3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
3MRDA 1FNFA 1FJ1A 4XVJH 3QI9B 5TE6H 4OFYD 5GHWL 2UWEB 2DQUH 1JPGA 1UKTA 1BZ9A 4YDLB 4H0GA 4Q9RL 2JE8A 4EDWL 2CRMA 1A22B 5EC1A 5I1JL 2AKRA 5JPMB 4X7SL 5FB8B 3FB8B 2G9HB 2ZNWA 4PJIF 4PREA 4OFKA 3O41B 2FATL 4GH7B 2EE6A 1RZFH 1A7BA 2ICCA 3DXAE 2X4RB 1AXTH 2Y5TA 2NXZD 3U9PL 4OKDA 1EV2E 1MJUL 2OR8A 2NZ9D 3N9GH 5DJYA 4MWFB 4OT1L 4MZ2A 1FVEB 3WHE1 4Q2ZA 3TZVC 2VDNL 1OP5H 2A1WL 1MLCA 1JPGB 2NY4B 2W9DL 3QQNA 1WAAF 3SE8H 3LKNA 3STZA 4X5XA 5IROA 4O9HL 1I8MB 5ALCL 3MCKA 1UYWH 4PB0L 4G9FA 5BS0E 3OB8A 3K8KA 3UTSD 3PDDA 4PLJC 4G9FE 2ADIB 1MVFA 3BZFA 1HH6B 4YHYB 4OFYA 1MF2L 5BZWA 1NMAL 5EN2B 1Q9KB 1DQDL 4ZSOA 5I17B 4ZDHA 1LEGA 3L5WA 2V5YA 5B39B 4MQ7A 5EBWB 2AXGB 4KTYA 3WLWD 3TO4C 3RZCD 3QQ9C 1X6NA 3DYMA 3GSNB 3PWPB 1F4HA 3RU8L 4XPAH 1BBDH 3S6CA 3G6DH 3GGWB 5FOJA 1MEXL 4M1GL 1IM3B 2MCPH 1IKFH 4FQHA 4POYA 4HSQA 3RY4A 4G8EB 3WBDA 2A0LD 5F1KC 3VGBA 4P2RB 5KW9L 4WWID 5DDHA 1NCNA 3I2CH 5E0QA 4XMKH 5IGXL 4O2FA 5I18L 4ZPTB 2FWOB 5F7DA 5EU4A 2IPTL 1XF2A 1LDSA 3WL9A 4P3CH 5FK9B 4E0RB 5D7LD 4IDJH 1EBPA 2I60L 2ZUVA 3MLUH 3AMKA 5DI8A 1HH9B 4RMSA 1QUNA 1I7RA 1KENL 4GLRI 3HTLX 4E5XA 4HJJL 1WZLA 3GK8H 2FLBT 5TE4L 3NH7L 4YDJA 5MI0B 3QJHB 1RUKL 5GZNC 3ARRA 2DAVA 3AM8C 2E7LA 4XPBL 4M62H 2CDEB 3ULUH 4JN2A 1HCFX 1ZT1A 4I0PA 4WFED 3QDAA 2VDQH 1BQLH 4JVPA 1G1YA 1HXYB 3MNVB 3DYOA 2AEIT 2A0LC 5DD5L 2YK1H 4XBPA 1S7UB 1NGQH 1ORSB 3GSRB 4K3DH 1RU9L 3TLRA 4J3WA 3BO8B 1OGAB 4JJ5B 5GISL 1NDGA 5DUBB 1ND0A 3B2VH 3MO1B 5A1AA 3CXHJ 3HRPA 3RIFK 4Y4FD 3VE0A 1AGFA 5IVZB 5F71A 1MWAA 3F7YA 2P24B 4Y2DD 5ID1A 3Q3GB 1KEGH 3Q5YA 4UU9A 3V5KA 5D1XD 3OGCB 1RUAL 3KPSD 3KPLB 3L95A 3VWJA 3I75B 4IRSD 2RCSL 4QOKB 1MY7A 2FJGB 4YUEL 4JFEA 4LLQA 1BJ1J 5B38B 3EOTH 3BOVA 5GGTH 1U8LB 2FL5A 2IAMD 1XF5A 1YNKL 4M7ZC 1I9RH 4NQDB 4GRLD 5C09D 1GOFA 2NY6C 3MFFA 1KPUA 2OL3A 3KDMB 3IDYB 3OKDB 1F8TH 3BISA 3E0GA 1UWGL 4JEGB 3V4PH 2YUXA 2OTWB 3WXWH 3FO9B 5EUOE 3V0VB 3IDXH 1UVQB 1YEKL 1M7DB 4LPXA 2FECL 1JYWA 3ZTJH 1NUFA 2D31A 3HI1A 1ED3B 4NNYB 4W6WB 2DDQL 1B0GA 1JF1A 3MLXL 2VLRE 1Y0LB 5IW1B 1YQVL 2W07A 5AAMA 1LQSR 1P1ZB 4HF5H 4KPHL 1RJYA 2N7BA 4JO4L 1PZ5B 3DUSA 3FZUC 2F8XC 4KDTA 3TM6A 2HAZA 4JPIB 1AKJA 3G04A 5EPMA 4ZFOB 4XPGH 4KK5C 4NM8H 3ISWA 5IEHA 4LL9A 3C5JB 2D7TH 5I17A 2OQJA 4XMLH 3VWJD 1FCGA 4OZFB 4H26B 2C3VA 2A83B 4KKNA 3V52H 2ZCKH 1KELL 3B2UD 3NGBC 4XCYB 2AABH 5GRXG 1U8NA 1K8DB 4LOUD 2DQFA 3TNMA 4TOYH 4OCWL 2ITDA 3IU4L 5E99L 5CD5D 5IQ9B 2QQLH 1KGCE 2J6EL 1CLYH 5C6WH 5F7FA 4Y89A 1P5UA 2R2EA 3LKQA 5J11C 4L8CB 1G9EA 5GS1C 1UKQA 1DFBL 1Q94B 5CFHA 4UT6L 3KPTA 4TUJA 3QJFA 5J6HA 3P0YH 3C87A 3RUGF 5LQBH 3C5ZC 3PGCA 4Z7VF 1RIUH 3H7BB 2HJLA 1QTYT 1DEEA 5I1LB 5T1LD 4MMZC 1CBVH 1I9EA 3O45A 1MCPH 4R4BB 4OI7A 2O61A 3C9NA 1FLRL 5CEZH 2Z8VC 1EMTH 4YHKL 5H37H 3WFCL 5HYQB 2BVOB 5CJOH 1VEPA 5L8KB 2EDBA 1A7QL 3TH3T 5CJXC 2HT2D 1I1CA 1YY9D 4OCMC 1F11B 3IJSB 3RA7L 1Y0LA 5CEXB 2BVQB 3HUJE 2NX5D 3OXSA 5C07B 25C8H 3DUHA 2Q3ZA 1I1YB 5IKCA 1KIQB 1R3IL 5DHYB 5IIEB 1AO7E 4XVJL 3VXSE 2DQUL 1JHTA 1BOYA 4N0UE 4QHMB 3OG4B 4EUPB 1VKXB 2H2PC 1PGRB 2O61B 3MFFB 1BJ1H 1J1XL 1FNSH 4NHUB 2K7QA 3UBXG 4Y1AB 3UBXA 3VFGH 4AT6B 3D9AL 1E28A 3FN9A 4AEFA 2CJUL 2HN7B 4OTXH 3T0WA 3O4LB 4NO5A 3I84A 4NZRL 5KANI 4TUOB 3KPRB 5E8PA 2NLJA 3ARDC 2GHWB 2ARJA 5AZEL 1D5BA 3KGRA 4NUGL 4XMPL 2HLFC 4QRQA 3C5SB 4MS8D 2ZCLL 3LEVH 5DD6B 4HPOL 3LRSB 5IR1B 5AWNL 4BA8A 1S7SB 4QHUA 3QDJE 4OF3A 1LE9A 5F9JA 5C71A 4LLDA 2B4CH 3FQRB 3BRFA 3GI8H 3MCLL 1FL6B 1VA9A 2XQYK 3ZKND 3M17A 5E8NA 2QSTA 4YXKH 2GK0A 3LH2L 3SE9H 1KTLB 5FO9A 3RY6A 5T1KD 3D0LB 4MA7L 2VOTA 1A02N 5I66B 1QR1A 4HJGB 15C8L 2NX5A 3DV4A 2XWTA 4MQXD 1G6RL 1DQLL 1M71B 3HC3H 5AUMB 1JWMB 1TJGL 1XF4B 1T83A 2NX5E 2ORBL 3NFSL 5DJ2B 3RZCA 1A6WH 2OL3H 4NN5C 1UZ6E 4XCEB 3PUCA 4I2XA 4FS0A 1A47A 1KOAA 4HUMB 4HFUH 1Z5LA 3QIUA 3QUZB 5I1CH 4H20H 4ZS7H 1OD7A 1G7PA 1OAYH 5IFHH 3UTTA 2VLJB 3H3KA 3LVEA 4KKCC 3BIBX 3QUXC 4M8QB 1DBMH 1IILE 4MLIA 4G80A 1T1ZB 3QXAA 1NMBL 3O3EA 4GAGH 2CKBA 2FX8H 2DQEH 1Q72L 4DK3A 1UXWB 2GSGA 2HKHL 4LDLB 3FOMA 3QIWB 4S1QL 1VFAA 1NBZB 4UQ2B 3PWJA 4BQCA 4AENA 1FYTB 5D7LA 3S36X 5D2LF 3P9WB 2C1OA 3GIZH 3SDCB 2VDNH 4F57L 2AEWA 3GRWH 3D85D 5SWZA 3FFCA 5SX4H 3RGVD 1MI5A 4X7EC 4JRXB 1UYWL 3DVFA 4PB0H 4P3CL 2J2ZA 3GSQB 1LK2B 2F5BH 4YWGH 4WWKB 3X11A 5FGSA 5I75C 1BQHG 5HY9A 2F5AH 1RZJH 1WAAE 3FN0H 4TVPD 2AJSL 5C0EA 4AMKL 2OR7A 2HTKD 3TH4T 4PG2A 4X5LA 4G42A 3NIFE 2AK4B 3D69B 4OD2A 4JDZB 3WO3B 2IPUK 5CD3A 2YUVA 3WO4B 1D5ZA 4PYHA 5A16B 4I0PC 1CXFA 1WT5C 3NCEB 5DRNA 5INCB 1ZLUK 4YHNB 1EK3A 1FC1A 4QOKE 1LEKA 2QSCH 4KJQC 3FAXA 4PJAB 2LVEA 3TBTB 3BKCL 4KXZI 4KK6D 4Q6IA 3SJVE 4CRPA 2F58H 4M3JA 4XNQA 1IKNA 5GGQL 1S9XA 1JHKL 2X4OA 4KJPD 4X7TA 1LD9B 1G7HB 2HVJB 1XZ0A 2BNQB 1LK3H 4NQDD 4OB5H 4X9BA 4LEOA 5JMOC 4JFPB 4WTZG 3ZHLA 1E6OL 3U4EB 5D2NE 1XEDA 3GSQA 2HVKA 4L8SB 4M5ZH 5CSBA 3QCVL 5HHQB 2VR4A 1EEZA 2DQIH 2R29L 3S34L 3EGSB 5F1IA 5ICZA 1T7YA 4ZOAA 3LQAL 4OSUL 2B5IB 2LV4A 3CMOH 1GC1L 2A6DB 3O8XB 3RQ3A 2QLVB 3KPSE 4HWNA 2I9LB 4JM4H 3S4SA 1GSMA 1VSCA 3MLWH 4PREB 4LLMA 4Z0BH 3N85H 5TPWH 2XTJB 2R0WL 5I74C 5JPMA 1WZMA 1KENH 2PYFA 3RWIA 2DYPD 4PJ7B 2MOVA 3K81A 5I6XC 2DQTH 4APQC 4X6DF 3E6HA 1QACA 4UOJA 4JAMB 3V4PL 4M62L 3PV7A 4WI9A 2BOBB 1MCQA 4LQFH 1G9NL 5IB3A 1ZA6B 1T4KA 1WISA 4JRYE 2Y07L 4ZFZB 2AJZB 5GGSY 5ERWA 4G9DB 3VWKB 1LP9E 1H9VA 2XN9A 4ZODA 1BQHB 4R90L 1QPPA 4V1DD 4PRNB 2AI0H 4IJ3B 3X3GL 2D4FA 4HGWB 1YQVH 3O3UN 5AUMA 4HF5L 5HI5C 5DD5H 2PXYC 5CIPA 4G7YH 1HOCA 4O58L 1ZTXL 3JWNC 5HHMD 4U2YA 4IDLA 1E4XL 2AGJH 1CL7I 3CFKB 3MX0A 5IM7B 3WFHB 3R06A 5MEOB 3IRZA 5IQ7H 2B1HL 1MRDH 1CFTB 5DHVB 4EIGB 4N8CH 1DVFD 1X5KA 2IANB 5FUCC 2PTUA 4F33B 3MLYH 3LRSA 2AXHA 4NRYA 3ULVH 4HK3J 4J23A 3EYUH 4AEIH 1NEZA 4XC3L 2HMIC 3C60A 3NZ8A 4AQOA 2YSSA 1NC4D 4FQPA 2RCSH 2J6EH 3CDGA 3LD8C 4HKJA 1MRCL 5D7KE 3IDNA 4FXGB 5T1LA 4RFOH 3CFEA 1GGBH 4XBEL 2P44B 2ADJB 3M1BA 2CK2A 4F3FB 1LE5A 1SJVA 5TQ0L 1G7JA 4WV1B 4F7EA 4POZD 3RWCA 2VDML 4NM4L 2OSLB 1JVKA 5FB8A 5HDLA 5FCSH 1QKZL 5ANMB 3FT2A 4X9GA 3UZEA 4JM2B 5CKAA 2XY1A 2B39A 2VDKH 4EUPA 5EA0L 3MMEA 5IB5A 1H3WM 5MENE 2ZCHL 2M26A 4HIIB 5CEZL 5FGCE 3DBXB 1WIOA 1EEYA 3WSQH 3CPLA 3FOLA 2ZPKH 4GXUM 2CIIA 4PRPB 5ESVA 1PQZB 1S5HB 3JWOL 4OF0A 3T09A 2V7HB 4OGAD 3STLB 2BRRL 2CLRB 3O6KH 4NO3B 4KXZH 1R3HB 4TN9A 3QBTB 2PTTB 1VFBA 3MJ7B 2NY3D 2EIDA 3KLHD 2ZOLA 4HIJB 2XXCB 5HPMB 3MNWB 4EUPH 3RVWC 4BFEA 1A4JA 3BE1H 3C60D 3KAAA 2FEDD 5T3XH 3O45B 3MV9D 4JN1H 4KC3B 1MUJB 4X9IA 4HXAL 4MXVF 4JFEE 4N1CA 4WGWB 3U4BH 1IEHA 1CR9H 3IFPB 5EU7C 3N06B 2NXZB 5IW6B 5F1OB 5EOCL 1IGIL 5FO7B 3L3HA 3TBYB 4F7PA 3VXME 4RGOL 4MSWA 5JQ6L 1MQ8A 4JQIH 5E00B 5F9OH 3BW9A 2R2EB 1UGNA 1YPZE 2G60H 3OJDA 5IV2B 1AC0A 3KPPB 3BDXA 5C0EB 1DFBH 1MVUA 1XGYH 4ODUA 5E9DD 3GMRA 1OAQH 1JZ5A 4WW2C 2MQ0A 5HJ3A 3DX8A 3HC0B 5ESAB 3OR7B 1MPAL 2NQCA 1H5BB 5I16B 3P11H 4QHNA 5EZLA 4B50A 4D0BB 3VXOA 1DTUA 3DETD 2A9MH 3GI8L 3MCLH 4P5KB 4ZOBA 4L3EE 5I74B 4YBHA 1EMTL 4YHKH 4BUGA 1CI5A 4G9FD 2O5ZL 5DK2A 4NT6A 3OHXB 4HS3A 1C16A 4XVSH 3FOMB 1I4FB 1GZQB 3DMMC 3BPCA 1HQRB 1MFAH 4RAHA 1Y18A 3HRZA 1F90H 5FM5M 4WW1A 4JY4A 4U3XA 4MJID 5C1MB 1T2QH 1B0GB 4MX7A 5KZCB 1N59A 1SY6A 1B88A 2QQKH 5I8CA 3THML 1ZHNA 4I1NB 2DN7A 5L8JB 4RA0C 1L6XA 1GHFL 1UVQA 3KPNB 3BKMH 4KH2A 1V3JA 2NY5H 5KVMC 2DBJA 1NLDL 5C0BA 2EYRA 1I3RB 5HHNB 1F4XH 3QUZC 4PIRF 1XIWC 3MJ6A 4MNQB 1MCNA 1TZGL 2VJXA 1KBGH 2E6QA 5SWSD 4OM0H 1R3JA 1I4FA 2EDDA 4BQBA 4S2SA 4EZMA 2FBOJ 1AXSB 2E6JA 5DQJA 3VD7A 1VESA 3KYOB 1M71A 3VD4A 5CINL 3ARYA 3MRLB 1OAXH 3VFNB 1MHEB 3A0OA 3QWRA 1A7OL 5AAWA 4PRPD 4OCLC 4PJAE 3MV7E 2R2BA 4UOW0 3BFOA 4UU9B 3SDYL 3V5KB 4HPOH 3Q3GA 1FZJB 4XVUC 1CGUA 1JI2A 5DMGD 5F7UA 4LLDB 3HC0A 4M7KL 5EU7E 1AGDB 4L4VA 4UNVA 1QHPA 4C83A 2HH0L 5E8DL 1ZANH 2OJZH 4IMLB 5DJ6B 5F3HA 1NDGB 1AI1L 4GG8A 3OGOE 4PJGF 5D7JA 3RWHB 2JIXD 2F5AL 4L4VE 2W92A 3FN0L 2AEPH 3MRFA 1ZLUH 3KS0H 1NCWL 4QXWA 1OB1A 1KXQE 3Q6GL 4MXQD 5C6TL 3BRGC 1YN7A 3JUZA 2ORBH 3NFSH 2RFXA 1VGKB 3QUXA 2OMBA 4G3YH 4ZS6D 1J0JA 3QWQB 2BY3A 4QXUL 5C0BD 1JGDA 3ZMRA 3DVIA 3GMNB 1T22B 4MD0A 5BVJB 1XF3A 3QCUL 5HPMA 3GO1L 5C9KA 4CVWA 1F6AA 3ZT7A 3DMMD 4OD3L 4U1KA 2EICA 3WFEL 1OWWA 4XP6H 4NO3A 5I2IA 1NMBH 3BN9C 2QADB 5CEXA 4OIIL 2DS4A 2W1NA 1XIWD 1RVFH 3FOLB 4O9HH 4NDMB 1CDHA 1TJHL 1TNNA 1YEEH 3SDAC 3DV6B 5IJVA 2ADFH 4XXDA 1LP9B 1G7MA 1NAMB 4NT6B 3TCLA 3WN5A 4ZFGH 4L4VD 3ZYZA 1NGPH 3EJJX 5MHSE 4UTBH 4PJ8C 4F57H 4W6XB 4QCIA 3WS3B 5K33A 5HYEA 3OJVC 1RZKL 3FMGL 1I7TA 1M05B 4R7NB 3U46A 4HKZB 3JVGC 4JFFA 4XNYL 2W38A 5DVLA 5GHWH 4L5FH 2VR5A 4TUJB 5F7LB 3W5MA 3CAFA 2X2YA 3QUXD 4I2XE 4EI5A 3BI9X 5IWLA 3DOSA 3NZ8B 4C4KT 4JZJB 5ADOH 1HKFA 2Q86A 5EUKB 5E4EC 4M9OA 4XAKD 1C1EL 4NRYB 5BJTB 4NZJA 3H9ZA 3SPVB 3VXQB 4WO4B 3HMXA 4Y4KD 2Y07H 3RAJH 3QNYA 3DMMA 1IKFL 4J3UA 4M02A 3BEVB 3BKCH 4PJBA 2YD5A 1CD1A 2AI0L 6CGTA 3O6MH 3VXUE 3TA3D 3EO1A 1Y6MR 5HSFA 2VC2H 4X0KA 3N9GL 4PJBE 1JRHH 1C8PA 4QXTB 5CWSB 2IBGA 1S7WA 3SE8L 1DQML 1ADQA 2OCFD 1V3KA 2FLRT 1REIA 1WZ1L 4AEHL 3IDMA 4EI5C 3QO1B 1RFDL 5J89A 4H25A 5FGCB 4C56B 1S5HA 1BFVL 5D9SB 2FR4B 3BJLA 2W9EH 3ZT5A 5IVXA 1H8SA 2EO9A 3F5WA 3M8OH 5TE4H 4J3TA 2IGFL 3DI3B 3MMEB 5IB5B 3LRHA 5J57B 2VXUH 3D39E 8CGTA 3JUYA 3X3FH 4JHWH 1VCAA 3LPGA 3O41A 5T3ZL 4OGAC 2C26A 2G9HA 2VN7A 4XBEH 4F3FA 2AKRB 1XR9B 1E6JH 2BRQA 4XH2A 1P4LA 4NDMA 4L4TB 1BQLL 1JNHA 4FA8A 4JFEB 3P4MA 2FYYA 1MWAH 4HUUB 4MAUL 2YK1L 3RU8H 4CDGC 2J4WL 3VDAA 1ZLWH 5GZOD 2XZAH 3A6BH 3EYQD 5C7XH 5FF6B 3O8XC 3VH8B 3IAGC 2MCPL 2FHCA 3IS1X 1N64L 5C0NC 2PF6A 1V7MH 4DUXA 1FV1B 4PJGE 4AZ8A 1R0AH 4HCRH 1IZKA 5DUBA 1CDJA 2F8VA 2IADB 1EBAA 2P5ED 1WV7T 3OAUL 2XZQL 5HBBA 2I9TA 5I18H 2AGJL 3HG1D 3VFUB 4MQSB 5C6PB 3G5VA 1HXMA 1MRDL 2R1XB 2LFGA 2IFGA 4CKVX 3MLUL 3AREA 3KYNA 5AG9A 3WV0A 1BM3L 1KJVB 3MLYL 5LVEA 4O02H 3O9WD 2VDLL 2X44D 4YR6B 3IRPX 2FX9L 1CXKA 3BPOB 2HFTA 3UDWA 3TO2B 4YBQD 3K0WA 3ULUL 1I1FB 1YEKH 3IDXL 5ESQA 1AR1C 3FT4B 5D8JL 5GGSA 5HDBF 3SE4C 3IKCB 1SJEB 1UENA 5TFSL 5IOPA 3QH3A 5EOQH 1MHEA 3ESUF 1KCRH 1NC4B 5IBUB 1KLGB 4LLMB 3KYOA 1D9KA 2VZTA 4HWZA 3QPXL 3ULUC 3VWJC 4Z7VB 3GBNH 5DGRA 1AJ7L 1GGIL 5KVFL 2VZVA 1QNZH 2YOCA 4LSPH 3TVMB 2GSGB 3S3PA 5JIHA 1C12A 5DDHB 4LNRA 3GMLB 5TF0A 3EYQC 1NSNH 2BRRH 2VDRH 1F6FB 5T1KA 1NFDF 4Y5YA 1A6VH 4PLKC 1UB6B 2EE3A 4ODHH 1VPOH 4P9MH 2OBGA 5J1AA 4OLYH 4I3GA 1RJZA 5CJ5A 4UT9H 1A64A 1UEYA 4G8GA 1HSAA 3QISA 4R7DA 3OKMB 1DSFH 1WFTA 2IQ9L 4R4NC 5FUZL 4PTTB 2DYPA 1BP3B 2NY5L 1LO3H 1Q9OA 1NANH 5JR1H 4OGZA 5DEGA 3UC0L 1X5FA 1U91A 2ZWLT 1DUZB 4P5MB 5IBTL 1Q0YH 2B7DT 4DAGH 3MBEC 1F8TL 5KSBE 5DRNB 4PJ7F 4OIAA 1IGIH 3LOWA 3QEQB 4HJGA 3D0LA 3VFRB 2G60L 1CG9A 1FDLH 2GSIB 1E27B 3D0VB 4U4BA 1UJ3C 5I1DB 4CMHC 4KI5C 3LEYH 4JLRB 1FO0A 3UX9B 5D1XA 3KXFD 5D7JD 1MHPH 5EIVA 3RDTC 1NGXB 4ZUSA 4OCNC 4TUKL 4M7KH 5HHMB 5IMKB 1LMKA 2NLJB 3T0DA 4Y19E 2C1PA 2NY2B 3HI5H 1JCKA 1XH3A 5CCKH 3ARWA 1T21A 2P8MA 4NKOB 4UMGA 3RVXD 4CN1A 1RZJC 1XGPA 4AT6A 3FT3B 2YZ1A 3GI9L 3HPJB 3BSZL 3FN3A 4JZOB 1MFAL 2V2TA 1UWXK 4KY1L 2RQ8A 2NY1D 4GAFB 3HUJB 5F96L 2IAND 3C8KB 3EO0B 5GJSL 3O6FB 4WDIB 4N9GB 1M05A 4XNZB 3THMH 4CBPA 1AGBA 1ORQA 2CUMA 1JJUA 4NWUL 5EU6B 3U0WH 3UTTB 4HWUA 2F15A 3V0WL 3U9UB 2CIIB 1NGYA 3EJZD 4DCQB 2DM2A 4YQXL 1EEYB 4KI5F 4D9LH 4XMPH 3GNMH 4I48A 4PJCB 4Q0XH 3B9KA 4I2XB 1F00I 2VDOH 5KS9A 4KK9D 4NNXA 3P0VH 2V9TA 3QEGL 5E4IA 2X41A 5KN5A 5C0RL 2B4CL 3O4LE 4MGXA 3VFSB 4IOSD 5T1MB 3FQUA 3EZJB 4MDIA 4XWGL 3WFCH 2VRAA 4MNHA 1V05A 1MHCB 4NWTH 4UNUA 5E2WL 4WUUB 1A6UH 2V9RA 3CIQA 3TYFB 1BREA 2WP3O 4G8FA 3TVMC 1L7IH 5EO9B 3ARFC 3VXPA 2JCCE 3WEXB 2EIZB 4YZFF 4HX1A 3U2SA 1FPTL 3T0BA 5LWYL 3FJTA 4LVHC 3MLTA 3V6FB 5D7IF 1RIHL 5DVNA 1XT5A 1AI1H 3OL2A 3C5SA 2BHZA 5GRYA 4L5FL 4HG4K 3FQWB 5TJWK 1QRND 2P5WA 3PWVA 2DM4A 4OAWB 4GOSA 2IANA 1JWSA 1HILB 4D94A 5KSAC 3GFUA 3Q6GH 2DQFB 2F74B 3DO7A 2ITCA 3BZDA 3RWHA 1DBML 1MHCA 3X13A 3P9MA 3IXTA 3BESR 3VXRB 4OCRH 2CJUH 1WSST 4QCIB 3WS3A 3ZE1F 2DQEL 3FRUB 3GSUB 3O2VL 1DBJH 2XN9D 1Q9LA 2CDGB 2WNGA 1Q9WB 4V1DA 3S97C 4ZUVA 3MRGB 4I4WA 1CD9B 4O2EA 2NXYC 4LCCB 1OTUD 3WFEH 3SY0B 2BOBA 5BO1H 4IM8A 4WFGE 3UDWC 3LD8B 1QLEL 2EZ0C 5CGYD 4N0UB 4NO0A 4NKDB 4UILL 2VIRA 2PR4H 2B1AL 3DYPA 4WHTB 4YXKL 1YUHB 3RDTB 4N9GA 1YN6B 3HAEG 3H6JA 1IM9B 3DI2B 4KKLD 2AK4D 3SGDI 3J8F7 1TVHB 1K6QH 4AMKH 2W9EL 1ZLSH 1CQYA 2UZYB 4NQUA 2I9LA 1YY8B 4KU1A 1U3HD 3QUKA 4JFQB 1U2CA 3O2WH 5C2UB 4JHAL 2HJFB 5DJ0B 1QRNA 2P5WD 2NY0D 2H1PL 1A6WL 2OL3L 4HC1A 2CRZA 4G6ML 3KPRE 4XNYH 3U1SH 4CMHB 3QUYD 4KUCD 5TGBB 3RNQA 4LLQB 3WFDL 1KT2B 2OJEA 1WFOA 1IAKB 4XNXL 3ECBB 1Q94A 5J56B 2X1XR 5ADOL 4F2MB 5F3HB 1FO0B 5ID1B 2H26B 3ZTNL 4CAGA 3F65A 5HHOE 4GKOA 3VE0B 1OGAD 4WI5A 3HG1A 1L6ZA 2B4CC 2NY6B 2DQIL 3X14B 5D6DA 4PP2B 4GBXC 3MGTA 4AH2A 3ARFB 1SYSA 1ZHBB 1AXIB 1T66C 4G6AD 1CL7L 5EO0A 3LN5B 43C9A 4JPIA 1IQDA 2A6JB 3I3BA 1TENA 3FONB 1P4IL 1DQMH 4Y2DA 3VG0H 2AK4A 4Z7VE 1SJHB 2JIXA 2FIRT 3N85L 2FECI 4C59B 3P40A 1BFVH 3FB6B 4XBGA 5L6YL 4U1NA 5HY9B 4IRZH 3U79A 4LRNL 3C08H 2AK1H 5F3BB 2YS4A 5JQHC 4O02L 2GKIA 4QRRE 1FIEA 4M03A 1VB9A 1RUML 2IAMA 1UH2A 2IGFH 5F93C 5KSVA 4ISVB 1T0PB 4KVCL 4DGVL 2MSPA 5JO5A 3B6SB 4LQFL 2ZOLB 3MRRB 4H5SA 1C5CL 3L3JB 4JR9L 4ZO7A 4XC1H 1BFOB 5J6GA 2QSCL 4AENB 3J7HA 1FYTE 3LKSA 1VFAB 3FO1A 1MNUL 5I71B 2X40A 2DLIA 5D5MB 2CKBB 1F13A 1RHFA 4K71B 4LF3B 2FX7H 1CE1H 5C07D 1ITBB 5T33H 4O58H 1ZVSA 2IMMA 3CPLB 2XZAL 4FQXA 4BK4A 5GS1A 5KVFH 1OP9A 2XWBB 4ISVA 3AVEA 3MACL 3FB7A 1FL3A 1YEGH 5GSRA 3UJIH 4WIQA 2Z8WC 5JHLL 1X5LA 2DF3A 3MA7B 3FB6A 4XBGB 1AQDA 4WW2F 4ODHL 1OF2A 3P4OA 4Z9KB 1JZ6A 3EYUL 4AEIL 4L9LA 4UOW1 3MXVL 2JJSA 1D5XB 3CMOL 4LK4A 2F74A 4MJIA 1S7UA 2Z31B 3GSRA 2F54E 1EGJH 3GKZA 1LO4L 3TYGH 3MLWL 1AD0A 1TMCB 2NX5B 2P5WB 4PJXA 2R0WH 4MJIE 2Y25A 1GRWA 1YMME 4RSVA 4LGPB 3BT2H 1GGBL 1W0WA 1FCCA 5GS3A 4X98A 3QI9D 2HRPL 4LSQL 2XICA 4OGYH 5D7IB 5DTFA 2P1YA 4LSVH 1BAFH 1JNNH 1CFTA 1FV1A 2QTEA 1PW3A 2Y9RT 3QEUA 4UB0L 1K3IA 3ESVF 2K1MA 4L1DA 3VH8A 3U83A 4LLWA 4ODTH 1A21A 4M3KB 3KPMB 4KRNA 5DXWA 1JN6B 3PJSB 4X5XB 5JORB 3VFSA 3LS5L 3UTZA 3ZDZF 5L88L 2OI9B 2DIAA 3HZKB 4PRPA 3R1GL 3BP7A 3RHWF 5DZOA 4FFVC 2ZJSL 4MWFA 4P2YA 2E27H 5C3LD 1BVLB 1G9MH 1SMAA 1XF2B 4N5ED 1RURL 3D25B 5DMIL 3RY5A 4NC2B 4JM2A 5B22A 3TN0A 1UFUA 2WBKA 3PV6B 5IQ7L 2H45A 2F53E 2CO7B 4L4TE 3ELAT 3RWGA 4O00A 5T3XL 1P7QB 3GSXB 5C8JA 5C0CE 4FG6C 4D2NA 4GAJH 3CFEB 4NQCA 1ONQA 2QEJA 4E9LA 3TBWA 2CSPA 1G0XA 4ZTOH 5ETUA 4KHXL 4ZYKB 5H35A 1INQA 3T2PA 2APFA 2YRLA 3FTGA 5SWQB 3EHBD 5E8OB 2Q76A 4WO4C 4YHZL 5B4MD 3V79C 4U1GB 3IFLH 3QI9A 4XNZC 4HT1L 5C86A 1WTGT 1JMZA 3V5DA 5KAQF 1LO3L 1Q0XL 1XGYL 2VL5A 3KYKH 5EUOF 4PJ5E 5DVKA 4ZAKB 3I9GL 3S3SA 1MREL 3STBA 5AD0A 3AY4C 3OKLB 2WZPD 4IRSB 4U49A 4URTB 5GRZA 1FYHB 4ZSOB 3VXRA 4ZO9A 1UM4H 2CQVA 4XGZA 3K4AA 2HWZH 1CDUA 4KMTH 4QT5B 3RWDB 4OJFL 3NA9L 2R39A 3SKNA 3QQ9D 1PG7X 5FKAB 1DVFA 5TE7L 2OK0L 5I1DA 4HGWA 2E7LC 3T8XB 3VFPA 5HVHB 3VFRA 4XVSL 4A6YH 4RMQA 4K3JL 2IF7A 5C0GA 3TN0D 4KJPC 2WWKT 4GRLB 5C09B 4L3AA 4LARH 2R4SH 3MLTB 2HP4A 1U58A 4YHNA 5LWYH 2PW2A 3SBWC 1D5MA 3O2DA 1KB5L 1IGCL 1QZ1A 4DFIA 3IU3B 3SGJC 1H15B 1S7XA 1C7TA 3W0WB 4OM1L 2R1YB 5H2BB 1IGFH 1MLBB 4ELKA 3ULUD 5DS8B 3QAZB 4YHML 4DUWA 1OF2B 3P4OB 5ANME 2E5EA 3SBWA 2X4SB 3ZKXB 1F4XL 4YFLF 2WQ8A 1BD2B 5E6IC 1PD6A 5EFIA 4YHOH 1K4DA 5F9OL 4TYUA 2GW5A 1PAMA 2JKXA 1C12B 1JF1B 3RGVC 5ICZB 5HGAB 2ZSVB 1JHLL 2YD2A 4YIQA 4P3DB 3GNML 2UY7A 4HKXB 2YPLB 1FJ1B 4Q0XL 5GGUA 5AEAA 3TVMD 3V6OC 3MLSL 1JFQL 1CFBA 2WINA 4MJ5A 5DFVD 3QXTA 4YHIB 2BSSB 2BVTA 2OI9C 3OSKA 1NQBA 4FABL 4OKVB 5HDQL 4HXBL 2ZUQC 4RISH 4NBZB 2ADGA 4G80B 4NFDA 2HH0H 3IFOA 3W11D 3ES6A 4BSWB 1U0QA 3CLEL 1KUMA 2VE6A 1A6UL 4Y5YC 4UINH 1U8LA 1FAIL 1M1SA 4MCYB 5LBSL 4O5LH 3O2WL 5INCA 2FD6H 4P3WA 4EVNB 3LMJL 1DE4A 3GRWA 4PJBF 4MA3B 3V8CA 5D1ZA 5T1DH 4AM0A 4G6MH 1A9BA 2LU4A 4QXUH 1NMCC 2I27N 3AREB 4WFHE 4C4KO 3BPOC 4DJMA 3WFZA 3UYOD 4HS8H 4JE4B 5CSZB 4N9OB 2MQ3A 32C2B 3GMQB 2A9NL 2GEEA 4U1GC 1X4ZA 4KK6C 5I66A 4OLVH 1QR1B 3X11B 3FAWA 3MRJA 4PG9A 3TFKD 3P77A 3BGMA 5EORH 4X80L 5I1JH 1SM3L 4XP6L 1UB5B 2IEPA 1TDQA 4OIIH 4CN4A 4P2OC 1WFUA 4L8DA 5E1AA 3G5ZB 1FGVH 2W0FB 1MJ8L 1RV6X 1YEEL 8FABB 1RK0A 2X1PA 3WNLA 2C4FU 3H9SE 3VI3E 5LAXA 2XZZA 1DLHA 4UTBL 4Z7OF 2NY4D 1LVEA 3LKPB 2P5EA 2EH8H 4DKFH 4HWEH 2W9DH 2A74A 2RIKA 4CUCA 4OLEA 5JLZA 2XWJB 4ODSL 4AIZB 1MRFH 3KWWB 3KHOA 1HYRC 1ZHNB 1NAKL 3PG2A 1LNUA 3BZEB 1FZOA 3GM8A 3W82A 5L6YH 4ZG1A 1CFVL 5C0JA 3WXVL 3SKMA 2MWCA 2ICWJ 1YY8A 2DLTA 2IPKA 2GT9A 2CLZB 5ALBL 1MIEL 3B8SA 2BNUB 3E2HB 3P30H 4MCZB 4LIQE 4X6BB 2H2PD 1CYGA 5DK2B 3RDTD 4HKXA 4GW5A 5IKCB 5F6HI 3ILPB 2R0LH 3U7YL 2JB6A 4JFXB 4OD1L 3T04D 4HS6A 1WQVT 2ZUXA 4GBXD 5JIPA 3MV7B 3RY6C 5ESAA 3EDJA 1D9KD 5GGSB 5T33L 4X9HA 5ILTH 1NJ9A 32C2A 1FFOB 5BV7B 1IAIH 3FQRA 1MCOH 3MRPB 4K94H 5F9JB 3MBED 3REWA 4QHKI 3KNBB 4ZD3L 4RMRA 1HDMA 3IGAA 4JFED 4YO0A 4GRMA 1PG7L 4JCMA 1CL7H 4L4TD 3G5XB 2BP3A 5I0ZA 1Z0MA 3HFML 1IGTB 1KACB 3M8OL 4GRLA 1IGML 4KUZL 1IVLA 1KJMA 5C09A 5C0CD 5J0BA 4OAWA 3IXAA 1J5OH 1MJJA 4R8WH 2WWMC 1CDBA 3ZSTA 2BZDA 5IEKA 5IQ9A 5FDWB 2I60H 3UO1L 1DVFC 3GK8L 3EAKA 1H0DB 4FQJH 4LFHD 5DRWB 4MJ5B 2HRPH 4LSQH 1MAMH 3RTQC 2H32H 1Z9LA 3IJHA 4DGYL 4HCRA 1XCQA 3OKLA 4Q2ZB 2J4WH 4Y5VA 4ZFOA 5CS7A 4C55A 3WN5B 4GQ9L 3QULB 5L2JB 5DJDB 3CSBA 1NLBL 3HLAB 1XGTA 3IF1B 2X4RA 1I1AB 1IAIM 1MNUH 5HHOA 4MDJA 3O6ML 3H3PL 4BZ2H 5DT1L 4NJAH 4P2QE 3T0AA 3QEHB 1BD2A 2FX7L 3RI5K 1QA9B 1MCKA 3QDJD 1BLNA 2E27L 2YD9A 4NNYA 1A3RH 3P4NB 3T2OA 4OCXL 3C9NB 1YMMD 3OAUH 5D2LB 3HI1B 1EUUA 3QXDB 5GISH 2XKNB 4NSKB 3MACH 1BZQK 3O9WC 2OTWA 2WV3A 4JDTH 2DOCA 3PGCB 5ACLA 5K93A 1QFWL 1BZ9B 1V7NH 4KZDL 2R4RH 4F15B 2P46B 4NCDA 3S36L 5K59F 4YNYB 5IHLB 1CFNB 1DBKL 2DQJH 2ZKHH 4Z5RB 4BFBD 4G6KL 4OFPA 4EQ2A 4NKOA 5FV1L 5K9OA 4Y4KA 3BP7B 4UIKL 1IGTA 3HNSL 5C9JB 4QXTA 1MCEA 2C1PB 5C07E 4TULH 3QDMB 2IG2L 3R06B 1XIWB 1MJ7H 1S7VB 3JWDH 4XCYA 1AO7B 3QP3A 2UWEF 3EOYG 3K7UA 4OZFA 5D1QC 4D9RD 3BEVA 5HI3D 2JTDA 4ZFFA 1H8OA 2IQAB 2DQGL 2O93L 4GG6E 4ZAKC 5GZOC 4MAUH 4W81A 3QRFM 3GHBL 1FZJA 5FFLA 4LVHB 3O4OC 1W0WB 2UYLA 2NW3A 1OGAA 1FNAA 2ZUWA 4OJFH 4WTXA 1QNZL 4XRCA 1CG9B 1LDPH 3HR5B 5GJTL 4GKSA 3H9HA 2CGRH 1KJ3L 2OX5A 3LS5H 5IW1A 5E8OA 1HEZB 2VLRA 1INQB 3HCVA 2XACC 4OLWL 4XP1L 1NBYB 1G9ML 4LIQH 2LVCA 2DYPB 3LDBC 1NGZA 1IAII 3S4SB 5ICXB 1IGCH 4N0RA 2DWEB 2VXQL 2XQYG 3NPSB 3RKDD 2D7TL 1CT8B 5D5ME 3L3IA 3F7VB 1W72L 3PGFL 4GAJL 5GPRA 4EEEA 3VA6A 3Q1SL 4NZTL 5BV7C 4U2ZA 4G8IA 5F7EH 2NY3C 3HRZB 1QOKA 4WHDA 1TTGA 4LNRB 3RUGE 5I30H 3PDOB 1WVZA 2XQBL 4P4RB 4FZ8H 5F1SA 1RZ8A 4LKCA 4U6HB 5JDSA 3F12B 5FYJH 3RWFB 5L2KE 4P59H 5JXAL 4YGVB 3F7QA 3PIQA 1TFHA 4HPYH 3HC4H 2X1QA 2DWEA 3P0YL 3MV8A 4OLUL 1T89A 4BZ1L 2R15A 2B5IC 4PRHE 4TNVF 4ZQKA 1NUNB 1EIBA 2IAMC 4M5YH 1WF5A 3JXAA 1IM3A 3VA2C 4LBEA 1YN7B 2VLRD 4HBQA 1IAOA 1QFUH 3KLHC 1YMMB 4XNUH 5SWSB 4PRDB 2YHGA 4JDVB 3O9WA 1NSNL 5D1ZD 2AV7B 4KQ4L 1KIPA 1PKQA 2G2RB 4H8WC 3MUHL 2VLKB 4XXCA 1KPVA 1R5IB 1U3HA 4JY6A 3KYNB 2AXJA 3LPFA 1A2YA 2GITA 3ROLB 1CXHA 3LMJH 1UEMA 2R1XA 1JYNA 4PGDB 5CP7B 1DSFL 1X4YA 1MCDA 3SDDB 1AO7A 1IBGH 3BDYH 1SYVA 4JRXE 3INUL 1NEZG 1UM6L 2Y1VA 2Q20A 1N4XL 4GBXB 1GL4B 1QLRB 3NCBB 5KVGH 1YC8A 2EC9U 1XCTB 1U8KB 4YQXH 1FIGL 2J8UA 2Q1EA 5EWIH 4OKVA 1T1YB 2H6PA 1S9VB 4G9FB 5IHZB 4MQTB 4LU5H 3D9AH 3ABZA 4YNYA 1QLFA 1NFDB 4OTXL 3ECBA 5A3IC 1MFEH 3RNQB 1KG0A 1S9YB 2VXTL 1T1ZA 3V7AG 4X6EB 3RGVA 3DBXA 4QY8B 3P4MB 2FSEB 4NUGH 1FC2D 4RX4A 4MJ2A 3H9YA 5IB4B 1MCBA 4ZUWB 5E08L 5JNYB 1L7IL 4U1MB 5D2LA 3GSWB 3LY6A 4Z7UB 3TF7C 4G6JL 1DANT 3Q5TA 5F7MC 4S0TD 3BXNB 4FFWD 2X4SA 3DIFA 3CSPA 3W5NA 3K4ZA 3GSNA 3PWPA 2BERA 5HHOB 3U4AA 3PWLA 4WHTA 3RDTA 5EC1B 5D2NB 1LO5A 1R3KB 3IDNB 4YHLH 15C8H 4Y0GA 3HCVB 2OYPA 3L3OB 3MGOA 4OZGE 5C0AB 4WTZA 3A67L 4N8PA 3LN5A 5DC0A 1J0HA 3ARQA 3BKJH 2FR4A 4KY1H 4X5WB 4ZDHB 4Y5XB 4YDVB 3ZYOA 5H94A 2XNAB 4LHUA 4BQ9A 5GJSH 3HE7D 4TTDC 4WI7A 2J5LC 4H25B 3K8LA 3X14A 4JFOA 4KDVA 1Q9WA 1ACYL 3VXTA 5TH2B 4ZXBA 1VGEL 5F9WC 3AS3A 2CK0H 4RBPH 1FQ9C 2E8ZA 3MBEA 4CVXB 2X70B 2IBBA 2X4QB 4MXWH 1DVFB 1O5DT 3WDIA 1MVUB 4HMEA 5HHVL 1VADB 4DGIL 4X80H 3ULUF 4JREB 3DX6B 3QFJE 4YFDB 3ZSSA 3DHMA 2NZIA 3KJ6L 3EO9H 2R23A 3DO7B 2XRAL 3QNYB 1Q1JL 1KN2L 1TQCC 4FQXD 1HILA 3NPSC 2FX8L 1RZGA 1ZT4B 1QLEH 5EU3A 1K85A 1URLA 4XCCH 4XI5D 5JUEL 1BQHA 3SPVA 4P48A 4S1QH 2YRPA 3A6CL 4Y1AA 3UBXB 4MYWB 2G75A 1G6RA 4RFNB 3H8NA 3F6IA 4XCNB 5KAQG 5IFAL 3CGTA 3HFMH 4Y1AE 4FN0A 4IS6A 2YA2A 3ULSB 2X9WA 1LWRA 3QHTC 4HIJA 4H1LB 2Q8BL 4Y4HB 4LCYB 3G9VA 5EU6E 2XKNA 4WHYH 1N6VA 2ATPA 5IIEA 3GZKA 1I8KB 3B9AA 5C8JB 1BGXL 5BRZE 3D18A 2P7TA 2CLRA 5DEFA 2WBJC 4FTVA 1KLUA 4GUPA 4LHUD 4PB9H 1J0KA 5EOCJ 3QDJB 3TCLB 1JTOA 3VD5A 3VRIB 2HTLC 4NKIH 3NIDF 4OV6F 2OXGA 2ATKA 1DJSA 5IJVB 2FEDC 4MHHI 2DI8A 3LKOB 4X7SH 1J12A 1S7TB 1NL0H 2WUCH 3EZ8A 3MZTA 3QEQE 5DSCA 3G6JA 2GI7A 4HGKC 1G7JB 3MRQA 1DEEB 1VEMA 3SJVA 5ITBL 4NJAL 5GGQH 3BWAB 2CDFB 3MRMA 3T3PF 2WP3T 2HVJA 2HJKB 3HI6L 4YC2B 4DKDC 1IE5A 3T0EE 2AJXL 4HKJB 4OB5L 2FB4H 1JK8B 1UCTA 4CJ0A 1HHJB 3FQNB 4K94L 4QTIL 4XHJC 3I02A 2MCG1 2FRGP 3GJFB 5JW4Q 5ALCH 3BN3B 1XH3B 2X1WL 1YYML 1MH5B 4EIZC 1K6QL 1CD0A 5F70A 3VGHA 3ARPA 4PJIB 1ZLSL 1IGMH 4IRSC 3MA9L 2JJTC 4KUZH 1RAMA 1B4RA 5I1IL 4JDZA 4YAQB 5MEOA 1NCBH 1O7VA 35C8H 1XGUB 2VAAB 1FAKT 5D1XC 3RVVD 5E2VL 4P46B 3DTXA 4WHYG 5E2UH 5DJ6A 2VZSA 5ISZD 5CIPB 1NJ9B 3QDGE 4QRTB 3ULVD 3U1SL 3MBEB 4K23L 2A73B 1JGVH 3CLFL 3BKYH 4FQJL 1QVOB 1FG2B 4NRXB 4I48B 4PJCA 3DX9B 5LGKA 4LCIH 4QF1A 5DHVH 1BBDL 1XMWA 2BSRB 3TPUA 1VHPA 3DVNA 4KGLA 3MRLA 5GRWA 4PJCE 3U9UA 1U92B 1Q9OB 2BX5A 3LN4A 1OGTA 4CGTA 5T5FL 2EE2A 3SGKA 3GMPB 1QR4A 3OR6B 1BFOA 1RUQL 4MNQD 3GSOB 5CLTA 3HUJA 4TNVK 2IFFH 1MFBL 4H5SB 1LGVA 3I2CL 5HI5D 1A7PL 1JL8A 4PJ5B 1I9IL 1C5DA 3ALPA 3EJYC 4RNRB 1CZ8L 4TVPL 3WHXB 3VXSA 3U0PA 3OAZH 2VXSL 2NY7H 4MXQC 1EGJL 1U36A 3GMLA 5DJXB 3VMOA 4LHJB 1LEIA 1LO4H 2WBJB 3VMPA 2E9IA 3RL1B 5E1HB 5EBMA 3NIGF 2X4NB 3BIKB 3Q2CA 4LRNH 1GIGL 3BT2L 2JJUA 2J7LA 2BNQE 4NZTH 4XC3H 1I8LA 3F7YB 4S1DC 1KC5L 4WUKL 2R9HC 1NC2D 4LSVL 2HFFB 1CGSL 3FHQA 5EC2A 4DGVH 3L3KA 1BAFL 1DL7L 1AGFB 4J7RA 3BPNB 4P5TC 4D3CL 2BNQA 4N8VG 2YEZA 4FZ8L 1U8KA 1CFQA 4TULL 3VCLA 5IB1B 4GBXA 4RFOL 3BD5A 4KI1A 1CE6B 2X5PA 4KROB 4UT7L 3T4AA 4PRBA 5F1NA 3GMQA 3NA4A 4HC1H 1BZ7B 4PGDA 4TPRH 3EFFA 5D7SH 1LE9B 3RVTC 5T3ZE 5MEPA 3GMRB 1DUZA 4J12A 3MOAL 4K3DL 3UYPA 5HGDB 1RURH 5JHDA 1BD2E 3JV4B 3HZVB 4U1SA 4FOMA 1QFUL 5DA0B 3ARGB 3AREC 4JN2B 1KCSH 4TTGA 2LU7A 3TBYA 4F7PB 1N2RB 1YNLH 4ODWB 1IT9H 1HHIB 1A6ZA 1TZHA 3JWOH 5JHLH 4NYLB 1OTSD 4F9PA 1EVTC 4KZEH 1U93A 2EC8A 1L0QA 3OKKB 5B4MC 3QIWC 3HZYB 5J9PA 4KHXH 1HH9A 2DQDL 1FVDA 2CXGA 3FFCB 3IDIA 1JPST 3N1PC 4MNGE 4RGNE 4YHZH 5EO1B 4ZAKA 4NC1E 1IBGL 1RJCA 4QO1A 2WINB 5CGMA 1W72H 3LKRA 4S1RL 4HAGA 4OUUA 3SKOA 3HPLB 5FF6A 3KYKL 3Q1SH 5C07A 1FIGH 5HD8C 4NZUL 2QQNL 5DMKA 5I75B 3ORJA 3GIVB 3QQ4B 2CMRH 2ZZUT 1I7UB 5LGHH 4UQ3B 3MLPA 4HIIA 4Y4FA 3AXLA 1IL1B 1SEBB 4HPYL 1I1FA 2AQ3A 4MA1C 2BJML 1BD2D 3ARBA 3N1GC 5IHUL 1CLZL 1HZHH 4KPHH 3VXNA 4M5YL 2UZIH 1QO3B 3QDME 5CZKA 2ITCB 5EU3B 3MJ9H 3QUYB 1VERA 1EA9C 1HXMB 1QYGH 2BHUA 3GHEL 5D96B 1AHWA 4LLVA 2HLAB 3FQXA 3BZFB 4NP4L 2Y23A 1ZLVH 4PJFE 5FCUH 3MZGB 3CDCA 3H9SD 3V6FA 2JELL 1FBIL 1U8QB 1U8NB 2CH8A 4CL7A 4HX1B 4JJHA 3U2SB 5DTFB 3T3MF 4P2CG 3VXTB 3VG9B 1CLCA 3IJYB 1BIIA 5DRXB 3DURA 5BXFA 3TYFA 4P99A 3KPRD 5H94B 1J0IA 3MRIB 1G7LA 3CMGA 1FVEA 1NLDH 1FVCB 5IG7B 1AKJB 3G04B 5EPMB 4MXWL 3VXQA 2XFXB 5HHVH 2Z31A 5AYQA 5MP6L 4Y1AD 1BX2A 1LO5B 1R3KA 1WZKA 5D2NA 1ZHLA 2ZUTA 3KJ6H 2BNRE 4WFGD 4Z95H 5LCVH 4JFYA 4YXLL 5M94B 1QQDA 3NA9H 4KKCD 3NTCH 4PRHA 4HXBH 4RWHA 4YDKL 1B6UA 4RISL 1NFIA 1XGQB 4K94C 1WCBA 4TRPH 1ONQB 3CLEH 4NQCD 5E2TL 4UINL 1P7QA 3GSXA 1F2QA 1U95A 1S3KH 5FA3A 4XB7A 5ABDE 5GS1B 1PY9A 2CXKA 1KEMH 4O5LL 4RQQB 4KROD 3DRTB 2FD6L 3P4NA 4EI5D 4WHCA 3C6LC 1FZKA 2GJJA 4J2XA 4PLNC 3AB0C 3QO1A 2NR6C 2E7BA 2WLYA 5E5RB 3OZ9H 3T77B 1TETL 1F4AA 1AH1A 2HTLD 4ZTPH 5IBLC 1TQBB 3I75A 2I26N 3UTZB 2P8PA 4F8TA 1FVCA 3RZWA 3VXRD 4NKIL 3WNOA 1WITA 4K3GA 3EO1B 5CIPH 1C08B 2WBJD 4B41A 4Q74A 4PJEA 1SM3H 1RK1A 5D7IE 2WUCL 2PXYD 3LB6C 4HJ0D 2JJTA 4JHZA 4GT7A 1YEIH 4NYLA 5D7IA 4F15C 2VWEE 3D0VA 5ITBH 5BJTA 5IEKB 1FNLA 1L7TH 1ZT7B 2J1KA 1SMOA 4YXHH 3LEVL 1FRGH 3L5XL 4JZJA 3H0TA 2RBLA 4M4RA 3T2NH 5INDA 4EI5B 1QEWA 4H88H 3Q6FB 4QTIH 2BVPA 1P7QD 3GBMH 5EZJB 1P6AB 3BQUB 3KYMB 4QOKD 3TC9A 5CD3B 5EB9A 1TXKA 3CVIL 5IUSA 2PKDA 5IB1A 4ERSH 3BIAX 3ZYIA 4X6CA 3MJGX 1TJGH 1RJZB 3P30L 4HLZH 3CH1A 5FAAA 4OZIB 3BUYB 1I7ZA 4Y4FB 1QFWM 4M9PA 3CC5A 1HHHA 5E7FA 5A2LH 2R0LL 1U9KA 3U7YH 4QRSB 2WAHA 3RWEA 2BMKB 3CLFH 3TT1L 4TTDD 4YX2L 2FIKA 3OTTA 2WBJA 3WL9B 5JXEA 2NY2C 4Q97A 3TVMA 2OTUB 2VQ1B 3OKNA 5CHNB 4JFXA 4PY8J 5F7DB 3RJDA 3I6KB 3MRHA 2B2XL 3RRQA 5MENA 3IETB 1PX4A 1T1WA 4HQQL 3GB7B 4JZNA 2CLZA 1IAIL 2NY1B 4OBRA 4R0LB 3HZMA 3ZZ1A 3FO2B 3LPWA 1X5JA 1TVHA 1HYSC 4Q9QL 3O3EB 4GMTH 3RAJL 3RBGA 3QFJA 1JUFB 1YZZA 4F7CA 3OR6A 2IAMB 4XX1E 4XPFH 2RHEA 5KSUA 4ZPVA 2KDGA 4I3RL 1E4XI 4JO2H 3DXAA 1AE6H 1JRHL 3TO2A 3OJ2C 3LKPA 4R8WL 1HHHB 4LSUH 3PWPD 3ZE0F 5I1KH 4BSVB 1NH6A 2A77H 4CNIA 5KSBF 2R2CA 5SX5K 1MWAB 4FRWA 4G6FD 4JANA 3OQ3B 3RIAK 3GEWB 4XVTL 5GRUH 1GIGH 1OT1A 3V6ZB 1YECH 5AZ2H 2QV2A 2P4AB 5F88B 3OBAA 1KTRL 1HIMH 4PGZA 4NKQB 4P46A 5E2VH 2NY6D 3P77B 3VFVA 4PG9B 3D39A 2IADA 1ORSA 5JXED 3QHFH 5JZ7C 2HFEA 1VEOA 1CK0L 5AYUH 4K23H 4DFHA 5MEND 4CU8A 1H8NA 1JMXA 2V5RA 3H9SB 4UT7H 5DQJB 3K1DA 1ZT7A 5DD6A 1MCWW 2EDKA 2KQMA 3V4UH 1KXVC 4XPTH 4QRQB 3NGBB 2EEAA 1KT2A 3CUPB 1QFWI 4ODVH 5I9QC 1CICA 3FFCD 1A3RL 5DJYB 1JK8A 3PHSA 5EO9A 1LEIB 5CZXC 5BRZB 3I50L 4PJFF 1EAPB 2E9WA 3QCVH 3EYFA 4Y8AA 1QFPA 4MNHB 2VABB 3C8HA 3CVHA 2NY0B 3ES6B 1KB5A 3KXFB 3O2DL 4E5XB 3S34H 1PG7H 1XFPA 1QBAA 4OCYH 4MDJB 3S36H 4NNXB 1CZ8H 4DN4H 5IK3B 3ZT6A 1A1OA 4UIKH 4P23C 4X4XA 4P5KA 3UO1H 5E6ZA 1KLUB 2V5SA 3QZWA 5ITFA 3IJSA 5FA3B 5GS0H 2R0KL 4D0BA 2E9BA 1NEUA 3W81A 3KPQA 2VDPH 5JOPE 6FABH 4Z0XB 2HMID 3UTOA 2Z93B 3NIGE 3O6FA 5SV4A 3UPRA 4D3CH 1G1CA 1DLFH 3P9LA 1DEDA 1KB5B 3KXFA 3LIZH 4NN7B 1N6QH 4M1CC 1T0NB 4MS8C 1NLBH 1ZWIB 1LDPL 1I8IA 3DNKA 1ZHLB 2VZ1A 4FHBD 1C7SA 5MHSD 4JO1H 1LO2L 2XFXA 4NHCL 1RZ7L 3CDGB 3U6RB 3WIHL 4TPRL 2Q7YA 3C09B 2PW2B 1M6OA 1CLZH 3IFPA 3S5LA 4MJ4A 4P9HC 5T3XE 4U6VL 4XTRC 2XI9A 3OB0H 1HHGA 3MJ9L 1J11A 2JJWA 3MYJA 4WI6A 1A9EB 2B1HH 2VXQH 1E4KC 3EYVB 3PP4H 2QKIA 1DANU 4UAOB 3P9LB 1QYGL 3BAEL 4NP4H 4JFFB 2B0SL 4K3EH 3I6LE 5ICYB 3VGFA 3RZCC 3QRGH 1R3HA 3AS1A 2O5YL 5T1MA 4WUUD 4FNLH 3STZB 4M43L 1PQZA 5ISZA 2UVFA 3IB4A 2JB6B 2IH1A 3ILPA 3VMNA 1NKOA 3SO5A 4YHYC 2Z8RA 1FFPA 1JF5A 5HHOD 3KR3H 3TBVB 5JXAH 4GG6F 5JR1L 1S78C 2GT9B 1K8IB 2KUTA 2R0ZH 3QDJA 3D48R 2DQGH 2OSLA 4PLJD 5KSBA 2P8LB 1P4BL 5ACZA 3FB8A 2AERT 2D9CA 4H8WH 4H0IA 5HYSA 5HYSG 3V6BR 5LGHL 4F7CB 5IB4A 3EO0A 3H42L 3GIVA 1C5BH 5I1AA 4BQ6A 5HVGB 3OPZL 2C4FT 1ZS8A 2NNAA 3Q0HA 2LU3A 2IC2A 2A6DA 4YBQC 4LIQL 5A43C 4F37K 4TUKH 3CX2A 1U8IB 3T65B 5IB2A 4KVNL 2AJ3B 1S9VA 3PWUA 4D9RE 3IDIB 4DEPB 4XPHH 1RZGB 4FP8L 3G6JF 1A7RL 2DMBA 3D39B 3BP5A 3SDDD 4NQXB 1U8PA 1UM6H 1WC7B 4NGHH 4K7PH 4GG6B 3BSZH 3HAEH 4NQSB 2XTJE 1HHKA 4F37F 2JELH 1NC2A 4WFFD 1AFVL 1A6ZB 1B2WL 5EWIL 1N2RA 1LD9A 3HE6C 4HFWA 1OD9A 3JV4A 4AG4L 4MA3A 3ZHKA 1PKQB 3TBTA 4AQ1B 3V0WH 3KYAA 1MFEL 4LSSH 1RHHA 3VFNA 1AD0B 3B83A 2Q87A 3MUY1 4JAMA 5C0AA 1MCRA 3FFCE 4ETQA 1M7XA 5F6IC 1TIUA 3T2NL 4ELME 1BVKA 2VDOL 4OV5B 4P4KA 1IARB 3D3VD 5LCVL 1PLGH 4I0PB 1JUFA 1KCKA 1I3RA 1WAAA 3CZFA 3FCTA 3IDGA 3TJHC 2LAGB 4QHKJ 4U1HB 5IVXE 2LAAA 3MV9A 2OP4H 4Z7UA 4NWTL 5E2WH 2WIIA 4GXVL 5SWZB 1INEL 2PYEA 1DR9A 4Z7UE 4FQXB 4DKEL 1J8HA 2Y36H 1AD9B 2X4TA 4WW1B 2RAMA 3T2QA 5BQ7A 5DQDH 1ODAA 2QQKL 2V7NB 3PABB 2Q8AH 4FMKA 1FL5B 1I9JL 3PWJB 4F7MB 5EFIB 3VJ6B 4Y2DC 4MJ6B 1YDPB 3OZ9L 4OZIA 3MV8D 4YDIH 4O2FB 2Y7QA 3BKML 1G7IA 1N4XH 4X7FC 3ZDXE 5KVGL 3A6OA 1EHAA 1GPOH 3QFJD 4C56E 5ICXA 5IOPB 2YPVL 1X5IA 4FFZH 5JO5B 4OV5A 4P2RD 1IQWH 1KCUL 1DBBL 1ZSDA 1PJ9A 2AEQH 3DGGB 1UM5L 1J1OL 1KFAL 3HE6A 2D7MA 2J8OA 4PJDF 1XGQA 1JBJA 5C0AD 3EYSL 5L2KD 1PDKA 3QFDB 1F5WA 4PR5A 2VXTH 1IC4L 4UV4H 4YEFA 4JFYB 3WNKA 2KZ1B 2YUWA 4XCEA 3LQZB 5E08H 5I19H 1A3QA 1JGUH 3SDXB 2NW3B 1X5GA 3EDKA 2YXFA 5IP4A 4MQ7B 4JDVA 4H88L 5B39A 4IRJB 2DQHL 5C0IA 3VXSD 4HUWA 3TEUA 1AO7D 1UXSB 5CLWA 4PP2A 1CDYA 3PQYE 3MRNA 1TVBA 3D39D 3CVIH 1DBAL 1JNLH 5DEZA 4PGEA 4ZUTB 4UNTA 2P8PB 1U8IA 3UEZA 5C9JA 1K4CB 3T77A 1MY5A 3AROA 1RI8A 4Z5RA 4HWBH 2XN9E 3SO3C 3I02B 4PGBB 3KPRA 5E8PB 3QWRD 4TUOA 4K71C 2FYYB 3VXMB 2OR9H 5HVWA 1I3VA 3TBWB 2JCCB 2K3TA 3AAZB 4XNMB 3V4UL 1CDCA 5I8KH 5E94B 1J05A 5DUPL 3VXNB 2GCYA 4KJYA 2EC9T 1L9NA 1WBXA 3CH8A 1TJIH 2B8OT 5FO8B 3R0MA 3ZTNH 3QXWA 3IT8D 5E2JA 2SEBA 5DVMA 4DOHE 3O6LH 3B43A 4YBLC 4WV1A 3TJEH 3WLWC 4M48H 4XPFL 5IMOB 5JW3L 3NCYP 4RIRB 2IH1B 1RUPH 3SCMA 5B3NA 4CN6A 3HLAA 3WIIH 1AE6L 2VLRB 4FTVB 1GOHA 4GUPB 3QULA 5E6IB 1A5FL 5I1GH 3KPMA 4IOIA 1BOGA 1NCBL 1ZOXA 2OZ4H 1P4IH 1RZKH 3VG9C 4V2CB 4M8VA 2EH7L 3LQMA 3B9KC 3X12A 3ZL4H 1P7HL 3QSKB 1BGXH 3CZJA 3U0TB 2VXVH 4PBVC 1P5VA 3VFWB 2AK1L 3GMNA 4KKLC 2R0KH 2HLFD 3NH7H 1ZGLB 5F6IB 1RUKH 5IM7A 4KVCH 3REVB 3EKCA 2N56A 1XIWA 1ZLWK 2PXYA 4ZS6C 3QDGB 4KTDL 3WS6C 4LP5A 3EYOB 1MCHA 3G5XA 3AM8A 1U8OB 1GCFA 1NUGA 3L9RB 1D5XA 3IGAB 5FYKE 4NCC2 2VDQL 3C8DA 4ODXB 4JM2D 5IESL 4XPTL 5H37G 4NHUA 1Y6KR 4LVOC 5IFJA 4Z78B 1KLFA 1WIPA 3EFFB 4Y19A 2NY3B 4WUUE 4DVRL 1CICC 3CCHA 4PJDB 2EIZA 1VKXA 4Z0XA 5FYLL 4IIQC 3VXPB 3T4AB 3TV3H 2GTWB 3SCMD 3B2VL 2VXSH 4LASH 3QZWB 4WUUA 5DQ9A 1ZVSB 5B8CC 1HE7A 1SVCP 1YYMH 3OX8A 3VRLE 5ACMA 5A2KH 3G5YB 2B0SH 1YDPA 3L3OA 1CGXA 1T7XA 1KTDA 1EFXD 4KRMB 4M7LL 4NQVB 4X8JA 3EOAB 2O5YH 4GW5B 4WGVB 1YPZA 35C8L 2BNUA 4J3XA 3X3FL 2Z35A 3MRKB 2CR3A 2EDHA 3S88H 4LEXH 1A1NB 1SBSH 2D03H 2FJFB 1OTTD 3U0PB 1KULA 2R9HD 3VXSB 4PJXF 3BZEA 1F58H 4M00A 1S8DA 3UZQA 4U1HA 4IIQA 4XNMA 4HUKB 4HBCL 5BVPH 4HIEA 1Z2KA 1IZJA 1DUYB 3P73B 4YFLI 5F44A 4OF5A 4ODTL 2I5YL 1OM3H 2FEEI 2C4XA 3QO0A 5L88H 3P3YA 4NHCH 5B3JE 1FP5A 4HJ0C 3TNMB 5DURB 4KKBC 5IVNA 2GAZB 1ITCA 1BFSA 4HWBA 1I9IH 1NBVL 4PGEB 1D5ZB 4NRXA 4ZUSB 4HFWB 4IMLA 2YMXH 2W0PA 3V6ZA 3OR7A 1J7VR 2IBZY 4HKBB 3N1FC 2RGSA 4JQVA 5JIIA 2W65B 4P2OA 5LKNA 2DWDA 1EFXA 4I18B 4W4OA 1JGLL 2CKBL 1YEJL 2L4OA 3MODL 3DTXB 1F4WH 4PD4J 1IGJA 3DX7B 2AJYL 3CDFA 1CF8L 2NR6D 4YAQA 3QRGL 2X05A 3RP1A 4LP4A 1IAKA 1KC5H 4PRDA 5FYJU 1DE4B 4OCWH 1CGSH 3RFZC 1YEHH 5E99H 5L9DL 1XGRA 43CAB 1Q38A 1GGCH 5DJ8B 1QBLL 3DGGA 4WENB 4Z8FH 3LB6D 4FQ1L 4MNQA 5TFSH 3NCJL 1ZHKA 5HHNA 5EOQL 1IC5H 4LGSB 1MREH 4PJ5A 5KVDH 2BJMH 1PEZA 4R7DB 3ZKMD 5HHME 1P4BH 3GSOA 3MRMB 4P9HL 4ZXBC 1UT9A 3R8QA 2VLJE 1MCPL 4DVBB 4KMTL 1M7IA 4RX4D 3Q48A 4J6RL 1EPFA 1KJ2B 3PDOA 5JLZB 1AIFA 5D93B 4YIQB 4XP9L 1B0RA 2DJSA 4XP4L 1IT9L 2FGWL 4ZOEA 4LCCA 5D4QA 2MQCA 5CZVH 2XXMB 5LAXB 4GXVH 1WCQA 3MTRA 2FWOA 1WBYA 4PJHB 5D96C 4L29A 3RA7H 1UWEL 3PXHA 5I1EL 3DROB 3GSUA 3IDYC 2BNQD 2W0FA 4UT9L 3OKOA 3TP4A 2GJ6A 1ETZB 2QHLA 4G8GE 1U3ZA 2C7UA 3LRGA 2GIYA 2PNDA 5EZLB 1YJDC 4MB4A 2FHFA 1QBML 4P4KB 2FGZA 4G5ZL 4J4PA 5C2BH 3FT4A 1V8HA 1N7ML 3IU3A 4XBPB 1MSPA 4NZUH 1J1PL 3CCHB 4ZNEE 2E8YA 3L3GB 2FATH 3K2MC 2C9AA 1CWVA 1MFCH 3ARZA 1NEZB 1I85A 4XRCB 4CDHA 2AEQL 4OQTH 4KKBD 1A3LH 4L9LC 5FYKL 5CILL 1HN1A 3MROB 1N3NB 1E4WL 2BVUA 4BZYA 3MR9A 5AZEH 1YC7A 3LEYL 4ZFFB 3MOBH 2A1WH 4OLZH 4Z7WA 5FHAH 2AS5M 5I19L 1OAKH 3AUVA 3V5HA 3MLSH 2LQRA 1MHPL 1T5XA 5DF0A 2I9TB 2QR0B 4FABH 4HAFA 3MNWA 3G6JB 5HDQH 1F3DJ 5GS2D 4HD9A 3AC0A 1CXEA 5AD0B 1T2XA 3OMZA 3HI5L 4GO6B 3IFNL 4W6YB 5CCKL 5TDOB 3HMXH 2EXYD 3E2HC 5EU4B 4PRIB 3V5DB 2APWA 5ITFB 4ZPTA 1TETH 1B9ZA 4LLUA 1INDH 4XAWH 1FZMA 1DQDH 1BOGB 5LBSH 4K9EC 4P23B 2YBRA 4OZ4A 3DGCR 4I18C 4W4NA 4A2MA 4HHAB 5GGVY 3UJJL 5IK3A 5T1DL 1A7NH 2GUOB 4NQCB 4NWUH 2PYFB 3RWIB 5E9DB 4HFUL 4B0MM 2BVOA 5I1CL 1AGCA 1J0ZA 1GPOL 1H3PH 4QRPB 2GK2A 4K55A 2HFGL 4JKLA 1MLBA 3IF1A 1CICD 1KCUH 3CFDA 4D9QE 5D1QD 4WV1C 3QEGH 4X6CF 1J1OH 1KFAH 5L2JA 5C0RH 1KPRA 5JPNB 1HSBA 3MRCA 4R96A 1DDHA 4RAUA 2R56L 4UV4L 1IC7L 5GRJL 4TRPL 1GOGA 1UCBH 2W91A 5C0GB 3H9SA 3K4DA 3WIIL 1NUDA 4HUNB 4LEOB 5IWLC 3MV01 1H3XA 3MV9E 5DHVA 3GRWL 3WNMA 1XCTA 4IDJL 2QKIB 4S1DD 1A9EA 1Z6JT 3QHZL 1I8MA 5CP7A 1MFNA 3KJ4C 1HOCB 1KF9B 5IMLB 4O51A 1A4KB 2Z31D 5BV7H 2IANE 1DDHB 3B9KD 5B8CB 3QUZD 4YHPB 1KPVB 1R5IA 4UDTA 4JZJC 3OKEA 5KSAD 4POUB 4OZIE 5A2FA 3GUTB 5KTEH 2IALB 2HT4D 4L9LB 5DZNA 3NIDE 4Y19D 4U1JB 1AQDB 3MLRL 2YPKB 4NNPL 3E6HB 2DI7A 1SEBA 2YD6A 1PSKL 1F6LL 2FZ3B 1K2DA 1AXTL 5IESH 4N90E 4D8PB 1T83C 2APBA 5CSGA 2FSEA 5DGQA 2HT3C 4XZUB 5BO1L 4BH8B 4J8RA 3ARXA 5I1HL 4DW2L 1KPUB 1BBJB 3W2DL 4OUUB 1FNEA 3IETA 3TJEL 3MRDB 3DETC 4X6BA 5MENB 2B1AH 3QIWA 4Z7OE 4JFZL 3ZYJA 4CMMB 4PY8I 4Z7WF 3B5TA 5T5NG 2BMKA 2PYED 1T03L 3U82B 2FJGA 5K9KB 3HZKA 4ZNCD 5HHQA 1J5OL 3PJSA 5JORA 1BEYH 4X8XA 1W8OA 1J18A 2VABA 4RRPA 5HVHC 2H1PH 2EH7H 4JM4L 3WJJA 4X4ME 2NPLX 4MQXC 5J11B 4Y88A 1OVZA 4CADB 2VXVL 2OM5A 3MR9B 1T20B 2PCPB 4YBLB 3WFDH 5DMYA 5KSAA 3S88L 2D03L 3QNZB 4MD0B 4YX2H 4X4MA 3FFDA 5J1SC 1BVKB 4NO2B 5DJCA 4R26L 1GGTA 1T6WA 1G9NH 3BN9D 3SDCC 4HQQH 1NGWB 2YN3A 3HKFA 3TZVB 1MEXH 4M1GH 3FHAA 4P5TA 1MFDH 2AVGA 1X5AA 4OZGF 5FO9B 1TTFA 3BGMB 4BZ2L 5JHDD 5JOFA 2ILLA 4K8RC 4XT1C 4ZQKB 4I3RH 4P2QA 1L4IA 3U30C 2J88L 4HIHB 3M45A 2IQAA 4XMKL 5DJAA 4HUVA 4QHUB 3VXUA 2F54B 4XPGL 5C08B 1X7QB 4O4YL 3PIQB 4XTRD 3NACH 4ESKA 4FQIL 4MMXC 1MI5B 4AM0B 3ZHDA 1AHWC 4XMLL 3F12A 1BFTA 3RWFA 2COQA 1G0YR 4F2MA 1ZEAL 3BVNB 3K46A 1RZKC 4HV8B 4AIOA 1SJXA 2VH5L 2DJ4A 3MXWH 3T0XA 4KZDH 4HUUA 1K3ZA 1B0RB 2EDQA 3C08L 2V2WA 3MRBA 4ZAKD 4IHOA 3ME0A 5B38G 1YEDA 4Z7QE 1DBKH 3CFBA 2YD7A 1ZKAA 3UCRA 4IMKC 4BELD 4PJ5D 2GFBB 5JW4M 3HNVL 1CT8A 1D3CA 3B9VA 2NNAB 4M1DH 2EYRB 3MRRA 2VB5A 4LPUA 4M93B 3RX8A 1QBLH 4R0LA 4YE4L 2VZ3A 1OGTB 4UV7L 1SBSL 3D2UD 4QWWD 1ZHKB 4UUJA 3TPKA 3QXDA 2J12B 5DRZB 3L5IA 4NN5B 1LHZA 5DC4B 1YUHA 1G7PB 1LO2H 4FQLH 5BZDB 1K2DB 3G6AA 5M7QA 5T3XD 4J3VA 4LQ1A 1QKZH 4OZFH 1BLNB 1CTOA 1XGRB 5BS0D 3GGWA 1ACZA 5ID0B 4U1NB 1J0YA 5EA0H 1EDQA 3TIDB 5E8EB 2X4PB 4PV9B 4TSCH 4HEME 1MAKA 4RRPG 4P2QD 4YPGA 3MRGA 1S7WB 2CGRL 1I7ZB 4Y2DB 1NMCB 3QUMB 5EZOL 2CDGA 4HDIA 4U6XB 3VI4E 1FFPB 3QG6B 1YY9C 5ISZB 1HWHB 4OLWH 4XP1H 4QYOB 4R4BA 4PTUA 5IMLA 4P46D 2ED8A 1CD1B 5CJQL 5I1EH 3C2AL 1BHGA 2HJLB 1J8HD 4WI2A 4U0RB 1HH6A 3BQUA 5EZJA 2MNUA 4LMQI 5J12B 3F7RA 3KVQA 2FO4A 3FB5A 5B39G 5M95B 3BE1L 5IR1A 3LSOA 3KR3L 3MODH 1D6EA 3LKQB 4L8CA 3PGFH 4ODXA 3K74B 4JB9H 4JKPH 1ZMYA 3S7GA 3RTQD 3GJFK 2VDPL 4KHTL 4KK8D 2X4UB 4B7LA 1RMFL 5F7EL 2H9GA 4IEFB 3O4LA 2D7OA 2Q7YB 1DLFL 3U46B 2G5RA 3WEXA 1N6QL 2V9QA 3LZFH 1RIVL 2EDFA 1JV5A 5FYKU 3KNBA 2CKNA 4P59L 5L2KA 3ARVA 2H8PA 4OLUH 4JO1L 4TSAL 4BZ1H 4JRYA 1FFOA 5A3ID 4OLZL 1QA9A 1LP9A 2DD8L 1JHTB 3N1QC 4JO4H 1RJYB 3VD9A 2Z93A 1I1AA 3T0VA 3VH8G 4KK5D 3KPQB 1V3LA 3B9KB 3LS4H 3OXSB 4HH8A 2BNRD 4E41E 2C5DC 4JG0H 3KPOA 4XP4H 3HE7A 4WFEE 3HMXL 3JWDC 3H7LA 3VFTB 4LLUB 5IMOA 4KQ4H 1A1OB 3RVWD 1I75A 4MCZA 4UUJB 1UWEH 4Y4HA 3FO9A 2GY5A 4H1LA 2BC4B 4GRWF 3L6FB 3T0ED 1T2QL 5CAYB 1U42A 5E70A 4QTHA 4NQEE 3FRUA 4QRRB 1JIBA 1UKSA 4IOFD 5K9JH 3D25A 1FZOB 4V1DE 2IH3B 5IFHL 3INUH 2VLMD 3F62A 3O4LD 4UT6H 2FJHB 2PETA 1T21B 2P8MB 1JRHI 5D72H 3B9EA 3QJFB 2F8OA 5J6HB 2Z0BA 2J8UE 4GAGL 4MD4B 5EG6C 1MFCL 1CQKA 1UM4L 3BMVA 2YA1A 3HZVA 5HGGS 1A3LL 1FLTX 4NIKB 5MEPB 3RTQB 5C08A 3O3DB 5TE7H 5CILH 5E1AB 4EDXA 2DKSA 3I85A 4Z77B 2NY4C 1OARH 3MOBL 4PJAF 2A83A 3QIBD 1CE6A 2WMPA 2GYSA 4LSTL 3V6OA 1INEH 3TT3H 4QYOA 5H8DA 1XR8B 3NBNA 3S3JA 3S35L 4P5TB 5TE6L 3WNNA 4MZ3A 5E8DH 5EC2B 2AJSH 5MERA 4NO2A 1EJOL 1JE6A 3EDDA 1R3JB 4OM1H 1O0VA 4MVBD 4YDIL 5EOTA 4YHMH 4NGHL 3TFKC 3DIFB 3QNZA 3OKMA 4HK3N 1P9MC 4D0CA 2CDEA 1F45A 2CUIA 4PS4H 3T1FB 5BZDA 5L0QB 3UJJH 4JGJA 3BP6B 4EOWL 2VE6B 3AXLB 4Y8DC 5I8CB 2XWBA 4ZNEA 1OT2A 2IMNA 1C5DB 3KWWA 4NN6C 5A40E 9CGTA 4JY4B 1QSED 4PY7A 4NZRH 2A74B 3BEWA 1PSKH 3VXMA 2OL3B 3KDMA 4Q58C 4LF3A 5FK9A 4OT1H 4I13B 1LK3L 4MJ6A 3CFBB 4RCAA 3GDBA 2ENYA 4NPYA 5DD1H 5AWNH 4HG4J 1J9CT 1U92A 5B21A 1ZXQA 1KN2H 2OTUA 5CHNA 5I1HH 4MAYB 2R29H 3BWUC 1J8HB 4HWZB 4XCCL 3O0RH 3DXAD 3QIBA 1N8ZB 5HI4D 1JGEA 4PFEA 2Y4SA 2OP4L 4X6FA 1UCBL 3UPAA 1CGYA 5IROC 4L3EA 2DKMA 5KS9F 5GRVL 3OKKA 4PG2C 4LLAA 2KH2B 4X7CC 2WSKA 5D71H 2YPKA 1OW0C 4P2QB 4EKXA 2Q8BH 3ARDD 4E42A 4AL8H 2ZOKA 4Y16C 2GJ6D 5DQDL 1BJ8A 2Q8AL 5DLML 4LLYB 5EDXA 5D1ZB 3SE4A 1KJVA 4FFYH 3P4LA 2BCKB 4PJIA 1CU4H 3ULUE 2E3VA 3MNVA 1P7KB 3PGDA 3SEPA 1QSEE 4ZS7L 1RHHB 3K2UL 3G6DL 3JVGA 4FFZL 5BZWB 5EU5A 1QSEA 2Y72A 3D69A 3WIHA 5KTEL 3VW3H 5FA4A 4KTEH 2R1WA 1ZGLP 1UM5H 4NRZB 2AJVL 3O6LL 3VXUD 1GZPA 3DLQR 4PJ8A 2XA8L 5FKAA 4YGVA 3VRJA 4KJWD 3SJVB 1R3LA 5GIRA 1G9MC 1N26A 3KJ4B 4OBSA 4XGZB 1SEQH 1E4XH 4F7MA 1MCLA 1FNGA 3HI6H 4MD5B 2OJEB 2IPTH 5D93C 1QPXA 3BIKA 2WW8A 3KPSB 3RWJB 2X4TB 2OZ4L 2MKLC 1IRAY 4DW2H 4V2BA 1G7QB 5E9DE 2VLKE 1JNHB 3SQOL 5J13B 1NAKH 3VI3F 2DLHA 3EOBA 3WHXA 3R0NA 3ARDA 4BH8A 1CCZA 3ETBF 2VWEC 3RUGA 3G5YA 3WUWA 1NGZB 3W0WE 4P2RA 2BK8A 5I1IH 4JPWL 1MRCH 1BWMA 2VXUL 2FDBP 2Z4QA 2R1YA 4TSBL 1AGEA 5E2UL 3W0WA 4ETQB 4Z76A 5DURD 3BP4B 2NW2B 5JA8B 3IAQA 5HD8D 3ULSA 4UDUA 1U8JA 4YE4H 3QIUB 4GS7B 1HYSD 4HH9B 5J3HC 4EJ1C 2IALA 2OR9L 2HYMA 3TBVA 1TTUA 3IDMB 3SDDC 4OUOA 3MREA 5F7WC 4JY5H 4WU7B 2C3XA 3L9RA 3IDJB 1R24A 5CWSA 1OHQA 2NXYD 5CEZE 2D2OA 3U36B 4WEUD 1Q9KA 5I0DA 5MI0C 3P9MB 1N64H 3O6KL 3DECA 5ELIA 5JW3H 2JCCF 1FGNH 2GQHA 5E8NB 4HCRL 3LV3B 2J88H 3AGVA 1D7FA 4OSUH 1U3HC 4PRNA 5CJQH 2VUYA 4X98B 1CFNA 2P45B 1OAUL 3RTQA 2WUBH 3QB7C 3E3QC 5FYLE 1N6UA 5DZLA 1MLCB 2XV6B 1CR9L 5GGVL 3BP4A 1SHMA 3FRPG 4J4PD 3HS0A 3PWNB 2NYYD 3B5HA 2FJHA 4PJ7A 5DJZB 5CJXA 1I7TB 1ZV5A 3BHBA 1G84A 3ZKNC 1CGWA 3RWGB 2EEDA 3MA7A 3ARBD 1OAQL 1RIVH 2SEBB 4QTHB 2DQCH 3FB7B 3T3ME 3ZO0A 2GUOA 1OM3L 2KBGA 2ATKB 1J05B 3P11L 2ZUSA 4WWKC 4TSAH 3H3PH 1I7UA 4FQLL 2XZCL 1A6TA 5DT1H 5HYIA 3IYLW 4JFDE 4EN3A 4ETYA 4PYGA 1FNGB 4BYHA 4OCXH 1RJLB 4Y16B 1EVUA 5DUMH 4FZEL 1NFDA 2VERN 2XG5A 5D6DC 4J1UA 4Y4FC 4GKNA 2YMXL 3CFCH 2WBWB 2R2HB 2DJUA 3LKRB 4JG0L 2ERJC 3C8KA 1NFDE 1IFHH 2ZCKL 1KIRA 1QFWH 2VDRL 4LDOB 4DN3H 1F90L 4NUJB 2HKFH 2QR0A 5E7BA 4HUXA 2V5MA 4QNPF 3ULVL 1T5XB 4LPYA 4X4YA 1CLYL 1FORL 4J3OC 4OLYL 3SDDA 2DQJL 4Z7WB 1U2HA 1JV5B 3MV11 3DO3A 3H7BA 3NAAH 1CICB 5HI4C 2JIXB 5FUZH 4DZ8A 2PN5A 1NGXA 2EDOA 4OCSH 5ADPH 1CXIA 3BZ4A 4GW4A 5I6XB 4G42B 2VZOA 4U1SB 5IBTH 3O9WB 1F58L 2MHAA 4OM0L 3ZDYF 2QQNH 43C9B 1RMFH 2ED9A 1YMMA 2DWDB 4NC1C 2XTLA 4P9HH 3GHBH 5BVPL 1K8DA 1T7ZA 4L3EB 3EJZC 5D1QA 4ZXBB 1FN4B 1PBYA 3HG1B 5CJOL 4RBPK 2VZUA 4GFTB 2R2BB 3MUJA 5GJTH 3QUML 2DM7A 4IJ3C 4XWOD 4QRUB 2OQJB 3D3VA 1CDGA 4KKAD 5BMFL 5IEHB 1OARL 1P53A 5F9DC 2MJWA 2Y7QB 3C6LB 4U6HA 1WBYB 3SDAB 3N1MC 4NQDE 5EZIL 3S35H 5CZXD 2HT3D 4FTVE 4F9PC 4YK4C 5C0JB 3WDHA 1EJOH 3S35X 2AQ1A 4MAYC 1A14L 3TJHD 3QDGD 1JGLH 1ED3A 3GSWA 4JG1H 2YWYA 3VWKC 3EYFB 1H3VA 5KSVB 3V9FA 1J1XH 2FJFA 3TBSB 5J3HD 3VFGL 3SGEH 3T1FA 1FBIH 3TO4D 3V0VA 1J1PH 3L3DB 4X6EA 2HT4C 3FCTB 5BVJA 4LCWE 5EOCH 2XQBH 1Y18B 4KI5D 1CN4A 4N0CD 3U0WL 1OY3B 1OP5K 4NQVA 1FFNB 2YN5A 3LN4B 4DKAA 3B4NA 5IHZA 2ZCLH 1KCVL 3HC4L 4Z7NE 1KLGA 3HE6D 4BH7A 5FECB 1EFQA 3TPUB 4JFHD 4FQCL 5BS0A 1SYSB 1ZHBA 3ARFA 4HIXL 3SGKC 1UQSB 5DYOA 4MNGB 1TJHH 1SYVB 1IGJB 3M17B 4HGMA 4WRLA 2A9ML 1F2XK 1YYLH 5CSZA 1D5IH 2AAVA 4L4VB 1X7QA 2O5ZH 1G0DA 3CFJB 1OTUC 3EIFA 4N0FA 5D7KD 5JOFB 4E41A 1S3KL 3X13B 3FMGH 4M6OH 5DA4A 4XAWL 4C57C 2AV7A 2D0FA 2CUHA 2DL9A 5CKGA 1GGYA 3ZKSD 4WI3A 3QDGA 5KVEH 1OCWL 4GW1A 4Y4KB 3DSNA 2YUZA 1NFKA 2MPAL 1MH5A 5IJKA 4C56D 3T65A 1A7NL 3QQ3A 4LBEB 2XOTA 3TO4A 1DUYA 1MUJA 3P73A 1RULH 1QBMH 5DJ0A 1X5XA 1EO7A 1HWGB 5TF1H 3QFJB 3VFWA 3K2UH 4K3HA 5C0BB 3RVTD 4UIMB 1EJ6A 5ECJE 5I1AB 2CR6A 3MV8B 2XTJC 1RK1B 4B53A 2HKHH 4OCRL 2YPLD 4F8QA 3I6KA 3MRHB 4IOIB 3UZVB 5CP3A 2EDXA 5C0DA 2R8SL 2WIMA 4LVOB 1OAXL 1AR1D 5GGRY 2O5XH 1E4WH 2J6EA 5C0ND 5GRJH 4JRYD 1HQRA 3WHE0 4IRJD 4QRSA 3LKOA 4CVZB 4M7ZB 1GZQA 3SDYH 5FGBA 1XR9A 2XYCA 4XWOC 5DJDA 1I1AD 5C70A 4AEHH 1RFDH 4WTWA 2F5BL 3CXHK 4U1LB 4YWGL 4A6YA 1BQSA 3GMOA 3JTSA 3O0RL 5GZND 4U6YB 2JJVA 1T3FA 2ZSWA 1WBXB 3D3VB 3IDUA 5H2BA 3QHZH 3W0WD 1H15A 5F21B 1YMHB 1CGVA 1DQJA 4PJDA 3GSVB 3LAFA 1IMHC 4I3SH 4PP1C 5EBLB 4MLSA 4PV8A 1H5BC 3MYJB 3KPPA 5DLMH 5FIEA 4G3YL 3GUTA 2VUOA 3BW9B 1SVZA 3IXAB 2D7PA 4LGRB 1KJMB 5FV2A