3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
3VWJC 2D0FA 5CZKA 4LLAA 4QRPE 1DQMH 3HUJE 2OR9L 2WV3A 3H9SD 4JHAL 2AJXL 1SM3L 4DAGH 5T1DL 4Y4FD 2LU3A 5ESAA 2XQYG 4PGDA 4TPRH 4RSVA 4J3OC 2B5IB 4U1JA 3QQ3B 1Z3GL 4ELME 1MELA 3LQZB 2BVEA 1UEMA 3F58H 3K4AA 5J9PA 4ZS6C 5TF0A 5BOZG 4D8PB 4FQQB 5HHQB 3OWEA 1EAPA 1DN0A 4G3YL 4LK4A 3IDMA 3GBNH 5IQ9B 3L3GB 3BH8A 3RRQA 3BZDA 3CSPA 4Z7WF 4P59L 3MLTA 3QUMH 3DX8A 5SWZD 5MHSD 3MLPA 5JHLH 3MMEB 3HI1A 3U79A 3MV8D 4KRPD 5TH2A 2APVA 3LD8B 4E42A 4KTDL 1ZEAL 1Q9WB 1SY6A 1FPTH 3ARDB 5K9JL 3GI8L 4JRYD 2XY1A 1T1WA 4LLYA 5T1LD 1A9EA 3F7YA 2DQFA 2EKJA 1UC6A 3ARDC 5JQ6H 1G9NH 4FQXB 4Q2ZA 4Y19A 3BUYB 3UJTL 5ESQA 5C6TL 1RJYB 2WWKT 2DQGH 4Y5YC 5DUPH 2KBGA 4D9QD 3ARTA 2R1YB 1Z9OA 2X10A 4E42B 2HFEB 3TYGH 4G8IB 1L6XA 2HFFA 5FDWB 5KN5A 1CTNA 3VXUD 4Y16A 5INCA 1T0NB 2BFVH 3TJHD 3BQUC 3SKNB 1CIDA 2YD6A 4FTVE 1EDQA 4F7PA 4KKAC 1NCCL 3K3QA 5EZOH 5C0DB 2ZPKH 2ICWB 4PJEB 4EZMA 3B2VH 3IDMB 2GJZB 2DMKA 4CMHB 1YECH 2HLAA 2QADB 1I9JL 1ED3A 2RCSH 4NO2B 1DQDL 4UV7H 3GRWA 4MNGE 4RISH 5F7UA 2XTLA 2Y23A 3WIHL 3O0RH 1RY7B 1JNLH 1I9IH 5L2KB 1EGJH 1FSKC 3MRDA 1DBAH 3FQUB 4QRQB 1GAFL 4P5MA 4HXAL 1CDUA 4F3FB 3QHTC 2QQNH 3ZL4L 2LTQC 5FA4A 1U3HA 2ICEB 4PGBB 3PJSB 3NTCL 1I7ZA 3OJDB 3MOBL 1ZA6A 2V5SA 5FIEA 3DX7B 3UBXB 2VLJA 3CFCH 2XQBH 5BO1L 1NANI 2R2EB 3L9RB 3O3AB 5I17A 1JF1B 2DDQH 2XRAL 3VXTB 25C8L 1BWWA 3QDMB 1K4DB 4XB7A 5E6ZA 4TVPH 1JV5B 1YYMH 4KUCF 4KTDH 4U31A 2YSSA 1OAYH 5DJZA 2W9DH 2Q6WB 4JFDA 1E6JH 3FQXA 5IIEB 2AJSL 5HGBA 2FLRT 1X3DA 7FABL 5C1MB 3E0GA 3QO0B 3T0BA 3GBNL 1DE4B 3DX6A 4C4KT 5CJ5A 3ARUA 5JOPE 2CLRA 4Z7VA 3LB6C 4CMHC 3S35H 5SX4H 3TESA 1XIWB 4C83B 4JQIH 1UB6B 3NFPB 4AG4H 5F6HI 2RJMA 3ORJA 1KBGH 3RWGA 4PP1C 4NO5B 3MBXH 2PXYC 4ZFFA 4Y5XC 1UEYA 1O0VA 3PJSA 1ED3B 3O4LB 4KQ3H 3OAZK 4HWZB 2BVYA 2DIAA 2VXVH 15C8L 2GCYB 2I5YH 5I1IH 1K8DB 2P1YA 3RFZC 2AV1B 4JY4B 4RWHA 4YBLC 3W9DA 4Z76B 2FSEA 3BDXA 3I84A 4DQOH 2XN9B 1CGTA 4PJAE 3BKYL 5DVKA 3I6GA 5CIPB 1U95B 1T1YA 3QQ4B 3BRFA 2AJ3B 1RZKL 2XFXB 4MVBD 1HDMA 3WXWL 1MFCH 1EEZA 3LD8C 1S5HB 2HMIC 2DQEH 1EVUA 2HLFD 2JB6A 1XR8B 3CAFA 4BUHA 3QFDA 5GS0H 2E7LA 5H35B 3SHSA 5GGRB 5I8KH 1QRKA 5E2TH 4TSCL 3V6OE 4YFDB 2B4CC 2VMFA 4QHLB 2DWDB 3IXTA 3V4PH 3KLSA 4DFHA 5GGRY 1UA6H 5T1KB 3VWJA 3O3DB 4RAUA 3VFSB 1FORL 4YDJA 2CK0H 5C0AE 3OX8B 2DLTA 1LP9E 3MUY1 4KAQL 2AJVL 4TUOB 1GYAA 1MCDA 4Z7NF 2EIZB 3O45A 3ALXA 5LXGL 3QIUD 3SE4A 1AO7D 1DN0B 5B38A 2EC9U 2EIDA 4L3EE 4OZIE 2X1OA 5J56B 4XGZB 4TULH 4BSVB 1KN2L 1RIUH 4OBRA 4QRPB 4AEHH 1TFHA 2BRRL 3MRHB 4P9HC 4FQ1H 3SKJH 2YUVA 3CSYB 3VXSB 1KACB 4JPIA 1CFQB 4UINL 1AIFB 1JPSL 2VR9A 5IEKA 3C6LD 5KVMC 4O58H 5D2NE 3UDWC 5IBLD 1YN7A 2NYYD 2F8VA 1VDGA 1CGWA 4LNVA 1ZANL 4MQ7B 1RJLA 3CX2A 1FAIL 3MLWH 3ECBA 4QWWD 4W6YB 4ZPTA 4NC1C 2PCPB 4XCEB 3G08B 2P48B 1WZKA 3MFFB 3MGTA 3D39E 1HDMB 1TJGL 4XMLL 2X9WA 1JPSH 1G7PB 2Q87A 4LLVB 4YLQT 1T4KA 4WJ5A 4MA7H 2VDKL 32C2A 2DQDL 2Z0BA 2VXQL 2UWEA 4JRWA 5ICZA 4QOKB 2ZUTA 3WKML 1U91B 1DQJA 4ODBD 1TPXC 4JFOA 3KXFE 3KPMB 3C6LC 2EYRA 2FZ3B 4OF0A 5BVJB 5FUOH 1LK3L 4QYOA 2GEEA 2PN5A 5J11B 4FQIL 2OCFD 4ZXBA 3DYPA 4WWKC 5JR1L 4YEEA 2Y25A 3F12B 4MB5A 4PRPE 3SDYL 1OGAD 2XIDA 3CK0L 4X9HA 2DKMA 3RWGB 2VXUH 3ARGD 4U2YA 5IBTL 5L0QC 1JRHL 2DAVA 3PXHA 1G6VK 1PQZB 1A6PA 1NUGA 5A2IH 3BEVB 1CT8B 5CP7B 2Y5TB 2E6JA 5D7LE 4C58B 3QZWB 4U1HA 4QXTA 5BZDA 4XPBH 4DEPC 5I8KL 1BD2A 4WUUE 3C08L 3VFVB 5IJKC 3TZVB 1A1NA 4MNHA 2V2TB 2J6EL 3CDGB 4HFUH 1S9WB 4GKOA 4M61B 5L8LB 3MRGA 3OKOA 4U6HA 4EBQL 3MFFA 3X13A 2D0HA 2V5RA 3RPKA 1U3HC 2C3WA 3TNNA 3QXDA 1TXKA 3BRGC 4UDTB 1AH1A 4I0KA 1MI5A 1ADQH 4HMCA 4GKNB 4L3EA 3MXVL 4M7JH 5ENWA 5I8CA 4QT5A 4LEXL 4BKLA 3C8KA 3O8XB 2KPNA 1AXSA 3ZKXC 1SJVA 3PL6C 1UZ8B 3MGTB 1J1XH 5IBLC 2NZ9D 2RQ8A 1CQKA 1OF2B 5K9KA 3RDTC 1Z9LA 4YGVA 3ET9F 4R0LA 1C08A 2VXSH 5ECJE 1MFAL 4OKVA 2C4FT 1JGEA 2EYRB 2FZ3A 1FYHB 1DTUA 5SWSD 1W72A 2DIJA 1CGXA 3SDXB 3B6SA 2R69H 1HYRC 1WFUA 2GJZA 5JIIA 4YBHA 1A4KA 3SO3C 3MODL 4LSQL 3ZDYF 3RWHA 4CVZA 4OB5H 1E6JL 5JXED 4R2GD 2ZCKH 4YGVB 1IC7H 3PL6D 5EPMA 5F8RC 1MFAH 1Q1JL 3VFGH 1AP2A 4APQD 4UQ3A 4PV9A 5E00B 2R2HB 3DUUB 4ZXBD 5C0AD 1Q94B 1WBZA 3L95B 3PWNB 5D5ME 1DEDA 1MCQA 5DVLA 4FFZL 2OXHA 1NKRA 3IXTB 1UKSA 4Y5VC 2DM2A 5F3HB 3P9WB 4LARH 4U3XA 2AV1A 1XF5B 3GMLA 5C09D 3JVGA 4Z78A 4LCCB 5LXGH 4JY5H 1TJHH 1WISA 3MBEB 3JUYA 3RUGE 3QBTB 3KHOA 1BBJB 5C09A 3LVEA 3P30L 5F7WC 4NRYA 1AI1H 1YECL 4E41A 1LMKA 4W81A 5B38B 4O51A 4JKPL 5IHBA 5IFAL 5IVZB 1BIIA 3MLSL 5IB3B 3PQYD 4I5BB 2W0PA 3CFKB 4PJFF 4JHZA 4JZOB 4P48A 1UM6H 2CGRH 1HEZA 1KGCE 1T1XA 5DJXA 1V7NH 4EIGB 2BNRA 4NNYB 4YHNA 1E27B 4X6FA 3TYGL 5D93B 3QUYB 1BMGA 3EGSA 3TBSA 4RAUB 1U41A 3VFSA 1TNNA 3WFZA 2ADJB 5J4MA 2NW2A 5CMAB 2I5YL 3WXWH 5F9OL 3DGCR 4L9LA 1FCGA 4AEIL 3PWLA 1BZ7A 4MNQE 4DQOL 3WUWB 1BJ1H 3JV5A 1RUQL 4P2QD 1F90L 2V7HB 4R4NC 5KS9B 4HPOH 3CVHB 5ESVB 3TBTA 2ZUUA 1LO0H 5D2NB 4PJCA 1F02I 5F7MC 2R0WH 4QGYA 2IJ0C 3TH4T 1YQ2A 5C0JB 3WFHA 3ES6A 4N5EC 5L7XH 3MJGX 5ERWB 1XF4A 4JZNA 3X14B 2ZUSA 1MFEH 1ONQA 4TOYH 3DXAE 1CR9H 4ZSOB 4YFLF 4MQ7A 4RBPK 3HMXH 3QIBB 2DQTL 5GS3A 1DL7H 3MLVH 3MJ8A 5DHVA 5BCAA 4K7PY 2R2EA 3L9RA 2CR6A 3VFOA 4JQXC 4P9HL 4Q6IC 3IVKB 4L29A 4PJHF 2CKBA 2DOCA 1JYXA 3QHFH 4YDIL 4O58L 3VRJB 5HJ3A 1QR1B 2GITB 1YYLH 4WGVB 4NQED 3CFCL 3VE0A 5IMMA 1UWXK 3CPLA 4M1DH 1WQVT 2BRRH 2R9HC 2VNCA 1FN4B 3O4LE 4BK4A 4K71B 4GRMB 5DD3L 5FYJL 4DVRH 4QRSB 3D1MC 5E8DH 4NN7C 1GOFA 3LKQB 3OX8A 1B0GA 3UPCA 5CFHA 5E94B 4OBSA 4UTBH 1DP0A 1XCQB 1U8QA 2MPAH 2NX5A 3D2UA 3VH8G 3H42H 2G5BB 3PQYA 4ZD3H 5KSBA 2IH3A 4TNVF 1SJEA 4R9HA 2OMBA 1I75A 3MLUL 3G9AB 3GM8A 1N7MH 1J11A 2VDOL 3B2VL 3BHBB 2DMCA 4X4YB 1ZS8B 3C5ZC 3KR3H 4KUZH 4RNRA 4JB9H 4ZODA 2G75A 3MA9H 3LQAL 4FXKB 4HQQL 5D2NA 1F4HA 4Y8DC 2BY3A 4XCEA 3HI1B 3O0RL 1N26A 2NNAA 5DTFB 5F89A 4WNQB 1ZEAH 2AEWA 3CD4A 3LRGA 5CP3A 3L3JB 3IJSA 5DUPL 1ONQB 2AJUL 1VEPA 3C2AL 1YN7B 4KJWD 3KYMB 3ZDXF 2HFTA 2XPGB 4K07A 1TTUA 4JKMA 3VI3F 3G5VA 5F7HA 3STLB 4PR5A 3QHFL 4IRSD 2ITDA 1DLHB 2AJYH 4KMQA 4WGWB 1M71A 3QDJA 5EIIA 1G7HA 3BD5A 3MUGB 4CVXA 2AKRB 5CBEB 2APWA 3SDAD 2DQGL 2R56H 3HMXA 3VXMA 3ZKSD 4YNYB 4KJYA 1FO0L 1KCKA 4JRYE 2AV7A 5GSRA 2HFFB 5FDWA 4YHLL 5DD5L 4G7YL 1JK8A 1FNEB 2IBZY 2IG2H 2VXTL 3K2UL 4H25B 1Q0XL 1Q0XH 4MJ4A 2A0LC 4NQEA 4HF5L 3MBXL 5DUML 3AC0A 4GW1A 4Y16C 2VISB 3L95A 1Z9MA 2HT3C 1OTSD 2CDGB 4ZYKB 1FO0B 4X6DF 3BPOB 2R56L 1LO3H 4P2RB 5DMKB 1H0DB 4HPOL 5F1IA 3MACL 3OKDB 4OF3A 4OQ1A 5MEQA 5GISL 1XZ0A 4KPHL 3KJ6H 3FB6B 2X41A 5D9SB 4TPRL 1XR9B 3HC3L 4HWNA 2P5WA 3BKCH 5DRNB 1RK0A 4R7NA 4HKZB 1F4AA 5AAMA 4J4PA 4FFVD 2PYEE 4NQEB 1AP2B 3QP3A 1NSNL 3HE6C 4PV9B 4Q0XH 3QH3A 1QPPA 4G6KH 2NTSP 5HD8D 5FYJE 2NXYB 5I1LA 3FFDB 4H1LH 1P1ZA 3QUMA 1RK1B 4X99B 5DGQA 1MJ8H 5MEPB 3BDYH 3VXMB 2A0LD 5DRZB 3T2PA 4QHKI 1M1SA 1SY6H 4K7FB 4KRLB 1TETH 4K55A 1G7IA 2WZPD 3MPCA 3O6KL 3IDJA 4JY5L 1INEH 5EZJA 4LSPL 5IT2L 3F7QA 4NQDA 5HHXH 4XRCA 5E8PA 2I07B 1MQKH 1RVFL 1YNKH 4RGNC 3VGGA 5E24E 3WNMA 1SBBA 3DARA 4LARL 3TO4B 3MTRA 4LIQE 1BHGA 5JDSB 3QCVL 2LE9A 2OSLB 1BLNA 4LFHG 5GJSL 5M94B 3LEVH 4X9GA 2RBLA 3LKRA 3QDGB 3BPOC 4Y4KD 1CN4A 4O2FA 4OLEA 2D31B 5FYKH 1RUPH 5JTWA 3RHWF 1PKQB 2IAND 2VDLH 1FVDB 4PP2A 5KW9H 1Y0LB 4RQQA 1LEGA 1ZHBA 1YJDL 5HBBA 4L9LB 1GGUA 2LFGA 3DMMB 5EBWA 1RZJC 4HBCL 5EU5B 1D5ZA 3GIZL 2AEQH 3TZVA 1N5AB 4P23A 5DO2D 3GK8L 2DKUA 1T83C 3PP4H 5GS0C 2Z4QA 4JM2D 5ITFA 5T3XE 3O6FC 4G6MH 2AK4D 2CRZA 1CXIA 4JANB 4F3FA 2P44B 3IAGC 1CE6B 4JZJC 4M1CC 5TQ0H 4GO6B 5B3JE 1AHWB 2I27N 4CN4A 5I1CH 4OUUB 1DDHA 3A6CH 3JXAA 4UAOC 5JO5A 5DEGA 2YPLD 1JRHI 3HI5L 4GFTB 2F19L 4KH2A 2GT9A 5EUOF 4MXWH 3R1GH 5C9KA 4Z95H 4NCC1 1PQZA 4WHYG 1CLOL 4MCYA 2YPLA 4UI2A 5JOEA 1U8JB 3WIIH 3PWUB 3MXVH 5F3BA 3BZ4A 1YEGH 2OI9C 5DMGD 5FKAB 4IJ3C 1FZKA 3D85B 3W11D 3X3GL 2UY7A 2CLZA 5I1AA 4UT7L 3B2UC 2ZOKA 4G9FB 3V0AC 3ARPA 4U3CA 2BSSB 1D5ZB 2UZIL 5E99H 4LLUA 5I76B 3S36H 4KGLA 3RZCC 1HH6A 1X5HA 2BVOB 3N1QC 3ROOA 3KPOB 1C5BH 1TIUA 5C0JA 4ODVH 2ZUQB 5GGTA 2VLKB 3DYMA 1D9KA 4GW5A 5IBTH 4WFHD 5BVPL 1QPXA 1PG7X 5I1KH 4AK1A 5T1LA 3P0VH 3ZKNC 4NQCD 3SE9H 3O6LL 3IJYA 1J8HE 2IALB 1F3JB 2P5WD 1E4XL 5EO1A 3QULA 2WIIB 3RGVA 4AMKH 5HHOD 1AXTH 4F7CB 3U36A 3TVMA 3W11C 5CD3A 2CIKB 3O2DL 4JM4L 1LEIA 3GMRB 2G2RA 3VFGL 3KPTA 2VZVA 4PJXA 4Y2DA 1VENA 5CINL 4M03A 1CLCA 3MV9B 3RTQC 1CF8L 3FQNA 4LGSB 1O7SA 4PJ7F 3B6SB 4LASH 3UJJH 3O2VL 1XR8A 4Y4HB 4ZTOH 1QKZH 4ESKA 4P0DA 3DVGB 3RZCD 1SQ2N 4QOKE 2EC8A 2V5YA 3GMMA 1HYSC 3EO9L 4JO1L 1Z9SA 3B9KD 4QHNA 5K9OB 4HZLA 2IQ9H 5ICXB 5IHZA 1H8NA 4I4WA 5TE6L 5DHYA 2ORBH 3BMVA 1DQLL 4K23L 2ZOLA 5FUZL 1NH6A 4XH2B 3HC0B 1LILA 2YWZA 1CU4H 2G5RA 4HKXB 5EUOE 2O5ZH 4QF1A 4P99A 5B4MD 5E2WL 2H3NA 3RX7A 5DD1H 2XQYK 1XGTA 1DSFL 4KMTL 4LCYA 4JFPB 2GSGA 3DX9B 1WC7A 3PWPE 4BQBA 3RY6A 4BH7A 5IW6B 4KXZI 4Z5RA 2ATPB 4YAQA 3SKUD 3LIZL 4TSBH 4X9FA 1CDBA 1OSPH 1FJ1A 3C5ZD 1CDCA 2CJUH 2E7MA 2XKUA 1G7MB 3LN9A 1LE5B 5D7JA 4Z7UF 2WANA 3KS0J 4QCIA 3TWCL 3NACL 3Q6GL 3CXDL 1EZVY 1HOCA 4YHKL 1V7ML 3SKMA 3VG0H 2C26A 4GRLC 1J0ZA 4ODHH 4ZAKA 2VZUA 3G5XA 3WS6A 4G80B 5FV1L 2R8SL 5EU6D 3BT2H 3WHE0 5B8CB 5C0BB 2MMXA 5JDSA 5L9DH 4HUVB 1KB9K 1KTRL 5ANMB 3I50L 4L1HA 3QXAA 2APBA 5J7CC 4LLVA 3I75B 3FAWA 3NA9L 1ZHKB 3C5JA 5C0GA 1MFCL 1LE9B 4PGZA 4UTAL 2AK4E 3FFCD 2C1OB 1DANU 5I74C 3IETA 3V4UH 3GMQA 3TVMD 3IDJB 4F37F 1HHKA 2WUCL 1FNSL 3D0LA 1OP3H 4UOW1 8CGTA 4NIKB 1NMCC 2DLFL 3VWJD 1YDPB 1F58H 1CL7L 3QDGA 2X9XA 1N5AA 5DFTA 5F71A 3EO1A 5MERA 1S7XA 1P9MA 3OB0K 4YC2C 3WMSA 4GRWH 3RKDD 1T04A 4ISVA 2OYPA 3JBG7 2X44D 4AM0A 4HXBH 3JTSB 4WW1B 2YZ1A 4ZS7H 5FEBA 4LLQB 3MRIA 3RAJL 1RK1A 5C8JB 3U1SL 1WGOA 1DBJL 4H88H 1R3KA 4LLDA 1CFTB 1R3IL 5CEXA 3KJ4C 5HYSG 3AS0A 3HE6D 3C60A 2NY6C 1H3VA 4ZTPH 3LN4B 3QUXA 3GSNB 5K93A 5J13B 4K3JH 3IDYB 1QSEE 1WSST 3ZYIA 3FL7A 4LSSL 43C9A 3ARRA 4HAFA 1HHHB 4NDMA 4AM0B 2IBZX 2XT1B 3D69A 1EERB 1A6TB 4R90L 5H94B 4XC1L 5GGRA 4LQFL 5HHOE 3DUSB 1PEWA 2R1YA 2MTPA 3HPLA 4MD0B 3MV7A 1QFWL 4QLRA 2HTKD 4WTZA 4YHMH 4M3KB 3FJTA 4B7IA 4M6MH 3O9WA 4KXZH 3P11H 2ZKHH 2V6HA 1UWGL 1UVQA 1OAZH 3QG7H 3LS5H 1F8TL 2R4RH 1T4KB 4LU5H 4XC1H 1AR1D 5DJ2A 2WWKO 3RWCB 1R24A 1JWSA 5CD5C 4I77H 4J6RH 3RY4A 1HXMB 1RZJL 1KYOK 5DK0A 1MCBA 4HK0B 3VFWA 3NAAL 4OCWH 3NZHL 1ZGLB 3I3BA 1DEEB 4PRHD 3CVHA 5EBLB 4Y4KC 4HIJB 1FG9C 1A14L 1PG7H 2Y6SC 5MP6L 5CLTA 3S5LB 1KB5L 5MEQB 3MRLB 4KHXH 1EHAA 3SO5A 1QHPA 4J8RA 1BFOB 3SJVD 4QXGL 1EPFA 1P4LB 4RIRB 4P5TC 5JPMA 2HT2D 5I1JH 1RUAH 3J8F7 3Q48A 1A6TA 5H94A 5JW4R 5DJXB 4RWYH 3U30B 1FRGH 4QRUB 1TZGL 3EFFB 4YJZL 5IHUH 4EXKA 4JFFD 4WO4D 5I66A 1DBML 4PRBA 1FLRH 5IMKB 4XP6L 5MI0C 3S88L 1TVHB 4L4TA 4QXUL 3VJ6A 4Z7UA 4ODSL 3U9PH 2A77H 4M00A 3KLHC 1O7VA 1OTUC 5DR5H 5D5MA 1A6AB 4OD1H 4FQJL 4LGRB 4FQXA 1T3FB 3B9EA 4ODWB 2YD9A 5I9QB 3HZMA 3BGMB 4M9OA 4LCUA 4KDVA 1HILA 3MA7A 4JFFE 2DWEB 4LVHC 3KXFD 2FBJL 1I9RH 3KPSE 3B8SA 4LNRB 4Y1AA 2YS4A 1F13A 2R8SH 4XBPA 2ZUYA 1GGTA 4X7TB 2QBWA 3ESUF 4X7EC 1PGRB 4UILH 7FABH 2F58H 1JPFA 5HPOA 4OCYH 3C5ZA 1WK0A 3P9MB 4XCYA 5I1HH 1LDPH 3ARQA 2YWYA 2GK0A 4AQ1B 4KJPD 2V9RA 1DFBH 3S4SA 4HMEA 4M7KL 3FT4A 2YC1B 2IADB 1EAPB 5DLML 1J7VR 3HZMB 5KG9A 4LKCA 2OTPA 4X7SH 2DF3A 4IOFD 3OGCA 4PJ5B 4JRYA 2DICA 9CGTA 1BVLB 4GG6E 1IEBB 1FGVH 3ZYOA 1RZFH 1MIEH 3QFJB 1SMOA 3MMEA 2UYLA 5KAQF 4L8DA 1I3GH 5E9DA 3UYRL 5E2UH 2GAZA 3ARZA 1FZMB 3K0WA 4HXAH 3MXWL 4KI5D 1PEZA 3JV4A 2PW1A 3G6JF 4PJXB 3G5XB 1EHNA 3UC0L 3BD4A 3QPQD 4WEBH 2OR8A 1A3LL 2BDNL 4UV7L 4CAGA 2LVEA 4TNWK 1MCKA 5I8EB 1FIGH 3HC4H 3MJ9L 4G8IA 2B1AL 2BNRB 4NNYA 2X4RA 3CX5J 3AMLA 3VMPA 3H2WA 3TCLB 1XGUB 2VC2L 3DURA 3QXUA 4M48L 4Z0XA 1CLYL 4R3SB 4HXBL 4CNIB 3IB4A 1QKZL 3GSUA 4YZFE 4QOKD 1M6OA 3I02B 3IFLL 3DXAB 3C09B 1FL6B 3EYUL 4ZG1A 3ARGC 1AO7E 1CBVL 5C6TH 4NZRH 4Y5XB 2W59A 1MJUL 4YX2L 2PXYB 3M07A 5A16A 3ME0A 5T5FH 5FO7A 4JDZA 3BSZH 1LK2A 3HPJA 4Y4FB 3ZYZA 2ICEA 5T33H 1E27A 2XG5A 3ABZA 2EH8L 5ID1B 2P49B 3U46B 1OTTD 3U9UA 3ZHKA 2VTFA 4LCWD 4Z9KB 1NPUA 1U3HD 2HA1A 3MV8A 5DJ0B 2OTWA 4N68A 3L3KA 4JGJA 4K7PX 1R3KB 1NBVH 4P59H 5L9DL 3SE8H 3EBAA 2HLFC 2OM5A 3UTTA 3WNOA 3TO4D 4PJBB 5B8CA 3OAUH 3UXFA 3UAJC 4YO0A 1T1WB 1W72L 1WAAA 3JWDC 4ZQKA 3GMPB 4LVOC 3BX7C 1UWXH 3DXAA 4D0DA 3BUYA 2B7DT 5E8EB 2IANB 1S78D 1BZ9B 1J0YA 4WUKH 2JIXD 2JCCB 3A6BL 4XWGL 1I4FB 3QIUC 4X7FC 1IFHL 3ULVL 1I1AA 1NLDH 4LGPB 5IG7B 2C1PB 1U8OB 4I48B 3L7EA 3O9WC 4I0PC 1G7LB 4HJJL 5EORL 1RURH 1E6OH 3VXSD 4YQXL 3DETC 5F7KC 2EDRA 3NZ8B 4I13B 3X11A 4L3CB 1J1PH 2R1XB 3VXRD 2WMPA 5J1AB 2IQ9L 3BGFC 4UB0H 1XGPA 1M7XA 4ZFZB 4K7FA 3GSVA 4PRID 3KPSB 4JRYB 4PJEF 2CIKA 1MRDH 1N8ZB 4OZHE 5CSGA 2VABA 5JW5B 5D7IB 1R5VB 1LHZA 1IM3B 4ZOCA 2JJTA 5LQBL 4FZEH 2QL1A 4OM0H 5F7NC 1QBML 2FR4B 1RUPL 1MHCA 2J1KA 1OP9A 3VFTB 4TUKH 2R39A 4JN1H 2W9EL 5BS0D 5E8EA 1UJ3A 1PAMA 1BZ9A 3O3DA 3TJHC 3KDMB 1HIML 4WFED 3L5IA 3WFEH 5D2NC 2KZ1B 1NC2D 1JHKL 1IKFL 4KGJA 3G5YA 1NMAL 3CCHB 3CU1A 4FQHA 4J23A 1UYWH 2KDGA 1L6ZA 3CVIL 4YBQD 4NJ9H 3NFSH 5C7XH 5HDQH 4CL7A 3V8OA 4PS4H 3G6JA 4MJ6B 1Y0LA 1MHCB 1ROWA 4OCRL 5TE7L 5I0DA 4ALAH 3QA3B 1B88A 2DYPB 4ORGB 5EU6E 2WBKA 4J3XA 2EYSA 2VLRA 1J1PL 1NFDB 3OR7B 1SEBB 3GSNH 4CN1A 2H41A 1ZAGA 2P5EE 2W0KA 4YNYA 1QRNE 4P5KB 2FYYB 1IGYB 5LWYH 2HVKA 5KVGH 3CSYA 3VXSA 4WIQA 3LOWA 1CGSL 1AGFB 4PJIA 5ID1A 1KPRA 1RZIA 4Y0GA 5B22A 5GZOD 4HPYL 1DE4A 1LDPL 1CD1A 1P4LA 3TJEH 3PV7A 3TJEL 2YKLL 1S9XA 5ADPL 5C08E 3BIKB 4OCMC 4MA3A 2FIKA 3CFEB 4APQC 5ISZE 3RJQB 3BKCL 1UB6A 3NFPA 2E8YA 4RCAA 3EYQC 4HIXL 1I9RL 1H3GA 2GTWA 3FRUA 5KSUA 3S4SG 4A2MA 2IGFL 4R3SA 2ZCLL 5LGHH 1EEYA 1WCQA 1D5MB 1EH9A 2A6IB 3PWVB 3X12B 4JG1L 4NBYB 2DRUA 3B9DA 4HCRL 3SE8L 3DHMA 3GO1L 4ETQA 2V17L 3MREB 3VXOA 1I1CA 4LHUG 3HNSL 3T08A 5DFVC 5C0RL 2Q7YB 3WN5C 1SYSB 1MRFL 3L7FB 1VFAB 1JGDA 2VAAA 3TA3C 4MSWB 2BP3A 4XP1L 2BC4A 5GGSY 5KJRL 5A40E 2FX9L 1T22A 1CT8A 1G7IB 1N2RA 1T7WA 5DC4B 3OF6D 1KN4H 1P7QD 3BPCB 4KK9D 5F96H 3MV8B 3BQUA 3MZGB 4HWEL 2JIXA 5IVXF 5E8PB 2FB4H 2ILLA 4YHOL 3BZEA 3DUHA 1QNZL 3OTTA 3MNZA 4KC3B 3X3FL 4PJIE 1NCTA 1FFNA 3D6GA 5D1ZC 1F4WL 3HAEG 3SPVB 3QCTH 1MCNA 1QRNA 1J0HA 4FHBD 3EDKA 1IMHC 3UC0H 1BVKB 1IAIH 1IGCL 1RK0B 3QEHA 2R29L 3E6FB 2AJZB 3CLFH 4IOSD 3AB0C 1MVFA 3F7YB 3SQOL 3RTQB 3UO1L 3MNVA 1LNUA 2UWEE 4HUUB 1XH3B 4JO2L 1HQ4A 2PXYD 2AS5M 3HRPA 4ERSL 1ZVHA 4RDQG 1J1OL 1YNLH 1FL5B 3WJLC 2OTUA 2J4WH 3QHZH 5EBWB 2HJFA 5T3ZE 3UP1A 3OKMA 4OZGF 4N0YH 1X7QB 4GBXB 2YPKB 1T1YB 4EDWL 4LPYA 1TCMA 3G5YB 5HHPA 4XNYL 3HCVA 2AABL 4Q0XL 1FBIH 1S7WB 2HG5B 5D71L 3UYRH 5BW7C 1N3NB 2OK0H 1VEMA 3EYQD 3K4ZA 1KCUL 2ATKB 1HNFA 5D70L 3NCBB 5IKCB 5JNYA 3QIWC 1QEWB 2VLJB 1Q0YH 4JFZH 2VLKE 2ZCHH 5DLMH 4PJHB 1XF3A 1CLZH 1X5JA 2AKRA 3HAEB 4GRLB 5EC1B 3B5HA 3SEPA 1JZ4A 2X89A 1OTSC 1CFSA 1JWUB 3C6SA 3HNVH 1JV5A 3L6FB 4PGDB 4P2CG 2V2XA 2VDNL 4QWWC 3TM6A 1IGFH 4FQJH 4PG2C 5IIEA 3VXNA 4DGIH 4KKCD 1IRAY 2NY3B 3EYVA 5AUMA 4OZIB 4ZO7A 3CH1B 4I0PB 3GKWH 3CUPA 2IMMA 4F7TB 4GW1B 1RHHA 4KJQC 1FNLA 4UUJB 4GAYB 5DQDL 3W0WD 1IEHA 1FO0H 1JZ8A 3FQUA 3MYZA 3DO7B 4FQ2H 2VIRA 3NN8A 2IADA 2PYFB 4JN2A 4PRHB 3OAZH 5IW6A 1KNOA 3PGFH 1PJ9A 4ODUA 4O2CB 3QUKB 1T83A 3FOMA 4NCC2 3T8XA 1S7WA 5C09B 4HD9A 1QO3A 4PJIF 1DBMH 5DJAA 5DRWB 3T77B 2EO1A 4CVXB 1P7HL 1JE6A 3VXTA 5IMOA 4WWKD 1FE8L 1HKLH 3ZT5A 2I9LB 4UTAH 4UU9B 4EEEA 5HI4D 1YQVL 4LOUD 4YWGH 5F9JB 5IB2A 3SO3B 1IAOA 5CGMA 3HPLB 1K2DB 5I30H 1P1ZB 3KYKH 4QEGA 1KG0A 4OSUH 2XXMB 4HZLB 4PD4J 3HZYB 1A7RH 3BT2L 2EDKA 3OB8A 1NLBH 1F2QA 1MY5A 2V2XB 2WBJB 3RY5A 1PKOA 3S3SA 1VGEL 1KFAH 3F8UB 4W68A 2YD8A 3OZ9L 5GRVK 2VISA 2XFXA 4C4KO 3PDGA 4HC1A 1QO3B 3NH7L 4PB9H 4PJHA 1F8TH 2R4RL 5FKPA 4R4FL 3NACH 4Q9CA 3QO1A 4S1DC 1A3LH 1CE1H 4G8GD 5FB8A 3MRIB 2X5PA 3IFNH 4Q74A 2E9WA 1F4YH 2QSCL 1BFVH 1D6EA 1MLBB 3VFUB 3LHPL 3RWEB 4DKEH 5GGTL 3QUXB 2X2YA 1JGUH 3U7AA 3BO8B 3GSXA 3VDAA 4KDTC 1GRWA 4U1JB 2AABH 4DGYH 5CZXD 2X4OA 4EDWH 5BQ7A 3EO0B 2X4SB 4P23C 3PWVA 3IDNB 4WFFD 3QG6B 3QIBA 1XGRB 4M93B 2IQAA 1YNLL 5DMYA 4F15B 2IMNA 4P4KC 4ETQB 4Z6AT 4ERSH 3QEUB 2YBRB 4QTHB 3BH8B 4NGHH 2VLLA 5FM8A 3HE7C 1HN1A 3TBYA 4UILL 2CQVA 4XMPL 1KFAL 4OZHB 3SGEH 4KJQD 2V5MA 1BREA 1KPUA 3VFOB 1YMMB 2MKWA 3RWCA 4ZPVA 1NGZA 2D7PA 4BZ2L 2VLRD 4LASL 4GLRH 4P2QE 4FXGA 5HHNB 4WHDA 1HHKB 3ARFC 1QNZH 3JUZA 4U49A 4L4VE 5IVZA 3QWQB 4P57A 2XOTA 3BWAB 5JORB 3TV3H 3KPQA 4FTVB 1AXTL 4IJ3B 1EFXB 2QHLA 3EJJX 3MV7B 4QHMB 2ZUVA 4PJ7A 3S8WA 1KTLA 2EYSB 2VLRB 5BRZE 1KCSL 4GRMA 1FVCA 2CMRH 3M17A 1NUDA 3EGSB 3TBSB 2Z8VC 1HSAB 4NP4H 4LOUC 3BO8A 1EHLH 2C7UB 3ARBD 4NO0B 2DL2A 2HVKB 4JDTH 2AJZA 4Y2OA 5C07E 3DRTB 3VCLA 5INCB 3JTSA 4NWUL 4RMSA 2UWEB 4XVSH 1PW3A 2NR6D 1ZT7A 4P5TA 3SBWA 2CKBH 1NFDA 3OR7A 2ED9A 1F6LL 3R8BB 4NO2A 4WI8A 1H15A 4QYOB 1F3DJ 1CXKA 1BJ8A 1JFQL 4LKXB 3DBXB 3IRZA 3T1FB 1BWMA 1XFPA 5JDJA 3HNVL 4PJAA 5EH1A 2BSRA 3ZE1F 1MNUL 5CEYB 5EZLB 3BEWB 3DLQR 3TWCH 2P8MB 4OGAD 3P4MB 5J3HC 4PJ5D 2WQRA 4ZSOE 1ZVSB 1T2QH 3OXRA 4M7LL 3QFJD 4OUOA 3V95A 2E27L 5FYKD 3OL2A 4Z7OE 1GGCL 5F7DB 3DPBA 3VFTA 5F9WC 1ZT4A 2DQJL 3UYOD 3VXOB 5L2JB 3FFCB 4DN4L 1B0WA 1P7QA 3HI5H 5I16A 2DJSA 4YEFA 1OLZA 1X44A 4W4NA 5E2JA 3ALWA 4XPTL 3RPIB 1UWGH 5CCKH 4JJ5A 5GRXG 1YMHA 2XWBA 5FHAH 5IVXE 5LWYL 3CLEL 3I2CL 4CRPA 4ELKA 3DIFB 5CD3B 1MOEA 1UH4A 4L8SC 3WKMH 5C0GB 4KDTA 4M5YL 4I9WD 5CZVH 4NQDE 4XNQB 5C9JB 2VKWA 5EC1A 1NAMB 1TQBC 3O2WH 4JKWA 4MJ6A 3RX8A 5BJTB 5DYOA 3UZEA 3C09C 1FHGA 3LQMA 4YDJB 4YDVB 1BOGB 4PRHE 5LGJB 1IAIL 4ZUWB 3HZKA 5HDQL 4EOWL 4ZTPL 3ARXA 3QCTL 3MJ9A 4LP4A 5BRZB 3D3VB 1I7RB 1R3IH 3OKNA 3AU1A 5TE4L 2D3VA 2VN7A 3MLWL 2R4SL 3FN3A 4YHOH 4P2QB 5DZNA 3T0VA 3IJHB 2OX5A 3MJ7A 4XZUB 3V6BR 5I1GH 5IVXB 5IB5A 1I7TA 5IB1B 4P3CL 1MCWW 2QQLH 2VSCA 2N4IA 4PTTB 4MHHI 3QEQD 1KTDB 2OR7A 1ZVYA 1T2XA 5M95B 5GRWA 3E6FA 2Y36H 1W0YT 2O5XL 3FHAA 4XBGB 2FECI 5E00A 2CDFA 3RL2B 3OKKA 4M7JL 5GRJH 5JZ7C 2YXMA 3CJJA 2Z91A 4PJGA 2FH6A 1KEMH 5D1XC 3T3ME 2F5BH 3H3KA 4ZO8A 3F62A 1T89C 1XIWC 5JO5B 4HIHA 4QHNB 3H9HA 4IEFB 5FO7B 1TETL 3H9SB 2VZOA 1YC7A 2EE3A 3GMNA 3KYNA 3O4LD 3U82B 3KPQB 4FTVA 4QHMA 2ZCLH 5E7FA 4JG0L 5SWZE 1OAXL 2F53D 4WI2A 4ZUTB 3H3PL 4GG8A 2IF7A 4XP4H 1W0WA 2WINA 4MXVE 5GSVB 2X70B 3TPUA 2C7UA 4NO0A 1NAMA 4KKNA 5E2TL 1U3JA 5A1AA 2BOCB 3O6ML 3WIIL 1AFVH 2I24N 3GNMH 2GFBA 3KPMA 2YKLH 4BH8A 5DMIL 3QJHB 4HPYH 3WHXA 1KXTB 5DQJB 1SYVB 4DTGL 4PP2B 1QP1A 1FZJB 4FQIH 3PUCA 1KT2A 2UZXB 2FO1A 2JK5B 1ULVA 4MLSA 5GGUB 1E4XI 4U7KA 5ICYA 2IBBA 3NBNA 1AQKL 3KPPA 2VLKA 1IL1A 2VZ1A 4GW5B 3IDIB 3V0WH 4N90D 2VQUA 4PPTA 3WXVL 3VWKA 5I8OH 2VDKH 4L3EB 5ENWB 2VXVL 4X4YA 3P4MA 5ID0B 4PLKD 4X5WA 3GI9L 2NY2B 4I3RL 1E28B 3U7WL 5F1OB 2O5ZL 5HXMA 1GGBL 1SBSH 2XN9D 4TSAL 3HMWH 4ZUVB 4YPGA 4U1MA 2WWMC 5DK2A 5JLZA 4UIKH 2VRAA 4GKNA 3ULUH 1RQ5A 2HKFH 4ELMA 2WINB 5GSVA 3OXSA 5GIRB 5E9DB 4JR9L 4J12A 2NPLX 1N4XH 4NZDA 4N0FA 1I3RB 1P4IH 2YUXA 4BH8B 1MFBL 5ETUB 4Y89A 1WJ3A 2XWJA 4J2XA 4O5LH 1MEXH 4YXHL 1P4BH 4X99A 5DEGB 1HSAA 1ZHNB 2VDLL 4LSVL 4DKFL 5HVHC 1UT9A 3HUJA 2HH0H 1R5WB 4TULL 5BVJA 5LJYH 4WDIA 1URLA 3SDDB 1IGYA 3IDYC 3DSFL 1T5XB 3BJ91 1YEIH 4AENB 3O6KH 1WCBB 2ADIA 4BQ8A 1P6FA 4OZ4A 5HYJD 4MAUH 3D87B 2K7QA 4UQ2B 5J6HB 4B7LA 1H0DA 5EIQA 4NCDA 4JFHE 3MQIA 4XAWH 2GCYA 1F3DH 1IGJA 3UTQA 3N85L 2BHZA 1C5BL 4JFDB 2FDBP 3ARDD 4HHAB 4OLZL 1NGYB 4FMFA 2BNUA 4EVNA 4MAYC 4KHTH 3WEXA 4MD5B 4LPUA 2JJSA 3BPLC 1YUHB 2GJ6B 3VMNA 3SCMD 2NY7L 5HHVH 3WD5H 2D7TL 5BV7H 5HHNA 5ALBH 3GBMH 3D9AH 5GHWH 1H5BC 2VL5A 2FJFA 2CUIA 5I8EA 2H1PH 1A47A 2C3GA 3D18A 3VMOA 1MHHA 1A6UL 2A9MH 2EDFA 2R0LH 4ZAKC 2EDJA 4OCYL 2UV3A 3UZQA 4WFHE 4WWKA 3RQ3A 3KYMA 4L8BB 1GC1C 3CC5B 4IRJD 1KJ2L 2WW8A 3ZSSA 3TIEB 3DMMD 4XC3H 4I8DA 4XNUL 3O6FD 4YXLH 5ALCH 3ARBC 5A3ID 2YN5A 3H0TA 2A74A 2DTML 2DTMH 2F53E 1M7IA 2FL5B 4POZC 4XMKH 1FLRL 4GAGH 3BW9B 5SX4I 2I9LA 5JHDD 5IQ7L 3N1PC 3V0VA 1NEZB 3F7VA 4NHCH 2X4TA 2DN7A 3IDNA 2PR4H 3S34L 5L88L 5KSVB 3RVVC 4IHOB 5FYJU 3QIUB 4NBZB 5GGVL 4GQ9L 3ULVD 3H9ZA 2ZG1A 4LLMA 4GAJH 5DJYB 3DVNB 1QACA 4X6DE 4K8RL 5T1MA 3MOBH 1A6AA 1JMZA 1IBGL 5TPWH 2VDOH 4KKLD 3EYFB 5LAXB 3QNXB 5DO2C 3RWJB 2V7NA 2NXZC 2XNAB 3EZJB 1VESA 3V52L 3O6FB 3CPLB 5GGVY 3JWNC 3LQAH 1KV3A 3C9NA 5T5NF 4MJIB 3GM0A 3HTLX 1JWUA 4NHUB 3FTGB 3VGAB 2OXGA 3MLUH 1J8HB 2CUMA 2AXFB 1U8HA 1ETZB 1KELL 1KIQA 3QXTA 2P8LA 3TCLA 1N0XL 1HI6A 2IBGA 4FMKA 1NCCH 5EZOL 1YZZA 3FQWB 3RDTB 4G6FD 4KRNA 1MJ8L 4PJEA 4P46D 1PZ5A 4M8QA 3MCKA 5E8DL 4OZ4B 5KS9A 1AD9B 2JK5A 2EE9A 2OQJA 2R23A 5KZCD 1NCBL 1K4DA 2R15A 1NCNA 1R3HB 3O2DA 5JXAL 4ZMAT 4OTXL 3HUJF 3WHXB 3GSNA 5IBUG 4FQQA 3M8OH 3GHEH 4X4XB 3HC3H 3GSQB 4PRDB 2AXFA 2E5EA 5J89A 1U3HB 1BD2E 3IDGA 1Q72L 3QR2A 2NY0C 3LS4H 4CGTA 4FTVD 5GJTH 1BECA 1I1YB 3PWJB 5JPNB 4M8QB 3VW3H 4G80A 4NPYB 3NPSC 4PB0L 2DQTH 4TSAH 1TPXB 4O02L 3G04A 4MCZA 3RNKA 4DEPB 4PY7B 1F3RB 2L7JA 4PRPA 5C0NC 2KUTA 1CFTA 5CEZE 3BWUC 4DZ8B 2BC4B 1MFEL 5TF1H 3QNXA 1C5DA 3MBEA 4YPGB 3WNLA 3UMTA 2P5EA 4Z8FL 1MAMH 3EKCA 1N59B 4OI7A 3OKKB 3VRLF 3HE6B 5C0DA 1DUZB 2NZIA 2XZQL 1WBXB 2B2XH 2VH5H 4JO4H 4PY8I 3S97C 1KJ2A 2NY4C 1JCKA 3DROB 4OLUH 2DYPA 4WHYH 2CGRL 2JCCF 1OARH 4DTGH 3DETD 5D5MF 3TT1L 5E8NA 1LO5A 5IFAH 3O9WB 5CUSL 3LH2H 3U0WL 1UJTA 3C2AH 5JIPA 1KB5H 4UV4H 2MCPL 3GB7A 1XR9A 3P40A 4WDIB 3EFDH 4S1RH 1JF6A 4QNPE 5J6HA 4DW2L 5I71C 1MUJA 3MNVB 2X4QA 5DMKA 2BOBB 5F1NB 3MA9L 4HKJB 4N0RA 3E6HA 3HRZB 4G9DB 5H2BA 4UUJA 5ESVA 3AREA 4C56E 3L5XH 2OL3H 1WWWX 3MJ7B 3DX8B 1VACA 1FNHA 4X4MA 3AY4A 2Z9TA 5C86A 3QNYB 5E8OA 1FJ1B 5IVOA 1TJHL 4G8GB 1BEYH 1T03L 1JN6A 1F2XK 2W60B 4ZFOA 3B3IB 1EEYB 4TUJB 3X12A 1CXLA 2J88L 3EDEA 5A43C 1A4JA 5DT1L 4YDLB 4QHKJ 1BBDL 5MI0B 4EUPG 5DUBA 3TH3T 1BZQK 3TT3L 1KENH 2GSIA 3HS0B 3QEGH 3FRPA 1RZ8B 3V7AE 5LVEA 4X7DC 4MA8H 4G8FB 4GG6A 1OAKH 4PLJD 1J88A 1J5OH 3WJJC 3QPXL 2H2PD 4Y4FC 2OL3A 3G6AA 4NKQB 3V4VH 3MCG1 3H9SE 4JFFB 4CW1A 3PDOA 4AENA 4C56A 3L3DA 1JNHA 3BP6B 3KPLA 4M8VA 4POUB 1E4WL 3KPRD 4OD2B 1B3JA 3IXAB 2DYPD 3L3HB 3FO2B 1WZLA 1FSKB 3HUJB 1HK6A 5F88B 5DJDB 4MA8L 3WBDA 3WIFB 5E2VL 4QHUA 2FATH 1FC2D 1INQB 3SJVB 2GY5A 2WUBL 1BQLH 5HI5D 4FQXC 1KYOJ 3UTTE 4OFDA 3U6RA 4IRSB 4KRPC 2VZTA 4EUPB 3CLEH 1DUYB 1JIBA 2PW2A 1KEGL 3O4LA 1JZ3A 1FNSH 1T6VN 5B21A 2Z93A 2NXYC 5ELIA 3P0VL 1AHWA 3QQ9C 3K2MC 1ACYL 1DBBL 1AR1C 3QB7C 4Y5YB 5FYLH 4ZDHB 2VDRL 3HA0A 3P4LA 3MZTA 1KB9J 1CXHA 2X4UA 4S1RL 4LPVA 3QXWA 3A67H 5EZIH 3TA3D 3DGGB 4OD2A 1DBBH 4X8XA 5EU4A 1BF8A 1G7JA 1AI1L 4U1NA 4WU5A 4N0FB 4YHKH 5FA3B 3BWAA 4PIRF 4AIZA 4OKDA 5HYJB 2WM0A 3B5TA 2IWGA 5CHNB 4ETYA 3BKYH 2EECA 3ZE2F 1KLUA 3QXDB 4S2SA 1INQA 4J1UB 3WFHB 4PBVC 1GC1H 2WBJC 1JRHH 4R2GB 4QT5B 2Y36L 5D2LB 1CK0H 3LN5B 3FT3B 2ID5A 2Y5TA 3VFRA 4KMTH 4KQ3L 1LWRA 3MNWB 1EHXA 5FUOL 5I1CL 1U0QA 1KJ3L 3N0PB 1OAUH 2A83A 5IWLC 4WU5B 3ZT7A 2B5IC 3RWDB 3P77A 5E4EB 3JTTA 1KTKE 2FX7H 4KV5F 5MEPA 1XCTA 3E2HC 4BQCA 3F65A 4DZ8A 3K1DA 1MCSA 5ANMA 3MV7E 5TE6H 2YD4A 3I6LD 5TGBB 3QEQE 2FATL 3V4VL 1RIVL 1TVBB 5TDPB 1V3LA 4G43A 4OFKA 4NWTH 5T1LB 3WFBH 4XP5H 3EO9H 5DZOA 4HEME 4HGWB 3WE6B 4APQA 3GBLA 1UM5H 1E4WH 4HIHB 4L8CB 3CFDB 5HVGB 2GT9B 4QHLA 5C09E 4WO4B 2NY3C 1OD9A 2V2WA 4B50A 2HFEA 3H7BB 4DKAA 1I1AB 2HKHL 1QLRA 4TVPL 1QFWM 4Z0BH 3ILPB 4ZUTA 1IM9A 4AMKL 4Y1AE 4GUPA 3VU2A 3QQ9D 5L8KB 3IFPB 1FL3A 1YY8B 5KSAB 1J05B 3WFCH 1JPTH 1N0XH 2XQBL 2EDHA 4JFFA 1FL6A 1AE6H 5FA3A 3O41B 1P9MC 1QG3A 2NY1D 1NGZB 3RHWK 5F6IC 1KN2H 1RIUL 5I1KL 1GOGA 1IKNA 1A7PL 4XP9H 3GDBA 4BK5A 4MHHG 4M9PA 3V79C 2QSCH 4HLZG 3DMMA 4JPKH 3U0TB 4FNLH 1BEYL 2W9LA 1BAFH 3PP3K 4IDJL 2CRIA 1B4JL 1OAKL 5FAAA 1D5IL 5ILTL 3C60D 3SCMB 3NH7H 5B3JF 2LQRA 4ZFFB 5I6XC 2OTWB 4OT1H 3TT3H 3QXVA 5IJKA 3DRTA 2Q1EA 2ARJA 3IJHA 3ZHLA 5HI3D 4ZOBA 2B20A 1S7RA 3MR9A 4GKZA 2ICWI 4P46B 2XACC 4U1IB 3THMH 3TBVA 4OCSH 1DEEA 3BN3B 5H2BB 2VDRH 3AREB 1YEFL 4J3VA 5C0AB 1G0YR 4U33A 4HFWA 4ZFOB 4LQ1A 4OZHA 4MLIA 1YMHB 2XWBB 4Y4HC 5FV2A 4EDXB 4XPGH 1RZKH 1EFQA 4Z8FH 1FP5A 1QD0A 5DFVD 1K4CB 1NBYA 4IOFC 4D2NA 3BPNC 1RPQA 4K94L 5FK9B 4N9GB 3C8DA 3LSOA 3FO1B 4X9IA 2EEBA 1BJ1J 1KBGL 1ZGLA 4PB0H 2CLZB 1GHFH 4FQ2L 5IWLA 3DROA 5D9SA 1AGCB 3QDMD 4OD3H 2OL3B 4S1DD 5FGCB 4KKBD 5KVFH 2X4RB 3PWPA 1U8IA 3GMOB 4N1CA 2PNDA 5DK3A 5BRZD 2NW3A 4XVUD 5DDHA 2VXTH 4E5XA 1PYWA 2WNGA 1GSMA 4V1DE 5IW3A 1D9KD 1AQDA 4AG4L 3Q1SH 4PP1D 5GZNC 2YK1H 1BD2B 1EMTL 4FZ8H 4PJAF 2H32H 5B38G 3IVKA 1WAAE 2QKIB 1WUNT 1HILB 3MA7B 2W38A 2ITCA 4NJAH 1T5WB 3RGHA 4AH2A 5EFIA 3DBXA 5E1HB 4P4KD 3VRJA 1HKFA 3SDAC 1YPZB 2HFGL 1OAYL 3G6DH 3NTCH 1WWAX 4JZNB 4PRDA 2NX5D 4Q7DA 5K59E 4D0BA 3BYYA 5KTEL 5FF6B 4WUUB 3SDAB 2DM7A 1ORSA 5LBSL 5C8JA 1IAKB 4MZ2A 2C5DC 5F9DC 1NFIA 1I1YA 3KG5A 3PWJA 3AFLA 3NCYP 2IPTL 4U0RC 1KULA 4LNRA 1U8IB 3MRBB 1IBGH 1CICB 3OBAA 5TPWL 4ZD3L 1KPUB 2R0KL 3U2SB 1H3PL 2LAAA 3CLFL 4B41A 4PG9A 2ATKA 3IRPX 4OZGA 1U8NB 4OQTA 1R24B 2F54D 1UH3A 5EU3B 1UADC 3PNWB 1AO7A 1YDPA 4F58L 1W8OA 3MRFA 4G6KL 1OGAB 3WUWA 5E4IA 4YHNB 4URTB 1YEHL 3E3QE 1FG2A 1TTFA 3M1BA 4EJ1C 1YY9D 3VA6A 1PY4A 3U4AA 1J12A 1P4BL 1VFBA 4FOMA 5IB3A 1QRNB 2EDQA 2FJHB 1B0GB 5CUSH 2Z8WC 3BAEL 3EO0A 4X0KB 3ARBB 1PX4A 2X4SA 4NO0D 1DVFC 3WUZA 4AT6B 3V9FA 1IVLA 1QA9A 1PKQE 3S37L 1LO2H 4NQXA 4IM8A 3QDJB 1JI1A 7CGTA 1CWVA 5HYEA 3BPNB 2PR4L 1K8IB 3LY6A 4NFBA 3REVB 3MLRH 3PL6B 4OFYA 5FGBC 1RIHL 1UB5A 4R4BA 4ZAKB 4ZXBC 3VD4A 2H32A 3ROLA 2GAZB 1MQ8A 4I2XB 2BNQA 3CDCA 3K2UH 2NZ9C 1HHIB 3NIGF 5T1MB 3F5WA 3OAYH 1C5CH 3MC0A 4TTGA 5HJ3B 4MX7B 12E8L 2YK1L 3SDXE 5K33A 5F93C 4HT1L 3N1GC 3C6LB 1N3NA 3IETB 1AGEB 3HI6H 3I3DA 5ALBL 5HTSA 2JJUA 2H2SD 3AREC 3L7FA 3MRBA 3OKMB 1AJ7L 5E94A 4PJGF 5TH2B 5C0EA 1A3RH 4K3EH 4X5XB 4KU1A 2BNQB 4I2XA 5KVFL 1NKOA 2X1PA 1NGWA 2A9NH 4JDVA 2XICA 5C0BE 3STBA 2NW3B 4IIQC 1P84J 5IR1A 5L2KD 4LAJH 4F33B 4WWKB 2Q76B 4F57H 4L8BA 3GMQB 1FZOB 5C0FB 1K8DA 3VD9A 3IKCB 5IMMB 5CJBA 4FFWD 1FO0A 4XC3L 3DO7A 5BO1H 4HIJA 3KR3L 4Q9RH 4OF7A 1SM3H 2AJXH 4GRLA 1JGVL 4U1IA 5CSZA 4L3ED 3MLRL 3GSRB 2JJTC 3FOMB 4OLZH 3CZFB 2Z8RA 5D2LA 1EGJL 4Z5RB 4JHWL 4J7RA 3MLYH 1R0AH 2PYFA 4PRHA 3WLWD 1G6RA 3S37H 1WAAF 3MO1A 2JJWA 3P4NB 5D8JL 3D9AL 1J9CT 3MRMA 4UNTA 1AGBA 5KSAC 5DD3H 1RHHB 2X4TB 2JTDA 3X3FH 1FH5L 3AM8A 5I18L 1MEXL 4N0UB 5JHDA 3W2DH 2CO6B 3VH8B 5KAQG 1MFBH 5JW4N 3FQTA 1BJMA 2BFVL 5DHYB 3SKOA 2AGJL 4RFNC 4IDJH 5SWSA 4PG2A 4ODTL 5CGYC 1Q1JH 3HB3C 2PTTB 3B2UD 1ZLVH 2HJKA 4G6JL 1NGYA 3BOVA 2HRLA 5TE4H 4HGWA 3Q1SL 3SY0A 3IFPA 5LQBH 4YXKL 2O5YL 1A4KB 3Q6FB 3CDFA 4HKBA 3RX5A 4MWFA 3TFKC 5HYFA 4MD0A 5JQ6L 4G9FA 4WEMB 1GGBH 2CRMA 3S5LG 3JVGC 1ZLSH 5DSCA 1OAQL 3MFGB 2YRLA 1OPGH 1UZ6E 3UTZA 4I2XE 3ULUL 1HEZB 1E0OB 4PJDB 5FGRA 1EO5A 4P49A 3ZKND 4CDHA 1T5XA 5LGHL 1WBZB 1RZ7H 5HYJE 5FCUH 1MLCA 1RURL 4HJJH 5EORH 1UG9A 2Y07L 5FHAL 5MERB 2EH7L 4L9DA 3VI4E 1CI5A 3FO9A 5D1QD 3GI9H 3FQRA 3RUGF 3SGJC 2MQ0A 4XP5L 1J1XL 1U8MB 4Z7QF 2EO9A 2VABB 1I8LC 2X6MA 4JVWA 4LLMB 3BESR 3HR6A 1KPVB 3CH8A 3CFJB 4UIKL 3W39B 5E08H 4K94C 4FQHB 1NDMB 32C2B 1XGYL 1S7XB 5CEXB 4ACPA 1GXEA 1I3UA 2HN7A 3U2SA 1MFDH 2D4DA 1A9BB 2Z31B 2PO6B 4OT1L 2ADGA 3MSPA 1JYNA 4EBQH 5DMIH 5ACZB 3A67L 4KJWC 1XAUA 2NY1B 4QGTA 4MA3B 3QRGH 1CZ8L 3OKYA 1BAFL 1I4FA 3BE1H 1GC1L 2YA0A 3GSUB 4HIIB 1K6QH 1QLRB 2UVEA 4NWUH 2BOCA 1KJMB 3CGTA 2NLJA 5HYQB 1QLEL 1UACL 2X4PB 4YK4B 3RGVD 4XPHL 4PJ9B 3T65B 5HGHB 3SDXA 3TC9A 1U91A 1YA5A 1EO8L 4FFZH 4K9EC 4DFIA 2YUZA 4XX1G 1DQTA 1WC7B 5C08D 1GPOH 1VERA 5DURB 1QQDB 5J9PB 4ENED 5TJWK 1BQLL 3H3PH 1HWHB 4IS6B 1CIUA 3GSVB 1KPRB 1RZIB 1FNGA 5GZND 4MA7L 3QI9A 4P3DA 4NKMA 3DRQA 3X11B 35C8L 4UDUB 1E28A 3R0NA 2N7BA 5ITBH 4YIQA 4D9QE 2SEBB 3UBXG 2YXFA 3R06A 4N5ED 1EZVX 1U58B 4TNWF 1FFOA 5GS1B 1TTGA 3FB7A 5CJQH 3ZKMC 1IGJB 3J7HA 2VZSA 1ZT4B 3FN0H 3HR5A 5GS2H 4Z7QE 4PJBA 1N59A 3KHQA 4YDLC 1QBAA 4Y2DB 2EC9T 2QQKL 4OUUA 5E2UL 1CK0L 4XRCB 2DQJH 5DJDA 2QADC 3SGKC 4YDVA 5F1KC 4WUKL 4FQCH 1BOGA 2E27H 1BFVL 4IRJC 4NPYA 3FT2B 4X7SL 1RULH 4KY1L 4HGKC 1MSPA 4P2OD 4Q6YA 4YK4C 4GRLD 1N6QL 3AGVA 3V8CA 2QR0A 4KI1A 5ICXA 1A1MB 5IHZB 4PYGA 2CR3A 1KC5H 1J5OL 4L4TB 4MNQA 5I1EH 4KAQH 1I8IB 3MO1B 3VXME 3V5DA 4MB4A 3L7EB 2D03H 4OCXL 5EA0H 2P24A 3PXJA 1NCWL 1AFVL 1J0KA 2H8PB 5TDNA 3LKPB 4JE4B 3V4PL 5BJTA 4XNMA 4OSUL 2PTUA 2F54B 5C70A 4DVBB 2E7CA 2V5TA 3EHBC 4HS3A 4RZCB 4XCCH 4QRRA 3GGWB 4JG0H 3REWA 1U36A 4BQ9A 1DQQA 2VXUL 3QFJE 4Y4KA 3K80A 1NCAH 1XZ0B 2Q7NA 4P4RA 1NDMA 2BMKA 1M7DA 4FABH 2J8UE 3QUZB 1NC2B 4WHTA 1BX2B 5I19L 1KB5B 1OLLA 3L1OL 1U8KA 4RGMC 2P43B 3RUGA 4WTXA 5F7DA 5I1IL 3QRGL 4MD4A 1G84A 4NN6B 1LDSA 1ORSB 4Q9BA 1NC4B 2WUBH 3T4AA 2A6DA 4H25A 4Z7WB 4OFYD 4WI6A 3LH2L 3FQTB 1OY3B 2WBWB 1F11B 1JGLH 2AERT 3KLDA 3HE7D 2AQ3A 1MAJA 3HE6A 1EEZB 2IAMB 3MJ6A 4TTDC 1OD7A 1L9NA 1FZOA 2VDPH 4LRNH 3BQUD 4OZGB 2C3VB 4QRSA 1A14H 1AC0A 4LPXA 1MCOL 3S3JA 4MQXC 4MWFB 4P2OA 4JO3H 3QPXH 4U05A 4X5XA 1QFUH 4PTUA 4TQEL 4F80A 1IGTA 3VWJB 5GRUL 5D93C 1KCSH 1NAML 4I77L 3RNQA 1K3IA 2CUHA 3BUTA 2HTKC 5B8CC 3UPRB 1RZ7L 1U93A 1RZGB 1F00I 5EO0A 5CBAB 4AT6A 1NANH 2PW2B 3BP7A 4G42B 3NOIA 5IM7A 2BOBA 2OZ4A 3DX7A 4HX1B 1P2CA 3IF1B 4LSRH 2PXYA 4JM2B 1X5YA 4PGEB 4QNPF 1ZLSL 4KROC 2VE6B 5KVDH 4W6XB 2OQJB 3MV7D 4P5MB 3VDCA 2WLYA 2YEZB 3M8OL 4QHUB 3ULVE 1IGTB 4GXVL 1N5YL 1G6RB 4CNIA 2CK0L 3OAYK 3SKOB 3D85D 2BX5A 4YXKH 3ZL4H 5EZJB 5IEKB 1HXMA 3EHBD 4LSDA 3TBWB 3W9EB 2HWZH 4LVNB 5IVNA 2X9YA 2XKSA 3PDDA 4R97B 3D69B 3VRIB 4RISL 3BJLA 4HUVA 1X6LA 4LRIC 1MCPL 2LV4A 4H5SB 3T0EA 1OGTA 2VDPL 4LRNL 5J12C 5D7SH 2AV7B 4JKLA 1JHLL 4ZFOL 4G8FA 3GMOA 4I18B 2J7LA 1LE9A 3O45B 2FWOA 3LEXB 1HI6B 2A77L 2CIIB 3B83A 3LDBC 5HYSB 1WZMA 5TQ2H 4PRNA 4L1DA 4BSWA 2IEPA 3V52H 3W9EA 3EYVB 1WZ1H 4PLNC 4DUVA 4NHCL 2CO7B 3K8MA 4R96A 3Q5TA 4B5EA 3QZWG 1DN2A 3IDXL 3K8KA 5L2KA 3OKDA 4V1DD 4M02A 1F58L 2FEDD 3BISA 3ILQC 4OI9A 3ESVF 3QI9C 2DB8A 3QIWA 4Q9QH 4X4XA 3VXSE 4RGOL 5D7JC 1U3ZA 1EEQA 2BNUB 4QTIL 5F70A 5CSZB 5D1QC 5E6IA 5E5RB 1A1OA 5DXWA 5SV3A 3RVVD 3IFOB 3SDDD 4H26B 1NC2A 4KRMB 4WHTB 3S35L 1Q72H 1ZT1B 3TZVC 4JQVA 3WJLA 2YRZA 2VIRB 2DLHA 4KJYB 1Q8MA 2X05A 1AGCA 4S11A 1IAOB 4H5SA 1SEQL 5EBMB 1VGKB 5E9DD 4X80H 2AJSH 1FVEA 1SJXA 3GRWH 4P2YA 1IC1A 1PFCA 1QFOA 1OWRM 3OXSB 4LU5L 5GIRA 5D71H 4PGJA 1IGIL 2FR4A 3N9GL 2VQTA 1K4CA 1NBYB 3BDBA 4YXLL 4H0GA 3GBML 4RBPH 5HDOA 4P2RA 2DQUH 1VFUA 1Y6MR 1KGCD 1NFDF 2A74B 1GVIA 5C0IB 4K8RD 4R97C 2FJFB 3SDDC 4MXQD 1YEJL 5D1ZB 5IOPA 4KZEL 1FBIL 3RGVC 4GOSA 4P46C 2KH2B 2QQNL 5EFIB 4L29B 1ORQB 2VDNH 4X0KA 3TVMC 4XVJL 5HYQA 1YEEL 2ZG2A 2CLVA 4I18C 3FMGL 3FZUD 2E7BA 1T7XA 3FN0L 2NW2B 2ENSA 4X9BA 2BK8A 5EU6B 2AK1L 5KOVC 5FO8A 4R4FH 1AHWC 3QDJE 2IALA 3SQOH 4GKZB 1JHKH 4OTXH 2NYYC 4HK0A 4YDKH 3GHBH 2IAMD 1HIMH 1NCBH 2A1WL 3D2UD 4I3SL 4K3DH 5EO9B 5FGCE 5E6ID 1P7KB 4DVBA 4Q97A 4NM8L 5EU7E 1UKQA 4JN2B 3WEXB 4Z7WE 3RZCA 4XI5D 2F53B 2G5BA 5D7IF 5T3XD 4RAVB 5EU3A 5DJ6A 1I85A 3MV01 3LSOB 4HWEH 4WUUA 5D72L 1FL5A 4RNRB 2AK4B 2WP3T 3HNSH 1HOCB 2C3VA 3ZSTA 3EOBB 3T0XA 3SGDI 2J8UB 1WFNA 5F3HA 4NZTH 2Q8BL 4ZUVA 3SN6N 4OIIL 4X83A 1WVZA 3WNNA 1F4WH 3PIQB 2GW5A 3DVFA 4GUPB 4N8CL 2OBGA 3BMWA 4JFYB 5IESH 1H9VA 5MHSE 3TO4C 1ES0B 4NNPL 2J3SA 2WWMD 3RWJA 4LCYB 3O41A 2P24B 4TN9A 4PJGB 3RWHB 1L7IH 2Q7YA 4YHYB 3MUZ1 4LVEA 1A6UH 5L88H 4ODXA 2ITCB 4N8VG 1OCWH 1UH2A 2X09A 3SCMC 4NQSB 4LF3B 1MRFH 3KYAA 2O61A 3ECBB 3ZTJH 3MRPA 3P0YH 5HPMB 5KVGL 4R6UA 2LABA 3BXNA 3QWOA 3WCYA 1RFDH 1N6VA 5D70H 4BKLB 3WS3A 4UQ2A 2ICES 4JG1H 3MREA 3FRPG 3L5WA 4CBPA 4YE4H 2JLLA 3NFNA 5FOBA 2D9QB 4ZPTB 1QTYT 4HJGB 4BFGA 4N0YL 4P5TD 1JTOA 1S9VA 3T0AA 4WTZG 5I75C 5D7LD 4PS4L 1AKJA 2JKXA 5C6WH 3WLBB 4DCQB 3EOTH 2FHFA 1JZ7A 1JMXA 1DQLH 3HG1A 4K23H 3QAZC 4WW2A 4KK8C 2P5ED 1FDLH 4HLZH 2VLJE 2VR4A 4YE4L 1FZMA 4K3GA 3QAZB 3CIQA 3GIVA 4NOFA 2JIXB 5J1AA 5LCVL 4OZHF 3VXUB 3MLZL 1ACZA 2EXWC 4POZD 4UZGA 5GGSB 3VGBA 3EAKA 1SEBA 4HH9A 3RI5K 1HHGA 2MJWA 1JNJA 3UYPA 2YOCA 1N8ZA 4U1SA 4XX1E 3VFMA 4YX2H 4XP4L 1H3UA 4ORZC 3BD3A 4WU7B 3NPZB 1S9YA 1X5GA 1BD2D 5CINH 1YN6A 1Y6KR 1QFWI 3DRQB 5AZEH 4ODTH 4E5XB 5ISZA 4UQ3B 4KRPB 1A1NB 1LVEA 4MNHB 2V2TA 4PGCA 1JL8A 1V3JA 3MV11 4F7EA 4JN1L 5BZWA 3OR6A 2QTEA 4NNPH 4MVBC 4NQSA 1Z0MA 2C4FU 3BFOA 5IB1A 5IB5B 3ARSA 5D6DA 3SE3A 4X6DA 3HMWL 1S7QB 3RZWA 4YQXH 2VDQH 1BLNB 4FP8H 5FOJA 3RP1A 3KVQA 4D9LL 3VXPB 1KIPB 3N06B 4WW2B 1MAKA 4BZ1H 1RZKC 4HCRH 4KROD 5D72H 2Z92B 5AAWA 1IARB 3EIFA 3O3BA 3IYLW 1Q9OA 1S9VB 3G04B 4MCZB 3RNKB 1QBBA 5CZVL 1TDQA 1S7VA 1PVHA 2GK2A 4YXHH 3MR9B 4MXVF 5IOPB 1ZLUK 4NM8H 4WJ5B 4WU7A 4F57L 4M43L 4C57C 4FFYL 3GMRA 3V5DB 3GJEA 1HZHH 4DGVL 2APXA 2NMSA 3G5VB 1KJ2B 1RFDL 4FQLL 5D6DC 4XPAH 3T0EB 3D3VD 1BQHA 1WT5C 3NCJH 4RMRA 3QSKB 4M5ZL 4EN3B 1NGXB 2EYTB 3MACH 1P6AB 5HHME 4KJPC 1T80A 1ZOXA 4OGZA 4JDZB 1JNNH 1RV6X 2N7AA 1S7SB 1JFQH 1IFHH 3P3YA 3ULVH 5DR5L 3VGDA 5IG7A 2DI7A 4NQVB 4CMMB 1F6AB 4U7MA 4R96B 3ZDZF 1EEUA 5F7FA 1T2QL 1LP9F 5DHVH 4HBCH 1R6VA 3MUJA 4V2BA 1YJDH 4GW4B 5I2IA 3MRCA 4PUBL 5GS2D 1YMME 4JGUA 2H32B 3ROLB 2X7LB 3TYFB 1W2KT 4AY0A 2Q8BH 3GSXB 3WFEL 4P4KB 4DZBA 2YD1A 1YNTB 4NBXB 3P9LB 3SGKA 2APTA 43C9B 1JP5A 3DGGA 1L7TL 4NQCA 4HWZA 1A9BA 2R4SH 1D5XA 2J8UA 4B53A 1AGBB 3UAJD 2BDNH 4A6YB 1DQJB 4OIIH 1CDHA 3UJIH 4P57B 3TBYB 4DJMA 1J8KA 3NZHH 5JORA 4I3SH 4K3DL 1X4ZA 1Z6JT 4WI4A 1IEAA 4PJDA 4JRXA 5DWUH 3GMNB 5EOCL 4MDJB 3I6GB 5FDYA 2A6KB 2YZ8A 4HAGA 4M93C 4K8RC 1I3GL 4WW2F 2GQHA 3S4SB 2H9GA 2MHAB 3O3EB 1G6RL 3KNBA 3ZE0F 1WIUA 3P4OB 1EUUA 1WZ1L 1GZPB 4G9FD 5C0FA 3S9DB 3RVXD 3FO0L 3GJFH 4GS7C 4I0PD 1W0VA 1TMCB 5I1GL 3T0DA 3VI4F 4X4ZA 3GSOB 2VC2H 4M48H 5KSBB 3D3VA 4JFQA 1K9TA 5I1HL 1KJVA 1QVOB 2F58L 4LSSH 2HN7B 1H3TA 4N9OB 4K3JL 2CSPA 5DEZA 3L3DB 3E3QC 4NQXB 5CWSB 1KIUA 2HWZL 3HAEA 4H20L 1WWBX 4XHJC 2B4CL 1ZSDA 3DYOA 5FYLE 5J12B 4MJIA 3OAUL 4I18A 3QEGL 3HZYA 1YEJH 3C60B 1JGUL 4NT6A 5I1DA 2QSVA 4POYA 3VWKD 1B6UA 5HVFB 1C16B 3HCVB 4U1KA 4TOYL 2VWEC 5TFSL 1AO7B 4HK3J 4G6AD 4Z77A 3IFNL 4BELD 2RB8A 1A5FL 4PBXA 2RR3A 5JW4Q 3OXRB 5KS9F 3ZO0A 5JNYB 1NCDH 4XBEH 4RWYL 4UT6L 4LCIL 1AGDA 3C6LA 2OL3L 2YMXL 3GRWL 1KXQE 4ZOAA 3ULVF 5T33L 3QEQB 4NP4L 2J5LC 4X80L 3S5LA 4A2LA 4QTIH 1L0XA 2EIZA 4Y4KB 1RJYA 3W82A 3KGRA 4DOHB 4FABL 3IFOA 4NZUL 1G9ML 3O3UN 4MJ5A 3QDHA 2NXYD 3DV4A 1QSFD 5DRXA 4CW1B 2EDDA 4XH2A 3K7UA 1U8KB 3EFDL 2XI9A 3NA9H 5AUMB 1ZA6B 1BZ7B 1HQ4B 2QEJA 4XVTL 5H8DA 5J06A 3BP4A 1MJ7H 3QH3B 1MCHA 3U4EB 5CJXC 3EFFA 3VWKC 1GZQA 1FGNL 5GRZA 5K9QI 3F6LA 4LLWA 3T4YA 2NY0B 3D3VE 3MLSH 1XF1A 2UYLB 3VXRA 5E8NB 1EAJA 1B4RA 2VAJA 2ADFL 1FIGL 4Z7UB 3LS5L 1ZTXL 5JQHC 3T8XB 1A8JH 2BVPB 3H42L 4U6YA 2GUOA 4R26L 3S36X 1Q0YL 4JFZL 3L1OH 3SOBL 1RZJH 1QFWH 3B8YA 5EUOB 4XPFL 4Y19D 3KPRE 2YPKA 3MUGA 4HS8H 2X1WL 3IJYB 3KJ4B 4UT6H 5B39G 1FGVL 5GGTH 4X7TA 2A6DB 5L0QB 4LCCA 2HYMA 3QO0A 1CVRA 4R0LC 3NIDF 2XPGA 4JFEE 4LEOA 3U0PB 4F9LC 5DJ2B 3VGAC 3O81A 1RUML 4KTEH 4LSUL 5I8CB 2AEIT 4NQCE 1WF5A 1T89A 1XIWA 3CU7A 4JZJA 1MY7A 3NAAH 4ZUSA 3K1KC 3RWIB 1T3FA 4ODWA 2J8UF 3CC5A 4KK5C 4NO3A 1PZ5B 2F9BT 4LVNC 1NMBH 4BFEA 2DL9A 4U6HB 5ITBL 5GZOC 3SDDA 3HLAA 1KC5L 2D0GA 2VUYA 3FCTB 2FO4A 2WAHA 3PWPB 4X8JB 3W81A 3QUYA 4IS6A 2JELL 3QZWA 4G9FE 4U1HB 5L7XL 1F4XL 1WCBA 1BQHG 4FA8A 2M26A 4XTRD 1KELH 3QEHB 1ZXQA 2I9TA 3LCYA 1IAKA 4JM2C 5JUEH 1GPOL 4G42A 3T0WA 3LHPH 2CXKA 1IC5L 5JA9A 4HULB 4O00A 4IRJB 4CUCA 3RU8H 4HHAA 4X6FB 1LEIB 3PGFL 4HFWB 5CJQL 2FD6L 5E95B 5DC0A 1ZTXH 2A38A 2LU4A 3IU3B 4LEXH 3OZ9H 2W07A 2IH1B 3TBWA 1T7ZA 3TCXA 3WL9B 3EYFA 5LAXA 2Z31A 1H5BB 1Y18A 2LU7A 5D7KD 5EC2B 2P4AB 3QWRD 4OLWH 5DHVB 3Q3GB 3HB3D 3TBTB 4YBQC 1G7QB 5ETUA 2UVFA 1AKJD 3CFBB 3ZE0E 5F97E 3MRFB 4Y1AB 5DMJB 5K59F 2FX9H 4H1LA 4LF3A 1WFOA 4XCCL 4PUBH 3T3PF 4ZDHA 1L9MA 3QIBD 5ERWA 4PY8J 1YEDB 5IBUB 2YHGA 1MCLA 4NZUH 1YEGL 5T3ZH 5A2LH 2VLME 2XKNB 4NNXB 4LBEA 1VCAA 4NN6C 5EA0L 4AJ0A 5CJOH 4QXWA 4L4VA 2G60L 2E7HA 2OK0L 1BOYA 1MWAB 5IHLB 5J1SC 1JF5A 3CUPB 4EN3A 1X4YA 2PF6A 3ARYA 4LHUD 3QUXD 3LKPA 3U83A 3LQAC 5EPMB 1BFSA 3W39A 5IFJA 3L3IA 1K6QL 4M6ML 4WV1B 2R9HD 3TGXA 3I50H 1G1YA 3TN0C 4LL9A 4N0CC 3AXLA 5DD6B 1MVUB 1DQQB 2X7LA 2W92A 2A6IA 3TYFA 1R5IA 1KJ2H 3BKJL 1I7UB 5BW7A 5FYKU 3ULSB 3LEYL 1IC7L 4PJ9D 4U1LA 4X5LA 3C8HA 3BP5A 1LD9A 5ADPH 2D03L 2F74A 2IPKB 4OCXH 3QNZA 4NSKA 2H1PL 2BVTA 2AEQL 3QRFM 4IOIA 2Y4SA 1CLZL 1J0IA 3IS1X 4DKDC 3ZDZE 4UNVA 4S1SL 2C1PA 4I48A 4G8EA 1EV2E 1RULL 5BS0A 1T7VA 5FYKL 5ISZB 3KLAA 2JB6B 5ADOH 5FM5O 3G6JB 1HZHL 2FHCA 4P2QA 3TEUA 1C7SA 1I1AC 4HUXB 1G0XA 3LKNB 4JCMA 5HVHB 2ZOKB 4AEEA 8FABB 3FB5A 2H9GB 2YD3A 4N0CD 5DI8A 3E8UH 3TO2B 5F6IB 5IROA 3SGEI 5FKAA 3O6LH 1NEUA 2J4WL 1KENL 1XGTB 1MCRA 4AEHL 5JZ7D 4YUEH 5F88A 1GGYA 1IM9D 3CVIH 2YA1A 4NKOB 5GGUA 1NMAH 1SVZA 5FYLD 4ODVL 4WI7A 2ZZUT 3CNKA 5TGBA 2E6PA 4TNVK 3ZE2E 4C56B 3D25B 4WY7L 3AU1B 1YEIL 1UXSA 3E6HB 4G9DA 3HRZA 3G9VA 1Q9OB 1KSRA 3EZ8A 1GCFA 4APQB 4V1DA 4NKDB 5SX5H 1P69B 5CZXC 4Y5XA 1GGIL 4HJGA 1NFKA 4ZFZA 3UTOA 2ZG3A 1OB1A 4LDOB 4PJAB 1FVEB 1QSFE 1NLDL 2AGJH 5H37G 1W8NA 2Y72A 3CSBA 3HPJB 1N4XL 2J8HA 2A9NL 2FLBT 3DX6B 2DQEL 5E03A 1MI5B 4HWBL 4BM7A 4LVOB 1FH5H 1CXFA 4XXDB 2Z93B 4XPHH 2P8MA 4QOKA 4MMXC 3QDAA 3PHSA 4HCRA 1GH7A 4LDLB 5EU4B 2JCCA 3EUUA 1TZIB 3Q3GA 4PRIB 4OLVH 2VAAB 3MRRB 5ICYB 3ELAT 3ARWA 1C5CL 3MRPB 2FH8A 1G7LA 1W0WB 4RRPG 4MNGB 3V0WL 3CXHK 5I71B 1J8HA 5DD0H 4XWOD 4OCRH 1P5VA 5FO8B 1MFDL 3DVGA 3NGBC 2BVQA 5MENA 1RIHH 2BSSA 3TP4A 1F5WA 5JMRA 3VW3L 5FB8B 2Y5EA 4B0MM 1OCWL 3FQRB 1R3LB 3GUTA 3PQYE 2XYCA 3ZMRA 4EI6A 4Z95L 4P5KA 4WV1A 2NY4B 2DM3A 4RGND 3R1GL 4ZUWA 3SDCD 3GNML 5FA4B 4ONGH 4Z7OF 5AWNL 4NKMB 3U9UB 1T21B 4HV8B 2H45A 3MRNA 2Z92A 3DSNA 4RX4D 2P46B 2Y07H 1BQSA 3VFVA 2DWDA 5EIIB 3WS3B 3MUHL 1LGVA 3SKJL 3NZ8A 2VLMD 3ULUE 3QG6A 1I8MA 4I0CC 4JM2F 1TQBB 1J10A 1YNKL 1KCRH 1M05B 4LPCA 4K9EL 3VFPB 2Q6WA 5IUSA 1C8PA 4MJ2A 3GK8H 1U8LB 5DRNA 2R0KH 4F7PB 4JANA 4TUJA 2VDQL 4N8CH 3B4NA 3JZ7A 4LEOB 2O5YH 3T2QA 3WSQL 5KW9L 4NRXA 1RZ8A 4NC0B 1I85C 2DQCL 2IH1A 3BDYL 4GKSB 1I8LA 1I9IL 1ZV5A 3NIGE 4JVUA 2QQLL 1SYVA 1I1FB 2JJVA 4FFVC 4DVRL 4ODXB 1CLYH 5FHBL 3S36L 5IV2A 5GJSH 5F21B 3BKML 4WTWA 3H3BC 4CDGC 3Q0HA 2CLVB 4K8RH 5HHQA 3QI9D 1FAKT 1CXEA 2X70A 2KZWA 2ESVB 3WIHA 5JXEC 5IMLB 4XAKD 5K9QG 4QTHA 1S7VB 1BVZA 1KUMA 1X5IA 3MLTB 1IEBA 3GSWB 1CS6A 4NKDA 1Q9LA 3MLZH 3GHBL 4Y1AD 4YDKL 4XVJH 3EDFA 1JI2A 2N56A 4KKLC 1Q9KA 2EEAA 3UJTH 3U4EA 2RAMA 1C5DB 4O2CA 1VFBB 1RZFL 3DECA 4FFWC 3JV4B 4I3GA 5I9QC 5A3IC 1RMFH 1QSVA 4JFDD 2CD0A 3V6OC 1INDH 1E6OL 3I2CH 3DTXA 1ITBB 5IMOB 2CLRB 4FQPA 5LBSH 1U8NA 1LO3L 5DRZA 1RSFA 1DFBL 4HG4J 2W60A 1NGPL 2I60L 3QEQA 1LEKA 4YZFF 1YJDC 1G1CA 1GGCH 2HT4D 5IB4B 1A3RL 4K3EL 4NSKB 3B9KB 4RGOH 4NN5B 4D94A 5BMFL 3GB7B 3V5HB 2AVGA 5IW1B 1MHHB 5D1XD 3KJ6L 2CH8A 5JXEA 1AC6A 2HJKB 1IM9B 1W72H 4I0PA 1MNUH 3ULVC 4HC1H 4LIQL 4LFHD 1A9EB 3VFNA 3MCKB 4TRPL 2XTJE 5GHWL 1JJUA 2EXYD 3G6JE 4KVNH 1R3HA 2XWJB 1U8QB 3D2UB 2VITA 3BAEH 4HEPG 3T1FA 3GSOA 4AIXA 4XP6H 3RL1B 1DBKH 5EBLA 2P5WE 2OJZL 3ZLQC 5IJVB 4OZFB 1VKXA 5DA0B 3U0TA 2ESVA 1D5IH 4NNXA 5ILTH 3B3IA 3QUXC 1AQDB 1S5IL 3HG1D 4HJ0D 4S0SD 1LO2L 2R2BA 2AAVA 1QSZA 2R0ZL 1Q9KB 1J18A 4LSPH 3CZJA 1CDGA 5JPNA 4KUZL 3L3JA 1IC5H 4M7LT 5L2JA 5FYJH 2VE6A 5K9KB 4KQ4L 3HN3A 4IDLA 5C2UB 1FC1A 1DVFA 1KNOB 2FEEL 5IW1A 1Q9WA 2ZKHL 2VLRE 5HGBB 5TFSH 4IRZL 4JGMA 5IR1B 4Q58C 1T1ZA 3QXAB 2ZJSL 3H9YA 3JSSA 3B9AA 3OJ2C 2DQFB 1AD9A 4Z7VB 4P9HH 2R2BB 3AS3A 2PKDA 5D7SL 2C1OA 2CK2A 3RI5F 2AXGA 1NL0H 3KYOB 4H20H 3L6FA 1OAZL 3RVTD 1DVFB 5KVDL 3MOAH 4F7MB 3UCRA 2FBJH 4NRZA 5D2LF 3UPRA 3FMGH 4MA1C 2J8OA 2A6KA 3GI8H 4X4ME 4GG8B 3MXWH 2XZCL 1UJ3C 3U46A 5EOQH 5D7JD 4LQFH 4R90H 3ZKMD 3RIFF 3LN5A 5KSVA 2FECL 2EDEA 4YHZH 2D2OA 5CEZH 3U7WH 1F4YL 4V2CB 3MNZB 3QFJA 3HHRB 3RWEA 1KLFA 4QRRE 4DK3A 5KSBE 1WT5A 3O11A 2PTVA 2R0WL 4JFQB 5DJYA 1T21A 1IGIH 3MRDB 4OV6F 4XBGA 4ZFGL 3P9LA 4PJXF 4PB9L 4U0RB 2ADFH 2FCBA 4OCNC 3QUMB 4QKXB 4EDXA 2C3HA 4E41B 4E0RA 2IANE 2WLZA 3O4OC 5FM5M 3CVHL 4XCFH 1UZ8A 3D0VB 5IM7B 2WUCH 3RVTC 2H3NB 5FECB 1FGNH 2QHRH 3QYCA 4K7PH 3MV8E 2L4OA 5AD0A 4MAYD 3FO1A 2YBRA 4LCCC 4M1GL 4HFUL 4M3JA 1YEFH 5HSFA 4AQOA 1RAMA 3B9KA 4LPTA 4I4WB 3FQNB 1CFNA 4HS6A 1DQML 3EJYC 3PWPD 4P4RB 5JIKA 2BRQA 4QXUH 3STZA 5INDB 2B8OT 1OSZB 3O3EA 3QA3A 5I19H 2JE8A 3BH9B 5ISZD 4GLRI 3R0MA 4NQCB 2AP2A 4NHUA 1T0MA 2ESVE 5CLWA 3PHQB 1RJZA 1KT2B 1A02N 3MCLH 3AAZB 1Z5LB 1U8PB 4LCWA 3BPLB 1N6QH 2G9HB 4Y16D 2CJUL 3Q5YA 1PBYA 3F12A 2BZDA 5IK3B 4OZFA 1VKXB 3C87A 4UNUA 1NJ9A 2F54E 1J05A 1IGML 2KL6A 2DQDH 4QCIB 4J3WA 1A2YA 3DI2B 4OZIA 4HV8A 2YD2A 4PJ9A 2QQKH 4PJEE 5EZIL 2EICA 1U2HA 4L5FL 4XMLH 3H7BA 1A6WH 4IHOA 3FRUB 5C0BD 5CD5D 5KSUB 1VSCA 5B4MC 5JW5A 3MGOB 1LP9A 3GJFB 4W4OC 2CRYA 4WNQA 1UWEH