3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
4XB7A 4Z0XB 2GY5A 2YBRB 1WIUA 3VRLF 4LCUB 1V5JA 2P7TA 1IM9A 4CVXA 1MCPL 2BOCA 4WUUA 4ZNEA 1BGXL 4YHLL 5D5MB 2ADIA 3IDIA 2OTWA 2EZ0D 3DV4B 4YHZH 4E42A 2F74A 1HHJA 4JAMB 3WO4C 1AD0A 3KVQA 4WY7H 1QFWM 4PB9H 4XCYB 4XGZA 4LNRA 5FO9A 3VXPB 3AY4A 2DQUH 1W72B 1Z0NA 1DQQA 4BH7B 1FE8H 2GQHA 1CS6A 1MVUB 3DPBA 4PGBB 4K7FB 5FYKD 5AYQA 3L7EA 2CLVB 4LLMA 4P2RD 5DGQA 5CSGA 1FZOA 3GO1H 4I18C 1T89A 1HH9B 4OZFG 1C5CH 4JGMA 1MCPH 3MFGB 4YDLC 4QHNA 5KSAC 3O2WH 4K8RH 5JHDA 1Q8MA 2Q7YA 1KENL 4NQXA 4LVNC 5TF1L 3VG0L 2G60L 1N5YL 2AI0H 1NC4D 4MD0B 2VLKE 2MKWA 3DMMB 5DHXB 3L3HB 3K4DA 3BWAA 4RIRA 1S9VA 3TYGH 5HBBA 2R2BA 2ZUSA 4LDOB 4W6WB 5DD0H 1F4WH 4PJFA 3CSBA 4JY5H 2YD5A 3ARVA 5I6XC 3ARZA 1BVLA 3C08H 3V7AE 1CXLA 1U3HB 1YECH 2EKSA 5C07D 5EIIA 3EYQD 1N59A 2ZG2A 4MDIA 2XKUA 1MREH 1X6NA 2YRZA 3NN8A 3GSNL 1KJ2A 3IDGA 1T4KA 3TV3H 1PZ5A 3STLA 5GRYA 1HH6B 4Y5VB 5E4IA 4Y16C 5F6IC 3DVGB 4NSKA 2EO9A 4D0CA 4YHIA 1CCZA 4NM4H 3W9EA 3Q0HA 4PJXB 5C0AD 1AP2A 4ELMB 2HN7B 1MNUH 3C6SA 3KWWA 5HDQH 4Z7NE 2E9BA 1KC5L 2Z8VC 3ZLQC 4CBPA 5BW7C 2DQGH 1ETZB 2FX9H 4S1DD 2X4OA 2VISA 3IDUA 3FO1A 1X7QA 4BKLB 1XGQB 1CR9L 1CFVH 5D2NB 1FCCA 1AO7A 5IMKB 4NQEE 4ELMF 1OGAA 1RU9L 1ZLSL 2G5BA 2A1WL 1G0XA 4ZFFB 5DJYB 1UVQB 2Z31B 3OQ3B 4DKAA 1BBDH 4M7LT 2OBGA 5ANME 3OGCB 4QRTB 3MLSL 4NBZB 1B90A 1D3CA 4MDIB 2UZXB 2BFVH 2W0FA 4HH9A 5DRNA 3TBVB 5AD0B 1DQJA 2G5RA 3S5LA 4P23B 4E41B 3NMEA 3BP4B 3GDBA 3HNSH 5LGHL 4Q9BA 3RAJL 2XQYG 3CSYA 3X3GL 3VI3F 3C5SB 1MEXL 2NCMA 5FEBA 5HGHA 4X0KB 4MVBD 5DJDA 3IKCA 1MFCL 5IW1A 3SGEH 1HYRC 2VLLA 4MXVF 4XXCC 3AXLA 4U2YA 3LB6D 1A7OL 5HYQB 3TJHD 5IM7A 4KY1L 1KELL 1MLBB 4OLZL 2P24A 3VXSD 2ICWB 4P4KA 3UO1H 2R8SL 2HT2D 3DX9B 1DE4A 1TTGA 1FFOA 4DGVH 4NFBA 5DD6B 3QG7L 3VG9B 4M93C 4D0BB 2C3VA 2O5XH 3LAFA 1U92A 1A1NB 2BERA 5F1IA 1RZJH 3QIUA 2EYTA 5ALCH 4AY0A 4FS0A 3MXWL 4KPHH 4MNGB 4NQEA 1ETZA 7CGTA 2EIZA 3QZWG 2QQKH 3ARGC 3OR6A 1B9ZA 2Q86A 5DTFA 1T3FB 4KQ3H 3C5JB 4KKCD 3RU8H 1ZT1A 1YDPB 2Z8WC 4IRJC 3ZL4L 4JFPA 4KJYB 4M1DL 1WFTA 4EUPH 3HZYB 4Z95L 4GFTB 1OSPH 4L9LA 5GGTL 2BY1A 2EXWD 5B22A 4ORGA 4P4KC 4DEPC 4AMKH 3WJLA 3JVGA 1A6VH 4KI5F 4QRPA 3NIDF 5E4EC 5M94B 5I1GL 5GISH 4C4KT 3OX8B 4ZAKC 1WT5C 1UM6H 3H42L 4PTUB 4NN7B 3HHRB 4IJ3B 3ZYJA 2DLGA 3N1QC 4UZGA 1RZIA 1I7ZA 3QEHB 2IBZX 2X2YA 4XPBL 4L4JA 4U3CA 5GSVB 1UWEL 2NLJB 1IKFL 1CZ8H 4XCCL 2D9CA 4FTVB 4WI5A 3LMJH 4BYHA 3EJZD 4G9FE 1S7RA 4WU5A 3ZTJH 1FPTH 1YYML 4TSAH 4F7CB 5B21A 5LQBH 5E0QA 3EAKA 1NL0H 3EFFA 1U8KA 5C0JB 1K4DB 3SKJL 2DAVA 5TDPB 4OI7A 5E9DA 1SJXA 2JB6A 1YY9D 4N8VG 5DQDH 5T3XH 2A6DA 1LNUA 5D5ME 1WVZA 3PL6C 5FA4B 5DXWA 2YUZA 4KMTH 1IZKA 3CFIC 1RFDL 5E08L 3GIZH 4FZ8H 5E70A 1R5IA 5HHNA 3ZT6A 1H3PL 4XCCH 4R4ND 2H6PB 1CLOL 3F58L 4G6MH 1MCWW 1CDHA 4KTDL 5DEZA 1N8ZB 3CU1A 4PRIE 1OAZL 2GFBA 5KZCD 1GGCL 8FABA 5C0RH 3BE1H 5IROA 5JOEA 4EXPX 2JB5L 3O3EB 2OSLA 2H2PC 4RNRB 1IL1B 2AXFA 3EO9H 4PGEB 5C0ND 1EO7A 5IOPA 5HHMB 5L2KB 3L3OB 4X9HA 4O58L 1P4IH 3QG7H 3C9NB 3MCLL 2LE9A 4I48B 2QL1A 4HX1A 4EQ2A 1DBJL 3MLTA 4F7CA 1A3QA 5CLWA 4ODWA 3QG6A 1Z9OA 1IC5L 1QD0A 3LSOA 1ZLUK 2NYYD 4ZUVB 1ZS8A 3C6LA 3PWNB 4U1LA 4F9PA 2FZ3B 4TUOB 4W4OA 2JCCF 1PSKH 1OSZB 2NY6C 5EN2B 1HHKA 4RRPG 4QHMA 4UUJB 4U1NB 5D5MA 3GKZA 4JG0H 3EDEA 4JHAL 1FN4B 3RAJH 1RAMA 2QJDA 3FRPA 3K46A 2BVQA 3WE6B 3O9WB 5TQ0H 2V17H 3B3IA 3S3PA 4HMEA 4NZTH 4YGVB 1PZUB 4H26B 1P2CA 4ODSH 1Q94A 3UC0H 1YEJH 3DX6A 5BV7C 2VTFA 2BNRE 5DJCA 1UCBL 3VDCA 3O8XA 1A7RH 1UWXH 3ALXA 2X41A 1H9VA 1CTOA 4G80B 4PGDB 1MJJA 1G9NC 2O93L 1UYWL 2CDFA 4OQTL 1LP9B 1EA9C 1KT2A 1P7KB 3WFDL 5EOTB 1SJVA 5DTFB 2GCYB 4QYOB 3BYYA 4JJ5B 1FAKT 5IBTH 4YIQB 3PQYE 3LZFL 4FABH 2WNGA 2R9HD 5CIPH 2IANE 3T3MF 1HZHL 5J1SC 4O02L 3BJLA 4ZOBA 5D6DC 3BIKB 2YEZB 1RHHA 3GFUA 1ZTXL 1RZ7H 3HI1A 3VD7A 4R9HA 5CJ5A 3LIZH 1A21A 3QNYA 4PLJD 4PREA 2CDEA 4JM4L 3VWJC 1CD1A 1JHTB 2X4QB 3ILQD 1I8MB 3CCHB 3QO1B 1VGEH 4R0LB 2OTUA 2FGWH 3NIGF 4NOFA 1U41A 43C9A 1BOGB 1B4JL 4LPXA 3SKNB 5ADPL 3QEHA 1KJMB 1MFEL 3BJ91 1RJLA 3PABA 4OF0A 3NCCB 1CFSB 1LQSR 4UILH 2MPAL 3TWCH 4YAQA 5MENA 1FC1A 1YEHL 2PUQT 1R5VA 1FDLL 1L4IA 5ITFB 4P2CG 3RY4A 2VIRB 4XRCA 4HIXL 3AM8A 3CZFA 3PDOB 5IHUL 1T5XB 5D7LA 1ZHKA 3MRKB 1T1YA 2MFNA 4YHKL 5EOCL 2FX9L 4EQ3A 1IEBB 3GIVB 5DJZA 1CU4L 4LLYA 5F9WC 3FN3A 3RDTD 2DBJA 4GKZA 4MCZA 1LO2H 3QHFH 5EOQH 5GZOC 1ZLUH 4NKQB 3TIEB 1KYOJ 4YEFA 1BZ7B 4NQSB 5JW4R 4HUMB 3MMEA 1ZWIB 4RFOH 4LSRH 2ID5A 3KPRE 1MFAH 3LRHA 4AT6B 2KQNA 3VWJA 3EOAB 2XTJB 2AK1L 3DXAD 2EO1A 2X5PA 1IKNC 4LSQL 5C0BA 3QQ9C 4XCNB 1FYTA 3JTTA 2QV2A 3GI8L 4HJ0C 5CJOH 5FXCH 4JY6A 5IT2H 3QRGL 3HC4H 3SBWA 1M71A 2ADJA 5LAXA 2EDWA 3MGOB 1Q0YL 4BH8B 3O11B 4PJGF 5C6WH 4DN3L 4NHUA 3SDCA 5E2WL 5D6CB 1YUHB 5DJAA 3GIVA 5DJZB 2DN7A 5DURD 5L2KD 1JNNL 2EDRA 5F7DA 1FLRL 2DM3A 1BBJB 3S8WA 5E2JA 4Y4HC 4BH8A 3WUWA 3TN0D 4GXVL 3DWTA 2NR6D 1YMMD 4X6CB 2BNUA 4PJ7E 4ELMA 1KACB 1BZQK 1MHEB 2A6IB 4W6YB 4PJ5A 3EO0B 4NZUH 5E6YA 2HRPH 5DD5L 3I9GL 1OW0A 4YPJA 1TQBB 4HXAH 4QLRA 3MLRL 5F7MC 4LLDB 3WFHA 5FB8B 4KRPC 4KTEH 5E9DE 2Z9TA 3C60D 1ND0B 1EAPB 2Y07L 3FAWA 5JQ6L 4DUWA 3MGTA 2AABL 4LSSH 5GS0D 4LVNB 1UQSB 3PUCA 1M7DA 2RB8A 1KEGH 1XGUB 5T1KD 4CN6A 1CDYA 4BK4A 1IBGH 4FA8A 1K85A 3BRFA 4LVOB 2Y1VA 3MLYH 4YC2B 2QADB 4IHOA 5CJ8A 4KROD 4QRSA 5HJ3A 1A6AB 3SDAA 5B4MC 3G6DL 5DK0B 3KJ4C 2IADA 1FL6B 3TNNB 1N6QL 2CUHA 4P4RA 3QRGH 1ZLWK 1JN6B 2CRIA 2R15A 2WMPA 2XFXB 1EZVY 4HWZA 3RHWK 4HMCA 5I16B 2OR7A 1X5IA 1XR9B 4FG6D 4M61A 4I4WA 4XPTL 2WWMC 1YZZA 3BDYH 1OW0C 2VL5B 4JQIL 1U8OB 1CD1B 4O02H 1YMMB 3VJ6B 4UQ3A 3B9KD 4FQQA 4Z0BH 4ZAKB 1P84K 4FQ1L 4QTIH 5C09D 3OJVC 4XNMA 5C09B 3MRGB 5MI0C 3G04A 1C08A 4WEBH 2X1OA 1FZKA 4Z7WE 1TQBC 1NGXA 4K94C 1ZGLB 1MFBH 1NFDF 3BVNA 3HUJF 1V8HA 2OLDA 15C8L 3FB7B 5B8CC 1ORQB 2FBOJ 2Z91A 1IAIH 4X99A 2DI7A 1OARL 3BVNB 3VXNB 1F4YH 2HG5A 3BEWB 3MBED 2JCCE 2E9JA 2BNQA 3HAEB 3KYMA 3QB7C 1FO0B 4PJCF 2OS7A 2XI9A 1MI5A 4QRRE 1MCHA 3ARDC 1NPUA 4V2BA 1KCSH 3QIBC 2G5BB 2GT9B 1K5NB 1IM3B 4ODHL 4N0CD 1RZKL 1YMMA 2ZNXA 5BRZD 1W0WB 2ZUVA 1GPOL 4PJEE 4U6XB 3DUSA 3VDAA 4HK3J 1IILE 4O9HH 5D1QC 3LKRA 1FZMA 2Y6SC 4M93B 5A2IH 1CT8A 3FMGL 1I3VA 1KB5B 1FN4A 1GAFL 5K9QI 4I3GA 2ZUUA 1HQRA 1UJ3B 3M1BA 3FZUC 1LE9A 4DZBB 4JKLA 4NC2B 5H37G 2R2HB 1FYTD 4NDMB 4PJ9B 4YHNA 5DMKA 3U0WH 1UJ3A 4HXBL 5KVEH 2WP3O 5DYOA 2VXSL 4J7RA 4AJ0A 5F1SA 2P5WB 5DHYB 3D9AH 35C8L 3EHBC 3IXTA 4MWFB 3SE8H 5D9SB 2I9LB 4U3HA 2JE8A 5I1IL 4LOUD 1P5UA 1GOHA 5CIPA 3IFNH 3ARFA 4OB5L 4TPRL 4FZ8L 4LP4A 1OAKL 5D72L 5T5FL 1QRNE 5JLZA 4NQED 3V6BR 5MEPA 4U1MB 1HHIA 3T0AA 2BSTB 2W92A 5D1XD 3MRRB 4OF6A 3BGMA 2EIZB 1KN2L 2ARJA 4QRPD 3TNMA 3S37L 1OT1A 1EERB 2A6JB 4J1UB 1UZ8A 3VGBA 4LKXA 3R0MA 4ODUB 2GAZB 2WBJC 3UPRA 3DXAA 5I1DB 5ESAA 5DD1L 5D2LB 2EE6A 2IQAA 2IAMD 3PP4L 3DETC 1UGNA 3WS6A 5IB2B 4AIZA 3JWDC 3BYTA 5I19H 1BIHA 5D2LE 1FFPB 4AZ8A 4NKMB 2MNUA 1BVKA 4XP6L 2F54E 3QUZA 1I3RA 3L9RA 1DCLA 3NZHH 5JOFA 4NT6A 1S9YB 4KJYA 4L1DA 2GKIA 4ODXB 4P5TC 3LDBB 2VLKD 4R8WH 4H0HB 3JV0A 4OJFL 1EBPA 4XHJD 1PG7W 1QRNA 4ZAKA 3ZKXB 5T3ZH 1G7LB 4ORGB 3MRBB 4WW2A 3QUYB 5J9PA 2QBWA 2YRPA 3B9DA 5KSBB 4Z9KB 2D4DA 3QI9B 2X40A 5CGYC 7FABH 1NL0L 1MH5A 3UBXI 5SWQA 1AXTH 4Z76B 4FQXB 1YNLH 5I8CB 4JCMA 5JHLL 3DRQA 4L3ED 5FO7B 4ZUWA 2QSQA 4IOSD 4NNYB 4Z78B 4U7SA 4Z7OE 3EYOB 3HG1B 2APBA 4MAYC 1RZJL 2PW1A 4L3EA 2D03H 4GXVH 1D5BB 2X4UA 5F3HB 4MQ7B 5FO8A 1JGEA 4YFEA 2X4PA 1R3HA 2ITCA 2FCBA 3IETA 3QUZC 3UEZA 4U6YA 3LRSB 5DD1H 4NHUB 1EGJH 4HWUA 4P3WA 2BY3A 1NFIA 3LKNB 2HYMA 3HE6D 4Q97A 4ZDHB 2H2SD 4WV1C 1CN4A 3FO0H 1KCVL 1DVFB 1S5IH 1TMCB 4NPYA 5C3LD 1JGUL 4LKCA 2ZUQB 3CH8A 4CVWA 3FFCD 5L8JB 5JDSB 1LEGB 5ID0B 4X8XA 4HQQL 4YQXL 4FQ1H 1JPFA 2F53B 4FZEL 1ROWA 2BNRD 4JY4A 2FJFA 1GGIL 1NAMB 3G6JE 3AC0A 1AO7E 4XVTL 3MV7D 4WHCA 1J5OH 4PJDE 2BVTA 4R4BA 4YEEA 2F53E 3ECBB 4YHPB 3I6KA 4TTDC 3U7YH 1AHWC 2HJFB 4W4OC 1M7XA 1XT5A 2DM7A 2XRAH 3ARRA 5E56A 5IB1B 1ZLSH 2Y06L 3QHZL 4R96B 3A67H 3UYOD 3QBTB 3MROA 3D9AL 2AEWA 3KHQA 4RGNE 1PKOA 3HPLB 4I3RL 2YR3A 2CR3A 4L8DA 4G6AC 2HJFA 3N1FC 2AKRA 3H42H 2H2SC 1GC1H 5DUBB 3PXJA 3O6FC 1UG9A 3O2DL 4JGUA 4JB9H 4YAQB 4NC1C 3C2AH 1QFUH 3PGCB 1XR8B 2DJ4A 4QHLA 4QXWA 5D1ZD 3MNVA 5IIEA 1BAFH 1EZVX 2AEIT 2OR8A 3SDDA 3U2SB 1JZ2A 3UDWC 3NABL 3N1PC 3IAGC 5MEOA 1IEBA 3D2UD 3P4OA 3FO2A 1UM5H 4JQIH 2I60H 5EIQA 4R0LC 1N2RA 1LO5B 1E4JA 4HUUA 5FV1L 2J4WL 4W6XB 1PAMA 4YBLB 3GJFA 4W68A 3NIFF 4HKBB 4FFVD 5DT1H 3UAJD 1A1OA 3RWIB 3DMMC 5JIPA 4JZNA 1RHHB 1CFTB 4PJXE 1G9NL 4HC1H 5CGYD 2FX7L 2IF7A 5IEHA 3ARPA 4LSVL 3FHAA 4OF5A 3OV6A 4PGEA 1T83C 1II4E 5D7LD 4MJ5B 4XHJC 1SJHA 3VW3L 3BN9D 3LKPB 4DKFL 4PJHB 3GM0A 4M3KB 3GBLA 2QADD 1VGKB 1S7SA 2CDGB 4XVTH 1MHPL 5FYKE 3SCMB 3KNBA 2B20A 1O7VA 3L3HA 5IGXH 1VACB 5B38A 1DBML 5D71L 1S9YA 3VFTA 1BP3B 4OZGF 4MZ3A 4WWKA 1HHHA 3SDYL 4M1CC 1B6DA 5GGVH 2AEPH 1RUKL 1P4LA 5FGBA 5KSBA 43CAB 2GSIB 2A73B 2DQUL 1IQWH 5FGCB 2IAMC 1XGPA 5SWZD 2AXGA 4APQC 4HWEL 4N5ED 4Y5YB 1WCBB 1VSCA 2WBJD 4MQXD 4X7SH 2UY6A 4NRZA 3ULVL 4RA3A 5TGBB 1H8OA 1B0GB 4H20L 5LGHH 2Y7QA 2VSDA 3B4NA 3UJTL 5L2JB 4J3TA 2HLAB 4KRPB 3K2MC 1WCBA 1FH5H 5LGJB 2EC9T 1MLCA 1NCBH 4QEGA 5KN5B 5D96C 2ZUWA 2XQBL 2XWBA 2ED7A 2UZIL 5D7IB 5C0FA 4JAMA 2L7JA 2CKNA 2BZDA 3TWCL 1AFVL 1GIGL 2A83B 3D25B 1KIRB 4XCEB 1HN1A 1CTNA 1KPUA 2WP3T 43CAA 4LOUC 2ADFH 3MREA 1CGYA 4IRSA 3UBXG 1OSZA 3KPMB 1IE5A 2HTLD 5E03A 1ED3B 1TTFA 2ZSWA 4LCYA 1A3RH 4M6OH 1H3PH 2XQYK 3QUXB 4XPGL 4B5EA 1KCUH 4EDXB 4CU7A 1MCKA 2VKXA 1CF8L 2IMMA 5F7YC 3FZUD 3T65A 4XH2B 3V4VH 3P9MA 1U8OA 1B0WA 4HV8B 4Y2DA 5HVWA 3IFLL 4Y4HA 3BH9B 5A16B 4ONHB 4KHTL 4OLEA 3DURA 5JUEL 1ZVHA 5D1QD 1RUMH 1U8HB 4CU6A 4K3HA 5FUCC 2H6PA 4K7PY 5BXFA 3STBA 4NOBA 3QJHB 3ORJA 4K8RC 3VXTB 2B1HL 1IM3A 4UILL 1EHAA 5EUOA 1UKSA 5H2BB 1HHGB 1DSFH 4MJIA 5T1LD 2AXFB 5L2JA 3TJEL 4MDJA 2LTQB 5E6IC 1AGEA 1HXYA 5GRJL 3PXHA 5TE4L 1HDMB 1ES0B 1U58A 5EBLB 5KSBE 4DJMA 2CJUL 3NFPA 5BJTB 1JZ3A 2GHWB 3KDMB 4ALAL 3I2CL 2VQ1B 5CKAA 3F5WB 4XWGL 3WXWH 1KJ3H 1T7XA 2VZUA 1CXKA 3KPSE 3EYFB 1FNFA 1CDJA 5DDHA 5JMOC 3ELAT 4N90D 5I6XB 5DJXA 3NBNA 5E4EB 4E41A 4WHTB 1YC8A 5LBSL 2NX5E 1CLZH 4EJ1C 5I1IH 1DQMH 3G5VB 3WL9A 1T66C 3TH4T 4PV8B 4GO6B 4LQ1A 4XVJL 3I6KB 3B9KC 5C0BD 2EDQA 4J8RA 2HMID 4P49A 2OK0H 2VDQH 1TCRA 5F7EL 5IMMB 2O5YH 4CADB 2DQDH 2A2QT 3ARDB 5E6ZA 1MCSA 3RHWF 4EI5B 5JW3H 5C9KA 1DUYA 1INDL 1S5HB 3LN4B 5C6TH 1U8QA 4OGZA 4PG2C 2IH1B 1LNUB 5F6HI 5ALCL 1MY7A 3QIUB 5CINH 2NY0D 1CGSL 4K3DH 3FT3A 2IGFL 3CVHL 4XTRC 4FZEH 5CILL 4XAKD 2AJVH 3BPNC 3HNTL 2R1YB 4MNQD 4HIEA 4KDTA 4A6YB 1NCDH 3K0WA 1NCWL 2QQLH 3QNXB 1FV1B 2I25N 1MUJA 4HUXB 4JFQB 2KH2B 2IQ9H 5HYSA 2B1AL 1CE6A 4JFZH 3NCJH 3GGWA 5DHVH 3JSSA 4WUKL 1ORSA 1VB9A 3OAYK 2ARJQ 1I1AD 1U8PB 5DSCA 4KRPD 3O0RH 3VD9A 2DQJL 1ERNA 5JPNB 4UMGA 4MD0A 4JFHE 2R2EB 4HIHA 4TNWK 1I1AC 4QRPB 3IB4A 2ZNWA 4P2QA 3UTSD 5IVXE 5KS9F 5MP6H 4ZUUA 3VFMB 5IF0B 1L9MA 2HFGH 2GTWB 4HWZB 2VIRA 1DQML 3DVIA 1BFVH 3BPOB 2AW2A 3UC0L 4F8QA 1KN4L 3B6SB 1IAIM 3RUGB 4QY8A 5EU4B 2R1YA 4X4ZA 2F5AL 5EULV 3O6KH 4WVRA 5GPRA 1J0YA 3QUMA 2Z8SA 4QXUL 1X44A 3NTCL 3QNXA 3VWKC 2JELL 4NKOA 1SEBB 4MD4A 5MI0B 4PJIF 5IIEB 4UDUB 4M43H 5TDOA 1AH1A 3KWWB 5LGKA 3ZDYF 1FNEB 4NKOB 4QHMB 4UUJA 4AT6A 1YYMH 1CK0H 4W4NA 4WI7A 4YH6A 3QQ9D 1G6RL 1UQSA 4AYFA 2FH8A 1TETH 3B8SA 4HS6B 1X5KA 4N0UA 1KLGA 3BMWA 1J8HD 1VEOA 1T2JA 5DO2C 3BZFB 2HMIC 2FHCA 4LKXB 4XP4H 4U49A 2ZUYA 5AAMA 1KYOK 4KV5E 4QTHA 4GW4A 3AUVA 4PLNC 2A6JA 3BISA 5HHOD 3RZCD 1YY8B 1CDCA 5IJVA 1A7QL 4PJIA 1GGCH 1T66D 3PNWB 3J8F7 4L8BB 2XA3A 1A47A 4KTDH 5HGGS 1T0MA 4HZLA 1PG7X 1OT2A 1XCQB 2QSVA 5EIVA 4PBWD 3C5SA 4XBPA 3VFGL 1XIWA 4RWYL 5I73B 1JHLH 3GHEL 3CPLB 3WCYA 3QNZB 1KG0B 1CL7L 1WZLA 4BZ1H 1Q9LB 4LNRB 5FHAH 3VXPA 3LEVH 2AK4A 3HR5B 4XVSH 1CFBA 2AJYH 4ZOAA 3EDDA 4U7KA 1PEZA 3VH8B 2UWEB 4RGOL 4OJFH 2GUOB 1JHLL 3GHEH 4F9LA 3ILQC 3J7HA 5DJ0A 5I1AB 5E6ID 5DVOA 4YHNB 1JWMA 1NDGA 3MRHB 3PJSB 5IVZA 4P9HL 4EOWH 5L7XH 4IS6A 4K8RD 1VFUA 1WCQA 3I6LE 2J3SA 4EUPG 5ICYB 3S34L 2GK0A 3AU1A 4F58H 3BPCA 5FKAA 1GJIA 1AD9A 4HKXB 5CFHA 1XFPA 1HHKB 2JB5H 3BN3B 1T1WB 5HHMD 4Y19E 1AKJB 5HGDB 1NMBL 3G6AA 1UEMA 3S35X 5JW4Q 4KAQH 4U1SB 4JFDA 5EBMA 1MHCB 4TUJA 4XC1H 4XRCB 3EOBB 4Y19B 2QSCL 1G7LA 1J10A 4LSTH 1G1CA 3RWFA 4ZD3H 1DBBH 2LQRA 3L3IB 4PLKD 1MFCH 5FOBB 3AREB 4PS4H 4L9LB 2P8LA 4WHDA 1TQCB 2CLRA 4QTIL 5DJXB 5DQDL 3CUPB 3GSQB 4YDVB 1W72A 5FHAL 3WO3B 3OWEA 3D0VB 2ITDA 1MCLA 5I17A 3K1KC 1MHPH 1DLHB 3DO7B 3MJ8A 3HN3A 1A7NH 4OBRA 1OGAE 1NGPL 2FD6L 5F9JB 1NBYA 1IM9B 4CVXB 2R1XB 3BT2L 1WEJL 2EDFA 3O6FB 1KF9B 3LQZA 3ILPA 3SJVE 3UTZA 1HCVA 4RZCB 1MCJA 4NO0A 2R0ZL 2VQUA 3QPXL 4JFFA 5TE7L 3O3BA 2BRRH 1EFXB 2XWTB 3H9SA 4MQXC 3LH2H 3SO5A 3PF2A 4N1CA 5AZEL 4APQD 4ZS7H 3MFFA 3UDWA 1IJ9A 3OKLB 4MLSA 2BSTA 4HKJB 1EO8H 5IQ7H 4RDQG 4UV7L 4LU5H 1U2HA 4Z7WB 4I18A 3MNVB 4P9MH 4PJCE 5IW1B 3KS0H 5HHXH 2VITB 4J3SA 4MA7L 5LBSH 1XR8A 3V6FA 1NFDE 4WCYL 3OAUL 3F65A 4JQXA 4RGNB 1JNHB 5D7IA 4XC1L 2QADC 3MJGX 3UTOA 5HHNB 1IC7L 1S7XB 5F96L 3FO2B 2KBGA 5DHVA 3HPLA 4UINL 5MEND 2HFFA 3MLXL 2QSTA 3C5ZA 4HBQA 3V6ZB 1YY9C 3L3OA 1ZHBB 2VXQL 3AY4C 3O3EA 3ZE0E 2HFGL 2FSEB 2G9HB 2YXFA 2BSRB 2EDDA 4LIQE 5E00B 5HVHB 2DWDA 5IJVB 4LSPH 3DMMD 1QPPA 4WW2F 4FFVC 1CVSC 1Q0YH 3LSOB 4PJAA 2A6KB 2OCFD 4PJEB 4TVPE 1AGCB 1T89C 4U0RC 5ELIA 5AZ2L 3QEUB 1PX3A 2BMKB 3MUHL 5I18H 1YUHA 2KZWA 5DJAB 2ZUTA 4ELME 4PJ8D 4KRMB 1TZGL 4CDGC 2PYFA 4QRQA 5I30H 4M9PA 2AV7A 3LHPL 2M1KA 4F33A 5IHBA 3IU3B 5J6GB 3I9GH 2MSPA 3NCYP 3L1OL 1OCWL 4KKNA 5BVJB 1I9JH 3H7LA 5KSAB 1YEEH 5F7LB 4LSRL 2VLLB 4Y0GA 4OZ4A 4DOHE 4RAHA 3DSFH 3C5ZD 4G6AD 2PYEB 2EXWC 2EH8L 4L8CA 1S78D 2D7NA 3EDKA 1IAKA 4KUCF 3SO3B 1VPOL 4MZ2A 2QQQA 4RBPK 5CEXA 4EOWL 3QDGD 2DLFH 5DRXB 4GW4B 4TTDD 1MRDL 3LD8B 5D7JA 5CS7A 3RVXC 4WDIA 1HSBB 1T22A 2FECI 3QUKA 4GG6A 1TPXC 4WWKD 5JIKA 1VESA 3PQYD 5D2NC 5F7FA 3SDXF 1Q1JH 4PRBB 4HFWB 4JRYA 4Y2OA 3UPAA 1WQVT 3ULVE 4XPFH 5E8NA 1U8IB 1PKQB 3TCXA 3RFZC 5TGBA 4JZJA 1FPTL 4L9DA 1IC1A 3D3VB 4LARL 2ZG1A 2WIIB 4DTGH 1UM4H 4WY7L 1LILA 3TEUA 1U92B 3BD5A 5T1KA 1YNKL 3O4LA 4PJ8B 4XPFL 4TTGA 3MV11 1BEYH 3UYRL 3QFJB 4KXZI 4L8SB 2VLRB 4JLRA 3TJHC 5LAXB 3W81A 3C60A 3JV5A 3L3DB 2EECA 1F6LL 1NC4B 1MLBA 3GRWL 1Y18A 3D39B 1Q0XH 3ABZA 4WENB 1E4KC 1QSFA 2OMBA 1I7RB 3P73A 3O41A 2HH0L 3OKMB 2R0ZH 3SHSA 2W38A 5CZKA 1U42A 4Q9QH 4MNQE 2CK0L 2DL2A 1QA9B 1U8LB 1ZT7A 1NCAH 4LCWE 2A6IA 3P11L 5T1LA 1IGJB 2D0FA 3RWGA 5B39A 2I07A 2WUCL 4P5TA 5MEQA 1T0NB 4O2EB 1W8OA 5BCAA 3T2NH 5TPWH 4GG8A 4BZ2H 3QR2A 3DXAB 1FIEA 4P5TD 4WRLA 3Q48A 4J6RL 3OKYA 1UKTA 2F5AH 4L4VB 4OIIL 5BRZA 4OUUB 4NJ9H 4P9ML 4O4YL 1BFVL 1SMAA 2VDNL 1NDMB 2YN5A 3QUXC 5D96B 3RQ3A 3EDFA 5ICXB 4YX2H 2H26B 3V52H 4X80L 2HT4D 4Y16B 4Y16D 2JJUA 3D1MC 3BUTA 3OKEB 5IMOB 5T1DL 3RGVB 1HDMA 1L7TH 3RPIB 2XA8L 4G9FA 3G6JF 1J11A 1NUDA 2VXQH 2YUVA 4N0RA 4JDZB 4J8RB 3RI5K 5EC1B 5I73C 1MY5A 3T0EA 2E9IA 1D5MB 3ZKXC 2EICA 2GCYA 1SYVB 4OCSL 4YXLL 1LE5A 1TCRB 1OAQH 5KG9A 2R4RL 2F54D 2FZ3A 4TUOA 3QT2A 3B9KA 1FRGH 5DZOA 1IGMH 3P9MB 5ECJE 4RFNB 3WFCL 1S7VB 3TA3B 1K3ZA 1HZHH 5MEPB 1W0VB 3MOBH 5C6TL 2E7MA 2X4SB 4YHML 2ICWI 4ZXBA 5IBTL 1NANH 4R2GD 5KVFL 2WUCH 3OXSA 5TE6L 3O3DA 1OARH 1MWAB 4R0LA 4ZD3L 1B88A 1NGZA 3GM8A 1PZ5B 2A77H 2AVGA 1R5IB 1S9KC 1NBYB 1OLLA 4JRXD 3DMMA 4FQHB 1MI5B 2R29L 4W70A 4AIOA 3FB8A 2EZ0C 4QCIA 4MMXC 3O6FA 1H0DB 3R06B 4GLRH 2IQAB 5DC0A 2EDLA 1JIBA 2PW1B 3QAZB 3SDAD 2ED8A 4NM4L 2YKLL 3L5HA 4OFPA 2RFXB 5B38B 2IANB 3MLTB 4ZFZA 2XXMB 4HS3B 3REVB 2ENSA 4U1LB 4LARH 4JFYB 4N0CC 4HWBH 5JXEA 4P57B 5FV2A 3QIBD 3D3VD 2IPTH 4OCSH 4NWUH 3T65B 4RA0C 4PJGB 3NABH 1L0YA 1NMCC 3MBEC 1MJJB 1LK3H 3PDGA 4GKSA 3H7BA 1J1XL 3QULA 4RFNC 2DQDL 5IBUG 4CAGA 4IOIA 4KAQL 3H0TB 2H9GA 2WQRA 2K7QA 5SWSE 5K9QG 5BW7A 2V9RA 1OY3B 5EU5A 4GKSB 4YX2L 1HSAB 5BS0B 2VXTH 3E8UH 4FQLH 3DUHA 2JIXB 1AE6H 1MRFH 5I19L 1UCBH 1K8IB 1DANT 5HY9B 4JFOB 2BSSA 4ZFGL 1TJIL 1SEBA 4YZFE 2DD8H 1JGDB 3WIFA 5IB3B 5F70A 5INCB 3CFJA 1R24A 1TVDA 3VMOA 2VN7A 1JRHI 1KCRL 3QG6B 2Q6WB 1YEGL 2IEPA 2A9NH 2WWMD 4AEHL 2VZ1A 3IFOB 4R2GC 4HFUL 2LABA 3ULUF 1WLHA 3OPZH 4NM8L 4U1HA 4OFIA 3WJJA 1RVFH 4MJ5A 5ABDE 4KK8D 1T04B 3QISA 5HGAB 1VEMA 3REWB 2PKDA 5FF6A 2X44D 2DQIH 1S5IL 4U1JB 2O61B 3U0PA 3MRDB 5B4MD 3WIIL 1P9MC 4AENA 4HJJH 4OM1L 2FJFB 2XZAL 4DCQB 4PJIB 5IFHH 4DAGH 5DURB 1MHHB 3QUML 4TRPL 1Z3GH 2BY2A 3MRHA 2XPGA 3MJ7B 4MA1C 5CJOL 3R1GH 5D1ZB 5D7LE 1ITCA 4RAVB 1A7BA 1QKZH 4BJLA 4Z7QE 3EFFB 4IRSC 4MAYB 5F1NB 4HWEH 4QF1A 5GSRA 4DTGL 1K3IA 2YA0A 2AK4B 1QLRA 2AK4D 2HT4C 2JLLA 3RWCB 5FYJD 4D3CH 4R4BB 4E0RA 2C4FT 2OI9C 3GZKA 2NMSA 1UM5L 2XNAA 1QBLL 2Z4QA 2ADFL 4OZGB 3SO3C 3TN0C 3SKUD 3MODL 5FO7A 4Y4HD 2V5TA 3D85D 3DSNA 4KQ4H 1TZIA 4BSWB 5GJTH 4R2GB 4Y5YA 2WINA 2HWZL 4XPTH 4NCDA 3WFEL 3QEGL 1AO7D 3MNZA 1FGNL 3IKKA 3QXDB 5C0GA 2B0SL 1FYTB 3JTTB 4X9GA 4JO3H 3A6OA 4LAJH 5KSBF 2WW8A 1LEIA 1WT5A 3VXNA 1HEZB 4LSDA 1TXKA 1VCAA 3IJSB 2P8PA 3P0GB 5CHNB 3S4SG 5E2TH 2Q8AH 1LEIB 3IXAA 3QA3A 4X4YB 3QUYD 3FFDB 3KPOA 4UNUA 5JW5A 4Z6AT 2IQ9L 1D5IH 1RUML 12E8H 1R3JA 2XPGB 3MJ7A 5L2KE 5GZOD 4G5ZL 1RUKH 3OJ2C 1T0NA 3FRPG 1YPZA 3GHBL 3HAEG 3VXUB 3G6JB 3SDYH 3GSNH 4K07A 4UNVA 4M48H 3VJ6A 1B6UA 5J3HC 4I77L 2YZ1A 1I4FA 4A2MA 1D7FA 3SJVB 4H8WH 5INDB 3MUZ1 4XBGA 4EUPA 1IC4H 1LO3H 4HAFA 5E2TL 5TPWL 4PJEF 1Z0MA 2G2RA 2IH3B 1DBAL 4DGYH 1BGXH 5EU3A 4MQ7A 4Y4HB 5JPNA 2UYLB 4HFWA 3N9GH 4FQCL 3ZSSA 2IBZY 3Q3GA 3QO0B 4F7MA 4JO3L 1JNNH 1KT2B 2JIXA 1TNMA 2V7HA 5IB3A 2LU3A 2J7LA 1GOFA 4PLJC 5JDJA 4X6FA 2E6JA 1R3JB 2W1NA 1T2XA 1CD8A 1NCBL 2VN4A 3QHTC 4JHAH 5HPOA 5DRNB 1H3VA 1LGVA 1FSKC 4LEXL 2A9ML 5CEZH 1DBBL 1S78C 4OKDA 4OZIA 3C5ZC 4OV6F 1JNHA 1U3YA 4N8VA 2GITB 4AEHH 1AQKL 2A74A 4JZOA 4I0KA 1NEZG 3VCLA 3BDYL 2FL5B 4MCYA 4RFOL 4HC1A 2VDML 3EO0A 4HDIB 3PHOA 4QRQB 3BWAB 25C8H 3MRIA 3U0TA 3EZ8A 2R0LH 2NY5L 3BSZH 1WAAF 4JPIA 4P5MA 4J3UA 3WN5C 4PJ8C 4MB5A 1CU4H 3WUWB 4YNYB 4MD5A 1JV5A 1DBMH 5D71H 2VXTL 3E8UL 3KPLA 3CC5B 1BZ9A 4NQVA 4XXCA 3W9DB 3PHQB 3R8BB 4U1KB 4EIGB 5D7SL 2ICES 2PW2A 2VOTA 3QEUA 2X4QA 5DUML 3B9VA 2W60B 4OF8A 4HF5L 5DJ8A 1NSNH 1Q9KB 4KMLB 1C5CL 1RK1A 1K6QL 2GSIA 3DVGA 4NSKB 2X4RB 4R7DA 3SDCD 4R26L 1RIHL 5GSRB 4NRXB 1DR9A 2FJGA 1CFQA 3RZWA 4BZ1L 5E9DD 1PY9A 3IDYC 5C71A 1FO0H 4ZMAT 2NY6D 3CPLA 4FTVD 4NM8H 4TSAL 1I1FB 4NKDA 1LDPH 3MRRA 4X6DA 4PGCA 5IK3A 1KCUL 4GLRI 4RMUA 2I24N 4PJFF 4RFEA 1AC0A 4GG6E 1OCWH 4WFFD 5FF6B 3FB6B 5HGBB 3W0WE 4YNYA 4GKZB 4MCZB 2H2PD 5F6HJ 1Z9MA 1BD2D 2W91A 5IR1B 1AE6L 3FJTA 1QHOA 5EOCH 4MA3A 2OMNA 2VDQL 5C92A 3GJFK 4HXBH 5KVEL 1TZHA 1R5VB 4RX4D 1AXTL 4XAKE 4I5BA 1NBVL 1TDQA 3W0WA 2F74B 1DQTA 5JNYA 3V4UL 3U9UB 4GQ9H 3LY6A 3ULUE 4OGYL 4LSVH 4NQUA 2EEDA 4ZUSB 2SEBA 5A2LH 4AH2B 4OCXL 4GXUM 2A9NL 4XNZB 1F3JA 5EZOL 5C09A 3LN9A 5ESAB 3BI9X 32C2B 3T4YB 5HXMA 3HCVB 2AXHA 1GZQB 1DBKL 4GW1A 3PWVB 4PJDA 5I17B 3UTPD 2X9WA 5BXFB 1V7MH 3MXWH 4IIQA 1S7WB 2H8PB 2HJKB 1NBZB 1UXWB 4ZYKA 3OZ9L 5C08E 5D5MF 3MRMB 3U0WL 2HG5B 2LAGB 3BEWA 3GSUA 3WFHB 5FB8A 3U4EB 1HCFX 4UTAH 4Q9RH 4WU7A 5H94A 1ZT7B 1H15B 2YD8A 3Q3GB 4F7MB 3W0WD 2P46B 3CDGB 5F7EH 1J1XH 4AM0B 1RUAH 2F54A 4YO0B 3B5TA 5CLTA 3QDJD 4R3SA 1QUNA 1C5DB 1J87A 3MREB 4MNQA 1V7ML 4WGWB 5IT2L 4OZIB 2XRAL 3RGVA 1FAIL 1OB1B 2B7DT 4L3AA 4X0KA 5DJDB 3T4YA 4M6MH 3VXUE 1U2CA 4OSUH 1P7QA 4PRPE 4U6HB 4IRJD 3FRUB 5JW4N 5HI4D 4CRPA 4JDZA 2JELH 2NX5B 4F3FB 2NX5D 1RFDH 2DQFA 1MAJA 5C9JB 5KSUB 3M1BB 5F21B 1ZOXA 2DRUA 5FYLH 3ARGD 2HTKD 2Q76A 4U1NA 2XY2A 4OGYH 3OB0K 2D31B 3X17A 3PDDA 2J5LC 4YXLH 1TJHL 2DIBA 4GBXB 2BHUA 1S7VA 3TA3A 2PNDA 3GB7A 4LSTL 4MD5B 2VLJE 1HXMB 4F7PA 1HNFA 3ESVF 4Z76A 3D0LA 4HWBA 1WC7B 4UV4L 4P4KB 4IDLA 4QHKI 4MXQC 1EBAA 3QDJE 5C09E 2ESVA 3Q5TA 4XPBH 1GOGA 1NGWA 3MCLH 5AEAA 1R3IL 3N0PB 4K3JH 3BGAA 3NGBC 3U7YL 3RZCC 1ORSB 2CIKB 2IALB 1F8TL 5C0EA 3LB6C 4Z0BL 3F62A 5HHME 3QUMH 1CE1H 1G9MC 2WBKA 5D8JH 1YMME 3QUYC 4MVBC 3RJDA 3LOWA 2P8PB 1YEIH 5ANMA 4LFHD 5L8KB 2DMBA 4RAUA 1PDKA 3I6LD 1M7IA 1LDPL 1TVBB 4OSUL 4XHQA 3QIWC 2M8XA 4G42B 4FQXC 1RURH 2MCPL 3HFMH 1EEQA 1FO0L 3C08L 2FX8L 3PP3K 2I26N 1WBYA 1R5WA 3NA9L 1LMKA 4MHHG 4UAOB 4BZ2L 2F8OA 3ARSA 5IB2A 3LEVL 1PQZB 1MF2L 1YY8A 4OFVA 2BNRB 4UT6H 5ESQB 1VFAB 1TTUA 3ZE0F 5IHLB 3BDXA 1CFTA 4DK3A 2Y4SA 4PREB 3BZEB 4LCIL 5D72H 4HEME 4NO2A 1KENH 4PRHB 5F88B 2ZP0T 1K9TA 3LMJL 3HA0A 4S1DC 2H1PL 3V52L 3CLEH 5EU4A 3UTQB 3P4OB 4Z78A 1IGYA 2R2BB 1MAMH 2X4TA 5GRZA 3NA9H 3MRNA 2ZCKH 1I85A 1AY1H 1EAJA 2R4SL 4OF7A 5EZLB 4RMTA 1AGFB 1H5BC 3GI9L 7FABL 1REIA 4QOKB 1I8IA 2BSSB 3I6GA 3EYQC 3B43A 3ARTA 4NQTA 1K8IA 5HY9A 4IRJA 4LLUB 1A6TB 5EO9A 4TSBH 4IIQB 4WFFE 1CE6B 2QR0B 2DI9A 3CFJB 5FYLD 4BM7A 4EN3B 5FHBH 1G1YA 1AQDA 3O6LH 1ZT1B 4QXTA 5ALBH 3HMWH 3AGVA 3C60B 1IKFH 4XTRD 4XPHH 1NSNL 1SVZA 4HIXH 1BQHG 4PJAE 1KCSL 1Q72H 4BKLA 1A2YB 1CI5A 2NY0C 5I8OL 3MRDA 4KK8C 1BM3L 2R1WA 3MBEB 3VRLE 5MENE 3JV4B 3T77B 3BT2H 5IF0A 3NACL 1UZ8B 2CRMA 2VERN 4NN6B 3RVTC 3IFLH 4PJ7F 1CFNB 4DW2H 5F3BA 2D7OA 3V4VL 3ILPB 3P40A 2VDPL 4DQOL 2NW2A 2J8UA 3BW9B 1H5BA 3LKQB 1FZJB 4F3FA 1NQBA 4M7ZC 5JHDE 4LEOB 4NZUL 3MNWB 3TGXA 1D6VL 2FJHA 5EIIB 1CLYH 4JKPL 3C8HA 1MVFA 2BVUA 5C7XH 5DI8B 4LU5L 2VZOA 5C9JA 1JGUH 2E7LC 2Q8BH 3UMTA 5KVDH 1QNZH 4NUGL 3E1F1 4N68A 5IK3B 1R3KA 4QRUA 4XP9L 5FUCE 3VXME 4JN2B 2HAZA 1QSVA 1AR2A 5BZDA 3SQBA 2JJVA 2WWKO 3SPVA 1JRHL 3FQXA 4F58L 4I2XA 5T3ZD 4HLJA 4NNXA 1H15A 3BP7A 3T4AA 4RQQA 3JWNC 1P7KA 1BWWA 4XAWH 2VDKH 5E8OA 3K8KA 5JHLH 4QT5A 2ZOLB 3GEWB 4UINH 3RRQA 2RFXA 3WNNA 2DWDB 3BKYH 4Y5YC 4HV8A 1UB5B 2DLTA 1UKQA 3OPZL 4OLWL 3JV4A 3SDAC 4PRIA 1U8HA 3BQUA 3OKOA 4YQXH 3D87B 1PFCA 5DHVB 3DUSB 3C8KA 2WV3A 3WKNA 1JI1A 3QXVA 2GUOA 1F3JB 2UUDH 4E5XB 4OGAD 3V6OE 3VXMA 1E4WH 12E8L 2H45A 1BQUA 3NZHL 3PWUB 3GSRA 1G0YR 5GGRA 4NNXB 4YHZL 4DGIL 4YHLH 2NXYD 5CGMA 1LK2B 3QHZH 3MLXH 1NGXB 3KPTA 4TRPH 3MOQA 2ED9A 3O8XC 4U1SA 1ZT4A 4LDLB 1QSZA 4PYGA 5EG6C 3ARYA 1I3GH 1WISA 1EX0A 4WU7B 3AMLA 5H94B 2FB4L 1AGFA 4YE4H 3TIDB 3OKLA 4CNIA 1GHFL 3RVVC 3HR6A 5HI5D 2NNAA 4FQJL 6FABH 2YUXA 2VLKB 3KYMB 3DX7B 3JWDH 5F6IB 3FB6A 4GXUN 4UV7H 5EWIH 2Y7QB 2FO4B 1I9IH 1J1OH 3HLAB 1DFBH 1W0WA 6CGTA 1A9EA 1QBLH 1ITBB 2JB6B 3MRJB 1MJ8L 1A1OB 2Y36H 3NTCH 5I71C 3EKCA 4N5EC 3IGAB 4G43B 1I3UA 3G5YB 1R3LB 1RJZB 1CVRA 4J12A 4IMLB 1A6AA 4ZFGH 3GK8H 2BNRA 5ESQA 3GMRB 5F8RC 5BQ7A 4JY5L 4JPWH 2FRGP 4I3RH 1BMGA 3DROA 5JZ7D 1J9CT 1NFDB 4P4RB 3T0EE 1D6EA 4F2MB 4M1CD 2FH6A 3QUXD 3ZHDA 4XXDB 1A6UL 2B0SH 4D94A 1VGKA 4KUZL 3BSZL 1CLOH 4UTBL 1N26A 5D1QA 5GXBB 4NZTL 4HULB 3EOTL 3MJ6A 5I8OH 4OZHF 4A6YH 4PBVC 3NVQA 1IMHC 5KVFH 3WIIH 4LHQB 3U7WH 5EZLA 4QRPE 5C0DA 4NHCL 4XB8A 4KC3B 1RK0B 2AABH 4CUCA 3BOVA 4FMKA 2UVFA 3OKKA 1FORH 1EAPA 1QEWA 1DZBA 1KN2H 3OAZH 5L88L 3HNTH 3UAJC 1F4XH 2J8HA 3QZWB 3VFPB 4QRUB 1OD9A 1F2XK 3VG9C 2NTSP 1I9JL 2EH7H 2HKFL 5DQ9B 2FR4B 2EDTA 3FQTA 3RWJB 1I7RA 2Q87A 1J8HB 4LMQE 4WFHD 4P2OA 3U30C 1RY7B 3CFEB 5IVNA 2IMNA 4TVSa 1NDGB 1FV1A 4N90E 5FGCE 5LXGL 2O5ZL 3X14A 5C0BE 3UZVB 2F8XC 1F58L 4LFHG 1L7TL 5C0CE 3ARXA 5EFIB 3O6FD 4POUB 2DQHH 1OP5K 1JUFB 5B3JE 3HC3L 5GGTA 5GRUH 5GQBA 3MGAA 1RJYA 3CSYB 1JGEB 4RAVA 2IPKB 3WDJA 2G60H 1N5YH 3C6LD 3HG1D 4GKNA 3SGDI 4PR5B 4M61B 4WEBL 3DO3A 1E4XI 3TBSB 1I7ZB 1P69B 1X3DA 1MCOL 4GAGH 1NEZA 2ATKB 4YDJA 5HYJB 1CLZL 4KY1H 1CD0A 2NY5C 4OLWH 1RUQH 1FL5A 4RIRB 4HUVA 4P59H 1WBXA 4HGMA 4WWKC 1IGML 1NCWH 5GS2H 1QRNB 3RVXD 1NEZB 2ATKA 5HYJA 2ORBL 4NO3A 1X5FA 4EDWH 3MV9B 1NCTA 3VXRB 3D0LB 3BPLC 4L4VD 4QTHB 3DOSA 1LO2L 4TQEL 1NAMA 2R4RH 3MRBA 1NGWB 1NCCH 1WWCA 1ZGLP 3IDMB 1JRHH 1ZAGA 1F8TH 4NQDB 4FN0A 4G6FD 4KKLC 1ZEAH 4TULL 3RBGA 2HH0H 4JPKH 3MV7B 3I85A 5FYKH 1FCGA 2IPKA 2X70B 1UC6A 2B2XH 4PJFB 3C5JA 5KS9E 5I8EB 1HI6A 2NY7L 5T5NF 3OHXB 1P4BL 4U2ZA 1GAFH 5EO0B 5I1LB 3FQNB 2D0GA 2FECL 4R97C 3G5XB 4NFDA 5C1MB 1UWXK 4WW1B 2MQ0A 3VFMA 4QNPF 5FUOL 1WEJH 5IW6B 2C7UA 2F54B 1DVFA 1YJDC 1ZS8B 3C6LB 5C0AE 4M7LL 3OR7A 3QFJD 3MRJA 3L7EB 5E5RB 2B5IB 3AS0A 3V0WH 3GGWB 2UWEF 2APTA 1P7QD 2PCPB 2R2EA 1BBDL 4OV5B 4WV1A 4M6ML 5EUKA 1IRAY 2Z0BA 1PD6A 3OKNA 2PTVA 4Y89A 4JKWA 4N0UE 1HOCB 5GRJH 2JJWA 3TYGL 1B3JA 3TVMC 3LEXB 1UZ6F 4N8PA 3QXAA 4Q9RL 3RWDB 5DJCB 2O5ZH 1NC2B 4LL9A 1MJ7H 1VA9A 4OUOA 2YD4A 1E6OH 3BAEL 4HBCL 2AJZA 3QUYA 5J9PB 4U6HA 3DETD 3VFOA 2BMKA 4LQFH 3ARUA 1ZA3B 2NPLX 2BC4B 4X6BA 5EO1B 3MJ8B 1I7TA 2MHAB 5K9JL 4TNVK 1OAYL 4CADA 1XZ0A 3QIBA 1U8NB 4BK5A 3BPOC 4F57L 3GMQA 4JQVC 1GZPA 4XGZB 5FO9B 3QH3A 2ZSVA 4LCWD 4LPYA 3QXWA 4B7IA 5J1TC 1XZ0B 1XIWD 3QIBB 2XN9A 1UWGL 2Q6WA 4HH8A 4UDTB 3G5VA 1Z5LA 5KTEL 3ETBF 1J86A 1GZPB 4EBQL 1JI2A 5D1XC 3WV0A 5IOPB 3I2CH 3PWPB 1ZMYA 3ZL4H 5BQ7B 3HS0A 3I50L 3V5HB 5A43C 1J8KA 4JFYA 2V7NA 3QXAB 3HUJB 3C9NA 4S11A 5D7KD 1A6WL 1BQHA 4HIJB 1IBGL 4ODUA 1DP0A 5EZJA 1CICA 4JDTL 1I1YB 3WNLA 1C5DA 3ARFB 3F8UB 4KVCH 4K7PX 4HKJA 5FYJE 3T0EB 1P84J 3A6CL 1KG0A 3T0WA 4PLKC 2EDEA 3DHMA 1LE9B 2GJ6A 1HKFA 1U3HD 1G7MA 4MXWL 2VLRD 1IAOA 3IS0X 4J6RH 2XN9B 3HE6A 1RZFL 1S9XB 2BDNL 3RL2B 4Z77A 2MKLC 2X4TB 5JW4M 1IQWL 2Y6SD 1A3RL 4GRLC 1TZGH 5I30L 4GRMA 2RCSL 1U8KB 4OLYH 3IJYB 5IVZB 5C0JA 4OZIF 3TZVA 3ZYZA 3S35H 1B2WL 2BNQE 4JREC 1MEXH 1UA6L 1YQVH 3RY6C 2XV6B 5J0BA 3AU1B 2C3VB 4UV4H 3IVKA 1B0GA 4NUJB 3KYNB 3U4BL 2IJ0C 3ARDD 1I7UA 3MUY1 2UZIH 3L95B 5BZDB 2VE6B 3PQYB 2XZQH 3HPJB 3LS5H 2RHEA 3Q6GH 2P5EE 3MOBL 1S7RB 4WU5B 5MHSD 1FO0A 4HEPG 2V17L 1KLGB 4JZOB 2GSGB 5HDLA 4PRPD 4RAUB 3DVFA 4P23D 2N7AA 2L7UA 5DC4B 3WDIA 4R7NA 4HXAL 2E5EA 4GRLB 3VFVB 3S5LB 2ZOLA 4GQPH 3FOMA 4O2CB 4JPIB 3UX9B 3LN5A 3VXRE 1OAXH 3IF1B 5EU7E 1MQKH 4TVPD 1FZJA 1INEH 1UB5A 4ZTOH 5T1KB 3LV3B 1ZXQA 4D0DB 5DO2D 4N8VB 1QRKA 2X4NB 4EKXA 1CYGA 3E2HB 5MERA 3GSXB 1ACZA 3RIAF 1C8PA 3FT4A 2HJLA 3CH1A 5LVEA 3QPXH 1CL7I 1T1ZB 4RZCA 2GJZB 4AG4L 4X4XA 2OYPA 1JPSH 5BRZE 1MRCL 3T1FA 1D9KB 2FJGB 1LVEA 4DKFH 1BX2B 2FIKA 1FH5L 3IRPX 4DKEH 2P5EA 5C07B 5I1AA 5E7FA 1AC6A 4G8GE 2A1WH 4KROC 3SDDB 1JUFA 3MV7E 4ODSL 5D7JB 3VWKD 4BA8A 4KI1A 1S8DA 4PTTA 1G84A 5TF1H 1MFAL 4C57C 4YR6A 4C56E 5C0AB 1HK6A 2QLVB 3U4BH 5GGUB 5CCKL 3QRFM 3BP4A 3ALWA 4C56B 3ARGA 2E27L 4PJBE 1PJ9A 1EO8L 1DN0A 3C60C 5FKPA 5CP7B 3L5WB 1AGDA 5IGXL 5KANI 5EOCJ 4V1DE 4Q2ZB 3MV9A 5ADOH 1H3UA 5M95B 5EUOF 3BKYL 3F6IA 1QVOA 5TDNA 3KLSA 3LH2L 4JG1L 4LKCB 4MB3A 4BFEA 1HKLH 3U9PH 4Y1AD 5DSCB 4TULH 3KPRD 3FN0H 2ESVD 5TQ2H 1BM3H 1ULVA 5KW9L 1IM9D 2JF1A 4G9FB 3WLWD 3WS3B 1C16A 4KGJA 2HRLA 1YJDH 5F7WC 4CMMA 4JM4H 3HRZA 5HPMB 1DSFL 4KVCL 2MQCA 3LIZL 4WCYH 1CFSA 1CIDA 1DQDL 5HDQL 2Q86B 3T1FB 3SKNA 3KPPB 1H8SA 3RWJA 1S3KL 3ZT5A 5HPMA 3S88H 4YPGB 4HJ0D 5JNYB 1G7JA 4OCYH 3RKDD 1EVUA 5IESH 5F7UA 2FHBA 2Q8BL 1G7QA 3FTGA 1NJ9A 4JN1L 3QQ3B 4PG2A 4HCRA 5EUOB 5FK9A 3P0VH 5CBAB 1A9EB 3RX7A 5GRUL 2R4SH 1RHFA 4FQXA 3U82B 4POZD 3ZTNH 1AP2B 1UWEH 1ES0A 5EBLA 3BZ4B 3OKDA 3SOBH 1HSBA 4N8CH 4ZSOE 4YBLC 3CZFB 4A2LA 1NBZA 3MRPA 3MA7A 3QJFA 4LGSB 4U0RB 1N5AA 1LP9A 1SM3L 3VI4F 5I1EL 3ZDXE 1U3HA 3MO1A 4PRNA 1FFPA 4P99A 3IETB 4R7NB 1NFDA 4F15C 3MUGA 4DZ8B 3JZ7A 2ZSWB 3UTTA 3V8CA 1QR4A 4OLZH 1V05A 4G6JH 3T1WA 4X98B 4F33B 1AJ7H 4OAWB 3LHPH 2A9MH 4ZFOB 3CGTA 3QFJA 1P6FA 4M43L 3TO4B 5I74C 1K4DA 2E7CA 4NQCA 3VWJB 4PUBH 3VWJD 5CKGA 4P2RA 3HE7B 3GMRA 4PB9L 4LLQB 4X5LA 3BO8B 2SEBB 1T83A 1JWSB 3FO1B 4CDHA 2GJZA 3AFLA 3VXMD 1P4IL 5FIEA 1UH3A 2R9HC 1KJMA 4XP6H 4DKDC 2HFFB 2HN7A 1E28B 1DDHA 3ZDZF 1EJOL 1LP9E 1U8JA 1WZ1H 1WAAA 3V5HA 3EGSA 1CR9H 3RDTB 1T5XA 3FFCE 5L7XL 2YMXL 2DQJH 5HHVH 3BXNB 3ULVD 1K5NA 4ISVB 4I77H 4JHZA 4OFKA 4N0YH 2FWOB 1OSPL 4KWUA 4Z95H 3MRCB 3LKSB 1OP3H 1U95B 2HTLC 3NCYS 1JPST 2B1AH 4EI5C 4ELKB 3IJHB 5EC1A 1DFBL 4DWHA 3L9RB 5DQJB 3QULB 1TITA 1U95A 3M17A 1CIUA 2CUIA 5BVJA 1KIRA 1T2QH 3CSPA 1YN6B 4PRID 4WTWA 4OCRL 1IAII 1XEDA 4ZPTB 5C0CB 3B83A 3JV6A 1I8LC 1EO5A 4XAWL 2LV4A 4ZUSA 1CGSH 1OAKH 1H3GA 3HZMB 4FQ2H 4N0FB 2V2TB 4IEFB 4NZJA 2XG5A 4M8QB 4XP4L 1CDBA 1W72H 3GUTB 1ZA3A 3U9PL 3KPRB 1IGCH 1EEYA 1IARB 2NYYC 4OI9A 5HSFA 4G8GB 3OKNB 5MP6L 1MWAA 4B50A 3QWRD 3MRQA 4IOFD 2PO6A 1ZT4B 4OQTH 4B53A 4YGAB 3O2WL 4CMHB 1E4WL 2GEEA 5C0NC 5M7QA 1MFBL 1A9BB 1WK0A 5HGDA 1JYVA 4HPYL 5GHWL 4NYLB 2VC2H 1T1WA 2Z91B 3NPSB 4JRXE 4H25B 5KANG 3P0YH 1XAUA 5BMFH 4NKDB 4R4NC 5I1JH 1T7VA 1TJGL 3HAEA 2W9DH 3P73B 5K9OB 1A0QL 5C86A 4JPVH 4YUEH 1QZ1A 1G7QB 2VLRE 2P8LB 4P59L 3RUGF 4I18B 1RZGA 3A6BL 3BN9C 3L3IA 1BQHB 4XC3L 1KN4H 5IP4A 1Q9WB 2Z92B 4XWGH 1A6TA 5C07E 3EYVA 5I8KL 5FECA 1JF5A 3PNWA 2C3WA 3MRFB 4NRYA 5FYJU 4Q9QL 4Y4KA 5H35A 1TZHB 3BPLB 2ATPA 3L6FB 1X5ZA 3LQMA 1KB5A 3B9AA 5C0CD 4AEFA 3LKRB 5GGSA 1WJ3A 4Y4KD 3S35L 3IU4H 5E2UL 3RGVD 4RGOH 4GUPA 5D1ZC 4ZAKD 1VFMA 4HT1H 1CBVL 2NY1B 3QEQA 5F8QC 3STLB 1CDIA 4GG8B 2BJML 1X4ZA 2GJ6B 2VYRE 1VFAA 5ACZA 3NN8B 1YPZE 1CG9B 4DEPB 1MQ8A 1YEDB 5EUOE 2GITA 4WFGD 1HWGB 3RL1B 1B0RA 3O2DA 5T33H 1FYTE 3JTSA 3D85A 1DTUA 1KJ3L 5DI8A 4G7YL 5TDPA 3V95A 1J8HA 4ERSL 3ZE2F 5EO9B 3U0TB 5I0ZA 1RIUH 4RMWA 4Y88A 3DLQR 4L29A 1CICD 3WHXA 4KKCC 4U6YB 3MXVL 1OGAB 2VZSA 3KPLB 4JE4B 1AO7B 3HMWL 4UDTA 3OGCA 4QRTA 5FHBL 1JPTL 4JQXC 4NPYB 4QY8B 3NA4A 4JCLA 1JZ4A 4WI2A 4X9FA 3TNNA 1JNLH 2HVKA 5ISZE 4KDTC 1JWUB 1WBZA 4L4TE 4PJEA 25C8L 1JHKH 3BHBA 3H3PH 1MIEH 4H20H 4D0DA 1G6VK 1AXIB 4LSSL 1YEFH 3HE6C 2XTJD 5KSUA 1AI1H 3CFBB 1NAKH 3QUZD 2HT2C 3QUZB 2DQFB 4QF1B 5LWYL 1T6VN 3KPOB 3FONA 3WXWL 5I1CL 5CEZE 5C2UB 2RGSA 5K9KB 1QHPA 2ICWA 3FOMB 4OFYA 4R96A 4UQ2B 4MAYD 1J7VR 4CVUA 3MV8E 5L8LB 1LHZA 3C2AL 5CSZB 1HQ4A 4PJCB 3VFSB 4P2OB 1N0LA 2E27H 1K6QH 4FNLH 2QEJA 5I75B 1XGUA 1JGLL 1CG9A 1EUUA 3T3ME 3QI9A 4ZO7A 3MX0A 4LLUA 4LSPL 3MV8B 2PTUA 5CCKH 3DV6A 2J88H 2VXVL 1B0RB 4LLYB 3BZ4A 4MAUL 4DK6A 2DLFL 5FAAA 5HDBE 1TCMA 3BHBB 3KYNA 4G7YH 3L5JA 4LDEB 4WDIB 1AGEB 5DRZA 3LEYL 1T1XB 4P3CH 3IVKB 5ESVA 4F7TA 2KPNA 1VGEL 3FQWB 5BOZG 1HHIB 2ADGB 4G8FB 1ZK9A 1XF3B 5IW6A 1QFWL 5ERWB 3EJJX 2ZPKL 2VJXA 2DICA 5L6YH 3VD3A 5LKNA 3X12A 4PRPA 2ARJB 5EBWB 5DDHB 1QBMH 2GJJA 5C0GB 4KXZH 3VXSE 4B41A 1KCVH 5SWSB 4K3JL 4PGBA 3FO0L 3INUL 1DLFL 5JXAH 3LDBC 3ZDZE 1E0OB 3B8YA 5AZEH 1QFUL 2YEZA 1EXUB 5CEYB 3P77A 5F9OH 2LAAA 4PRDB 3OB0H 2PTTB 2ZPKH 3TM6A 2BOCB 4WUUB 3BE1L 4HGWA 4WI4A 5GGRB 3FT2B 2AGJH 4YHPA 3Q5YA 4WWID 4U1JA 3TC9A 4H1LA 4LVEA 5DS8B 1QLRB 4FMFA 4WNQA 3ULVH 1JFQH 4K7PL 5I2IB 1G9NH 4MDJB 4CW1B 3K7UA 4XNUH 4M7LH 2GT9A 3TCLA 5JO5A 4GMTH 1U6AH 5J6HA 1CGWA 3TT1L 2WBJA 1RUPH 3GSRB 3QHFL 3JTSB 4GRMB 5LCVH 3UJJL 1RPQA 3EHBD 5C0AA 5KSVB 4NZRH 3P77B 2QSCH 1GZQA 1E4XH 5DEGA 1BAFL 2D31A 1V3KA 1NGYA 5IHZB 3HC3H 2BCKA 2D2OA 4BH7A 2Q8AL 2DOCA 2OJEB 4APQB 5ICXA 3WMSA 1OWRM 1KBGH 2AV1B 4DZBA 2P47B 4X6CF 2G75A 5GJSL 4PJXF 2Y23A 3WHE1 2WM0A 1OGAD 1P53A 2D03L 1G7IA 3ZZ1A 2X10A 1NCCL 3UXFA 1S7QB 3QQ4A 4Z7VE 4HLZG 1C5BL 3OAYH 2DS4A 3VFUA 2P8MB 2DQTH 4P9HH 4PGZA 1YEJL 2AJUH 1U36A 2VSCA 3TCLB 5EZIL 1CXIA 4YO0A 4EDWL 3VRJA 1JK8A 3VGAB 1MCCA 4U05A 4XPGH 4KQ4L 1F3RB 2APXA 4NO5B 1I7TB 2MHAA 2A74B 1F02I 2EC8A 2X89D 3G08B 4F37F 4HS3A 4U1MA 5F72S 5T3XL 3I50H 1CL7H 1QSEA 2BVOB 2XKNA 3QDHA 5JA9A 3MRMA 3RVUD 5L0QC 3CVHB 3BKCL 3F7PC 3B9KB 3AS2A 1AFVH 3ZYOA 3HMXH 2EDKA 5DMGC 3CVHA 2QQKL 4PGCB 1HYSC 1KB5H 1G7JB 1KIPB 1YMHA 2FWOA 4CMHC 1F42A 3W82A 2W9LA 1I7UB 4CU8A 1SQ2N 1ZGLM 1FZKB 1MCDA 3LPWA 4K9EH 4OKVB 4DN4L 1R3LA 4LHUG 4L8SC 4U6VL 1BD2A 4FQHA 5CSBA 2J8UF 1WWAX 3S34H 2BCKB 3HZVA 1NUNB 2P5ED 4X7SL 1MCNA 2VL4A 4U7MA 2C1PA 1XH3B 5E8NB 1YPZF 4FG6C 4UT6L 4OCWH 5EBWA 4Y19A 5DK0A 2DM2A 4H1LH 5CEZL 2BHZA 2L0DA 4PG9B 1J1OL 1NFKA 4XP5L 1ZLVK 5EWIL 3VCLB 4IMKC 3HB3D 3GMOA 5EA0L 4LRNH 4UOW1 5KOMC 4JZNB 4WFED 1FL5B 3EYUH 4LCYB 5CINL 3RWDA 3TFKD 3IFNL 3LD8C 1JWMB 5A1AA 1RULL 2OX5A 3OJDA 3K3QA 1EH9A 5E1HB 3S3JA 3QXUA 3TZVC 4LLDA 5GS0C 3CSGA 3MROB 1F11B 3WNKA 4XNXH 4WO4B 15C8H 3MYJB 1UB6B 1CGUA 1M05A 1G6RA 1PW3A 3TYFB 4QXGL 2X4RA 1S7TA 4FQIH 2DQGL 1WIOA 3KPQA 1CFNA 4JJHA 1AKJA 4Z18A 5CZXD 1A5FH 1EMTL 4GOSA 1WBYB 2H3NA 4HCRL 2P45B 2AJ3A 4OZHA 1W0VA 3GNMH 1F45A 2NR6C 5J8OA 5DD3L 4NQEB 3W9DA 4F7EB 3S88L 2OL3L 1NJ9B 4CN1A 2CXGA 4ZS6C 1NMAL 1VEPA 5GZND 4C55A 2EYRA 4PR5A 1EJ6A 5MEQB 3KPNA 3QDMB 4RGMC 1I8LA 3SJVD 4PTUA 4N1HB 2FB4H 3FL7A 4MSWA 3BRGC 5J12C 3PHOB 1J0IA 5IVXB 1H3TA 3N1GC 3DIFA 5C0BB 3VH8A 3DRTB 3O6KL 1F4WL 4FXKA 4ZFOL 1OPGH 5FUZH 2UUDK 1S9WB 1F2QA 4ZXBD 4Z7WF 4K94H 4Z7UA 1QSFE 4HUWB 5SWZE 2ZCLL 2APFA 2K7PA 1AKJD 5I1KL 4HS8L 1GC1C 4M6NL 2VXSH 1CFVL 3RVWD 4Y16A 3WFZA 4MJ6A 5ACZB 2BVYA 4GBXD 5CZVL 2KL6A 3U6RB 4P5KB 3UCRA 3IFPA 2EKJA 3RDTC 4JFHD 4C54A 4KU1A 1JJUA 4RGMB 5D70H 1A7OH 3SDXA 2Q20A 3MRLA 3MV9E 1A6PA 4M9OA 3IDJB 4RRPA 3INUH 1JL8A 1S5HA 1X5YA 2OP4H 2VDOH 1OGTB 1MIML 5T5FH 2ERJB 4I8DA 4NP4H 4ODXA 5C08D 3X3GH 1HXMA 3DX9A 1MVUA 1JZ6A 4OB5H 4TPRH 1GGBL 1ZLVH 3DURB 4GQ9L 2CKBH 2IGFH 2X4OB 4D0BA 1U9KA 2Z4QB 3BGMB 2V6HA 2IAMA 4Z7NF 1HI6B 4O00A 1LEKB 1FG2B 4IHOB 4PJBF 5GS1C 1GGYA 2VQTA 1GVIA 1AQDB 3NAAL 1K2DB 3MV8D 4OKVA 5ALBL 3ULSA 2OXGA 3SQOL 1D5XB 3MLYL 1IEAB 1S7WA 3GMPB 1W8NA 3H9SD 4ELKA 4S1QL 4N0YL 5DR5H 1JTOA 1RVFL 5I76B 1FBIL 2J88L 1EDQA 3F5WA 3GMMB 3IYLW 5D7IE 3WSQL 3GSOB 4C83A 2X1QA 4LRIC 3STZB 2MMXA 5ITBH 5E8EA 2Y25A 4HIHB 1YEGH 3KXFE 4NO5A 1Z9SA 4NKIL 1LO0H 1DN2A 5C70A 1C7SA 3FO9B 1QSEB 2BVOA 4NT6B 4MYWB 4ZFFA 5L9DL 4PB0L 3OKOB 4PPTA 3V6OC 3QIUC 1PYWB 1F6AA 1JYNA 3BPCB 1UACH 3LKOA 1Q1JL 5FKAB 3V9FA 2ENYA 1RIHH 4V1DA 3QCTL 3TPUB 3OAZK 5SWSD 1YEDA 4BFGA 3UPCA 5DRWB 2ZJSH 2PYEA 4TUKH 4DUVA 2YPVL 4LPTA 1F3DJ 1GIGH 1WTLA 2HLFD 1WITA 3FQRB 2JK5B 2DF3A 4PJAF 2XQBH 3NGBB 4LCIH 4L4TD 4ZG1A 4WEMB 1R3HB 2ITCB 4FTVE 2OXHA 4G9DA 1KXVC 1DQLH 5E2VL 2AJZB 2BXYA 5I75C 2DTSA 2G75B 1HXYB 1D9KA 4ODVL 5E8PB 1U0QA 3C8KB 1ZHNA 4NWUL 4G9DB 3CUPA 3GSQA 5DJ8B 3MUGB 2UZYB 5IB4A 3HI1B 2VUYA 3BQUC 3AAZA 1FVEB 1YEEL 2FO4A 3O9WC 2UV3A 5J1AA 3Q1SL 3BX7C 1T0MB 1C7TA 3REWA 5K59E 2WUBL 3PWLB 5HHQA 1C1EH 3QSKB 4GAFB 1KB5L 2YKLH 4AENB 1A7PL 1HQRB 2PCPA 2AP2A 2V2XA 4JHBA 3FFCA 5T1MB 1LO0L 3G6DH 4NN7C 3ZE1F 3JUZA 4P9HC 4TN9A 5DS8A 2BXZA 3WXVL 4OGXL 5KVGL 5JPMA 1HWHB 3H9SB 5E8DL 4PJBA 2N7BA 1PG7L 3OF6A 3QCUH 4FFZH 5E99L 2JJTA 3VXOA 3CDCA 1KCKA 3I3EA 4H5SA 3PL6D 3A67L 2P5WA 4M6NH 5DHYA 4YGVA 43C9B 4Y5XB 1JYWA 1G7MB 3W2DL 1JGDA 4BQCA 2MOVA 5FYLL 4U1KA 3CAFA 2ZUQC 3H0TA 2ZZUT 3WKML 1T3FA 3EJZC 1GPOH 1A1MA 3SCMA 3ROLB 3VFRB 2GY7B 2UWEA 5DQJA 1NH6A 3EFDH 3OMZA 4H0IA 3E2HC 4YDKL 4KDVA 4UIKH 5EU3B 1XF5B 3KYOB 2FYYB 5IG7A 2NLJA 4YIQA 1F4AA 1ZANL 2VDOL 3SPVB 3HS0B 2WBJB 3B9EA 5EOQL 3X13B 1HINL 4BUGA 5H37H 3WJJC 4JFDE 1X5AA 3I02B 1SJHB 3RGHA 4LAQL 1RUPL 2DYPD 2YN3A 3GJFB 4P4KD 5J57B 4JFEA 4XP1H 5AWNL 4G3YH 4LIQH 3IAQA 3JWOH 1WICA 3CVIL 3V0AC 4S1RH 3WBDA 3BFOA 4ONFH 3MCKB 4KVNH 5CUSH 2DIJA 1QSFB 2IADB 2E8ZA 5KJRL 3ULUC 3LQAC 2VWEC 4WW1A 4FOMA 1TLKA 1T0PB 3VXUA 3G5ZB 4OD2B 3HTLX 3QNZA 4YFDB 4OCLC 1QR1A 3UJIL 2CR6A 4KROB 3CZJA 1YN7A 2DM4A 3SBWC 1AR1D 1BOYA 3SJVA 4MNGE 2CJUH 5JIIA 1FG9C 4CW1A 2WINB 2ESVE 5GRVL 1L7IL 2CRZA 2XOTA 2I5YL 5HJ3B 3SDAB 3G6JA 4QXTB 4LCCA 1XGPB 4HFUH 4LHJB 3GMNA 1DUZA 4WEUD 4GG6B 2FO1A 3BP7B 1U8PA 2IBGA 3KLAB 4OD3L 2CD0A 2PO6C 8FABB 3QI9D 4JHWH 2N4IA 2V2WB 1KEGL 4MXWH 2YD2A 3X3FL 4BUHA 4FQ2L 1FL3A 2W9EL 1QYGL 2XWJA 4PJ5E 4Z7UB 4NIKB 2CGRH 2YD9A 5FM5M 4OZFA 4KJPD 2B4CC 3ARFD 3DGGB 4BQ8A 1YNKH 4OF3A 3BIAX 1FNSH 5JW5B 3ARWA 3FQNA 4FQLL 1UM4L 3ZT7A 4WGVB 1RULH 4O2FB 5DJYA 3HNVH 4CJ1A 3CFBA 3O4LB 4YHOH 3O4LD 3DI3B 2W0FB 4HH9B 4PFEA 3L3DA 3U30B 3OXRA 4IMLA 4ZPVA 5TDOB 5INDA 2DKSA 2PYFB 2Y5EA 1WFOA 3QFDA 3SGDH 4YHOL 1N59B 4AQ1B 4IBLT 2Y72A 5FCUL 3EIFA 5D7SH 3BEVA 1VERA 3WNMA 1IC5H 4KK9D 4PJXA 1YPZB 1MPAH 4F57H 1F58H 1J0JA 1EJOH 2EDOA 1NAKL 5D6CA 1G7PB 5A3IC 2EIEA 2A6KA 4KK6C 3WD5L 3DSFL 5HHOE 1UM6L 2YWYA 2Y5TB 1FSKB 5I1GH 2MCG1 3CLFL 1ADQA 4BQ9A 1XGTB 5GGUA 3GJEB 5F1NA 3TT3L 1T5WA 4XZUB 1Q9WA 5DQ9A 1A6WH 4IMKA 5HYSB 1PX4A 1IZJA 1UH4A 4UIMB 4L3EE 2VO5A 2RQ8A 4CJ0A 1YDPA 3D18A 1QLFB 1TJHH 1KUMA 2ZJSL 4WHYH 4Q2ZA 4JRYD 3SKJH 2VXUH 4LGPB 2YC1B 4Y1AB 4HUVB 4YFLF 3CX2A 4MA8L 4XNZC 4A6YL 2ZCHL 5DJ2A 1U8MA 3B2UD 4C4KO 5HDOA 3SKOB 5KSAD 3MSPA 4UOW0 3ZSTA 3HE7C 3ARDA 2OJZH 2VH5L 3L3JA 1A6UH 5TFSL 2DJUA 4KHXL 2AJUL 4EEEA 1KPVB 1NLBL 2F58H 3SDXB 1OP9A 2E6QA 2BVEA 1AGCA 3CVIH 3CX5J 1SMOA 2VDMH 1LDSA 3WLBA 2EKSB 1RZ7L 3NCJL 4Y4FD 2YK1L 5DLML 2I9TB 3D85B 3P30H 1I1CA 5JQHC 1TETL 3NH7L 2NY4D 5JOPE 2NY2B 4ZTPL 1CK0L 4NJAL 5D1QB 1QRND 3F7VB 4GAYB 2EXYD 4RFEB 5HDBF 2COQA 3MLPA 3AAZB 1X4YA 4HLZH 5IWLA 3PGFL 1BVLB 4WTZA 3IDNA 4MLIA 5KSVA 1J0HA 3TLRA 4ZNEE 1UXSB 4RGND 4ODHH 3N1MC 4MGXA 2PF6A 1X5JA 1BFSA 1RK0A 1FFQA 4QCIB 3A6BH 3A0OA 1U8JB 4YC2C 3KHOA 1BLNA 5C0IB 3MACL 1N6QH 1OTTD 3PWVA 4S10A 1IGTB 1F3DH 4LF3B 3WUZA 5IV2A 4M5ZH 4M7KL 4OFDA 5HVGB 4F15B 35C8H 5ACLA 2HJKA 1DEEA 2OK0L 1J0KA 2Z8RA 5TQ0L 2C7UB 5AYUH 1X4XA 4UT7H 1A02N 4RMVA 3HI6L 4PV8A 5I16A 4X80H 4XMLL 2X42A 3H8NA 1J0ZA 5L2KA 1MNUL 1RMFL 3G5ZA 4J3WA 1MCQA 1KNOA 1HH6A 3RJQB 3HC0B 4FP8H 5TH2A 3PWNA 2GW5A 1IAOB 1J05B 1NC2D 3WS6C 5GGRY 1FNGB 3IAPA 4LLAA 1OB1A 4YXHL 3V8OA 3W0WB 2NY2C 3CXHJ 5TH2B 4J4PA 3T3PE 5IUSA 3ROOA 4PJ9A 1M7DB 3CFKA 5T3XD 4AEEA 5A16A 4JM2B 5IBLC 1JZ8A 2OL3B 1BFTA 4J2XA 4ODTL 3EJYD 4I0PC 2PYEE 1DDHB 1FORL 1HHGA 4P46D 4JVUA 3F58H 1XGRB 2X1XR 1ZLWH 2FHFA 3V4PH 1LO4L 5C2BL 2VUOA 1IAIL 3BRDA 2VZVA 1MCOH 2OL3A 4Q7DA 5H8DA 4HCRH 3HZKB 1V7NL 1XCTA 4X5XB 4P5TB 4QGTA 4URTB 5GS0L 3AB0C 5JDSA 3KYKH 3D69B 5E99H 1NKRA 1XH3A 2YPKA 1VADA 2YPLE 1IT9H 5EORL 1O7SA 3QXTA 2B5IC 4Y4FA 5DUPH 3I84A 3WIHH 1GCFA 1VFOA 1SY6A 4XCFL 3OHXA 1GSMA 1R0AL 3NZ8A 3O6ML 4IRZL 1NDMA 4H88H 3O3DB 2CPCA 3DHJA 4J4PC 1X6LA 4NKIH 1Z9LA 4X6CE 4J23A 4OD1H 4PJ9C 3RX8A 1KB9K 1PYWA 4L3CA 4LRIA 3EYSL 3LKOB 4L5FH 4ORZC 4ZUUB 5SWQB 2HFTA 3G6AB 4EN3C 3TJEH 2BK8A 5JO5B 3TO4D 3WLBB 2HKHH 1M4KA 5GGSY 3STZA 1JYXA 3V0VB 5EDXA 1DE4B 4XX1E 4N0UB 3P2TA 4JO1L 4HUUB 1IGJA 5B39B 5CJQL 5KBNC 1VACA 3WXVH 3KPSB 1A14L 2DBLL 2BDNH 4I3SL 3L7FB 5GRWA 1OGTA 5JXED 3RWIA 4F7EA 5SV3A 1BD2E 5DC9B 2QR0A 3MOAH 5IROC 1AHWA 3QQNA 2GTZA 4PJ7B 4D8PB 5F96H 4NP4L 1OTUC 2P4AB 3SCMD 4LLQA 3VFWB 5L9DH 4QOKA 3W9EB 2VR9A 3SY0A 1FC2D 1KLFA 2WUBH 3E6HA 4PRPB 2YD3A 1D9KC 1LEKA 3MLWH 3GSVB 4S2SB 4G6KH 1S7SB 3IGAA 5BV7H 2JJTC 1Q9LA 1M6OB 1FDLH 2A77L 3MLZH 4XMPH 3SDDC 3UTQA 2WQ8A 4HUWA 5FO8B 1QLEH 3IJSA 2Z93B 2YD6A 4S1QH 5DEFA 2Z31D 2XG4A 4JY6B 5HI3D 4P2QB 1A6ZB 3ECBA 3SGKC 1KCLA 4LASL 2P1YA 4G9FD 5K93A 1IC7H 3QEQB 4X8JA 3CIQA 4KZDH 3BP5A 2I07B 1LEGA 2PXYC 5ID0A 2AJVL 2CO7B 1I8KB 4OZHE 5DMYA 3G9VA 2ZOKA 4JY4B 5J13B 4MAYA 3VGGA 4YXHH 1U91A 2EE2A 5EU6B 4XP9H 2KUTA 5EU6D 3SDDD 3D39D 1KULA 5FDYA 1P2CB 2Q76B 3OBAA 4K2UH 4XPAH 4FRWA 3AREC 4KI5D 4M02A 1FNLA 2G9HA 1N3NB 5T1DH 2H26A 1I9RL 2FDBP 5GRXG 3ZKMC 1CLCA 5J11C 4JKMA 3SCMC 1A7RL 4KJQC 1G7HA 3F7RA 5F7KC 1L6XA 4KKAD 2Y06H 1NUGA 1V7NH 2YPKB 3VE0B 1BWMA 1OAUH 3BD3A 2YPLD 2B2XL 1XF3A 4XMKH 5JXEC 2B39A 1BZ7A 4NQSA 2V2WA 1VHPA 1ODAA 1A4JB 2VH5H 1Y6NR 4BSVB 2AXJA 5D2NE 1F97A 5EPMB 3S9DB 3IF1A 2DKMA 4ZO9A 4PJDF 3H3BC 3S96A 1MPAL 2D7TL 3TBSA 4YBQC 4ONHA 4KZEH 5HGAA 4E41D 1JK8B 1N64L 1O5DT 4O2FA 4ZQKB 1JHTA 2VABA 1IGIH 4WW2B 1JPGB 4PUBL 3FFDA 3AM8C 4L8CB 3I02A 2YA2A 5HGHB 2OTWB 4KZDL 2E7LA 3C09C 3QA3B 5F9JA 3U48A 5J56B 5JXAL 1BIIA 1RI8A 3X11A 1HQ4B 3VFSA 4EDXA 3UBXB 4GRLA 3VFVA 1S7QA 3QQ4B 1EFXD 4WI8A 4PJHE 3OG6B 4ZTPH 1DQQB 1NLDL 3O45A 2V2TA 4GMSL 4Z0XA 3LQZB 1MHHA 4J4PD 1OAXL 4MA1B 2P5EB 2WWKT 5DVKA 5FYKL 4X6DF 1OM3H 3F12A 1CLYL 4JKPH 3RTQD 5IFJA 3BUYB 4MB4A 4R7DB 4F8TA 1F4HA 5ETUA 4OCMC 2VQ1A 4AL8H 5D7JC 4U6VH 2VE6A 3PQYA 2XWTA 5GGSB 1HSAA 1NGYB 5IHZA 1ZSDA 1F5WA 2GK2A 2YMXH 3GSUB 4EI5A 3M17B 4O51B 1RJCA 3KPSA 5D2NA 5TFSH 3RDTA 5J11B 4K94L 1U8IA 4X4XB 4Y2DC 3JV6B 4ENEC 2CLVA 3H9ZA 2P44B 1DANU 3S4SB 1PLGH 3VD5A 2AJYL 1FNAA 4LK4A 1YMHB 3MZGB 5HYJE 4K23H 4FNLL 1IQDA 2VLKA 4B7LA 4D9LH 1DLHA 2Q1EA 3DO7A 2CLZB 3RWEB 5C6PB 2IG2H 2QHRL 5A2FA 4NN5C 3KR3H 4XWOC 2D3VA 2DWEB 2E3VA 4YHYC 3NIFE 4Q9CA 2OR9H 3PG2A 5C8JB 3RIAK 3V6OA 1MJUH 1IKNA 3MBXL 3NH7H 1BJMA 2YPLB 4PJBB 5ID1A 3CFKB 5CEZD 4PJHA 2OQJA 4P3DA 3GRWH 2BSED 4KRNA 3PWJB 4TVPL 3U46B 5D7IF 5KW9H 1BF2A 5DA4A 4O5LH 3SE9L 1JF1B 1ZE3C 1KGCD 4K9EC 2C9AA 4KVNL 1GGUA 1L0QA 3OKEA 2P43B 3PWUA 5CUSL 3TO4A 2YSSA 5E8PA 1MJ7L 1OM3L 3S4SA 3NCEB 1HKLL 5FM5O 3R4DA 2BX5A 4GMSH 1EEZA 3QEQD 4Z7VB 1OQOA 5CIPB 4FTVA 2VDLH 4RX4A 4X7DC 5LG1A 4MNGA 3T0ED 3CC5A 2RR3A 1J1PH 4OTXL 2AEPL 5GIRA 3MNWA 1FVEA 3V5KB 1WFUA 2H32A 3BO8A 1U8NA 3MXVH 4GW1B 4YHYB 2CQVA 3D5OF 4Z7UF 5FK9B 3KXFB 2NTFA 2ATPB 3L6FA 2C3HA 4JN1H 4M62H 3BKCH 3MRIB 5CD5D 1OTTC 4FFYH 1CGXA 1FIGH 3O9WA