3NPUA

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
250
structure length
246
Chain Sequence
b'TDLKASSLRALKLMHLATDTDEKVIALCHQAKTPVGTTDAIYIYPRFIPIARKTLKEQGTPEIRIWTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADHIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPAGGVRTAEDAQKYLAIADELFGADWADARHYAFGASSLLASLLKALGHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
molecule tags Lyase
source organism Escherichia coli
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
total genus 97
structure length 246
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3npuA00
4QQ3A 3OVRA 4WY0F 4PC8A 3W2UA 3UWWA 4YXGA 3L68A 3W7IA 5F1UA 3PG8A 4NXKA 4Z0SA 1XDLA 2ZA1A 3IGUA 1B57A 5G2HA 5KZEA 2GQ8A 2Q8ZA 1JQXA 5AN7A 1OFRA 4PL2A 2V9DA 2ABAA 5F2GA 4MIMA 3ZFHA 4CCEA 1KTNA 1FDYA 4UFIA 4NJIA 5LSMA 1IF2A 1OX4B 2Y7FA 3B0UX 1FX6A 3B03A 3MP5A 3CHVA 4EF8A 1I4NA 4UTTA 4UIOA 3VNDA 4ZQMA 2C1HA 4GNJA 4R34A 3IVTA 3BG5A 3KRZA 3PS7A 1W8SA 2WKJA 4L4LA 1A5BA 3NPWA 4IXHA 4XUGA 2CW6A 1ZHAA 3CIWA 4DBEA 2QCMA 1OYBA 2DZUA 1X6UA 1H5YA 3A22A 1YPFA 3LGEA 4Z1CA 3C2OA 3UZ5A 3S6DA 3HMJG 3N2XA 3PULA 4OT7A 2ALDA 2DU2A 3G1XA 2W6RA 4H6KA 2QCGA 1QPQA 5G1YA 4OV4A 4PH6A 5TIMA 1W5OA 2E1DA 1HTIA 4LVDA 5FEZA 2QJIA 3HGRA 1K3UA 4UMAA 5DBTA 5KITA 3PM6A 2YYUA 2E6YA 2GOUA 3BW2A 1SW0A 1WV2A 3I65A 4Y90A 2YR1A 2ZQ0A 4XZ9A 3LCXA 3DENA 3HPXA 3UNDA 2CLHA 3L0KA 1JJKA 3LCWA 4P2VA 4E2DA 5CZTA 2DP3A 1KM4A 3LXBA 4FNSA 4LWWA 5K7JA 1F2JA 1HG3A 3B4UA 2V30A 3G0UA 3I7SA 1QPRA 1LBLA 5DCEA 2CLOA 3NQAA 4NUWA 1AW5A 3W7CA 1TPWA 3G8RA 4N4QA 1PVNA 5EA9A 2Y88A 3CWOX 3V1PA 5AC6A 2CZ5A 1B9BA 4WD0A 3TE9A 1G4SA 2FJKA 1KTBA 4UTTC 3NQGA 4R7JA 2PE4A 1EWEA 3L66A 3FKKA 1KA9F 5AYXA 3W2JA 4UC5A 4O11A 1LCOA 5U7SA 3W1MA 5AFDA 1EB3A 1IXPA 3CTLA 4Y96A 3HF3A 2EHHA 1PHQA 1VH7A 1XM3A 3GIYA 2P1FA 4K37A 3I68A 2F84A 2FIQA 4ZMGA 1OX5A 3MWAA 1VRDA 3GX9A 2YPIA 4FNUA 1QNVA 2Z1BA 4UMCA 3VFLA 4UTKA 5IM51 3MHFA 4EWND 3RK8A 5EBUA 1LM1A 3NQVA 2QUTA 4K8EA 3TSBA 2Y63A 4BF9A 3I7RA 1LOQA 4O14A 3NQEA 4JS3A 2NXGA 4JYFA 1Q6RA 3BG3A 1ZALA 4N9CA 2H8XA 5F4SA 2GQ9A 4IWWA 5HQEA 3AJXA 5D03A 2VXNA 1ZENA 3DI1A 4UCGA 1T99A 1H61A 2YZRA 1DHPA 4RXFA 2ISSA 4O10A 2PRLA 1ICSA 4XQ6A 1N8FA 3NQCA 2GVJA 1MO0A 3WJZA 5J5RA 1LZOA 1LOLA 2XN2A 1TPH1 5AHMA 5LNRA 1SPQA 3U8GA 1R2RA 3OEXA 4JYDA 3UWYA 3CT7A 1FBAA 4ZQNA 5FF4A 3O6CA 4N9BA 1F73A 1K8ZA 4ML9A 2NWSA 4JICA 4DXVA 2XN0A 3R8RA 4BI6A 3ABRA 4O1CA 4S2BA 2B4GA 4JN6A 3BG9A 1XBXA 4M6VA 4WOZA 4I9AA 2YDAA 1KBJA 1VJIA 3RNDA 2NX9A 4K6AA 3T40A 4PFMA 1VR6A 4DPQA 1VHNA 3NM1A 5F4XA 1H51A 3Q37A 1Z48A 2X16A 5DBUA 3S9YA 2C15A 4CNNA 3NR0A 5EL1A 3QH2A 4ZQRA 2VKZG 4GJ1A 1F05A 4HKPA 1XBYA 2VEMA 4I7UA 1Q6OA 1ME9A 4NT0A 1H62A 5LZLA 1WXJA 3PBVA 3OHIA 1VYPX 3DFTA 5G2IA 3EX2A 4HHPA 1G7UA 1EIXA 2WSQA 3W87A 3NQ2A 1SW3A 2KZHA 1WOBA 1NVMA 3QSRA 3S8HA 3B0VC 4WXYA 4ADTA 3KFTA 1KM0A 4TR9A 1BTMA 4ZQCA 2G5WA 3ABSA 4EIVA 1UUMA 1ME7A 4DF1A 4K38A 4UR7A 1C29A 3G1DA 1O5KA 3FFSA 5LHEA 4O54A 4TMCA 4JGDA 2FPYA 1EPXA 2A85A 1DOSA 2X2GA 3FLUA 3HO8A 4KKXA 2GVGA 1HL2A 1AMKA 1M7PA 2V81A 2B7PA 3THAA 3LOTA 3LHWA 2C16A 1FDZA 2C3ZA 1C9DA 1XFBA 5BNKA 2B0MA 4MJZA 3UD6A 4O1AA 3K30A 3P81A 3KXQA 3L9CA 5LNVA 3OIXA 3RLVA 5DN1A 3MUXA 1I2PA 3MJYA 2ZZ6A 4D2JA 3FJ6A 4N6EA 2Y7GA 3LDVA 3QC3A 3QRHA 4ZQPA 3SSJA 3GK0A 1H7WA 3R13A 4W9TA 5I3IA 4Q32A 1SSDA 3WJXA 1W5PA 4NVTA 3IIOA 2QCCA 2RHGA 4UTWA 1TV5A 1RVGA 2X1UA 4FX6M 3FYPA 4TO8A 4M7SA 5DY3A 1VLWA 3WJWA 1K7EA 2E5CA 3EX3A 3EWBX 4OE7A 1B4KA 4RLIA 1JUEA 3EB2A 2EKCA 4TMBA 3NQFA 1LTDA 3BLFA 3UWVA 1A50A 4FHAA 2V0TA 4MUZA 3UPWA 2QAPA 1LDCA 3MHUA 1KFKA 3CC1A 3M6YA 1VCVA 3LRKA 3P62A 3QFEA 1FCQA 1PIIA 2DJXA 3O63A 6ALDA 1YXDA 1XUZA 1H7OA 2E09A 5F2LA 3NOEA 4Z1BA 3S42A 3TH6A 3CM4A 3NQDA 4RJEA 3ATZA 1BWKA 2Z6IA 1FWNA 2A2IA 2GJNA 2WNZA 1SO5A 1XXXA 1TYGA 3W7MA 1ZAJA 3TSDA 1OYAA 2ISVA 2DZXA 1J4EA 1LORA 4RXGA 5FF2A 5DLCA 1BKSA 4C1LA 4NX5A 1QMLA 1I2RA 3T78A 3MP4A 3FS2A 4LV9A 1H7NA 2V2CA 1M7OA 2VEPA 4JY9A 4N6FA 2FLIA 4AXKA 1HO4A 5AHLA 3NPVA 5BOOA 3QQ1A 2NX3A 2AAMA 1MEHA 2QUUA 3Q2DA 1VYRA 2ZRVA 1W5MA 4IMDA 3UY8A 3BVJA 1W5QA 3W74A 4WZHA 3NM3A 2C18A 1OFEA 5DCDA 2A0NA 2ZTJA 4PL1A 3EKZA 3TC7A 1IGSA 3MYOA 5LGZA 3G1VA 3PVFA 3W7KA 4JDBA 5F2MA 1J5TA 3LHZA 2D73A 4O13A 3ZR4A 3STFA 1IXNA 2JKAA 5G4EA 4XTDA 3W1XA 4DO4A 4MY9A 3W7LA 1JR1A 1OFDA 2HS8A 5BW6A 4NZJA 4FIRA 5G4WA 4O8RA 3SI9A 3A9IA 2I1OA 5K9DA 2Y7DA 1KLYA 3DZ1A 2VFIA 4O0KA 6TIMA 2JGQA 4KFOA 1L2UA 4UUIA 5KTLA 4QNWA 3O8AA 1X7FA 1TTQA 3B04A 4N9DA 3B0PA 4LVFA 3C3NA 3VE7A 3LCIA 3CQ0A 4MZ1A 1DQXA 3BK0A 4A22A 4K8HA 5K9XA 2HS6A 4PODA 4YCPA 1A53A 1JULA 3ZWSA 1OK4A 4ORMA 3CB8A 3GDTA 4DBDA 1XL9A 3LCGA 1AL8A 3NL6A 3W22A 1JCLA 2FPVA 4G1KA 2FB3A 2Y89A 4JYEA 1UCWA 3GLCA 1FWSA 3HGOA 5HINA 4UFMA 5EYWA 3M16A 5IBXC 3HQ1A 1PV8A 1K02A 4A2RA 3TJXA 4WUIA 3W7DA 2OMAA 1W3TA 4RZ6A 3P8IA 1WDWA 2H3BA 3S5ZA 3L5AA 4GRSA 5FF7A 3MI6A 4IMGA 1K7FA 3MP3A 3F4WA 3W83A 3KX6A 1GYLA 1FDJA 3NG3A 4FO4A 4OWGA 1YDOA 4WY0A 3SW6A 3GZ3A 1YTDA 3NZRA 5AHEA 5FEXA 3CIXA 1RR2A 3PR2A 1ZNNA 3QM3A 1Q6LA 3TSMA 2TSYA 2YW4A 4IMCA 5H2ZA 1K8XA 3TMLA 4O16A 3EWWA 3IIZA 4LC8A 3STGA 1P1XA 5HNRA 3ZWTA 3E96A 5EKYA 2R91A 4MLJA 2QCHA 3QEZA 4DO6A 1KFCA 3DBPA 3P8JA 5CZ0A 2VFHA 2ZFAA 5AHFA 3IGXA 4BWLC 2NXHA 1GTEA 2J9ZA 1SZNA 4LUJA 2ZCGA 3A21A 1FXPA 1A5SA 2G96A 3M0ZA 1H63A 1W5NA 3PSWA 4LNYA 3RU6A 1SO6A 3NL3A 4LVGA 2VFFA 2WSYA 3MW7A 4MJMA 4QNEA 3GAYA 1FCUA 2RKXA 1GVQA 3W1LA 3SGUA 4QITA 1L6SA 4QISA 3KHJA 3C2VA 3G1YA 3LI1A 2ZA2A 4JXCA 1I2NA 4M6QA 1LLWA 2ZBTA 2CU0A 4J9JA 3W1NA 1H50A 4A3UA 3FEMA 2OCZA 1ZFJA 2WNQA 3LHVA 4HNNA 3IVUA 4NZFA 4JX6A 4TU1A 3W7NA 1YADA 3G1SA 1XCFA 3TIMA 1GVSA 3NAVA 4FXSA 1MZHA 3LBCA 2WOQA 4OV9A 3E0IA 3QSTA 4AEOA 4UTUA 1H7PA 1WQ5A 4B5NA 1NFBA 4MVAA 4IGHA 3ATYA 3QW4B 3W1UA 3PB2A 4FXRA 5FEWA 3EX1A 4O17A 1XUUA 2FFCA 2CLEA 3N3MA 2HTMA 2A1YA 1MXSA 2CLFA 2XFWA 1H7RA 3C8FA 3IV3A 3GB6A 2QCNA 3QQ0A 1P0KA 1TMHA 1QO5A 4CNOA 1F6KA 2X1SA 3EEGA 4AVFA 3P5YA 3O1NA 1LBMA 2ATSA 3USBA 3CPRA 5SWUA 3E49A 5DELA 3UWUA 1QDSA 3LV5A 2YW3A 1BWLA 3MMTA 1I45A 3W1AA 3C4UA 1EX5A 5K2ZA 4LV4A 1OX6A 3SFKA 1TPEA 2OT1A 3FA5A 4OGZA 5C55A 3M44A 1ZY9A 3EX4A 3THQA 1ZCOA 3JR2A 1JCNA 3DI0A 2DZVA 3HOJA 1H7XA 2F7FA 3O16A 3MI2A 3KVJA 1K8YA 1RV8A 1DJNA 3NPXA 5I3JA 1F6PA 3MBFA 4JIPA 3NQ7A 5G2WA 1YLVA 1JCJA 2GVLA 5IBXA 2C6QA 3UYCA 1OG0A 5I3GA 1O60A 2X30A 5D2TA 5FI8A 1ICPA 1PS9A 2PURA 4R33A 4Y6GA 5ABTA 5LKYA 4O1BA 1AW1A 4O52A 4QAIA 4WOQA 2NLIA 1VCGA 3N2MA 1QAPA 2BLEA 3LV6A 3FYOA 1X1OA 1OJXA 3DFNA 3DHFA 4POCA 3G3MA 2EAWA 4BFAA 2VFEA 2YXGA 4UTHA 1GPWA 4JX4A 4JTFA 1YTEA 4Y8FA 4HNTA 2Q3RA 2JKEA 4ZQOA 4LVAA 2QEZA 2VELA 3IEBA 1G69A 1F76A 2PCQA 1T0OA 4GE8A 4N02A 3HGSA 2QJGA 3L67A 3KRUA 1ALDA 2QDGA 4Z08A 1VZWA 5BMXA 3NNTA 2VEIA 4IPIA 3N14A 2HMCA 2CLLA 3W7GA 2ZRXA 2FPTA 3UPBA 3C0JA 5AB3A 4JTUA 2CLMA 3HIJA 3UY7A 4EOUA 4CQ8A 1KLZA 1GG1A 4DQWA 3W7PA 2P0OA 5F4WA 2YFOA 4K7YA 1KFJA 2B7OA 3MI3A 3GR8A 3KVLA 3MBDA 1I2QA 1R47A 1NF0A 1LYXA 2VOMA 3G1AA 5DXYA 3P80A 4AMAA 3HPSA 3W2MA 1EP2A 4GC4A 3VCRA 3PBYA 3PUDA 4AH7A 3JS3A 3W84A 3O06A 1DKWA 4FNTA 1CI1A 5HWMA 4O4WA 1EEPA 5D2XA 4JTGA 5HR7A 4ONVA 1TRIA 1J2WA 2VFDA 3TW6A 2O7SA 4LS1A 5MHBA 4ZZ9A 2RDWA 1WA3A 4FIQA 3TCEA 1H1YA 4K7VA 4QSHA 4RCXA 4HNUA 2A6NA 2QCEA 3NDOA 1L6YA 2Z2UA 3S1WA 2WNNA 3VI2A 1FQ0A 1AL7A 3UWQA 2FQIA 2E77A 4NJKA 4UTMA 1PE1A 1Z41A 3LHTA 2I14A 4UFLA 5K4XA 3GNNA 5FF3A 5EMUA 1HO1A 3W7HA 4DPPA 4KWVA 4MYAA 5CSSA 2AQWA 1NSJA 2QDHA 4JEQA 3EWYA 1LOSA 1RD5A 1DBTA 1S3HA 3FOKA 3BARA 1ADOA 3ANYA 4XBSA 4M7TA 2E6FA 5E1QA 1FWRA 1RQHA 1GTHA 3MHGA 2ZRZA 3P61A 1WX0A 1VC4A 2EGZA 3U6WA 1GG0A 4JTIA 3D0CA 4JTSA 2X1RA 3CLMA 3KRSA 5TQLA 2TMDA 1QOQA 3QMTA 2BTMA 1TO3A 2RDTA 5HJLA 3R2GA 4DELA 1JRBA 4UTIA 3TQ0A 3SZ8A 2QCLA 2J6XA 4JTJA 3ELFA 2CWNA 3CEPA 3C52A 3LLFA 4TIMA 1K7XA 1MSSA 2CLKA 3N34A 5KINA 4KFNA 5E93A 3HB9A 3PC0A 4U4MA 3QW3A 5D05A 4MZYA 1JCYA 1V5XA 4OU1A 1THFD 3L2IA 4JTTA 3W7QA 4LVBA 3M43A 3HG5A 3TFCA 4MLRA 1L9WA 3V75A 3KAOA 3S5YA 5J5DA 2NX1A 5D2WA 1LROA 4AHQA 4FNRA 2NUYA 5AYZA 3BLIA 2H8ZA 3PBWA 8TIMA 1V7YA 2A7NA 3GXPA 1S5VA 1GZGA 1OVDA 4K36A 5F1VA 3W71A 3LCHA 1P0NA 3RMJA 5LNWA 1UUOA 3W1RA 4R53A 3STCA 3EWZA 1AW2A 2UV8G 1CX9A 2VC6A 5D32A 3G3DA 3HBLA 4LY8A 4QM1A 4OQVA 1TPFA 2AGKA 3WK0A 3KVKA 1OFPA 3DAQA 5I3KA 3TAKA 3GDMA 1FUYA 5AYYA 4M19A 3WJSA 3M5ZA 2V5BA 3W75A 3N73A 3TW7A 2PC4A 1W3IA 3T55A 1IIHA 4X2RA 3WK1A 3W07A 2OT0A 3TA6A 4AWUA 2NXIA 1RPXA 3FKRA 4LRTA 4HN4A 3QF0A 1QPNA 2H3DA 4M6PA 2I9EA 1UB3A 1W37A 3EWXA 5A8GA 3M47A 3TQKA 5G1TA 2OZ0A 1Z44A 4LS0A 4ZVJA 1JVNA 4HIBA 3LCFA 3SJ3A 1TB3A 1SU5A 3QMSA 4IJBA 3BV4A 1YDVA 3W86A 4E2BA 1GJPA 1SO4A 3BPWA 3O6DA 1U83A 3W2LA 2A6LA 3A5FA 1G67A 4FNPA 3LRLA 4O50A 1Q3NA 4JTEA 1JUKA 1FXQA 3TXZA 2QCDB 3ABQA 3DFQA 3W1TA 5LNUA 1JCXA 1FCVA 3LHYA 4NNAA 4TX9A 4AWSA 3VKJA 1LRNA 1KV5A 3DFPA 4AF0B 2CZFA 3S5NA 3O15A 4IXXA 1SSGA 3ZS4A 2V82A 4O4VA 1SUXA 3A23A 2ZZ1A 3NO5A 3LM7A 4O28A 2DJLA 4OBTA 4AAJA 3W70A 1XI3A 3NZ1A 1HUVA 5CKSA 1EUAA 3INPA 1W3NA 4O1DA 1G4PA 3I6RA 4AF0A 4CQAA 1DJQA 4IUOA 3TJLA 4OHQA 3DH7A 2ISWA 2GPTA 4A21A 3B8DA 2RFGA 5CPLA 3NQ8A 4O57A 3C6CA 3LCLA 3WFAA 3IVSA 4BR1A 1GYNA 2G97A 4NNCA 1XBVA 3PUEA 3DXIA 2A7PA 2E68A 2YX0A 3F1QA 3IIVA 1OX4A 3O07A 1GVRA 4JD4A 1D9EA 1LBFA 2PRMA 2ZZ7A 2J27A 1U5JA 2JK2A 1N55A 3LTPA 3SR7A 1RZMA 3NQ6A 3LTYA 3QPYA 4IPJA 2WO5A 2CLIA 3MYPA 2Q3OA 3PY2A 4N9EA 4KFPA 1FWTA 3PG9A 1TSIA 2E5DA 1G6CA 1QR7A 3VE9A 1O5XA 1VPXA 3BW4A 3LHUA 1FY6A 3C2RA 5DY2A 4JNMA 4UTJA 4GBUA 4ORIA 5CPMA 3WJYA 1PCWA 1GT8A 3O6YX 1TQXA 3DKLA 1O94A 5D33A 5AC8A 2ZRWA 2X1TA 1GQNA 1RQEA 3NXFA 3SIZA 1VCFA 1CW2A 1IIGA 1TIMA 4JIQA 3KOFA 2H6RA 3C61A 1TTJA 1H1ZA 2QR6A 3WK3A 3PSVA 1F7BA 2ZDRA 3C2FA 4N2YA 1Q45A 3F03K 5D2YA 2QF7A 3GXTA 3S1XA 2RDUA 3HG4A 1W31A 4O19A 2FDSA 1NEYA 4IMFA 1R2TA 4AHPA 1QFEA 4Z1DA 2A7RA 1SQ7A 3UWZA 5T26A 3TC6A 4Z1AA 1SFJA 3PB0A 3QJAA 3G8EA 4IMEA 1OF8A 2O7QA 3L21A 3LXAA 5K4ZA 4LOCA 1GVFA 3AO0A 4EVZA 4Z0JA 3LBMA 2WPBA 3M5VA 2JGYA 2R94A 2V2DA 2C19A 3SECA 3W7JA 1SZGA 5EY5A 3NVTA 3TAOA 3F4NA 3M5XA 5U4NA 1TCDA 4DF2A 3HGJA 1K03A 1YXCA 4U28A 1WAUA 5BRBA 3W7RA 1OABA 3G0XA 4GUGA 4K39A 1IXOA 2J88A 2TYSA 1I8JA 4XKYA 3W1QA 1KFBA 1M6JA 4CCDA 1GEQA 3DU0A 4JY8A 2R8WA 3H54A 3BLEA 1KM5A 4X9SA 3LXCA 3NA8A 3SGZA 1SZFA 2W0UA 1DORA 4IX2A 5CZJA 4KWWA 3W23A 4O15A 1DV7A 1UBSA 5CPOA 4IOTA 4N4PA 3S5OA 3T44A 2JBMA 3PUOA 5L9FA 1TJRA 4LUIA 5CPNA 4WJEA 2C13A 2ABBA 5L6UA 1G7VA 4BI5A 4PA8A 1XKYA 4JTKA 4Q4KA 4UXDA 1PHWA 1ML1A 1W1ZA 1D3GA 5C5YA 3IIXA 2ZTKA 5G5IA 1ME8A 4UFKA 5CSRA 3W3OA 4RV8A 1TJPA 4UMBA 4RX0A 4WY0B 3LI0A 3N19B 1G4EA 1WOAA 2Y61A 4WQ6A 2YCEA 2WV8A 4PCFA 3Q58A 4NNBA 2V8ZA 4ZL1A 3TMQA 3HG2A 1VLIA 1VS1A 3N9RA 4H3DA 5DXXA 1JQVA 1TV8A 5GVJA 1KTCA 2QUVA 1EWDA 3YPIA 4DO5A 3RFAA 2ZRYA 1OFOA 3GNDA 3H53A 2H90A 3M1ZA 1TPUA 2YGYA 4QIUA 3M7WA 1T8XA 1PCKA 3BGGA 4Q33A 3NYZA 4ADSA 3OG3A 1O4UA 2DORA 4UNLA 1KW1A 5D30A 4GXMA 4X3ZA 3P60A 1VQTA 4L4MA 4UTWC 1XBZA 1SR9A 1ZAHA 2Y85A 3C2EA 2Y6ZA 2VENA 4YCOA 2CZDA 1R46A 3W2KA 3TROA 3TX9A 3R89A 1TRDA 1ZJIA 4WXZA 2NZLA 1A5CA 1TTIA 4DF0A 3I7QA 1LLZA 3NEVA 1T96A 3HPZA 1ONRA 1A5AA 1GOXA 1VGAA 4LS2A 2ZZ5A 3L0GA 2BX7A 1SO3A 1S5WA 3S1UA 4YMZA 1X1ZA 3UQNA 2Z6JA 1MEIA 3W85A 3LX9A 3C56A 1NF7A 4CQ9A 1KM2A 2ZZ4A 3EKLA 1YPIA 5C6MA 2TRSA 2DZTA 2ZZ2A 2R14A 4RR4A 1EP1A 2EF9A 2V2HA 3GVGA 5LNSA 1NAL1 1WBJA 1F5ZA 1RQBA 2DZWA 4NJHA 3OBKA 3P5ZA 2NV2A 4M5PA 5D2VA 4RK8A 3CEUA 5C2XA 4MOZA 1OF6A 4RKAA 4UFJA 3TNOA 3E02A 3UXDA 4MKNA 3TK7A 4LC6A 1X8FA 4S1FA 1TPDA 3EXRA 4O18A 3A24A 1OFAA 3DKJA 1D3HA 1IXQA 2PRHA 3GKFA 3UXAA 5HUPA 3ABOA 5AHIA 4O12A 4FB7A 3IRDA 2YFNA 3LB0A 3TFXA 2VEKA 2J9YA 4YLWA 1W56A 4JR5A 2Z0IA 3DFOA 5BMWA 3OVPA 1TPC1 1OYCA 3E12A 1WYIA 3M5YA 3B05A 4QJ1A 2B7NA 1YXYA 1VYSX 4UFHA 5CZSA 3TV8A 2WSRA 1EP3A 1PL9A 5KZMA 4O53A 4XBKA 3A5VA 2E6DA 1KV8A 4ALDA 1TV7A 3QPZA 3FJLA 1KM3A 5CG7A 2XN1A 3LRMA 4DEFA 4CCCA 3LERA 4AHOA 2C14A 4HPJA 3H55A 1FWWA 4NQ1A 2VFGA 4NJGA 1AK5A 3IGSA 2ZRUA 2GJLA 5KZDA 5D09A 4HSNA 4HNVA 1R30A 4JX5A 2ZYFA 1KFLA 4MPQA 4A29A 3G1HA 2ATMA 2Y7EA 5HULA 4MZ8A 4JTHA 3GDKA 3NQMA 3HG3A 1I2OA 4AB4A 1LRTA 3NL2A 3G22A 4IX0A 4XWUA 2JKPA 3M41A 4GFSA 1QO2A 3G1FA 3G18A 3EWUA 3IIPA 4HT3A 5FF0A 1M5WA 3TKFA 4WX2A 3UZJA 1TREA 3QYQA 3W9ZA 3WK2A 4MFEA 5LHFA 1TPVA 2OJPA 3NPUA 4P61A 3P74A 1QOPA 3PWAA 2Q8LA 3G0SA 2NV1A 3R12A 5D37A 2CFFA 2FTPA 4I7WA 3QZEA 4YWIA 3MO7A 3R5EA 2RH9A 3W72A 3TDFA 2G95A 2Y70A 1W54A 4MY8A 4YL2A 4PEKA 2DZPA 4NXSA 1XDMA 3TUUA 5DCBA 1AG1O 2LLEA 5TBOA 4NU7A 4ADUA 1SZEA 3CWNA 4LT9A 3T7VA 5I3FA 2A5HA 5KSWA 2P10A 1KBIA 2WQPA 5CGQA 4E38A 2NWRA 2FB2A 1GVOA 4GUJA 3TU9A 5A5WA 1ICQA 3L0NA 3PBUA 3DFSA 5C54A 1JRCA 3E9AA 4LTSA 3W6YA 4UR8A 5FESA 1Z42A 4JDYA 3GDLA 1F74A 2J9XA 1TPB1 3QMRA 1VHCA 4I7VA 3PAJA 4NX0A 1GWJA 2QKFA 1C8VA 4BWLA 2BWGA 5HMSA 3GYEA 4FF7A 2A4AA 4CNPA 3P82A 1P4CA 1EUNA 3U2OA 1EA0A 1L6WA 2GUUA 2HSAA 5FEPA 1MEWA 1UASA 4FX7A 2TPSA 1YTKA 5AOUA 3JRKA 1HFBA 2QCFA 3O05A 3KVMA 3EXSA 2E5BA 3GAKA 2V5LA 1SW7A 3P67A 3P7YA 5H91A 2BXVA 5HWNA 1OFQA 3DGRA 3P84A 1YDNA 2C0AA 5D38A 4BI7A 3S0CA 4E0CA 1KM6A 1JCMP 5KMYA 1DQWA 4MY1A 4FX8A 5D02A 2GQAA 3M9YA 4GUFA 1OFBA 4RZ4A 2B7QA 1XC4A 3L65A 4UTLA 3T4CA 5F2IA 3BO9A 4GUIA 3NL5A 4HPXA 5LGXA 1QPOA 1SFLA 1Q6QA 3DHDA 3LLDA 2QAFA 1DL3A 2ZA3A 2EPHA 1KM1A 2W79A 4C1KA 5I3HA 3W1PA 1OK6A 3BGJA 5K9CA 1B3OA 1OHLA 4IQLA 3OA3A 1O95A 1G4TA 4BK9A 5AC7A 2NUWA 1YYAA 4HSOA 3EXTA 3GKAA 2ZZ3A 4PTNA 4FNQA 3S1VA 2IQTA 1BEUA 5HWJA 2A21A 1E51A 4LU0A 3GR7A 5EPDA 1W0MA 4O0ZA 4NJJA 1QCWA 4MYXA 5E0KA 4RZ5A 4GWEA 5HR6A 1TQJA 2QJHA 1QWGA 4Y9AA 3TR2A 3W88A 1B4EA 3B06A 3SY5A 2J24A 1P5BA 4FEZA 7TIMA 2E6AA 4MFDA 1WBHA 1Y0EA 3HJZA 3N9SA 4X22A 3GXNA 5HUOA 1UJPA 3W7EA 3EX6A 1TTPA 2YYTA 4AWTA 3Q94A 3TXVA 4S2CA 2QCDA 2WJZA 3L5MA 3LTSA 4XKYB 1H60A 3RF9A 3TQVA 3OVQA 2BSLA 3CU2A 4H4IA 1KFEA 4XTIA 1FCBA 4GUHA 4EF9A 3STEA 2DZSA 4ICNA 3NGJA 4LRSA 2YSWA 3GDRA 2Y62A 3G24A 1LP6A 5AHNA 3L5LA 3FIGA 3W73A 2CZEA 2NUXA 4A2SA 3BW3A 3W2NA 1LRQA 4JTLA 5D04C 1DVJA 1ZAIA 5K3VA 4LW7A 4UNKA 4CLMA 1JUBA 3W7OA 3PF3A 1S5TA 1R2SA 2BZNA 3RLUA 2OX1A 3W76A 1N7KA
chains in the Genus database with same CATH superfamily
4GPNA 4JQ3A 2DT0A 2EG7A 4YXGA 3L68A 1XV8A 3FAWA 4FOJA 5HBFA 3EDFA 4HQVA 2VURA 2ZA1A 1XCXA 5G2HA 3CUZA 5I77A 2VVSA 4Y7EA 2Q8ZA 1JQXA 5F2GA 2ABAA 4XSMA 4BA0A 4UFIA 2QPXA 1EJUC 2POTA 3ICJA 1OBAA 3AYRA 3B0UX 3MP5A 1I4NA 1YNYA 2C1HA 4Q8PA 4OUIA 2DDXA 3IVTA 3L7RA 3PS7A 3QY7A 3WUEA 4Q7BA 3WH5A 1X6NA 1A5BA 3NPWA 1X97A 1XISA 2FHBA 1OGGA 4MAZA 3CIWA 2YCKX 1V3MA 5ECVA 2J7GA 1YPFA 3LGEA 4Z1CA 1X38A 5GJMA 3UZ5A 1SYTA 3T42A 3N2XA 2BOGX 4OT7A 2ALDA 1QVBA 1M65A 5G1YA 4PH6A 4QDWA 4LUTB 3SM0A 1KBLA 5FEZA 2QJIA 1R3RA 3PM6A 4M3PA 2V5DA 2PGWA 3CHCA 3D47A 4EXQA 4Y90A 2YR1A 5I07A 2OG9A 3LCXA 3DENA 3HPXA 3UNDA 5C2CA 3AHTA 3FY1A 4P2VA 4F2UA 4AD0A 4OFCA 5C7VA 5CPQA 1HG3A 3B4UA 1WKEA 1KCKA 3G0UA 2O0TA 2XWEA 5DCEA 3M0JA 5LIUX 2WZIA 1AW5A 2FKPA 3FGCB 1PVNA 3NZPA 2GSJA 4JZ5A 4GACA 3KBVA 1IQ8A 3H7RA 2D23A 3QLDA 2CZ5A 4QG9A 1B9BA 5MKGB 4UQEA 1G4SA 1GKRA 4UTTC 2PUZA 3S4TA 3NQGA 4RNFA 1Q6GA 3L66A 5MF5A 4XAPA 5E9AA 2ZX9A 4W89A 3W1MA 3BICA 2PBGA 3CTLA 4Y96A 4J3WA 3WF0A 3HF3A 4IG2B 3E5BA 3GIYA 4H7ZA 4F9JA 4ZMGA 4G7FA 4KPLA 1F4AA 3WQDA 2HK1A 2YPIA 2F9RA 1QNVA 1UWTA 4UMCA 3VFLA 4UTKA 1UC4A 4NAFA 4RDZA 3MHFA 4IFOA 4EWND 2PU1A 5EBUA 3NQVA 3CQHA 3EOEA 4EWJA 3TSBA 3QY8A 5IHRA 5A69A 3NQEA 4JS3A 3LMYA 2H8XA 4IWWA 3OO2A 1XR2A 3AJXA 5D03A 2XPKA 1CWYA 1ZENA 2XIIA 3DI1A 2PTZA 4ZO7A 2CXGA 1XC6A 1JDEA 2YZRA 3PNUA 1D8WA 2VM8A 1JPHA 4YTSA 4X9YA 2XN2A 3W02A 2A3HA 2WHMA 5FOOA 4R85A 2CBIA 3L2MA 3CT7A 3PZIA 2PWFA 3O6CA 4N9BA 2WPGA 1QW7A 3R8RA 3ABRA 4WLCA 3GR4A 2VDIA 1Q13A 3WNNA 3BG9A 1XBXA 1TA3B 4M6VA 4I9AA 2EKGA 1VJIA 3T0BA 1XIIA 5FIPA 4PFMA 4DPQA 1VHNA 1H51A 1TJ2A 5DBUA 2C15A 4W4QA 4QG6A 4DNMA 4C6LA 3N11A 1F05A 3PJXA 1DIOA 3PZQA 4NT0A 3UA4A 5LZLA 4KS0A 4GINA 1V3JA 2Y2WA 3DFTA 2EXOA 1KFWA 3EX2A 4HHPA 2VWSA 1KXVA 1KRMA 4S38A 1WOBA 1NVMA 4ADTA 2Y5JA 1KM0A 3TLQA 1EF3A 2FH8A 2G5WA 3ARRA 4EIVA 4DF1A 4PFHA 3VIMA 2OZTA 1WCGA 3WX7A 5LHEA 1RUSA 3AMGA 2JEPA 4TMCA 4S3DA 3CYVA 1EPXA 3LPOA 2A85A 4NYUA 5DRIA 3TYBA 2A3LA 3GG8A 1HL2A 3U7VA 3ZYZA 2B7PA 1JXKA 1OADA 1XYCA 2UY5A 3FAXA 1EDQA 2BHZA 2WLZA 2C3ZA 3SQMA 3VIOA 4M81A 1XFBA 3REQA 5E0FA 2B0MA 1WZAA 3B8IA 2XIOA 4GG9A 4EX4A 3L9CA 3OIXA 2VHLA 4JIRA 1F3WA 3GNRA 3MUXA 4H01A 2ZZ6A 4N6EA 3QC3A 3WH6A 4C6OA 3UCQA 4W9TA 5I3IA 4Q32A 2VP8A 3VNJA 1XRTA 3IIOA 3S9ZA 1BQGA 4H04A 2QCCA 2ZX5A 4W7WA 3M07A 4MJ2A 4B3LA 2RHGA 2J79A 2BHYA 1XYZA 1PWMA 3VOCA 2FZ8A 4XO6A 4M7SA 4IICA 3EX3A 4AZ6A 1JUEA 3EB2A 2EKCA 1VBGA 3UG5A 4GYFA 4HP5A 5C0QA 3RRXA 4MUZA 4C60A 2OKOA 4GYPA 2IPWA 2VUNA 1KFKA 3M6YA 1VCVA 4C6DA 2P3ZA 1LWJA 3LZ3A 3JW7A 4ATWA 2E09A 6A3HA 3CB3A 3WQEA 2EQDA 3S42A 4H19A 3OBAA 3CM4A 3BLPX 4J3ZA 4GO8A 3ATZA 5A8MA 5EFDA 2A2IA 1UWRA 4PCTA 1SO5A 1TYGA 3WCZA 3UCCA 1UR2A 1J4EA 3AMDA 2PWDA 3FNDA 1BKSA 1EH9A 4ATDA 3ARWA 1TR9A 1I2RA 2WC3A 4PB3A 3FS2A 2OPJA 1H7NA 3K8LA 3QV7A 2V2CA 1M7OA 4C6NA 2RDXA 2FLIA 1UWAA 2ZX7A 2YDQA 1XD0A 4L56A 1C90A 4GQBA 4ZTYA 1MEHA 4PBEA 2QUUA 2VQUA 3Q2DA 3ONCA 3GM8A 3ECQA 4XZIA 5EMYA 3UY8A 3WLQA 3AALA 3W74A 1V03A 3CH9A 3EMQA 3LU2A 5E0CA 2A0NA 4PL1A 3G1VA 1E4IA 3W7KA 1J5TA 4J3VA 2PSNA 1DIKA 2P3EA 3HN3A 3SRKA 4MY9A 3W7LA 1JR1A 5BW6A 3OZOA 2G3IA 4FIRA 5G4WA 3A9IA 2Y7DA 1KLYA 5CAKA 2VFIA 1FWGC 4MGGA 1GKQA 3VGDA 2V3EA 3WF1A 1TTQA 1E6QM 3EYPA 4QE4A 3U0HA 4OBRA 4YNGA 3CQ0A 1POJA 3BCJA 1DQXA 3BK0A 4TQTA 2XGIA 2OOFA 5K9XA 2HS6A 4YN5A 3GUWA 3MPGA 1R3SA 4YCPA 1JULA 3CB8A 1PBGA 4JYEA 4UTFA 3GFZA 3R8GA 2D2GA 4PEEA 4WUIA 2ZIDA 4G9PA 1UH3A 5LIYX 3P8IA 1WDWA 4NILA 3S5ZA 5A1AA 4GRSA 1QNSA 3POHA 3MI6A 1XH0A 3AISA 3F4WA 3KX6A 1GYLA 3F4VA 3NG3A 4HOXA 2UBPC 4HMCA 1YTDA 4D71A 3HV9A 3WEMA 5FJOA 2TSYA 2GDVA 3H2AA 3VZXA 3WDHA 1Q6CA 4PUJA 2VR4A 4QCFA 3UG4A 5LA2A 4L80A 3TMLA 2J75A 4LC8A 3STGA 5DF0A 2FDMA 3ZWTA 3E96A 4M82A 4IL0A 3QEZA 3DBPA 3P8JA 8XIAA 3PAOA 2ZX6A 5HMEA 3WQ6A 3U2EA 1SZNA 1FXPA 1A5SA 1W5NA 1QBBA 6CGTA 3WO8A 1SO6A 2VFFA 3BGAA 5ENLA 3IACA 4MJMA 1FCUA 2RKXA 3H24A 3SGUA 1YDYA 2C8NA 3ENLA 1L6SA 4UZSA 6XIAA 4HTBA 3G1YA 4MMWA 3LI1A 4KF1A 5IDIA 2OCZA 4NZFA 3IVUA 3W7NA 5JBFA 4KCUA 3KOYA 3LBCA 2WB5A 3E0IA 1GHSA 3QSTA 4PB4A 4UTUA 1H7PA 2P5NA 4MNKA 4AZGA 4JHMA 3HFYA 3QW4B 4XV0A 3VXGA 5IFPA 1C3FA 1XUUA 3RRAA 3MKKA 2E3ZA 3N3MA 5JBDA 4QLLA 1XS2A 5E6YA 3IV3A 2QCNA 3KCJA 1WXZA 1H0GA 2GVEA 3P5YA 4S23A 4JNYA 3UWUA 2YW3A 1I45A 4H6QA 1EX5A 1KO0A 4LV4A 2QJJA 4OGZA 3M44A 3GZAA 2D24A 1JCNA 4ZOBA 3MMUA 4C6QA 2DZVA 1EGVA 3KWXA 5I3JA 3MBFA 3NQ7A 4PULA 2V6AA 1JCJA 2PDCA 4GIEA 2GVLA 2C6QA 1XYFA 2WSKA 4ZBCA 4WDWA 1ICPA 1PS9A 4Y6GA 3NYDA 2PBOA 1AW1A 2RGMA 4QAIA 2Z25A 2YLLA 4XIMA 2I57A 3FYOA 2C79A 4JBRA 3DHFA 3EOUA 4UR9A 3G3MA 4C6MA 1GPWA 4JX4A 1XDJA 1KR1A 4Y8FA 4MWAC 2OGJA 2JKEA 2Q3RA 2Z1WA 4LVAA 1DYSA 2ODOA 1FWHC 1ESWA 1G69A 2PCQA 1SGJA 1H11A 4N02A 4REQB 1GW9A 3L67A 4MTVA 1ALDA 4W93A 3E6EA 1DWFM 1E1CA 2OVLA 2OB3A 1CGVA 4LYPA 4HJFA 4WVXA 3C0JA 1VFOA 2CLMA 3QYSA 1JXJA 4L5ZA 4EOUA 1AFSA 4QS5A 4DQWA 2YFOA 1QI2A 1RK6A 4U3CA 5FJPA 1Z89A 3GR8A 3KVLA 5DQPA 2YXXA 3GC2A 2QXWA 3MBDA 4AISA 1LYXA 4W85A 2XVGA 4L9YA 4HK6A 4PGLA 4ERGA 4ZR8A 6TAAA 4L4PA 3GVRA 4RE0A 2DUXA 3PUDA 1IE7C 3JS3A 4PBFA 3G6MA 1O66A 1EEPA 2CPUA 2NT1A 3OG2A 4ONVA 3THCA 3LGDA 4HHLA 3AHYA 4LS1A 2QT3A 3LQLA 5EGRA 3L4VA 2RDWA 3F2BA 2WMGA 1RPKA 1IYXA 3BXWA 3MZNA 1P6CA 3L23A 5H8PA 4QSHA 2WZEA 8CGTA 5BZAA 2QCEA 2WBKA 1PTDA 2F6KA 1FQ0A 4Q4PA 4E8DA 4V28A 1GEHA 1H3GA 4UFLA 4LF1A 1HO1A 1QW9A 4KWVA 3H2MA 5CSSA 2QDHA 4JEQA 3ID7A 3IJDA 2E9MA 1DBTA 1A3HA 1ADOA 3WBEA 4XBSA 4KGJA 4M7TA 3K1DA 5E1QA 4DY1A 3EKGA 4AMCA 3MHGA 2Y8UA 1YIXA 4ZO9A 1GORA 2EGZA 4JTIA 3BJTA 1NELA 2X1RA 1XSKA 4B16A 4ZOCA 5TQLA 3MSGA 2XGBA 3QMTA 2BTMA 2W4XA 2V69A 3CGTA 4B92A 4D6GA 5ECUA 3ARZA 1TMQA 2J6XA 4JTJA 3ELFA 1JZ2A 1OT2A 1PWLA 2F6XA 1ZQ5A 1K7XA 1MSSA 1J11A 3RIKA 3PC0A 1GYMA 2OYMA 1PYFA 4MZYA 4B2DA 5GJNA 1VFMA 1THFD 3L2IA 3W7QA 3D3FA 4MLRA 3UG3A 1BD0A 5J5DA 2PDNA 4Z2GA 1I75A 3UF9A 3K4DA 4AW7A 4MB5A 2H8ZA 3PBWA 2A7NA 4HNLA 1UWUA 5M1TA 1K4HA 5BCAA 1PJ9A 3M6DA 5LNWA 3I4KA 2EO7A 2UV8G 1CX9A 3WK0A 3TAKA 2INFA 3B8TA 5FKYA 2IKIA 2OELA 4L4OA 4QRNA 1EQPA 2IXVA 3CZKA 2FFIA 3TW7A 2PC4A 1R85A 3KTCA 3OBEA 3WK1A 3TA6A 3S1GA 2NXIA 4LRTA 3URAA 5EMJA 3T08A 1OINA 1T5AA 1RALA 4M6PA 1KQZA 3O3RA 4W88A 5A8GA 3SBFA 3TQKA 3OHMB 2OZ0A 2C1GA 1JVNA 2PDPA 4HIBA 5HXMA 1TB3A 4IJBA 1YDVA 5ABFA 1W1TA 1BF2A 3BPWA 3O6DA 1FHVA 3A5FA 4FNPA 2QCDB 2VZVA 3DFQA 1QXLA 2P76A 2PI6A 4F0HA 3PWGA 4NNAA 3URNA 4JIEA 1XYLA 3NO3A 2Z2AA 5BWFA 2GK1B 4UOZA 4IXXA 4M29A 1SSGA 4AEFA 3A23A 7XIMA 3GG0A 3LM7A 3CH0A 3W70A 4I5UA 3WDIA 1UR1A 2DUZA 4LBSA 4HOWA 3W82A 3AWNA 1G4PA 4AIBA 3I6RA 3UGVA 4CQAA 1DJQA 1EJRC 4S3KA 3VTRA 4A21A 4CN4A 2RFGA 3ZJKA 3WBAA 1E73M 3C6CA 3IVSA 4D1IA 2G97A 2QGHA 3BL3A 2A7PA 2E68A 4X60A 3MJMA 1GVRA 4JD4A 1D9EA 3NO1A 1TWSA 3GBDA 2ZZ7A 4YVXA 3HZ3A 3U48A 3SR7A 2Q3OA 1KBBA 4AQLA 1ISVA 3KDOA 2Y1HA 1G6CA 3VE9A 3DDMA 2FVMA 1VPXA 1BFNA 1J0ZA 3ARYA 2PEVA 3WJYA 1GT8A 2WLYA 3DKLA 3G5EA 3THDA 2C91A 3H4GA 4BCEA 5AC8A 2ZRWA 2X1TA 2OEMA 1CZ1A 2EJAA 1EGZA 3EA2A 1GNXA 1RP8A 2JE8A 4JIQA 3KOFA 5D9PA 2FGLA 1RY0A 3OP2A 4KRTA 3WK3A 1F7BA 3C2FA 3SO7A 5I5RA 2OWXA 3IPWA 3F03K 5D2YA 4QBXA 4GVFA 1R2TA 1QFEA 2HEJA 3GH7A 3WELA 3CPUA 5A2BA 1SFJA 3A4AA 2W3ZA 1OF8A 3UR7A 3T09A 4LOCA 3AO0A 4EVZA 3AIEA 1HKIA 1V6UA 2XFYA 3R25A 1YXCA 3WMLA 4U28A 3PBGA 3W7RA 1NDVA 4EACA 4K39A 4GUGA 1IXOA 2MNRA 4XKYA 1V3HA 2Y5EA 1M6JA 4BZYA 2XH2A 3OLDA 1MQQA 4MM1A 3SFWA 1QNQA 2PZNA 2ZE3A 3E74A 2I7GA 4AY1A 2VZTA 3E38A 4KWWA 1ITUA 3GTHA 1DV7A 3LMZA 5CPOA 1CGTA 1GKPA 3WD4A 1XG3A 3WENA 5L9FA 2E1WA 4LUIA 4OKDA 4WJEA 2C13A 2DSWA 1VENA 3ARUA 1XKYA 4XZMX 1PIFA 1UD4A 3EOOA 5C5YA 1UKSA 1PPIA 2ZVIA 1NWUA 3W3OA 4AIUA 4DIAA 1TJPA 4EK7A 3SUSA 2RGLA 3MWCA 3ZLFA 4GYKA 1WOAA 1JPDX 1UOZA 3N17A 2WV8A 3AHVA 4KEMA 5JIPA 1VLIA 4P7QA 2GZXA 3N9RA 4DXKA 5GVJA 1KTCA 4H2HA 4FP1A 1XW8A 3MV11 5A6TC 1OFOA 2FZNA 1B3YA 3GNDA 1UKOA 1TPUA 3F4CA 4ZSTA 3GNPA 4QIUA 1HJXA 3BGGA 1R7OA 4Q33A 3FA4A 3NYZA 4ADSA 1GQKA 3OG3A 1V79A 1KW1A 1V02A 3FX4A 4PSRA 4C6PA 4DHGA 1VQTA 3P60A 4UTWC 1ZAHA 1GJWA 4FALA 2X09A 2BG5A 1YX1A 1S2AA 1EDTA 1TVNA 5DANA 3U7BA 1I0DA 2I16A 2X0HA 1KWGA 3TX9A 1OCBA 1ZZMA 3TZFA 4GISA 4DF0A 2QMJA 3Q4DA 3G2GA 3NEVA 2DH3A 3CQIA 3PPHA 2J77A 1ONRA 2Z1SA 1GOQA 1A5AA 1UR9A 1GOXA 1VGAA 1DJWA 4LS2A 4LSBA 4YMZA 4DJDA 4WDUA 3UQNA 1V3IA 2Z6JA 3NDYA 4Q4SA 3W85A 3R10A 3C56A 1Y5VA 5E6ZA 3TTEA 1SJCA 2DQWA 2JIEA 1Q7QA 5C6MA 2DZTA 1DWJM 2V2HA 3FSTA 1Z7AA 3A12A 1RCOB 1TV2A 4UNIA 3P5ZA 3QTGA 5D2VA 3KL0A 4RK8A 3OOQA 4HYRA 4MOZA 4RKAA 3E02A 4MKNA 5CJMA 1MDLA 1X8FA 4S1FA 3EXRA 1OFAA 2YLAA 3NFUA 3DKJA 3EGJA 4RZBA 1EJ7L 3PK7A 3W4RA 3GKFA 4AWEA 3UXAA 2IUZA 3T2QA 4D6CA 3TFXA 2WHKA 1JZ5A 2VC7A 5HANA 4L6DA 2IKHA 3BSHA 1W56A 4JR5A 2PDHA 5BMWA 4QJ1A 1E56A 2QJMA 4XZBA 2B7NA 2E9LA 3RGTA 4WGXA 2HROA 3UYIA 5CZSA 3TV8A 5D8WA 1PL9A 1WDSA 2F8QA 2E6DA 4HMNA 2OR2A 1KV8A 2PZ0A 1V6YA 4LBRA 4S39A 3WSUA 1EC8A 1KM3A 1TWDA 5CG7A 4AHOA 1UG6A 4YIWA 1A5MC 1AK5A 4CNTA 1WUFA 1XYBA 3H6OA 4GGHA 5KZDA 1UZ4A 2VWTA 2GYIA 4RDYA 3LPGA 2PGRA 2ATMA 2AGTA 3T4WA 1JYXA 4TTUA 4JTHA 4O0QA 1LRTA 1WKDA 3DBNA 3CXOA 5JBEA 4XWUA 4MJ4A 5I06A 4A6GA 3M41A 4GD0A 1QO2A 3P2VA 3VMNA 3G18A 4HT3A 3WY1A 5FF0A 1M5WA 3A3WA 3CHDA 3QHNA 5JU6A 2YL8A 4I6VA 3B4YA 2OJPA 3S2NA 3MSYA 3R58A 1S2UA 3P74A 1QOPA 4LAOA 3PWAA 2NQHA 2NV1A 1UP2A 1TV4A 2OYKA 5D37A 3W6MA 3CQKA 4JTQA 3FA3A 4YWIA 4A05A 4BEUA 1FH8A 4FOKA 2G95A 2Y70A 3VDHA 1XYAA 2V3GA 2ZE0A 4PN2A 3QQWA 3B8WA 4MY8A 4GZJA 4QHRA 4QJ3B 1US0A 4GIYA 1TUXA 2GJRA 4F2BA 5HJYA 3WBYA 1GVEA 3PZVA 2BY1A 3T7VA 2A5HA 5T9CE 1YE6A 2WQPA 2WMHA 3TQPA 5AC4A 3VVGA 1YMYA 4EPDC 4MSSA 1JRCA 1JYNA 4JDYA 1F74A 2J9XA 2CYGA 3GE7A 3QMRA 2P8CA 3PAJA 1VBJA 5HNUA 4QR6A 4AZ5A 3E2VA 4BWLA 2I56A 3GYEA 2ACQA 2DVUA 3GD6A 2PD9A 3U2OA 3IK4A 2J7FA 3PJUA 2HSAA 2DVXA 1B2YA 1CDGA 2J4GA 4DBSA 3SEPA 1MEWA 5HDRA 3VGHA 4CQDA 2W9MA 1ISYA 5DEZA 4PUDA 3T0AA 2OLSA 4QAWA 1UH4A 1SW7A 4JEJA 4S3EA 4MB3A 3P3BA 3P7YA 2R6OA 2PGEA 2BXVA 1OFQA 4XKMA 3P84A 3G6LA 4KRUA 3VD5A 3UA3A 5I03A 3E5PA 4H7VA 5KMYA 1HN1A 3TN5A 4FX8A 3GXDA 1QWKA 3VIJA 4RW3A 4W84A 2VL4A 3SN0A 4L9XA 3A64A 1XC4A 2J8FA 1MQPA 5F2IA 2A3BA 3GH4A 3ZT6A 4W8LA 4GUIA 5E09A 4C1NB 2QPUA 1SFLA 1TX2A 1Q6QA 4I9MA 3WLPA 2QAFA 3IAPA 4XK2A 2F2HA 1PXGA 4XD4A 4ZOAA 1OHLA 1NWSA 4AXNA 1OC5A 3EOSA 1BYDA 2W63A 5AC7A 5JIWA 1E9LA 3GKAA 4L6OA 5I23A 3V1HA 3QTPA 3URQA 2E8ZA 1E5NA 5XIMA 1H4PA 3WLIA 2X40A 2QDEA 4MYXA 3VOFA 2A3EA 2Y5SA 4JFUA 4AY8A 5C9RA 4HCHA 4Y9AA 1B4EA 3B06A 4ZFCA 3QGKC 2J24A 1P5BA 3SCOA 7TIMA 2E6AA 4MFDA 4UWMA 3GXNA 3UVIA 4EKJA 2C0HA 1ZL1A 4B5SA 3ITGA 2PAJA 2XG9A 3Q94A 3TXVA 4S2CA 3L5MA 2WJZA 4X0VA 2VCAA 4A8NA 4Z2IA 3TQVA 2HNHA 3CTTA 4H4IA 2PDYA 4R27A 1V7AA 4GUHA 4RPPA 2DY3A 3STEA 1UR0A 3W38A 4D1JA 3C8NA 1BG9A 4LRSA 2HVOA 1EF2A 3GDRA 3G24A 5AHNA 7ODCA 3WLSA 4TVUA 3PUGA 3BSGA 4F0MA 4LW7A 4UNKA 1JUBA 5E9XA 1R2SA 2BZNA 1QI5A 3W2UA 3UWWA 2OU4A 1NARA 4QDPA 1CXLA 4ZO6A 1UHVA 1EX1A 4Z0SA 2YB1A 3BDKA 1B57A 5CQ1A 2BFGA 2GQ8A 2D2JA 4DLFA 1W32A 5RUBA 1KTNA 1P0BA 5A8QA 1W1PA 4YVPA 1C7SA 1W6TA 1ZPTA 3AYVA 1TWWA 3CHVA 4JHZA 3S2JA 2HBXA 3BG5A 3KRZA 2VGGA 2I5QA 5H1WA 4LY4A 2RJGA 4B4HA 1H1NA 3DERA 1UWSA 3GG7A 3RPMA 1HW6A 1V3KA 1BVWA 1ZCCA 2IKJA 2CZVA 1OYBA 2BOEX 1Q85A 1XYMA 3C2OA 3S6DA 4I3GA 2DU2A 2L5HA 3E2QA 4H6KA 1KR0A 3PZOA 3N6QA 2HPIA 3K8MA 3TTOA 3UJ2A 3R0KA 2E6YA 1RAKA 3BW2A 3VAVA 5JH2A 1WV2A 2IPJA 4PR4A 1YKWA 2J7BA 4XZ9A 1OB0A 2BVWA 3KBNA 9XIMA 2CLHA 4V1XA 4OUEA 1JJKA 5CZTA 3MMWA 4A3RA 5K7JA 1F2JA 1IEVA 2DW7A 1LBLA 2D22A 4D8ZA 2YDSA 3NQAA 1WZLA 4NUWA 1GGOA 2OZ3A 3W7CA 2UY2A 1BXCA 2O92A 3NZQA 4WCJA 3AAMA 3CWOX 5AC6A 2QUNA 3GXFA 4WD0A 2CC0A 3FEQA 4WKHA 4F0KA 1NY1A 2FJKA 5M2FX 1YPXA 3N15A 4R7JA 3IANA 5AYXA 4UC5A 1MW1A 4O11A 1LCOA 2WMIB 3R6IA 1BRLA 5AFDA 4ZGYA 1EB3A 4IIDA 1Q2RA 3QGAC 3MUY1 4PE8A 1VH7A 2E9BA 3DFYA 2GUBA 4K37A 3M0YA 4K3ZA 3GXIA 3VIIA 4F0SA 1OX5A 2X7WA 3LY0A 4IUGA 3U3HA 1XHGA 1B54A 3WNLA 4AZ7A 1UP0A 5IM51 3LZ5A 3RK8A 2QUTA 1OG6A 4K8EA 1D2KA 3CO8A 5CLWA 1FOBA 3T2OA 1PTGA 4L1GA 4BF9A 2QDDA 4O14A 3GU2A 1U33A 1Q6RA 3BG3A 1R0MA 3R0DA 4N9CA 3TTSA 1SFSA 5F4SA 3GYCA 4AIOA 3FW6A 2CNCA 1KXTA 1KRAC 1OZQA 3WBXA 1T99A 4D6IA 3SRFA 2XM2A 4KQNA 4XQ6A 1N8FA 1TUFA 3NQCA 3VK5A 3WJZA 1KD0A 4OIFA 1LZOA 1REQA 3W00A 4Q8QA 1TPH1 5LNRA 1Z9AA 3SURA 3VKAA 5JH1A 5FF4A 3B97A 4J4KA 4JICA 1K9TA 4PMQA 1OWQA 1JYWA 4S2BA 4LYQA 4AIEA 4WOZA 1KBJA 2NX9A 3WEOA 2G41A 1OD8A 1R87A 3V0TA 1IWPA 5F4XA 4QQUA 1Z48A 3S9YA 5AVNA 2OZ8A 4E2OA 1XBYA 4DWSC 4I7UA 1WE5A 1ME9A 1UPMB 1Q8AA 1Q8JA 4H7CA 1QOXA 3O7UA 1C92A 1F3XA 1EIXA 1CXKA 3W87A 4LANA 1SW3A 2KZHA 2J74A 1LL4A 4HB7A 1RBAA 3RJXA 1DJHA 3S8HA 3KFTA 4CD8A 3OB8A 1G1YA 3ITTA 1ME7A 4K38A 3FFSA 2J7HA 3WQCA 4O54A 4LCQA 3DHPA 3M7SA 4JGDA 5CG0A 3S47A 3UT0A 2GVGA 5AYBA 4JNZA 4OBSA 3GHSA 1EKOA 2X1IA 5GNZA 4H41A 2PDIA 2YCIX 4GOAA 3I6EA 4O1AA 3BAKA 3K30A 1VIZA 3P81A 2O9PA 3RLVA 2X0SA 5DN1A 1X39A 4QGCA 1I2PA 2ZADA 5A6AA 1UD5A 4ZQPA 1XLGA 3GK0A 3D6NA 1H7WA 3R13A 3VU2A 2WVUA 1PTAA 1FWIC 1SSDA 5D8ZA 3WJXA 1W5PA 5EB8A 3S5SA 3PZNA 1FRBA 4LFYA 3WMCA 1BHGA 1BQCA 3BC9A 3QLLA 1TV5A 4PMYA 2DQXA 5A94A 3N29A 5DY3A 1VLWA 4WJ8A 1DTUA 4KEVA 3NQFA 2F6UA 1LTDA 3QV8A 1RLDA 3L4ZA 3BLFA 1A50A 3UW6A 2WJDA 1PDZA 3CC1A 1M01A 3P62A 2Z26A 3FVDA 1PIIA 1WDQA 3O63A 4A4AA 6ALDA 3FXGA 3SJNA 5T8GA 5FJRA 1A3XA 1MDRA 2F2KA 1AJZA 1XH2A 1UOKA 3VNKA 1J6PA 1JPMA 5F2LA 4Z1BA 2ACRA 3HM7A 3NQDA 4RJEA 3MKVA 2ON3A 2Z6IA 5GQBA 1FWNA 1UMYA 4IQJA 2GOKA 4BS0A 3XINA 2HVNA 4GKLA 5FF2A 5DLCA 1QTWA 2NVCA 1QPKA 4C1LA 4NX5A 1QMLA 3T78A 3GHTA 4LV9A 3ZSTA 3SAZA 2CHRA 2ACUA 2Z27A 2W67A 4JY9A 1O6IA 3NPVA 3QQ1A 2NX3A 4I8YA 2FZBA 4RPQA 5CXPA 3EMZA 4WDTA 4WZHA 3NM3A 4QJ5B 2O4QA 1LQAA 2D0HA 1X8CA 1OFEA 3BAWA 5DCDA 3A9BA 5LGZA 4JDBA 1JDFA 4HHMA 3STFA 1IXNA 2J62A 1NIUA 5I24A 4XTDA 3W1XA 5GNYA 1E1EA 1OFDA 2HS8A 4PMZA 4XISA 2OSXA 3CS2A 4O8RA 1B9ZA 3N18A 1W9VA 2JGQA 3IUIA 1L2UA 4H9TA 1RSCA 5KTLA 5AC5A 3L4UA 2OQLA 4N9DA 2ZWZA 3B0PA 1A4LA 4W8BA 3IUDA 1EO7A 3ITLA 1FTXA 3CV6A 2YA0A 1A53A 3ZWSA 4D9PA 3GDTA 4DBDA 1AL8A 4KCVA 1JCLA 4U5IA 1JAEA 1AVAA 4UFMA 5EYWA 3M16A 5IBXC 1IEQA 2CKRA 5CAHA 3OTRA 1JPIA 1AMYA 1P6WA 4WK9A 4G7EB 1F07A 1Q63A 2H3BA 2ALRA 1ZB5A 1C8XA 5BXPA 4AD2A 3W83A 1FDJA 3E0LA 4FO4A 1JAKA 4WY0A 1YDOA 3SW6A 1AQMA 4AFYA 1K77A 1MXGA 3RJYA 1XPYA 2BY3A 1FWFC 5FEXA 1XLHA 2PP0A 1RR2A 2JQXA 4L1WA 1ZNNA 2WVTA 1A5KC 1Q6LA 3TSMA 1E0WA 4DJED 2YW4A 3GTFA 1KRCC 3NURA 4IPPA 5H2ZA 1WDPA 4O16A 3S6TA 4DZ5A 1P1XA 1DJYA 5EKYA 2R91A 2QCHA 3I4EA 4DO6A 2XWDA 3DG6A 4QFUA 1JI2A 4ZO8A 4BWLC 2NXHA 1GTEA 1BXNA 3HPAA 3A21A 4I9JA 1H63A 2V67A 2WYSA 3HV8A 3PSWA 1W9BM 1IEXA 1TWIA 4NI8A 4LVGA 4E4PA 2EJ1A 1IR2A 4AEEA 3IJ8A 3VIKA 4MB4A 4QNEA 1BPLB 5TF0A 1HNYA 2P50A 3PJWA 4QITA 4RUBA 3V35A 3C2VA 3U4FA 1I2NA 1LLWA 2CU0A 3W1NA 4R3UA 4A3UA 4QJ4B 4JX6A 4ROQA 1YADA 1XCFA 3AWOA 5HQLA 3G77A 1MZHA 4GIAA 1O68A 3MCNA 3CUJA 3XISA 4AEOA 3ANUA 1NOWA 4B5NA 3C86A 4KESA 2BP1A 4IGHA 2WWDA 4KGLA 3ATYA 3EB3A 2OO6A 3R4IA 3PB2A 3QY6A 3IV8A 2FYMA 3CLWA 1OZMA 4O17A 2CLEA 3WFLA 2PDMA 4W5ZA 2A1YA 1MXSA 5EBAA 1H7RA 4XD6A 3GB6A 3QQ0A 1P0KA 1TMHA 1R3VA 4CNOA 1F6KA 1OIFA 3EEGA 1Z69A 1XLBA 3T8QA 5DELA 1EHNA 4HZ7A 3EMCA 3LV5A 4FR6A 4MWAD 3VPLA 3EWCA 3W1AA 3CMJA 5A95A 3C4UA 3FCPA 1OX6A 1TPEA 1YQ2A 3FA5A 1ZY9A 4Q8MA 2AL2B 2FVKA 4NAEA 3LENA 1DIEA 5HOSA 5CJNA 9CGTA 9RUBA 2FH6A 4Q7IA 1DJNA 3KP1A 1DPMA 1F6PA 4JIPA 1YLVA 5DT7A 5IBXA 3UYCA 1OG0A 3COTA 5C8BB 1B90A 5A6JA 3WF3A 2PURA 4GQGA 4O1BA 1HIZA 2NLIA 1QAPA 3ARPA 1M7XA 1UZHA 4B9YA 2YXGA 3W28A 3TJIA 3KTSA 4I5RA 2QEZA 2VELA 3SB0A 4AVNA 1F76A 1T0OA 3GSMA 3N13A 2PWVA 2QJGA 4JFSA 2CWXA 3GHRA 4FK9A 3KRUA 4Z08A 3NNTA 3BZJA 4IPIA 3IJQA 2WK2A 3W7GA 3ZVIA 1VFUA 2XVKA 3UPBA 1KWKA 2ACSA 5DFAA 3GW3A 3UY7A 4CQ8A 1GG1A 3W7PA 2P0OA 1QRQA 2B7OA 4G2DA 3PWIA 3T0CA 4HMEA 2FZ9A 4Y9PA 4IL2A 3TP4A 1NF0A 3G1AA 5DXYA 3P80A 3VZYA 4AMAA 1L2QA 3HPSA 1VPQA 5BOFA 3EDKA 4AD3A 3B9NA 2CHOA 4GC4A 3VCRA 2ZXBA 4FLQA 3FSUA 1NQKA 1E3ZA 1P7TB 3VDBA 3UERA 1CI1A 4UB9A 1V3LA 1W3LA 3M0XA 4QROA 5HR7A 2CERA 4L65A 1J2WA 2QQ6A 2O7SA 3WD1A 4JAWA 1W17A 3KS5A 2AMXA 4H9VA 4K7VA 1W9PA 2VQTA 4YYFA 4HNUA 1J0JA 2WCGA 1L6YA 2Z2UA 3S1WA 8A3HA 2WNNA 5I7GA 1UR4A 1GUVA 4NJKA 1Z41A 3LHTA 2I14A 3NZGA 1NOUA 3IJ9A 3WD0A 2FTYA 5K4XA 5FF3A 5EMUA 3DUGA 4DPPA 2AQWA 1FHLA 4C6FA 1F3EA 4J3SA 3MVTA 1S3HA 3ANYA 4JQAA 5I79A 3ARQA 2E6FA 3P61A 1RJQA 3TYEA 2G3JA 1CGUA 2XH4A 3D0CA 4JTSA 3CLMA 3MUIA 2TMDA 4U10A 1TO3A 1ONXA 3R2GA 4H9XA 2VZSA 2VDHA 5HAOA 3TONA 3SCWA 3TQ0A 4ZB5A 2CWNA 3C52A 3ZLHA 1FWCC 3LLFA 4DBWA 4JTCA 3MY9A 3TTYA 2CLKA 1XQLA 3FJNA 5KINA 1V0LA 4KFNA 2YCLA 3UNTA 3DECA 3HB9A 4YTTA 4YTUA 3VNZA 3DGBA 4KCTA 4U4MA 4H83A 5D05A 1JCYA 3RCMA 1V5XA 4OU1A 3VKKA 1ENUA 3V75A 3SRHA 3KAOA 5J04A 3S5YA 3U9IA 3SUVA 2X8RA 2O56A 3OQEA 2NX1A 1LROA 2VVNA 2HXUA 1MFUA 3VZZA 4FNRA 2NUYA 4A8LA 5AYZA 3BLIA 1MW3A 1S5VA 1OVDA 3EDDA 4K36A 4GI6A 1OC7A 3W71A 3W1RA 3BWWA 2VC6A 2WCSA 1DXIA 4Z1YA 3KBSA 5M5DA 1T8QA 1CLKA 1ZP3A 4IF2A 2D1ZA 3DAQA 1QU4A 4D72A 1CEOA 4M19A 3M5ZA 2V5BA 4UOQA 3S6OA 2Z2BA 2MUCA 2VRJA 4QE1A 4X2RA 2V3DA 3W07A 4WR3A 2OT0A 3JU2A 4AWUA 1RPXA 1DXEA 4X61A 2BXYA 2H3DA 4WKAA 1NDZA 1GPFA 2QF8A 3FDGA 3HJEA 3RUBL 1BVZA 4MDPA 4Z42C 3BV4A 2HPMA 4F66A 3OVGA 3W2LA 2A6LA 3LRLA 2WJFA 1XX1A 1JUKA 2ZVRA 3TXZA 1CPUA 1S2CA 3ABQA 5FD0A 5LNUA 2CXEA 1JCXA 3URBA 1FCVA 1XIBA 3LHYA 1U2YA 3I6TA 4BQ4A 4TX9A 3R7MA 1LRNA 2XHYA 3VFCA 2OWWA 3IAQA 3M0HA 4H8VA 3SUUA 2DZBA 2V82A 4J3TA 1SUXA 1K4GA 4O4VA 1UKTA 3VINA 4O28A 1WAWA 2ZC1A 3NZ1A 1HUVA 5CKSA 1EUAA 1W3NA 3VO0A 3SCRA 1M53A 2VEGA 3HQNA 4OHQA 1D8CA 3DH7A 2GPTA 4J3XA 4ZOEA 3GDBA 4W87A 3B8DA 1B3WA 1FWJC 4F48A 4NL1A 2NQZA 4O57A 5C71A 2DV0A 3LCLA 3WFAA 2DPEA 2O55A 4XB3A 7ENLA 1HVXA 3BTNA 4NNCA 3CT2A 2YX0A 3F1QA 4BJHA 3O07A 5LIWX 1JZ8A 1LBFA 2PRMA 1LF1A 1U5JA 1RZMA 2WO5A 1S2WA 2CLIA 3MYPA 1G94A 1YNPA 1FWTA 2JEQA 3PG9A 2E5DA 2NVDA 1W91A 2J8GA 1O5XA 1F8MA 3WUFA 3LHUA 1FY6A 3SY1A 1TJ1A 1JZ7A 5DY2A 2NSXA 4JNMA 4JKMA 1CBGA 1NDWA 3O6YX 5B7ZA 1O94A 1MFVA 3IJLA 5JXQA 1KCZA 3SUTA 1ECEA 3BOFA 3V5OA 4D6DA 5CGMA 3GTNA 1RQEA 3SIZA 1RJRA 1TIMA 2H6RA 3C61A 3VC6A 4C7FA 5IRPA 4TUFA 3F5JA 3APYA 2WKGA 4N2YA 5GNXA 4MWAE 1W3KA 3GXTA 4BQ2A 1Y65A 4MKVA 4O19A 2FDSA 1NEYA 4IMFA 3T81A 2QPSA 4PCPA 1P6BA 4Z1DA 1SQ7A 3UWZA 1CTNA 3QV9A 3G8EA 3ZJ8A 2O7QA 4XSLA 3L21A 2WHJA 5K4ZA 2CHNA 2WPBA 2NVAA 2V2DA 3W7JA 1SZGA 1HKWA 3TAOA 4FLSA 1TCDA 1WAUA 4S3CA 1KFBA 3TLLA 2CITA 1A5UA 4HCLA 4JY8A 3H54A 3BLEA 3NA8A 3RO8A 4H00A 5CZJA 2XSBA 1V6XA 4IOTA 3POCA 3AQUA 1KGXA 2JBMA 1Z6KA 1H49A 3PUOA 1B3VA 3OODA 1T7LA 4J28A 4M56A 1E4LA 2C71A 1GOOA 4IP5A 3NOYA 4WEVX 4JTKA 4J2MA 4YVVA 1PHWA 1ML1A 4IZGA 1HVQA 3SN1A 3E0WA 2GQ3A 3IIXA 4Q8OA 5G5IA 1AZ2A 1K6WA 2EG8A 1VFHA 3CL8A 4MNLA 3QFWA 2R1PA 4RX0A 3WD2A 3WBWA 3AC0A 3BLOA 3N19B 2WMIA 4PUEA 1JDCA 1VFLA 4PCFA 1TV3A 3Q58A 4IIGA 1WP6A 4EAMA 4NNBA 3WG6A 4ZL1A 3TMQA 4OVXA 3KRBA 3E3HA 5DXXA 1T41A 1JQVA 2B81A 3YPIA 1F4HA 4EXBA 3RFAA 2ZRYA 3H53A 4EXAA 2ZUWA 1B31A 1EEXA 1T8XA 4AZCB 3KDNA 4C5ZA 4A3HA 4C65A 1LL6A 2E25A 3FVMA 5BRPA 4C6EA 1IWBA 4US6A 2DORA 5D30A 4GVGA 4LB3A 4L4MA 2AQOA 1FP9A 3ARSA 2VENA 1SJAA 4YCOA 1X96A 2CZDA 2PMQA 3W2KA 3TROA 2G0WA 1RH9A 1ZJIA 2X2YA 1TTIA 4WIWA 3DOPA 3GC5A 5GJPA 4PCSA 1V6VA 3T6CA 3T2PA 5CPTA 4KBXA 1LJYA 4URIA 4GCAA 1SO3A 4H9YA 3NJ3A 3S1UA 4PMDA 2VX7A 3CAKA 4CQCA 1EBGA 4JTAA 4IMAA 1NF7A 1L6GA 1KM2A 2ZZ4A 1V8EA 3VIFA 4LYKA 4PB5A 1ZSXA 4H8UA 2GJXA 1Q7ZA 2JFEX 5LYRA 4A8IA 1LQ2A 1IZJA 1NAL1 3VABA 1J0YA 4RV3A 3UWEA 2JIWA 3OBKA 2NV2A 1E6SM 3IK2A 4M5PA 5BOEA 1MVYA 3CEUA 3K4WA 5C2XA 1RLCL 4BF7A 1E70M 4PRRA 3TK7A 5J8LA 3H4XA 2OLHA 2V5JA 1TPDA 3A24A 3JUGA 1A49A 1OT1A 3AS2A 1QK2A 3VGFA 3SCVA 4ZB0A 4O12A 3E0FA 3AUJA 1KBKA 4GXPA 4Q4QA 1HZYA 3T9PA 4E3VA 4HBKA 3AHXA 5FJIA 3KBJA 4FPSA 1YXYA 1FWBC 2Y0FA 2WSRA 3H2OA 4XBKA 3A5VA 3O6AA 1Q7MA 1MUCA 1TV7A 3QPZA 4ERIA 3LRMA 3AI0A 3LERA 1UWIA 2I17A 3QOKA 4REQA 2C14A 4HPJA 3CZEA 4NQ1A 2VFGA 4NJGA 4QSFA 3IGSA 2ZRUA 2GJLA 3NSMA 3MUZ1 4HSNA 5DO8A 1KFLA 3G1HA 2NQ5A 4FOUA 2DZAA 2O9TA 3HPFA 3AU2A 3ZJ7A 3TYUA 4GA8A 3ZMRA 1E0XA 3HG3A 2GL5A 2G3NA 2XJ7A 4IX0A 3DC0A 4KWUA 2HNEA 4YHEA 1AUSL 3TKFA 3PHAA 4WX2A 3UZJA 3IWPA 4GBDA 1J96A 3WK2A 4MFEA 1ZP4A 1TPVA 1JFHA 3FV9A 5PTDA 1AJ0A 3KLKA 3B9OA 3N4AA 1XIDA 2CFFA 4AZBA 4DX3A 3QZEA 3MO7A 3R5EA 2Z1VA 2ZUTA 2RH9A 3TDFA 3VGBA 1E15A 1W54A 4YL2A 1XDMA 3AXKA 3TUUA 5DCBA 1WNOA 1AG1O 4C90A 4ZEPA 2GDUA 3U2CA 4E6MA 1JYVA 2X41A 3CWNA 5I3FA 3TEVA 5KSWA 2P10A 4LB4A 2NWRA 2FB2A 4CQBA 8RUCA 2QVNA 1KGWA 3N2TA 1X98A 3OA5A 1SR0A 5DMLA 3NIYA 3L0NA 3PBUA 5C9XA 1BSLA 3L4WA 4U2ZA 3MZ2A 3GDLA 1JFXA 4KIRA 4BQ5A 1TPB1 4DVOA 4I7VA 2E67A 1EO5A 4NX0A 2G8ZA 2BOFX 2QKFA 2NW0A 1XD1A 4TVDA 3NEHA 2A4AA 4CNPA 3P82A 1XIJA 1P4CA 5FAGA 5HNNA 5HPCA 3EOLA 5FEPA 1JCTA 4F0LA 4WF7A 3VNYA 2TPSA 2OXNA 3JRKA 4HPNA 3O05A 3EXSA 3WNOA 1ZBCA 1XGDA 3B8SA 3WF2A 5I6SA 2PLKA 3TN3A 1ZS2A 3P67A 1IWAA 4DAIA 5H91A 2WQDA 3DGRA 1A5OC 4RNJA 5D38A 1PKNA 3QZ6A 4BI7A 5I00A 4PCNA 3APTA 1KM6A 5AECA 1JCMP 4DZAA 1HKKA 2VZOA 3WLKX 5D02A 5FSDC 3CL6A 2GQAA 5C9WA 4RZ4A 2B7QA 4UTLA 3T4CA 4CEUC 3BO9A 3NL5A 1ITCA 3QR1A 4HOZA 2PLMA 3H2CA 1C93A 5LGXA 1UA3A 2W79A 3SQSA 3HTWA 4HYWA 5I3HA 3UBPC 2D2HA 1ISZA 3BGJA 3ZR5A 3II1A 2HJPA 1XLCA 3MUAA 1XLEA 4R88A 4BK9A 1JDAA 2GUYA 2OEKA 1GOIA 1M7JA 1E6PA 4K2SA 2ZZ3A 4FNQA 4NSBA 2IQTA 1BEUA 2A21A 2VT0A 3KOZA 1P0EA 7A3HA 2PWGA 4WKFA 1QCWA 4NYYA 4LUTA 4RZ5A 4GWEA 5HR6A 1GOKA 1V02E 3TR2A 3W88A 4IGSA 2Z1KA 1NJJA 4AVOA 4DM2A 3LS9A 2PD5A 1Y7VA 5BRQA 4RE4A 1DWIM 1MUWA 1TTPA 4AWTA 1GOWA 2BGNE 3PP7A 3GVVA 4AC1X 1J18A 3V4BA 3OVQA 2BSLA 3M0KA 2J25A 2PWEA 1H41A 4ICNA 4P8VA 4TX6A 2YSWA 2ADAA 4ROPA 4J5NA 3W81A 4XVDA 1BKHA 3BW3A 3LPPA 3P0WA 2PC8A 1ZAIA 5K3VA 4CLMA 3PF3A 1EJWC 1TJ0A 2WCAA 4GYPC 5M17A 1LWIA 2V5KA 3OVRA 3RG6A 4PC8A 3TYZA 5F1UA 1J9YA 3PG8A 1U5VA 4NXKA 1Q6DA 4LH8A 4LALA 2VZUA 3V5FA 2ZUMA 5AN7A 4PL2A 2CKSA 1CNVA 2VC9A 1U22A 1UYQA 3PFRA 2GJXB 1JG9A 3WDPP 2XM1A 3ZFHA 5AVHA 1E0VA 1FDYA 4NJIA 3N3TA 1KB3A 1IF2A 3QR0A 3MVIA 2Y7FA 1QHPA 2HBVA 4X2PA 4UTTA 4ZQMA 4GNJA 1W8SA 1GJUA 2ZDSA 1IEWA 2XSAA 3GY1A 4JQ1A 1ZHAA 2QCMA 2DZUA 1X6UA 3WDRA 3VNMA 4PMRA 4AU0A 1GZJA 4PTVA 4CD5A 3ZQ9A 3HMJG 4FMVA 1VF8A 4JKLA 2W6RA 3A6OA 5BXRA 2QCGA 1QK0A 4IQDA 4OV4A 3I3BA 1TVLA 2PP3A 1C9WA 4GFIA 3HGRA 1K3UA 4UQBA 5KITA 7PTDA 2G4FA 2YYUA 5CC5A 5HQMA 2GOUA 1SW0A 2Q09A 2GSHA 3I65A 4JFWA 5CLTA 4JIHA 3T0DA 4M24A 4IIHA 3UJEA 3PTQA 3BLKA 1GOMA 3FN9A 3LCWA 4E2DA 1VRXA 2DP3A 3UR5A 1KM4A 3BCDA 1X6LA 2DFAA 1ADSA 1W1VA 2V30A 4H8HA 3I7SA 3CHEA 1QPRA 3VD4A 2CLOA 5ABEA 1CGYA 1TPWA 3G8RA 5EA9A 4LXFA 2GVYA 3V1PA 3V5CA 5CPSA 3N9KA 1K70A 3TE9A 4Y9NA 1KTBA 1IV8A 1VIWA 3BZGA 4FF5A 1UC5A 3ZIZA 4CD6A 1S38A 1HT6A 1J8VA 3FKKA 1KA9F 4JN7A 3W2JA 5CSUA 5U7SA 1L6FA 1BVNP 3EDEA 1IXPA 3A13A 2R24A 1ZBKA 2Z1XA 3NVDA 1XM3A 3NCOA 4B3KA 3D5HA 2P1FA 1PAMA 4MNJA 3I68A 5AZ1A 2FIQA 3RCNA 2P53A 4L9ZA 3NSXA 3MWAA 1VRDA 1BRLB 3BCFA 1S1PA 4FNUA 1RVKA 4KCWA 2Z1BA 4K68A 2QW5A 4L1XA 1TZZA 3DYOA 4HU0A 3NQBA 3TOYA 1Q4NX 4HJWA 3P14A 2Y63A 1B3ZA 3UJFA 4GO9A 3KP0A 1J0HA 4JYFA 2NQJA 3GFXA 4GK8A 3REQB 8XIMA 2GQ9A 3OU8A 3BJFA 3ANVA 5HQEA 4XAFA 1XLMA 4UCGA 1W2VA 1QUMA 3KL5A 2NLYA 1DHPA 2ISSA 3WQVA 2PRLA 1ICSA 3VGEA 2QS8A 2GVJA 3W24A 5HMDA 3RPDA 3U8GA 4J27A 3ALFA 1R2RA 4JYDA 4OZOA 4FLOA 3DG3A 3UWYA 1FBAA 4ZQNA 1F73A 4J40A 4JL2A 2NWSA 3ARXA 4BI6A 1KQYA 4O1CA 2B4GA 3RM8A 3WUGA 3WQWA 1G0CA 5C9UA 1MW2A 2YDAA 3GG1A 3RNDA 4NZ3A 3WUBA 4K6AA 2DSZA 1M68A 1NFPA 3Q37A 2E8YA 2X16A 3PTDA 4CNNA 5LXXA 3QH2A 4ZQRA 1UZ1A 4F79A 3UCDA 1H62A 4FSAA 1XLFA 3QHMA 4RDWA 1I60A 1MW0A 4R5EA 3WLMA 1VYPX 1GW1A 4YYCA 3KBWA 1XLKA 1AH3A 3H21A 4LAUA 3PZ9A 4GZEA 2WSQA 3IJ6A 5C7HA 4MNMA 4G6CA 1OM0A 3QV6A 5EFFA 4LEFA 3V18A 4DWSA 3B8UA 3AS3A 4TR9A 4IHCA 2XVLA 2YXOA 1PZ3A 3F7JA 1UUMA 1MNZA 4UR7A 1R3WA 1O5KA 4JCMA 5DMMA 1CCWB 3USZA 5FSEC 2X2GA 3FLUA 4KT2A 3HO8A 1EDGA 3OLIA 2YA1A 1S39A 2NV9A 1AMKA 2V81A 3THAA 3LOTA 3LHWA 5A8PA 3GUGA 1C9DA 5BNKA 4MJZA 3UD6A 4MWAA 4V15A 3KXQA 2J7DA 4A3QA 4M0XA 4O1FA 1A80A 5G4HC 5IDZA 3F4DA 4ZFMA 4CU8A 3W37A 3VMOA 3FJ6A 4Q4MA 3LDVA 1AJ2A 3QRHA 3SSJA 1ECQA 1C8YA 1E1CB 2HXTA 4QTGA 4DYJA 2ASHA 4NVTA 4B15A 4AUBA 3ZVHA 3VKCA 5GPRA 2E7FA 3DCPA 1RVGA 3OIHA 2X1UA 3K2GA 3FYPA 4FX6M 1NFGA 2ONEA 4TO8A 4A3YA 2QJNA 5IXEA 1K7EA 2E5CA 1QHZA 3EWBX 5CBJA 4OE7A 3UGRA 1B4KA 4I5XA 2D2OA 3LNMA 4TMBA 3B9DA 3UWVA 1TWZA 3QR3A 4FHAA 5B80A 3Q65A 2QAPA 1LDCA 5REQA 2PDJA 3WN6A 3MHUA 2HK0A 1F3TA 1O1ZA 2GGGA 1DJGA 3QXBA 2D3NA 2DIJA 1J93A 4AD1A 2DJXA 2GDQA 1HQTA 1BG4A 4CNSA 2YCLB 2AL1A 2PF0A 1SZRA 3MTWA 2WZMA 3NOEA 4LJ3A 1E5JA 1U1UA 1XXXA 3W7MA 2BGSA 1K9EA 1E4MM 1P43A 1ZAJA 2VMFA 2DZXA 4YTQA 3QBUA 4RXGA 2E40A 4UQAA 4E4UA 4X63A 3KE0A 1IHIA 1J2BA 1ZJBA 2VEPA 4N6FA 2KX9A 4AXKA 1HO4A 2X42A 5AHLA 3T07A 1SMDA 5BOOA 4JFVA 2AAMA 4GI8A 4GQRA 1T6MA 1E55A 4GI4A 3U5YA 1DP0A 1W5QA 4AD5A 3Q67A 2C18A 3TC7A 4OTKA 4GVHA 1IGSA 3ITCA 3MYOA 4KIEA 1KXHA 4I8DA 1H2JA 2D73A 2OEJA 1CB7B 4QEHA 4O13A 3ZR4A 3AOFA 4LUSA 2QZRA 2JKAA 4DAFA 4NZJA 4ATLA 4CD7A 1VD6A 2CESA 2I1OA 5K9DA 3DZ1A 4O0KA 6TIMA 3O2LA 4KFOA 3VIGA 3N2BA 4UUIA 2GGJA 3IGHX 3O8AA 3QGVA 3KZPA 4L6HA 1OIMA 4LVFA 3C3NA 3VE7A 1X7IA 2IKGA 1S1RA 4MZ1A 1R86A 4A22A 4IGMA 4MB1A 3BJSA 3SCPA 5JUVA 5M3WA 2V38A 1PKLA 2GK1A 4ZTXA 3AZSA 4FS9A 1XL9A 3NL6A 1DJZA 2FB3A 2Y89A 3VD7A 3HGOA 2ZICA 3OW1A 4F40A 1K02A 3RM4A 1DHKA 2VI0A 1W3TA 1WZKA 4GMEA 4GQQA 3ZR6A 1RCQA 3W01A 3L5AA 1QI4A 2JF7A 1WB0A 2WXDM 4HGXA 2VTFA 3JZUA 1K7FA 3MP3A 2BVTA 3ME3A 3SCSA 4OWGA 3GZ3A 3LYEA 2QYGA 1OCQA 4PMOA 3MUCA 1SM9A 1RXOB 3CIXA 3PR2A 1UJQA 1DWAM 3WLOA 1PX8A 2FVLA 5IHSA 4IMCA 2WJEA 3MO4A 3EWWA 3GFYA 3IIZA 5HNRA 2W61A 4RNIA 3WL0A 4ES4A 4GNKB 3WFZA 3B8VA 2OSYA 1HKVA 5AHFA 2AAAA 1UR8A 2J9ZA 1UD3A 1Q65A 2FZDA 2G96A 3M0ZA 4E4FA 4LNYA 3RU6A 1RBLA 1XP3A 2P0IA 5M03A 2YCJA 1TMLA 3MW7A 3VDAA 7CGTA 4HMDA 4OECA 1WDDA 3KHJA 2ZA2A 4JXCA 1E6RA 4JL1A 2ZBTA 4J9JA 4DYKA 1ZFJA 2WNQA 3LHVA 4HNNA 1E0UA 3E0VA 3AHZA 3ES7A 1M03A 3G1SA 3RM9A 1CXIA 1GVSA 3NAVA 4FXSA 4LQ1A 1MRQA 1XGEA 4XUYA 1HF6A 3WF4A 1WQ5A 4MVAA 2OO0A 3C5QA 1TX0A 1UD8A 3CMGA 4FXRA 1UUQA 5FEWA 4Q6JA 1N82A 3LSBA 2ZUSA 4P8UA 4Q7NA 3RN6A 2HTMA 1N8WA 2O4MA 2JF6A 2XFWA 3C8FA 1QO5A 4PMXA 3WLRA 1O1HA 2X1SA 5FJUA 1A0CA 4AVFA 3EBVA 3O1NA 1LBMA 2ZUNA 3CPRA 2REQA 1QDSA 4PSPA 1ADDA 1BWLA 2WSPA 1NH6A 1XH1A 4K1GA 1QNRA 5IFTA 5C55A 3THQA 3NUKA 1ZCOA 1J10A 3JR2A 4WGHA 2WVVA 3MB9A 4DUWA 3DI0A 5A2CA 1NP2A 2V3FA 2F7FA 3O16A 3MI2A 3NPXA 1GHRA 5G2WA 1ODUA 1VFSA 3CK5A 4MF4A 4HU4A 2WMKA 1QBAA 2X30A 2WANA 4V33A 5FI8A 4GH3A 5LKYA 4DWSD 2GFTA 4O52A 4E2VA 3UR8A 2BLEA 4GQ0A 9XIAA 2EPKX 1OJXA 3WMBA 4L64A 4BFAA 2VFEA 3L4XA 3UZZA 4IGNA 4ZQOA 4YJ5A 2QVHA 4AX6A 2G3FA 3DIPA 3IEBA 1B30A 3VKBA 3HGSA 4XZLX 3CUFA 1JNDA 2Q8XA 1TR1A 1CLXA 4B5VA 4ENLA 2HMCA 2J66A 2ZRXA 4WHBA 3U2ZA 5I09A 2FZMA 4JTUA 3HIJA 1E71M 4WSHA 1KLZA 1E6ZA 1K9FA 1KFJA 3EDJ