRA 1SO5A 4XD6A 1DWFM 1RHCA 1Q2SA 4K8HA 2ZVRA 2UY5A 3EDKA 4DUWA 1AD4A 3HJZA 4K1GA 1YTDA 2PDYA 3QHMA 4QIUA 4QJ5B 2NQLA 2CETA 4W7UA 3A3HA 4N2YA 2YL9A 4XBKA 2JKPA 4Q3MA 4HYWA 2P3ZA 2BXVA 1VH7A 5DCBA 2CWNA 3ZLHA 1IIHA 2G95A 2QPSA 3N13A 1U1JA 3MYOA 1TTIA 1X1OA 3AIBA 3VIKA 3DYOA 5G4HC 4UTLA 4MJMA 1EL3A 2J8FA 5CZJA 1XLIA 3KWXA 4DJDD 1LG1A 3OA3A 3S5ZA 2VRKA 1HJUA 5DO8A 1KCXA 1G94A 1XD1A 1K02A 1QI5A 5HJYA 2ZADA 1M7OA 3WLPA 2C0AA 2OR2A 4YIWA 2CC0A 1MXDA 1I4NA 2B7QA 4JTEA 1GW1A 1REQB 3FNDA 1DJWA 3P74A 3VOJA 4IXXA 1P1XA 2BVTA 2E77A 5KZEA 3W24A 1PZ1A 3VOHA 1K1DA 1P6BA 2DW7A 2PWUA 1B0IA 3UZXA 1UA7A 3L66A 4C6QA 5BW6A 3TYUA 3TOPA 1OCNA 1PIFA 5HMDA 4OZOA 2PTWA 2ALDA 1V0NA 4NZ5A 1LF1A 1A4LA 4MLRA 4BK9A 1Q6EA 1VYSX 2VFDA 4YVVA 3BVJA 2IPGA 1P7TA 3MMTA 5LNWA 4KCVA 3NCOA 1CNVA 2YA2A 1AZ2A 2PWEA 2XUCA 4M0XA 1UB3A 3GDBA 4HMNA 4TVCA 1TELA 4B15A 2W9MA 3R8RA 2GL5A 3QYQA 3CB3A 1FHLA 5T26A 3P0XA 3HG2A 5LGXA 1VHNA 1Y65A 2DUXA 1J10A 3T9PA 3ANYA 3WF4A 1XBZA 4GH3A 3MC5A 4GE8A 5CPOA 1L6GA 1TV3A 4NZCA 3WD4A 1EH9A 1FDZA 1YW1A 4TX6A 1KXTA 2P50A 4B9ZA 5K9CA 1FWRA 3VNIA 1PX3A 3V16A 3V75A 1DL3A 3LY0A 4AG0A 4BQ5A 1ONRA 1NDZA 3L4UA 3WUBA 5CQ1A 3GDMA 4O12A 1WPCA 4PMUA 2REQA 2OT0A 3CU2A 1QWGA 4NYUA 3MP4A 3ATZA 2WJFA 3N2TA 1TV4A 2W91A 1UKOA 1QPKA 3EKZA 1UR9A 3W1MA 3DCPA 3NGFA 2YCLA 5FEPA 2DSUA 4R88A 4IM4A 1PAMA 2UZ9A 4LC8A 3P80A 3SR7A 1CTNA 1Q6GA 2C16A 4P61A 1YIXA 2V38A 3WELA 2JFEX 4A8IA 2PLCA 4FXSA 5I02A 1VD6A 1JJKA 4V2XA 1YBQB 2GOUA 3GR4A 4BA0A 4C6NA 2VURA 2PDWA 3REQA 1MRQA 2E68A 4PUNA 4EPKA 5G4WA 4F0SA 4GNJA 2WVVA 3S5NA 3MI3A 3OLIA 4RUBA 4ZO9A 1VEOA 4IIHA 3NVDA 3RPTA 1UD8A 5H2ZA 3WO8A 3WDQA 2QCGA 4H8HA 2INEA 4FAMA 1QNVA 1MFUA 2J62A 4UFMA 4AD0A 2WKJA 2PDJA 4B4FA 4NL1A 5IDIA 2VEGA 2V5DA 1GK8A 1MEHA 4NT0A 3QSTA 3KTCA 4QAWA 1QW8A 2NXGA 4ACZA 5B7YA 1JL8A 3LCLA 3P81A 5JH1A 1KXQA 3ZJ7A 5CPTA 3T0AA 4YN5A 3RLGA 3W85A 1KC7A 3LCWA 5KSWA 3UWZA 2X7WA 4MJZA 4AVOA 4K38A 5A8GA 2VOMA 3JZEA 2R9RA 5LNVA 3IGUA 5T9BG 1BYAA 3CC1A 4LYPA 1LT7A 4UNKA 2DIKA 3M1ZA 3A4XA 1LL6A 3W1AA 7REQB 3BCFA 4M5PA 2BMBA 3SQLA 3CM4A 4JEQA 3QGVA 1U5VA 1B3WA 4W5UA 2D20A 4F0KA 3NEHA 1EP2A 3KVLA 4CCEA 3ARZA 3HV9A 3UR5A 3LEPA 3W84A 3EWZA 3FYPA 3IVUA 3TKFA 3QM3A 1XF0A 4WJXA 1XYZA 5EBUA 1JCLA 4CCCA 3V7PA 4UOJA 3OIXA 1VIZA 3ELFA 4B3KA 2X0YA 4GZEA 4GRSA 4E3VA 4GVFA 5LXEA 5HANA 1GYNA 3WLNA 1AQFA 1EDTA 3UJSA 5C2XA 1S2UA 1THFD 4XX6A 2RDUA 3G8EA 3G1AA 4JFWA 1GVQA 1RQBA 3S4TA 3W6YA 3FVDA 3QY8A 4D72A 3AO0A 2H8XA 4TR9A 5E93A 2YCKX 2ZZ2A 3PZIA 3PK7A 3NQ8A 3EOEA 4E8DA 4K2SA 5K4ZA 3RU6A 4CU7A 4DLFA 4Y90A 3OZMA 4WR3A 1ZGDA 4C6CA 1FVPA 3TW7A 2VC6A 4MZYA 3M64A 2PDHA 3BMXA 1ISVA 3E5PA 4O18A 1KFWA 5A3HA 1Q7ZA 3TN3A 3AROA 3RPMA 1JQXA 1YDYA 3WJZA 4OU1A 3VGEA 1OFQA 4S3AA 3UYCA 2AOSA 2FTYA 2PRMA 3E96A 2D2JA 4MJ2A 1CGTA 1SJAA 3ZOAA 1XSJA 4Y9NA 1GVEA 1W3TA 3FSUA 4QAIA 3CV2A 3EPNA 5A2AA 3CT2A 2J7DA 2JEQA 5MKGB 4RZ5A 1V6VA 4M80A 4K3ZA 2ZXDA 3VD7A 4ZSTA 5CGMA 3W38A 1V6WA 3SZ8A 3CYVA 4KIEA 2ACUA 1UCWA 5HBFA 3VINA 2FVKA 2X1IA 1KBBA 1XYCA 1C93A 5A6SA 3G1DA 4AZGA 2V69A 5F7UA 3H21A 1E9YB 4LB4A 2W3ZA 2ZXAA 4LUIA 2AMXA 3BLFA 1DE5A 5F4SA 2H3DA 2C6QA 1NFGA 2BZNA 3TJ4A 3DZ1A 1MNZA 3R0DA 4PCSA 4DZHA 1XLMA 3S9YA 1RA0A 1UOZA 3SRHA 3EBVA 3DHDA 2YCLB 3XISA 2CITA 1N8IA 3W53A 1DPMA 4WDWA 4R34A 1CGYA 2WJEA 5D02A 3GNOA 3RITA 2X1UA 1FHUA 4MKSA 5HWJA 2NLYA 4P2VA 3AU6A 3GNPA 5HWMA 4E4PA 3P93A 1A5BA 4ADUA 3VNKA 1K8ZA 4YCPA 1XIBA 1F6YA 5DF0A 1CXEA 2X2YA 5CG7A 2YXOA 1PHWA 3REQB 4KRUA 3SFWA 3M0JA 4GCXA 4H7VA 3PUGA 1VP5A 2WVVB 1Z89A 1AH3A 1AW5A 4IICA 4RR4A 2QF7A 2ZA2A 1OJXA 3KWSA 4GIYA 4FI4A 3QV8A 3QZEA 4Z2JA 4Z2HA 4S39A 2FZDA 5ECVA 4XO7A 1WXZA 3VZXA 2CKSA 3L7RA 1SM9A 3WQWA 1AMKA 3SGUA 4REQA 3GYCA 5G1TA 3ZSTA 3GIYA 2YBTA 2J47A 2VZVA 3DFNA 4D8ZA 5SWUA 5C9XA 4MB5A 4FF5A 1JCXA 2Z7GA 1GQNA 5D2XA 1OSEA 1Q6QA 1QI2A 4H00A 5E0KA 2PDIA 3WCZA 4A2SA 4W5ZA 3O1NA 3ABQA 4DJDA 4FX6M 3T1GA 4XBSA 3MPGA 4H6KA 2GK1A 3AZSA 5CXPA 4H7CA 3FDGA 2W66A 4LVAA 1ZUAX 2D3NA 2FB3A 3M44A 1B3OA 3NO5A 4XVEA 2ACQA 4GXWA 2BHYA 1J0KA 1UH2A 1WOAA 4W9TA 4KBXA 4D6JA 3PSWA 2YR1A 4DO7A 3ZQ9A 4H6QA 5AVHA 1F6KA 1RXOB 4MWAB 4J2PA 5EGRA 2PMQA 4PBEA 3GRIA 1K8CA 1LBFA 4XV0A 2NQZA 2WW5A 4Z1BA 1MQPA 3H53A 1E0XA 2DVXA 6ENLA 5FJTA 3T0DA 3DXIA 4FX8A 4ICCX 1VFHA 4DB7A 2VD8A 5F4WA 2OOGA 1QI4A 2F2KA 3P14A 4CNUA 2J4GA 5CPNA 2IKJA 3AHZA 5H91A 5A1AA 2SFPA 3LPPA 4OOZA 4NJGA 1ZBKA 2DSZA 4JL2A 3VIFA 3HQNA 4EXQA 1D2KA 2NVAA 3K8LA 3KAOA 3IUIA 3AIUA 7ODCA 4LAUA 1XLHA 3THDA 1RQEA 3W2JA 4UTFA 3QZAA 1BVZA 3ID7A 5ABFA 5HJLA 3WF3A 3OG2A 5HATA 3BW2A 5AVNA 1ESWA 2EKCA 3SY1A 3C0LA 4Y9OA 1S3HA 1H1ZA 2J9XA 5AC6A 5RUBA 3B8IA 4N42A 1HT6A 4A05A 1F07A 4JIRA 2PC8A 2V5BA 4AIBA 2WYSA 1CGXA 4S1FA 3LPOA 4E4FA 2FGLA 2GJPA 5FF7A 1JUBA 4A8RA 2GQ3A 5E6ZA 1NWRA 5IM51 4IXHA 3WKZA 3L67A 5BRPA 1WDWA 3G22A 3UG5A 4MADA 1HNYA 4BWLC 4OECA 1XCFA 3ICJA 2YIHA 3W00A 4AW7A 4O1FA 4AWSA 2FB2A 3WLTA 1ZJAA 2XN0A 1W5NA 1X6NA 4KEUA 4NG3A 1IZCA 4CCDA 2HSAA 2OKTA 3W2NA 4IL2A 1YDNA 1H0IA 4DUOA 2GJLA 2H9AA 4RDZA 2VOTA 3DDMA 3P2VA 4AY1A 5AHMA 1WYIA 2PP1A 3B9NA 5C70A 1QTWA 4ZVJA 4HU8A 3ITLA 3UW6A 3TYZA 1F76A 2OO6A 3MSRA 5AHEA 3FKKA 3BAYA 3EA1A 4QE1A 4F8XA 1U30A 3SSJA 2OLSA 1EEXA 4RKAA 3O3RA 1LCOA 2WSQA 4GY1A 3C2EA 2IXVA 1NWSA 4G1KA 3P8IA 2RJGA 1V8EA 3GLCA 3RCMA 4OT7A 1M04A 5CAKA 3MP3A 2BVDA 4RDYA 1VPXA 5IOBA 4KPLA 2HTMA 3UXKA 1TTJA 2Y7FA 2IPWA 1OYBA 3S47A 4US5D 5M17A 2W62A 2QT3A 1P4CA 5FJPA 5I77A 3MO4A 2XGBA 3M07A 3BLLA 3MVIA 3EX6A 1ME9A 5AOUA 3VD3A 4GYJA 3WDJA 2GOKA 5A6MA 2CU0A 4GGBA 4GNKB 3KOYA 2ZDRA 5BMWA 2X0HA 4FNPA 3AHXA 2Y5SA 3EWYA 4JNYA 3TA6A 4JR5A 1SW0A 4L6DA 3N9KA 2DZSA 4XKYB 1NDWA 1B9ZA 2PTDA 3RX3A 5DY3A 4L4PA 3SURA 1X96A 4IFOA 3UZYA 1E70M 4Q8MA 2TAAA 3MCMA 1N55A 1QOXA 2HVMA 2A6NA 1M03A 2XIQA 4OFCA 4ZCWA 3LNPA 2C91A 3TJXA 4LOCA 2X41A 1JCTA 1M65A 2VYOA 4PULA 1LLZA 1FX6A 4ADSA 1MWOA 3SUTA 1U22A 1UP2A 3WH6A 3UBPC 3VCNA 3W7OA 2RFGA 1W3LA 3FY1A 3L5LA 4C1NA 1NEYA 4QG6A 4BFAA 3VNLA 4MZ1A 1UJQA 1K70A 1KB3A 3B05A 1PCWA 3C3NA 4BR1A 4JTTA 4GWEA 1ICQA 2QV5A 5EMLA 1C7TA 3CHDA 2OWCA 3N9RA 3USZA 4NHVA 5G2IA 4A3RA 2IKIA 3ERPA 1HKWA 1NM9A 3GR8A 4QTGA 1GOXA 4ICMA 1XDJA 4LY8A 3QN3A 2PRLA 3UWYA 3FEQA 3VYLA 4JTKA 3GDRA 1OFDA 4YLWA 1R9YA 5F2MA 3N2CA 2BG5A 3ZJ8A 3BC9A 3QR0A 3R94A 5AYYA 3LHWA 3CBWA 2V5KA 1EOMA 3LCXA 2IMRA 2PF0A 4PCNA 2Z2BA 1H09A 4LV4A 2DU2A 1GKPA 2V63A 3CJPA 4MJ4A 1C8XA 4KFPA 3B03A 1KTCA 3C2VA 2PDFA 3WK3A 4DPQA 2VEMA 1EC8A 3ITXA 4OV4A 3NL6A 2KZHA 2ON3A 3BDKA 5ABFB 2XSAA 3TQPA 1NDVA 3W25A 3HFTA 1GVYA 3VC6A 2OYLA 4I7UA 1WOBA 2YCIX 1XLEA 1Q13A 2Z00A 2VEFA 1G4TA 3W7RA 1F7BA 1Y0EA 1X1ZA 2WJZA 1RSCA 4ZB2A 3RN6A 3CUJA 4GO9A 4YL2A 4J1OA 3O07A 1J8VA 2GGIA 1MO0A 3S1UA 3CIVA 4ZO6A 3AMLA 3BLPX 2EGZA 5A2BA 2ZX8A 3VI2A 3LA4A 1JG9A 3TROA 2GQAA 3CMJA 3TUUA 3R4IA 4PFMA 3L68A 2A7RA 5HUOA 4JDBA 2PZNA 3AI0A 1H41A 1W91A 2NVCA 1L2UA 4TX8A 1WDDA 2PGWA 2EQDA 3VM7A 4PB3A 3AYVA 2IPFA 3UJEA 2QMJA 4XZHA 1V3JA 1TMHA 3QQ0A 3EDDA 2G3FA 2RKXA 3G0UA 4HOXA 4Z1YA 3V3WA 3H23A 2VP8A 3UNTA 3NAVA 3CO8A 1BGAA 3APGA 3ITYA 3PJUA 2FPVA 1VPYA 3WLKX 3M0KA 4FF7A 2ZQ0A 3MHUA 4XKMA 3A5FA 4FHAA 1JCYA 2Z1KA 3S2NA 4Z42C 5AYIA 5HNRA 1EOKA 1OM0A 2HNEA 3R0UA 3BJSA 4ZQRA 5DRCA 3W7CA 3R0KA 1EO7A 1V0LA 2YL8A 1E55A 3TC6A 3P3BA 5I3HA 1E4LA 2J13A 1G69A 4GGHA 3VCRA 4Z2LA 2WWCA 3MUXA 3ZM8A 4IX0A 3U8GA 4QBXA 3DBPA 3S8HA 2VZSA 2NWRA 5C7HA 3B0VC 3URBA 3BUVA 4IIFA 1SSGA 3WG6A 3CL6A 4HTBA 4HNNA 4HOWA 1JDDA 5DXXA 3AXXA 4EXAA 1RJPA 4HP5A 3PTQA 2XH0A 2CNCA 5I0DA 5I6SA 3DFOA 4KW2A 2HEJA 4HPGA 3IACA 4RW3A 3K8KA 2QJHA 2X1RA 3JUGA 3NQAA 4KWWA 1BLIA 2VUNA 5CZSA 3FS2A 1EP1A 2DW6A 1CXKA 1U5HA 4BEUA 4IH3A 4BKNA 1HKKA 2QUTA 1EHAA 5EMYA 3V0TA 3KCLA 4JQ2A 3A21A 1ODUA 3U4AA 1JUKA 3RMJA 1R3YA 1GOWA 1T0OA 1GYLA 2IQTA 4FLRA 1KBKA 3LCIA 2RJHA 1V79A 2FZBA 4RDVA 3CYJA 1I0BA 5BROA 3T0BA 3U2EA 5E9AA 3WIJA 4LBSA 3Q58A 4LBUA 1EQPA 2QS8A 4M19A 4UC5A 4WHBA 4CN6A 3O6YX 3N1AA 2ZRZA 3GQYA 1C8YA 3PVFA 1B3XA 4TU1A 3GTFA 5L9FA 1RH9A 4FPSA 4QXIA 4CQCA 2CXEA 4JX5A 4HHLA 5C54A 1R0MA 3LV5A 2OXNA 2V2CA 1JR1A 2G4JA 1R9ZA 1KM0A 4HPNA 2XFYA 3U3HA 2PTYA 1QXLA 1IE7C 4LANA 3NYDA 2D69A 2CFFA 4F0RA 3LS9A 2FLIA 3SCNA 5IBXC 4JQ1A 1R8LA 1HJXA 2VD9A 4X22A 4ADTA 2WVTA 2XINA 2NXIA 1ECEA 4P7QA 1VENA 3ZWTA 3V5OA 4WY0A 4JS3A 4KQNA 4ASTA 3B8WA 5E09A 1O60A 5DT7A 5DMNA 4NNBA 5D32A 3PB2A 5F1VA 2E6DA 3JZUA 3PY2A 2CEQA 2ISSA 3NWRA 4WKHA 2OEKA 1EYWA 1GEQA 1MW1A 2QUMA 3EX3A 4Q4SA 2PDKA 2VC5A 3SFKA 1S46A 1Z42A 3M7WA 2O55A 3QFEA 1ITUA 1IXQA 3OGVA 3KRZA 4ERGA 3PTKA 4LUSA 4J28A 3TTEA 3FXGA 4J4KA 5KITA 3K4AA 7PTDA 4PTXA 3WF2A 3VGBA 1JPHA 4W87A 1X1NA 1BPLB 5M5DA 3BAJA 1XW8A 3CQHA 2C0HA 1DE6A 1HVXA 3MHFA 3UA3A 3ZSSA 3E74A 4FOUA 4G8TA 4GKLA 2DEPA 2Q71A 3LTPA 4CNNA 1ML1A 1AQMA 4JY8A 3CNYA 3BARA 1CWYA 5D03A 4UCGA 5AN7A 1OF6A 3IJ6A 3L4YA 1KO0A 3P0WA 2F6KA 4HSHA 3N2MA 2OKOA 3QH2A 1HL2A 1TJ1A 3G3MA 3RO8A 4P7NA 1XX1A 3TZNA 1UOKA 1UIPA 4JAWA 4HSOA 4YJ5A 3V35A 4QFUA 1Q66A 1O66A 1GOIA 3E49A 1PIGA 2Z1BA 5F4XA 3S3GA 2DPEA 4US5A 3H2NA 2AL2B 4W4QA 1GG0A 3KDOA 5D30A 4LCRA 1E0UA 2PS2A 4HCLA 1F4HA 1CGWA 4NNCA 5CH9A 3KOZA 1TREA 1AJ0A 2PF8A 1CXHA 3QF0A 3DFYA 3A23A 1GOKA 2Y62A 4L4MA 2WANA 5A6BD 4YXGA 3TH6A 4M81A 1WO2A 1QVBA 1V77A 4ROPA 1J0ZA 1JFXA 3S6TA 3ZR6A 3A64A 4HPXA 1AH0A 3TW9A 4DY1A 2GPTA 3NQGA 3I6TA 4YCOA 1TTPA 3TWBA 3UPBA 1N8WA 2WSRA 3APTA 4GISA 4RXGA 4PA8A 4I7VA 3L0GA 4WKAA 2QKFA 1PTGA 3I6EA 4O0KA 1ISYA 1XSKA 2BV9A 1DIEA 3MW7A 3ORWA 3W26A 4BWLA 4P8XA 4GK8A 2EXOA 5A69A 3UZZA 4ZA0A 2WMIA 3N4EA 2OZTA 1H7XA 2GJXB 4JTHA 2CPUA 3STEA 1XYAA 2BLEA 2C18A 3NQDA 3OBEA 2NVDA 1G4EA 1EPXA 3LK6A 2Q6ZA 2CLFA 2WMGA 4AZBA 4XZIA 4MY8A 4ZOCA 3A3WA 4HA3A 1LBMA 5LYRA 2MNRA 5EFFA 4XG1A 5I79A 4W8BA 3RLUA 3IVSA 5FEXA 2VC7A 2E5BA 1UKSA 3GO2A 3HOJA 1TVNA 2ZUNA 3EB4A 4B90A 1JXKA 3W7DA 4KF1A 2A5HA 4MG4A 4GFSA 2OODA 4WD0A 3DECA 1PZ0A 1CXLA 3W7NA 1FCQA 3TJLA 1X98A 1ZZMA 1PBGA 2CYGA 4HN4A 3H7UA 3NQBA 1BFNA 3BV7A 2QCNA 1CLXA 3RFAA 3LRLA 1E6ZA 1JDCA 3F03K 3K2GA 1H7RA 3UNDA 1RVGA 4M7TA 1V02A 4U28A 5H8MA 3TP4A 3C2RA 4LFYA 1P0NA 1E71M 3BAWA 4HPHA 2RH9A 3UZWA 2RDWA 1E1FA 1V3LA 3W7KA 4L80A 1KLYA 4G7EB 3LTSA 2W27A 3PS7A 2QVNA 1R3QA 2VCBA 1G01A 3VKDA 3WDPP 2PPGA 4MB4A 2IUZA 3L9CA 5KINA 2EPOA 1PDYA 4Q8TA 2QVHA 2QPXA 3L4ZA 3W7QA 4HK5A 3GU2A 3VPLA 1Z7AA 3TYCA 4LBRA 5HNNA 3NVTA 5BMXA 3HPSA 2VX4A 3RLVA 1XWYA 2ZUWA 2PDUA 1DORA 4DF2A 4US6A 2J66A 3GVWA 2QEZA 5DMMA 3PULA 2E8YA 2Q09A 2WB5A 4LUSB 3IGXA 4AEFA 3W23A 3H55A 3VIPA 3RRAA 5JBFA 2PDNA 1JZ6A 4PMDA 1C3FA 4KRTA 5J04A 3IUHA 4NZ3A 3WFLA 1E4NA 3IIXA 3LXAA 2H8ZA 3W1RA 3BAXA 2XHYA 1OK6A 5FSEC 1GPWA 1I1XA 4I9TA 5AYXA 1CYGA 4DZ5A 2CXGA 4O53A 4FNUA 3W7JA 2QCLA 3QY6A 1WBJA 5LIYX 3IAQA 5HA7A 5KTLA 2I16A 3BJTA 3WBEA 2GQ8A 3GDLA 1CECA 1POJA 4IQEA 4XAPA 3B97A 1KFCA 3AYSA 4U3CA 1DQWA 5CSRA 3LBOA 2I5IA 1C8VA 4CVUA 2WNQA 3IIVA 3SUVA 2TYSA 2C71A 3H4XA 4C6IA 4WDTA 2RDTA 4H8VA 1WZMA 1QHPA 2XH4A 3SRDA 1XCWA 1E1EA 4YNGA 1EJSC 4N9DA 5E0CA 4S3BA 1KV8A 3LPFA 4H19A 4GNVA 2E3ZA 3TCEA 3WQVA 3WQDA 4GBUA 3KVJA 2OX4A 4DYJA 3H4GA 2DP3A 4GC3A 1AG1O 3GHSA 2I5GA 1FHVA 1G7VA 2E67A 2RGMA 2Z1VA 5HMSA 2F2HA 2Y6ZA 1LBLA 3QC0A 3LQGA 3L5AA 3OPSA 3WY1A 3V5FA 2HDJA 4P8UA 1JZ5A 1KFKA 1OGGA 2A6LA 1UR3M 3MCOA 3AALA 2WSKA 4HYRA 3GG1A 4IZGA 1U1UA 3AXKA 3V0SA 1I75A 1GPFA 3GC2A 3GDKA 4ZSUA 4XAYA 4LX4A 4M82A 3PZTA 4K7VA 3BV4A 2VVNA 1GVFA 4LJ3A 5I3KA 3FV9A 1DIOA 2O92A 1KNWA 3I7QA 2POZA 3EWXA 2Y89A 1WDQA 1GJUA 1J4EA 1GZJA 3A12A 3DHUA 5DN1A 1JCNA 1QOQA 3WUFA 5GPRA 3TXVA 1HKJA 5CBBA 1PIIA 2YLLA 2BBFA 4ZTYA 1Z69A 1FY6A 3WH5A 4AZ6A 1QHOA 1I2QA 2XVLA 4GIAA 4U31A 2ZKMX 5DCDA 1MVYA 1XYLA 4JY9A 1AUSL 2R6OA 1N82A 2DJXA 2CLKA 1CT5A 4H3DA 1XP3A 1E56A 1NTHA 2V3GA 3KP0A 1SW3A 4GQRA 3QKEA 3OP2A 3EYPA 4UQCA 4L9XA 2P0IA 1P0DA 3GW3A 4QR6A 4F9JA 3R58A 3FDKA 1JRCA 4ZTXA 2O4QA 1PX4A 4GC4A 2OU4A 5EMJA 3UGRA 2WMFA 5H1WA 4XZ9A 3VK5A 3B4YA 4FIQA 4AMCA 1TRDA 2VFFA 4IQLA 3TCSA 3GZ3A 4MDOA 1ODZA 3SQMA 1QPOA 3VKKA 1IYXA 4R3UA 2MANA 4GUGA 2A4AA 4HIBA 2KAUC 3M16A 4Y9MA 4UQAA 1A5LC 2EF9A 1V6YA 2QHAA 3T81A 2PLMA 2J25A 3BO9A 4W7WA 3N19B 3KE0A 3OYXA 2PLJA 1VFOA 3W75A 3I4KA 1X7IA 3VFLA 3LN3A 1J96A 2CHRA 4MLJA 3VABA 1U5JA 4JIHA 3LPGA 4ZB0A 4ZZ9A 4DM1A 1G7UA 1QATA 1OADA 5D2YA 3GXIA 2QZRA 4C1LA 3VGHA 4WSHA 4JKLA 3P61A 4PODA 1F73A 1UYQA 2GWNA 1EA9C 1K6WA 3IK4A 5FJIA 3GS6A 4WY0F 3IAPA 1P0EA 2PDXA 5U7SA 3PBYA 4WCJA 2VQUA 2V5LA 4GYPC 1H7PA 4S3GA 3OLGA 4YTRA 5BWFA 2QJNA 1WZLA 3GXPA 1VBGA 1J0YA 4DNMA 4DWSD 1RJRA 3N14A 5XIAA 5CC7A 2CCRA 2XN2A 4QX4A 2XFWA 1HQTA 1OFPA 2WZIA 3ZYZA 1XI3A 4AY7A 4U5IA 1RQHA 3W1UA 3MY9A 1NVMA 1MDLA 1XUUA 3O06A 1XFBA 4PMRA 4QSFA 3IJDA 3WBWA 1UH3A 2EG7A 4N4QA 3H6OA 2ZE0A 4LVDA 4WOQA 1UJPA 1YNQA 1G1YA 2O56A 2PWGA 2CHNA 5CAHA 4KS0A 4N4PA 2VVSA 4NASA 1B9BA 4Q7BA 3QV7A 2WAGA 3HPFA 4FALA 3PBMA 3CL7A 3TR2A 2BASA 1XH2A 2FGZA 3RAOA 4Z2GA 1JFHA 2XFFA 1PHQA 1WUEA 1DJZA 1SZFA 1UBPC 4O19A 4H2HA 3GY1A 4Y9AA 3GSMA 3RPDA 1XBVA 1XHGA 3ARSA 4I7WA 5A6BA 2F6UA 2EPLX 4DO6A 2CW6A 4ATDA 3GXFA 1E0VA 5IBXA 3M46A 3ITOA 4IJCA 3ONBA 1E9IA 4XB3A 3C8FA 5AYZA 3EGJA 1B5TA 1CB7B 2VUYA 3VGGA 1H7OA 4L1GA 1PCKA 2DSVA 2I1OA 2OB3A 2XIMA 1D8WA 3NM3A 7ENLA 1UUMA 3G3DA 4CUCA 3D3FA 4V15A 3EMQA 1C8QA 4K6AA 3WFAA 3SQSA 1RLDA 3CH9A 3NQMA 6XIAA 3ARVA 1YHTA 1I2RA 1P48A 3QR3A 4LUJA 3KHJA 3TWAA 4G56A 6PTDA 2OOFA 4DNHA 4L9ZA 4UZUA 2Y8UA 2I5QA 5IHSA 3G1FA 1Q45A 1E43A 2E5CA 5TAOA 5LZLA 4NF7A 3TNBA 3FGCA 4AD3A 4DXKA 3T2PA 1K9DA 5AKQA 2O0TA 1PO9A 4XZWA 5BXTA 2C1HA 4A8NA 3KZSA 1KM1A 1EPVA 2X30A 4DBSA 1CPUA 1IEIA 1Q5MA 2NSXA 3WK0A 4FO4A 3NDYA 1K6AA 3O9NA 4IIEA 4P7OA 1VGAA 3NL2A 3VIOA 1AD1A 1Q65A 3S1WA 4PBFA 2JGYA 3WL0A 2HK0A 2YKKA 1UWSA 3PNZA 3S0CA 1GONA 7A3HA 3WK1A 3BICA 2DZAA 2GVLA 3M41A 4BCEA 1SFSA 1A3WA 4FS9A 1SJBA 2HBXA 1KWKA 3BH4A 1R2TA 3LHTA 1GVIA 3MZ2A 1ZNNA 3PG9A 4F3HA 1QBAA 1CXFA 2NWSA 1UP3A 1A5AA 3W88A 2QPUA 2FJKA 4GZIA 4FIRA 1TV5A 3FJ6A 4DN1A 4BEQA 3CAQA 1JPKA 4DBDA 1OIMA 3WMCA 2J27A 2F84A 4EX4A 4GYFA 1KLZA 2ZUTA 3HPAA 3W29A 4GQBA 4A29A 5CEWA 1GOMA 4QLJA 1QK0A 1D9EA 5LIXX 3KL0A 1RBLA 2QCDB 3DU0A 2DZPA 3RO6A 2ZX9A 3MMWA 2NT0A 4LUTA 3W73A 3TVAA 4KFNA 4M6UA 4XZBA 1UR2A 3GNDA 3RCNA 2FMOA 3S5SA 4MSSA 5REQB 3TJIA 4B2DD 1DP0A 1FA2A 4BF7A 4MVAA 3AYTA 4DO4A 3GC5A 1I6NA 2VZOA 1VFMA 4F2BA 4PRRA 4DRSA 1PL9A 1W1PA 2VFHA 2D24A 3THAA 3GBEA 3LLFA 1VPQA 4FX7A 4URIA 1M9HA 2A1YA 3KRBA 3FVMA 3YPIA 2FJUB 2QAPA 3ZT5A 6TAAA 1KA9F 4AZ7A 3VIMA 4C6DA 4PMXA 1SZGA 4GFIA 4MPQA 1EO5A 4CNPA 1GJWA 2P88A 3AISA 4PL2A 3UGVA 4PCFA 2QUNA 4MWAE 3NQ2A 3HPXA 1JRBA 3B06A 1RALA 1UR0A 4W7VA 5JIWA 4JQAA 2UV8G 4H9UA 2ZVIA 3DX5A 3FN9A 1FFQA 2BXYA 1UUOA 4E4UA 1YQ2A 3JU2A 3KBVA 3R89A 3LZ5A 1RK6A 3WH7A 3CUHA 2Y8KA 3IJIA 2ZC1A 4GJJA 1ITXA 3JR2A 3LGDA 4J2MA 4FMVA 1ZENA 2WBGA 1LL7A 1A0DA 1G9HA 1FWFC 1FWGC 2V2DA 3TSMA 1DQXA 4DAIA 3FYOA 4WK9A 1WDPA 4JTUA 3XINA 3E2QA 1WP6A 4TV6A 4JN7A 2OYKA 1E1CB 4XTDA 1OX6A 2PCEA 2VX6A 4AZHA 3SBFA 3BTNA 4AMAA 3K8MA 1C9WA 2V3FA 3I65A 3LM7A 5LA1A 4HD5A 4PCTA 2P10A 1AJZA 4JTLA 2CZ5A 4M6VA 1H7NA 5AY7A 3R79A 1P0BA 4JEJA 4X61A 3GVRA 3SY8A 2ZC8A 1HO1A 2D2GA 4KIRA 2BOEX 3LXCA 2YJQA 4S23A 2PDBA 3UJRA 1X38A 2R8WA 2D1ZA 4GQQA 4JTRA 3LMZA 4ERAA 2VO5A 2ZZ1A 2RHGA 2WHKA 3G0XA 3USBA 1LDCA 2BSLA 3URQA 3GFXA 4RZBA 1WAWA 1UD3A 1Y8BA 3MWAA 2BWGA 3TZFA 3NNTA 3E02A 2ZTKA 8TIMA 3WQGA 4HNVA 3TTSA 3TFCA 1R38A 1HF6A 1VFSA 1JEZA 4JX4A 1TTQA 3PJTA 1UD2A 4LSBA 1H60A 1FFRA 3PN8A 4R27A 2YOCA 3GW0A 4YHGA 3EAUA 5DT5A 2Q8XA 2BXZA 1TQJA 4CD8A 4NAEA 2WPBA 3WFZA 3WL1A 2HROA 3HU7A 2XVGA 4Q8PA 1V7AA 2Q8ZA 3CZGA 5D9PA 1RLCL 1XC4A 1QPRA 4F66A 4PMNA 2QCMA 2G97A 2A7NA 2IQDA 3U2ZA 1R86A 1OD8A 2DT0A 4AIOA 4LW7A 4UFHA 5A6JA 3O7UA 3PTDA 4A3QA 4I90A 1PKMA 2P53A 1XLJA 3ONCA 1HKIA 1UZDA 4Z1DA 1MDRA 3T2QA 3AS0A 1GJPA 1A3XA 4BY3A 3W83A 2ZWYA 1GZGA 1J5SA 1EP3A 3SJ3A 4PH6A 1OGBA 3PZVA 1DXEA 4ZR8A 2JALA 2OGYA 4DM2A 4WVXA 1BYBA 1E51A 3VDHA 3BJFA 4LAZA 4CEXC 4UUIA 3B0YA 5CSUA 2OTDA 1ITQA 4OKDA 3GUGA 1M53A 3KVKA 1TUXA 4IP7A 4AHOA 4IMCA 7XIMA 1OZQA 2HXTA 2CZVA 1MXGA 3SRFA 2ZRYA 4QISA 4LB3A 3NYZA 5JQ9A 4MUZA 4QSHA 4FNQA 3KBWA 1XUZA 3GVGA 2V6AA 1ZAJA 4Z0JA 3ZMRA 2YSWA 3QJAA 4NAFA 1OZMA 3S6DA 1KBIA 5C6MA 2CLIA 5C9UA 4UB9A 4JTGA 4QJ4B 3PPHA 1IXNA 3CWHA 3R12A 4QEHA 4JNZA 5A8NA 1QFEA 4CN1A 4IP4A 2INFA 1XIFA 3MV01 1TPB1 1C91A 1SYTA 3N2XA 3UG3A 1FWBC 2WZMA 2P0OA 1AFSA 1A47A 1M7PA 4HHMA 3WJWA 5XIMA 2YDSA 2P5NA 5FL0A 5JU6A 4MB1A 2BGSA 2YA1A 1E6SM 2NQHA 1JPMA 3U9IA 3VXGA 4DIAA 4PUWA 3VE7A 4IFKA 4IHCA 4PMOA 3VMOA 2Z1WA 4CD4A 4HJFA 3ARXA 4PUEA 2ZRVA 3TQVA 3UT0A 3B9AA 1OWQA 2UY4A 1FWSA 3TYAA 2QDEA 4HA4A 4OQVA 1OX5A 2OZ3A 4CU8A 3P6LA 3FK4A 2VQTA 4N02A 1T99A 1UHVA 1Z32X 1IQ8A 4Z2KA 2XDFA 3IRSA 3P8JA 4W88A 2DJLA 1XLAA 1LTDA 1MYRA 5GQBA 3TXZA 4UXDA 5GJNA 6XIMA 1E0WA 2QUUA 2RAGA 2OT1A 1MUWA 3HF3A 4TTUA 2Y1HA 1GKRA 4J3UA 4Q4OA 1AH4A 2PCQA 3NPUA 4JTFA 1XIGA 1G4SA 1F2JA 1LM1A 1OFBA 3MT1A 2E6AA 1L2QA 2Q8LA 3DENA 2Q3RA 1R6WA 4UMAA 3WLMA 3WLIA 1BGGA 1ENUA 1ZLPA 2TMDA 3KRUA 3W87A 2NUXA 3WDIA 4JTAA 4AWTA 3QKZA 4GYPA 2C19A 3UXIA 4Q6XA 1H51A 1ZCOA 4O50A 4WXYA 1QWKA 3DEQA 1EIXA 1QU4A 3JS3A 1E6XM 1FCUA 3WD2A 2PTXA 3CXOA 3VKJA 1XM3A 3G6MA 1UW9A 4XAGA 1TPEA 3BW4A 3F5LA 4JFTA 4LS0A 1ZAIA 2GLKA 1IEVA 2FHBA 3S2CA 3DFSA 5I3IA 3BCJA 3QYSA 3K13A 2I57A 4Q33A 4RNFA 2VZUA 2W79A 3WQFA 4NILA 4DZIA 3ZVIA 4Y9PA 1TUFA 1BSIA 4FNTA 1LLOA 2OSXA 5CCZA 4U2ZA 1FWTA 4ZFMA 2YZ5A 4XZLX 2OVLA 1XLLA 2WC3A 4WRHA 1B3YA 3HJEA 3V1HA 4ZOAA 4W89A 3W7IA 1EX5A 4DJEC 2V0TA 2WC4A 5T9CE 1QNPA 3ZO9A 1VBHA 4X0NA 2YGYA 2FDSA 5FEWA 4O1EA 4K8GA 4FXFA 5I2UA 1H61A 1HX0A 4G6CA 4JZ5A 1LUCA 3PF3A 3UU0A 3BOLA 2ZFAA 2POTA 5TF0A 2PRHA 2GUBA 6A3HA 5C71A 3VOCA 2V2HA 2EO7A 5MF5A 2OEJA 1HJVA 3THQA 4XZMX 4GJIA 1W3KA 3NPVA 3CQJA 2V9DA 3U57A 4A3YA 4AWUA 3IS4A 4DJFC 1XIIA 1PKNA 4WJ8A 4V1XA 1BD0A 4IJRA 5G2WA 3G24A 5TNVA 2X09A 5CGTA 4AISA 3AMDA 1KM6A 5E9XA 2ONEA 3OW1A 3CV7A 3WUGA 5EPDA 3TA9A 3R43A 1OX4A 1AL7A 4PTMA 3CZLA 6REQA 4B2DA 3ABOA 4MF4A 5HMFA 3HZ3A 3VDCA 1W3NA 2P8BA 4RL3A 2VEPA 4I5XA 4HZ6A 1MI3A 3QQ1A 3PG8A 4FNSA 2G3MA 1GORA 2DUAA 3HIJA 2PP0A 1TPWA 2NQ9A 1PZ3A 3WJYA 3FJ4A 5AHLA 1MFVA 2VHLA 4I9JA 3T4WA 4S2CA 2DFAA 3AJXA 2VC9A 3CIXA 4NAFB 3AHTA 4HZ8A 3V18A 4FXRA 4O13A 4QE5A 3Q45A 1A0CA 2L5HA 4KETA 2CERA 3KCOA 5ABGA 4D1JA 3MBDA 4YTQA 1V6TA 3VNYA 3DFTA 5LKYA 3PB0A 1W1ZA 3V36A 2PA6A 1ISWA 1RR2A 2HWGA 1DOSA 1JAKA 3KW3A 3EEGA 1BWKA 3A13A 4UBPC 8A3HA 2ZWZA 2WV8A 1OFAA 4ATLA 1MZHA 2PU1A 2QDGA 3T42A 3NTYA 2G4FA 3HPZA 4IP5A 4DJED 3D47A 4C1KA 3VNJA 2YBUA 1UD4A 3OZYA 3UJ2A 4YYCA 2X1SA 4EPBC 3NQCA 4ZL1A 2CBUA 1ZBCA 4O1AA 3QMSA 3NDOA 1XLFA 1ZPTA 4H9XA 1Q6FA 2AQWA 3HTWA 2HS6A 3GFZA 4A21A 5CC5A 4ACYA 1TB3A 2XIJA 1YRRA 4KRZA 2WHMA 4RDWA 4AEEA 2CHOA 3QLDA 4D6CA 1T5AA 4I3GA 4O1CA 4D6HA 3WQOA 3WJSA 3RJXA 2FZ9A 3UWEA 1P5BA 3AIWA 2GVJA 4ROQA 4G5DA 2QCHA 3PZQA 4DJFD 2OO0A 3DERA 1KWGA 3CV6A 3I3EA 4KMQA 2E8ZA 3QHNA 3SCRA 4E8GA 1V93A 3A9BA 3LLXA 1OF8A 3I6RA 4C6OA 1UC5A 3RK8A 3S1VA 4DF1A 9XIAA 5DLCA 3S46A 1R3VA 1PV8A 2PURA 5MHBA 4MYXA 2GVYA 4KT2A 3RNDA 4B3ZA 1RVKA 1T40A 4QQUA 2PDPA 3ZZ1A 3TNOA 1F8MA 2V5CA 2NX3A 1TA3B 1Q7MA 4PRWA 3Q65A 3CK5A 4K7YA 1Q2RA 4ZBCA 1UWTA 1QO2A 2CLEA 3WEMA 1ZHAA 4H9TA 5IHRA 2NXHA 1T6MA 3O6CA 4UFJA 1A50A 1E6QM 4Q8UA 5A8QA 1UPMB 1XRTA 1BRLA 4I6KA 1FWEC 4DVOA 3M5VA 3KXQA 1K9FA 1YTKA 5D9NA 3LG3A 3EXRA 1WKFA 4GUHA 5FF4A 1DJQA 3EB2A 2DORA 2CWXA 1ZBWA 4F48A 2OZ0A 1GNXA 4EACA 3B8DA 5BZAA 4MUPA 1CLVA 3VGFA 4YTTA 1OCJA 2VELA 1W5PA 1DTNA 3NFUA 4JKKA 3NZRA 4NZFA 4X9SA 5I3JA 1UZ1A 4EF9A 4GCAA 1O6IA 1P0KA 2Y24A 4WSJA 1V0MA 1A5CA 1Z8AA 2C15A 4AHQA 1NELA 3ZVHB 3HV8A 2QR6A 4MM1A</