3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
4G43B 1HHIB 3QIBD 3D25A 1NKOA 4GMTH 2A9NL 4HLJA 4LVHB 3TIDB 4R0LC 2NLJB 3CSBA 1DVFD 5DRNA 2H8PB 5FOBA 3KPPB 5GRUH 3GSUB 4KKCD 1FDLH 1FIGH 1YEEH 3ALXA 1CK0L 4JVPA 1CICB 5J6GB 1KCSL 4OZIA 5MEQA 2KPNA 5EO9A 3RL1A 3GO1H 4S2SA 2GTWB 1G7LA 5BVPL 4YXLL 3QI9B 2H6PB 1DBJL 2D9CA 4U1SA 1MCDA 4M7KL 1BOYA 1UACL 3C6LA 3GB7A 3LS5H 4FMKA 2VZSA 4JHWL 4X9BA 3SKUD 2ICEA 2LTQC 4K2UL 5FGRA 2R8SH 5D7JD 1JGEA 3VDAA 3BN3B 4NZUH 4DCQA 3KNBA 1YY8A 3CFJB 5I0ZA 3QXWA 3TA3B 3B5TA 5E8NB 1P5VA 4NC2B 2X41A 4NQSA 4BUGA 4E41D 5FO8B 4PR5B 5D1ZC 5GISL 1D9KB 5F21B 4X98A 1A7NH 5B8CA 2CGRH 3O4OC 4ZPVB 3UTTE 2YPVH 4KY1L 3VI3F 4EDWL 1WWBX 3BD5A 3VCLB 3UPRA 2BMKB 4HJGB 5ACMA 1HWHB 1CLYH 2IBZX 4UBDD 1MJUL 3D9AL 4HKXA 3FT4B 4PV8A 1UXSA 1EXUA 5I1JL 4PJ5B 3ZMRA 4P2OD 4KJWD 2R1YB 5DQJB 3U1SL 1UVQA 1B6DA 3QUXB 1RURL 4YPGB 2BNRD 5DRWA 5A43C 3TC9A 4G8EA 1FV1B 1X7QB 4XPGL 4QY8A 3OKDA 2ZOKA 2V5SA 2D0FA 3C60B 3JTSA 4HUXB 1C8PA 1MY7A 1P5UA 1C5BL 4WUUE 1LD9B 3SDXA 2CDFA 4XXCA 5DS8A 3SJVB 5HYJE 1JPST 5A40E 4HPOL 4JDTL 2RB8A 2AK1H 4O2FB 5I1LB 1CT8B 5JNYA 1HIMH 5FF6A 4LVNC 4GXUN 4AM0A 1NAMA 1Q9WA 1N59A 4HUUB 3QEUB 4G8GA 5L2KA 2OX5A 3C5JA 1NGYA 4ZUVB 4NCC1 1OGTB 3QO0A 3VFTA 4BQBA 2X2YA 4YHNA 1KLGB 2VQUA 3KDMA 2DJUA 3GK8H 4NKQB 4D9LH 5AG9A 3FFDB 4YGVB 2OL3B 2Z9TA 4TTDC 2IBBA 2NXZC 5TH2B 4AY0A 5TDOA 3MUZ1 3DX8B 1RZKL 5EU6E 1XGUB 5DK0A 2VDKL 3BHBA 1T1YA 1GGTA 1AC0A 3NTCL 1CZ8L 4MJ2A 4M62L 4NO0D 2H9GB 1PG7W 5GRYA 2OJZH 4LNRB 3TO4A 1U8LB 2OYPA 4QWWD 5HGHB 4D9RD 2OZ4A 4Y4KB 2YD7A 2AS5M 5EN2B 1I8IB 4AIZA 5A1AA 4B53A 2IANB 4OAWB 1P4BH 1YY9C 3C8KA 4KROD 3ZDXF 1IZJA 3CFCL 4HWBH 5HHNA 4BH8A 1EJOL 2VLJA 4DTGH 5CILH 4LHUA 4NCC2 3O9WB 4LBEA 1LP9F 4XCEA 3PWJB 3E2HB 1E4XH 1MAKA 3PL6D 4ZAKB 2BSRA 2I9LA 1QRNA 4XMLL 5HJ3B 3ARGA 1FH5L 4PB0H 2MPAH 1U3JA 1S9VA 2PXYC 1DBBL 5DRXB 4EVNA 4UQ3B 4V2BA 3GMOB 3LB6C 3L3HB 5EIQA 4TNVF 4XVTL 1NUNB 3HPJA 4FQ1H 2QHLA 1DLHA 4WEBL 5JIKA 3MLYH 1N6VA 2C4XA 1TVHA 3ZHDA 2R0LL 3ZT5A 3T0EC 2C26A 4GKNB 3MRDA 3MRCA 1LO2H 3MCG1 3MACH 4X9GA 5IG7B 4X6BA 1NCNA 2AK4A 1JUFB 4Z7WF 4HUKB 3P9WB 4OLVH 2G75B 3I50H 5E9DB 4JFEE 3FT3A 4PRHA 4KTYA 2ZOLA 4F7CB 2R2EB 3OF6D 2HWZH 3UBXI 3SBWC 4ALAL 5BQ7A 2F74B 5D2LE 5HPMA 1JGUH 1Q94A 3FB8A 3WN5C 3MRHA 4HX1A 4R4BB 2J6EA 2VXQH 2WUCH 5MEND 3QQ3B 4LRNH 4N0UA 2QQNL 1XZ0B 3O11B 3JWDL 3OKMA 1U8PB 2ZZUT 3VXUD 5KS9B 1I4FA 3SDDD 5EU4B 3T04D 3V6ZB 2FSEA 4RQQA 2CDEB 2CLRB 3GSXB 4RAVB 4JHZA 1AIFA 5D7LA 2UV3A 3H3PH 4X7TB 1CGUA 5DJDA 4KJYB 1DVFC 3RVUC 1A3QA 2IQ9H 4OFVA 3MJ9L 4Y5YB 4OB5L 1B0GB 1TJGH 1QSFB 5MERA 1AI1L 1CE6A 2Z8WC 2P49B 4KAQL 2EDNA 2Y7QA 4Z77B 5IEKA 1FO0B 1KB9J 1IM9B 2OSLA 4UAOB 5CIPH 2ZJSL 3QHFL 4NNXB 4DGYH 2ADGA 2F8XC 1GHFL 3ZTJG 4F15B 4JG0H 1AGCB 3O3EA 3D39B 2J8UE 3P0YH 1NC2D 4AT6B 3O0RH 3QR2A 1U3ZA 1JYXA 1LO0L 4QHUA 2C4FU 3VI4F 3T0VA 4NQDB 1BM3H 1INQB 1TZIB 3E6FB 2AEQH 4TVPD 4DUXA 5EC2B 1EUTA 1XR8A 5HHMB 1RUAL 3NFNB 1OGAB 4YO0A 1XF2A 4Z78B 1ED3A 2ZPKL 2Y07L 2AW2A 3ABZA 3PHSA 3MCKB 5HYQA 4JGJA 4HUVA 4X80L 3QJFA 1LGVA 4F7MB 1QLFB 3QDGA 4JRYD 2RQ8A 4WDIB 4UT6H 4RFNB 3DXAA 3SQOL 3DUHA 4G6KL 4PJAA 4LARH 3UPCA 3L3JA 3T0BA 4HKJB 4CMHC 4HQQH 4Z7QE 3KJ4C 4QRTA 2EYSA 2HFFB 1SJVA 3ZO0A 5IF0B 4CUCA 2A38A 3CVHB 4M5ZH 4OT1L 4M7ZC 4P2OC 4KJWC 4IRSA 3VGGA 1EFXA 5I17B 4LSRL 2IQAB 4MNGB 1MJ8L 2EDYA 2BOBA 3OZ9L 3WSQL 4Z8FL 3G6AB 1KJ2L 3FT2A 1NCDH 3OAYK 3HFMH 2XXMB 5IMMA 3ELAT 3P4MA 4HULB 1R3LB 3ROOB 2VLKD 1I1FB 3DTXA 4QHKI 4AK1A 1NCBH 3IKKA 5T5FH 1EX0A 3P2TA 1OLLA 3QJHA 4Z0XB 2AJSH 1R0AH 4PY7B 2BSED 2D9QB 1IAIH 3SPVA 5GGSB 5DJ6A 2W07A 4H5SB 3MOAH 1FL3B 2P24A 4A6YL 4DKEL 1KENL 1PSKH 5EIIB 2EE9A 5ABDE 5T3XD 2Y36H 1FPTH 2P7TA 3CC5A 5IHUH 4ENED 3V4UH 5MP6H 4GQ9L 5F6IB 4QRSB 5CEYA 1E4KC 2AJZB 5DRZA 5CHNA 4Z7UF 3NACH 4AEHL 2R1XA 4IOFD 2DKMA 4ZPTB 3WDIA 4IIQA 4RGNB 1BBJB 3HA0A 4GRWH 5INCB 3SEPA 3MLWL 5ETUA 3B8YA 1SYSA 1CL7H 1F3JA 4GRLD 5E8DL 1U2CA 1NLDH 1PDKA 5AUMB 1AGBB 4N8VA 2X4PA 1F97A 4QWWC 4P57B 2X1PA 3CVIH 2D7NA 1GIGL 3BH8B 1TQCC 4D0BA 2YA1A 3ARFC 3EO1B 3FQXA 4FOMA 4ZO7A 3UROR 4N8CL 2ZUVA 1F4YL 4KROC 1YNKL 2YHGA 1NMCC 4OCXH 3RBSA 5SX5K 2A1WL 3BH9B 3PL6C 4TVSa 5DK3A 5FGBC 1D6EB 1AHWB 1D7FA 4UUJB 5F96H 5EDXA 3BFOA 4WWKD 3WEXA 1AH1A 3PQYE 3SGKC 1RUPL 4ONGH 1CXEA 5LJYH 1F6LL 3BDBA 1Z9SA 3NPSC 3WFDH 4FQLL 1KJ3H 4BQ8A 5DI8B 1FORL 3O3BA 2KH2B 4LPTA 5CBAB 5DR5L 2J4WH 2V5RA 4FG6D 3QWRD 4OLYL 5ITBH 1MCWM 1FCCA 3EGSB 1NL0L 2MHAB 2HFGH 3RWCA 4EUPB 4O2CA 3BRDA 3WIHA 2GSGA 3D0LB 2GJ6A 3F12A 3RY6A 4KHXL 5E2VL 2ESVB 1IKFL 1AQDA 2BXYA 3MRKA 2FX8L 2BNQD 2F19L 2KZWA 2DQJL 2BP3A 4BELD 3EYFA 1TITA 5DHYB 4YFDB 4KUZH 2YSSA 1MFAH 2UWEF 5B38G 4MA7L 1LO3H 3FKUS 3DX9A 3PGDA 4MCYA 3E8UL 3TJEH 1U8OB 5DJ0B 1MAJA 3RWIA 1MFCH 4YEEA 1A6PA 1L0QA 1MFDH 5LWYH 2F54A 3H9SE 3VXTA 3HRPA 1A14H 3RZCA 1UM6L 3SCMB 2UVFA 5ENWB 3EDJA 4NJAH 3ARYA 3ZL4H 4ZTOL 3CZFA 2FO4A 2A6DA 5IIEB 1Y6NR 3QFJD 4HXAH 4EN3B 1INDL 1MSPA 1I3GH 3K2UH 1HINL 2RFXB 2Q20A 3Q6GH 3DMMA 4HKBB 3MV9D 4JO4H 3IU3A 1W72L 4W4NA 5J1SC 2HKHH 4QT5B 4FABH 3GEWB 4UDUA 3GMNB 4BH7B 3MODL 4U1LB 1FZMA 1NBVH 1XFPA 3RGVD 4Y5XA 3CJJA 5TF1H 5IJKC 5HHQB 2R29H 2OTWA 3D6GA 3QXUA 5E2WL 4J8RB 2GUOB 4P4KB 4KK6D 5GGSY 4JJHA 3KYAA 3CAFA 5DJ8B 3IDNA 5FXCH 1OARL 1AGFB 4X7DC 1YN7B 2CH8A 3LHPH 3TM6A 1I1AD 3DO7B 2COQA 5CZXD 5KSVA 3KXFD 4KZDH 5KVEL 3QIWA 4PTTB 2DQIH 3G6DH 2FECI 3OKKA 3C5ZB 3FRUB 5T1LD 3DRTB 5GIRA 4U0QB 4F9PA 1XGQA 1IGYA 1KIRA 3MREB 4UV4H 3OR6A 5DJCB 1T66C 2AJ3A 4JVUA 1DQDL 4NQCA 4OLWH 4YXHH 1JHLL 1TTGA 1E28B 1A21A 3CLEH 3HCVA 1I9EA 5KSAC 4RZCA 4NHUA 3KS0H 5FM5M 4JFPB 3KYNA 5FCSH 3TNNA 4Z7OE 2B1AL 2OP4L 4HG4K 4KRNA 2VOTA 2G5BB 3UTTB 5D1QB 4KJQC 4BA8A 5DTFA 2ZSWB 4FZEH 5JORB 3CZJA 3VGHA 1C08A 5JOFA 5HVHC 5EC1B 5GS0L 4ODTL 4H26B 1AQKL 3MMEA 2R56L 2FGWL 5F1KC 1KN4L 3IGAB 4TNWF 1RVFL 4QRPA 3GUTA 3QEQA 5FV2A 4OZFA 1YPZF 1T1WB 1NGZB 2NPLX 4BZ1H 3HI5L 5BRZA 3MXVH 1Q9OB 4H20L 2V2XA 3QXTA 1U91A 1O7VA 2DLIA 4XWGH 2YD6A 1LP9A 3RNKB 2NQCA 3CFDA 4WGWB 3QNYA 4KRPC 4WUUB 4E42A 3Q1SH 2NXYC 5ESAA 4M8VA 5HYJB 1X4YA 1PQZB 3OKNB 3AXLB 1QNZL 4JM2F 2LAAA 1QYGH 4OD2B 3I3EA 4LCCC 1CDBA 2AV1B 4UINH 3MFFA 1SJHB 1KCLA 2HJLB 1T89C 3QUML 3MRQA 3QUKB 3CNKA 4TVPH 2CKNA 1KBGL 2YBRA 3I75B 2W59A 3SE3C 3KLDA 1SBBA 4H25A 4NN7B 3P11H 4YZFF 3BXNA 4J3WA 4ONHA 2NY1D 3DOSA 1Q0XH 5FKAB 1YNLL 4NO5B 3IJSA 5IBTL 3GRWH 2BFVL 4NBXB 1SM3H 3S4SA 4MQ7A 5I1CL 5J0BA 3IETB 4GMTL 5D5MF 1JPTH 2XFXA 4MAYB 2H26A 2V7NA 5GRUL 4C56E 1MHHB 1FYTE 5EU6B 2V5MA 2CR3A 1FDLL 1YEEL 1C12A 1GSMA 4X7FC 4FQ2H 1UB6A 4JJ5B 4LFHG 3CLFH 4I3GA 5E1AB 5IESH 4FZ8L 2VXSH 4I0PB 1LE5A 1EAPB 3TWCH 1U9KA 3GO1L 4P46B 3O8XB 4MWFB 4PJFE 3QDJD 1T22B 4G80A 2XA8L 5DYOA 3J7HA 3R06A 4KKLC 4PRNB 2WWMD 2XY1A 5FFLA 3VXME 2IF7A 3MRRA 5KW9H 3MLZL 2LVEA 1CD0A 2R8SL 1H3TA 3TYFA 2IH1A 2H3NB 4NFBA 5GRVL 3S37H 2YRZA 4NZUL 4L4VE 4WTWA 1TJHH 5DA4A 3DV4A 1G7JA 4X6EA 4JZOA 2CKBH 2R23A 5I74B 4JRXE 2JJWA 2ID5A 1SBSH 2ZUQC 5D1ZA 1F3RB 3ARDD 3WFHB 1WIUA 3OR7A 3PV6B 4OCWH 5LXGL 2AJYH 1K3IA 5IMKA 1RJYA 1A7NL 4YHLH 1U3HA 1HILB 3S88H 5ELIA 3QAZC 4E0RA 1ERNA 1JF6A 2CGRL 2O26U 1WTGT 5F88A 2YPVL 3TVMB 3TBTA 4XAKD 4NO3B 3ULSA 3QIUB 5T3XH 3MLTB 3ZKXB 1KEGH 1ZHBB 3H0TB 4OZ4A 4HGWB 4YDVA 2A6IB 1D5IH 2ZUXA 3EUUA 4JFEB 4GAGL 5TE7L 3QH3B 1CU4H 1YMMA 1JZ4A 3VWKA 2VDNL 5HHXH 5SX4H 1DFBH 4MNQD 3SHSA 4XMPL 5D2LB 1NEZB 1UENA 5L2JA 2HRLA 4UDTA 1HYRC 3F58L 2EH8H 2JIXA 4ERSL 3BEVA 1HXMA 1EJ6A 1PGRB 5H2BB 1T2QH 1YEFH 5IB4A 12E8H 1XF3B 4B41A 1FNGA 1N2RB 1X5AA 1HQRA 4G7VH 4JN1H 3HNTH 4QXUL 3BZEA 4F3FA 1BIIB 3ULVC 4HV8B 3L7EB 1BJ8A 3IAQA 5TQ2H 3U4BH 3U30C 3ZDZE 1ACZA 1J87A 1DANU 5HYSB 2AK1L 4RMSA 4C59B 1HSAB 1P7QD 3OHXB 3UZVB 3I9GH 4XVJL 2GJZB 1MOEA 1WUNT 2BCKB 2EXWC 2V2WB 2VQ1A 1QFUH 3KPQA 1JPFA 5C0AA 1IKNC 4G9FE 3LQMA 2DQFB 3U83A 2ZCLH 1CGSL 3NFPA 2R2BB 3S3JA 1JTPA 3PIQA 2YPLD 4HXBH 4NQXA 3O3UN 2J8UB 4X99A 3GK8L 1UWEH 2P47B 4DFHA 3T65B 4A2LA 1AKJD 1T20A 5C8JA 4GKSA 4JFXA 4XNQA 1J10A 5F3BA 1WCBB 4YHYB 4R7DA 3L5IA 2BDNL 32C2A 4L4TE 1FGNH 2CUIA 2XTLA 4FP8H 3K4AA 1U41A 1CI5A 3BPCB 3IDJB 1WC7A 3FO2A 2AABH 4ACPA 1JHTB 3LKSB 1UH3A 1GC1C 3W0WD 1BZQK 1ITBB 5CWSB 4Z7UA 1FFOB 4LLUB 1S7WA 2NY3C 4WW2F 3UYPA 3HZKA 3OAUL 4O4YH 3PWLB 4DTGL 5CILL 2DDQH 1I9IH 4AL8L 3UYRL 2XWBB 3BN9D 5A16A 2B4CH 3HKFA 4CADA 4JFYB 3A6BH 4MJ4A 2ITDA 4PB0L 4PJCE 4D2NA 5DQ9B 1L7TH 5I71B 2J5LC 2YK1L 3B9KB 3WFBH 2XRAH 4DZ8B 3ZYJA 1YC8A 5T1MA 5JMRA 1G9ML 4Z5RA 5IK3A 4CNIA 2R2HB 5HI4D 5JUEH 4RAUA 1A4KA 4YDIH 5GGRA 3S98A 2V5YA 4TUOB 3L3GA 2R9HC 1EUUA 1JI1A 4FFWD 2VWEC 3HUJF 5ILTH 4KUCD 1NUFA 1X5ZA 2CD0A 2IEPA 4LLDA 3MLYL 4H0GA 3K8LA 5IFJB 2PW1B 5TGBB 3EYSL 4HPYH 1J8HD 3MRIB 1LO2L 2P8PB 3G04B 1P2CB 3MACL 4JG1H 2ERJB 3GSVB 4HH9B 4PJIE 1FZJA 4JAMB 4OLVL 4QXWA 1QBLH 3QUYD 3I50L 1HKLH 5KSBE 1XIWA 3BDXA 4LOUD 1TLKA 3CCHA 4XBGA 2VLRD 5B3JE 2HWZL 3DBXA 3WFCH 1X5KA 2UYLB 3UBXB 4P2RA 5MI0C 2DTSA 3SY0B 3C9NA 5C07A 3WN5A 5JTWA 2FCBA 3V5HA 2V2TA 4HS3A 4UT9H 1W0WA 2E9BA 5F9AC 2GQHA 4QHLB 1PW3A 3WIFB 2WUCL 4PJ8D 4YR6B 4QF1B 1AGDA 4LMQI 3PP3K 2JJVA 1MCPH 1A6TB 5EFIA 3WJLA 5BS0E 2L7JA 1DE4A 3BP7A 1MRFH 5E7BA 2DAVA 1BMGA 1ZT1B 2ZUTA 2VLLA 1GC1H 3H3PL 2R15A 2P46B 3MRGA 4RCAA 1T0NB 3NVQA 1ZANL 3X12B 1UH4A 2UWEA 1DCLA 2IPTL 1J0YA 4XXDB 3CK0H 1BFSA 4LNVA 1A7QL 1MCHA 3HPLB 1XH3B 3GMLB 1FVEB 4AG4H 2X4SA 4DGYL 3D0VA 4YK4B 3P30H 3OXSB 3RWJA 1S7TA 3LEXA 1YUHA 3BSZH 3T1FA 3X11A 3BYYA 2AEPH 4OGXH 1CF8H 2A74A 1S7QA 1Y0LA 3GHBL 3T2NH 4JG0L 2AXGB 2WINA 5C0GB 2YD9A 3O0RL 2JELH 3L5JA 2WZPD 2BC4B 2WWMC 1WK0A 4Y5VB 3IAGC 1BM3L 4OLUH 3WNKA 4DN3H 2AEQL 3VH8A 4POUB 5EORL 3AAZA 3UX9B 2DWDA 3NIDF 3VGBA 5TE4H 4F37F 5D6CA 3QNZA 1MLCA 1OQXA 2IMMA 3PQYB 4PY8I 4RMWA 2D03L 1T83C 3DSNA 1CXIA 5FUOH 5JQHC 2R0WL 5J11C 1WQVT 4UT6L 1CR9L 2YKLL 3UTQA 9CGTA 1YEDA 2Y6SC 3GSNB 3BEWB 1MQKL 2VO5A 1DLFH 2PW2B 3MV8D 3TESA 3E6HA 1JV5B 5C0DB 3MRPA 4GG8B 4ZG1A 1IGJB 1R3JB 4ZUUA 3ULVF 4UT7H 1DBKH 1MWAB 1R24B 1FJ1A 4QRUB 4LKXA 5ICZB 3I02B 4P48A 1XGPA 1NFIA 4XCYB 2X4NB 1RI8A 1KN2H 3JVGC 2IPUG 2O5YH 4PTUB 3T3PF 4CN6A 2D31A 5K59F 5DJAA 2O5ZL 5KVGH 1EK3A 4NNYA 4W81A 5IQ9B 4U1JB 3DVGA 2GJJA 2QLVB 4LDOB 1NCDL 1VACA 3HFML 4MLIA 5SV4A 3O4LE 3C2AH 1MLBA 1I7TA 2UUDH 2ADJA 3D48R 3STBA 1SVZA 3H9SB 4RFEB 2DF3A 1NCBL 3VRJB 5C0BD 5T5FL 4ZXBD 4YNYB 4X4YB 1R0AL 4ZYKB 4ELKA 1G6RA 3NZHH 4I0CC 1JWMB 5DHVH 1IAIL 4V1DA 3VD3A 3TIEB 5ID1B 3FFCE 1YPZA 3IJYA 1QLEH 1PSKL 3VFMA 1FPTL 4QTHA 2EKSB 4ZO8A 5IHUL 3T4AB 4IDJH 3CX5J 4LMQE 4OD1L 4LLMA 4RFOL 3LS4H 5MP6L 4PLOB 4OIIH 4KH2A 4Y19A 2XZCH 5I75B 5CLWA 3NACL 4MXVE 5C09D 4Q9QH 1JPGA 3VXRD 4J3XA 4ODHL 2AVGA 3UJJL 4JM2A 3BKJL 1S7RB 5E56A 3MC0A 3D18B 2NY2B 3ULUE 2A6KA 5CJBA 1HI6B 2CK0L 1HHJB 4N0FB 1D5BA 1VGKA 4JDVA 3O3DB 4LQ1A 3L7FB 4ZFOL 1NDMA 5SWZD 1JF1A 3GSOA 3ESVF 3ARFA 4N5UA 3CVIL 3VFUB 4PG2C 4AYFA 4XZUB 1KG0A 3WBDA 1IEBB 3OPZH 2NY0D 2PTVA 3EOTL 4Y2DD 3SKOB 1QR1B 1FFRA 4D8PB 1JIBA 1A0QL 2HG5A 1AGEB 2P4AB 1TVBB 1QD0A 5D5MA 5DFTA 3VXPB 1EVUA 3C08H 3PL6A 4TUJA 1ZT7A 5D72L 5FGBA 3EYQD 4GW1A 5CP7B 4R7NA 4RISL 4HIJB 4PJDF 1VADA 4WI7A 3CDGA 1VFAB 5F96L 4N68A 3TZVD 2Z31C 3SGKA 5IOPB 4I4WA 4WFED 3QISA 4U6HB 1P4LB 4FXGB 5IFAH 1YYLL 4Q97A 1CFTA 3IU4H 3WFDL 5HI4C 5L8KB 1G7QB 1CLZH 1MCFA 3PGCB 5MEOB 3WHXB 5JPMB 3PJSA 2J4WL 4EI5B 2C5DC 5F1OB 1KC5H 4PB9H 1CDJA 3C09B 5BV7B 1OPGH 2C7UA 1OAUH 4CVUA 1Q38A 2CSPA 3U9UA 5IB5A 3OXRA 1WIPA 4RWHA 3IFLL 5ISZD 3S9DB 3QUYC 4XPTL 2XN9D 1C1EH 5JO5A 1UWGL 3BDYL 4WV1B 4L8DB 4KUZL 2QBWA 5DUMH 1OB1A 1LQSR 1LO3L 4JGMA 5T3ZE 1ZHLA 2GW5A 2GK0B 4L4JA 3C5SB 5HGAB 1NFDF 3KS0J 4LKCB 3WNOA 2ITCB 4PJ7E 1RZ8A 2DWEA 1IM9D 1DDHB 1HOCA 4JO1L 4X6CF 3RVTD 4L8CB 1MFCL 4QNPE 3B2UD 3TBYB 1X3DA 5BVJA 2PO6D 3V0VA 4UIMA 2A73A 1A14L 4OCYH 5IVXF 3CU7A 4NJAL 1B0RB 3D39D 2AJUH 4YBHA 2W60B 3CSYA 3EYVB 3RDTB 2V7HA 4ORGA 4HXAL 1FO0L 2IBZY 3KPSE 3G08A 4YPJA 3V52L 3LSOB 3TPKA 4OM0L 5T1DH 1I3GL 3K2UL 2DQCH 4C56B 4XAWH 1FYTB 2EO1A 2X4TA 3ALPA 2A9ML 3Q6GL 2J12B 4JO4L 1ZLWH 1IC4H 1NBYB 2HKHL 3IAPA 3KPRD 4DAGL 4FABL 4L5FH 4LK4A 5C0FA 1P6FA 4U31A 5L8JB 2BY1A 2G2RB 1NBVL 1GJIA 4PJFB 5DMKB 4K8RD 5TF1L 1XF4B 1NC2A 2DYPD 4OZIE 5CZVH 3DROB 4OCMC 4WTZG 5C0IA 5FDWA 4TPRH 4K7PH 1BOGA 3BKCH 2RGSA 3GJFB 4YBLB 1D9KC 3PWUA 5D7IA 1NUGA 3VXMB 3U36A 3ETBF 3S7GA 1ETZB 3LHPL 2Q86B 3FQUB 5I30H 2HTKC 3HC3L 3QCVH 4L4VB 4WCYH 3TCLB 2DQIL 1G7MB 4MZ2A 2DIBA 4WHCA 1LEGB 1QFHA 4UV4L 3EIFA 4JRXB 3TBSB 4U1GB 1OAXH 1FL6B 3PHOB 5I2IA 4OLWL 4UQ2B 4YXHL 5KSAA 5J89A 3CLEL 1VDGA 4ZODA 3BP4A 5DJ2B 3WUWA 1IEAB 4FQIH 4LGRB 1H15A 1J1XL 3QUXC 2VZUA 3BOVA 3DI3B 2BY0A 1SJEB 3HMXH 2P5WE 5FB8A 1LK3H 2Y25A 3LY6A 3PWPA 3FQWB 2F58H 1RHHA 3G5YA 3WFEH 3HRZA 3AS2A 4WFFE 1FNEB 1KJ2A 1Y6MR 1F4XH 5FEBA 4CAGA 5IB2B 2VXTH 3NGBB 2OJEA 5EU5B 1Q9LB 2C3VB 3KPNB 5JPNA 4OI8A 4S10A 2VYRE 1IC7H 2X1WL 4ZSOE 3RL2A 4BZ1L 1WITA 3UYOD 4WO4D 2BSTB 2XYCA 1LILA 4KI5E 2VSDA 3MXVL 4JO3L 3WS3B 2P48B 1U8NB 5KBNC 4P9MH 4XWGL 1G7IA 3V7AE 4ESKA 3FO1A 4IHOA 1DQLL 2BOCA 3VE0B 2NNAA 4BSWB 1NGPH 1T1XA 4ZXBC 1I1YB 4XPFH 5C9KA 2I60L 2A0LC 4OCRH 3H3KA 2X1OA 4LLVA 1QYGL 3F62A 4Q0XH 4YH6A 1OM3H 1F11A 3Q6FB 4U1KA 1DEEB 4OLXH 4UINL 4MSWA 4X6DF 2BVUA 4YXKH 3HUJA 4BFIB 4TVPL 1X5YA 4WU5B 3SE3A 4F33B 3NABH 4G9FB 3RWHB 2OR9H 2C3XA 3G6JE 4F2MB 1OTUD 3AUVA 4U7MA 3P11L 2F8OA 4JFDE 5CGYD 4H8WC 1SY6H 4DEPB 4Y4KC 1Q0XL 4MA3B 4P9HL 3GRWL 1A9BA 3S35H 2I9TA 4QOKA 3LRSB 2Z92B 4OF8A 4UTBL 5GS1B 1T04B 1JPTL 4O00A 2JJSA 2WV3A 3B9AA 4U1MB 3DWTA 4X6FB 1K5NA 1FZOB 1KXVC 1V3JA 1RFDL 3M17B 4FQ2L 1S7UA 2HRPH 5K9OB 4ZAKC 3CLFL 4L4TB 2X7LA 2Y06H 2NTFB 1HQ4A 3TWCL 4MJ6A 1EEYB 1PX3A 4NFDA 3MRLB 4PP2A 5FA3B 2B20A 2P8LA 1KV3A 1MCCA 4Y2DC 1VHPA 3BGMB 4K55A 4Y4FA 1KT2B 5KW9L 5IQ7H 4U1HB 3LKOA 3RHWK 4U1NB 5BMFH 1HYSD 3EYQC 3S37L 1F2XK 5ACLA 5DFWH 2EH7H 1TJHL 5H35A 1OD9A 4OZHE 5E8OA 1NCCH 1FNLA 4PJCB 1NGQL 2NX5E 3X13B 3U0WH 2CKBL 5GGUB 2QKIB 3TF7C 4U0RB 4R90H 4JFFE 5F7YC 1SBSL 5C1MB 3U6RB 1BLNA 3QULA 5J1AA 5HYSG 4HJ0C 3MRNA 3LQAC 4Y4HB 3L5XH 1JZ8A 1IQWH 2ATKA 3QWRA 3FB6B 1FL5A 3ARVA 5E6IA 3VXSD 1UJ3B 4AJ0A 1XF1A 1ZA6B 5GQBA 2DI8A 2VDQH 2HT3D 1KIQB 4YHOH 2FLBT 5FO7B 1A8JH 5DEGB 3QO1A 5I19L 1HHHB 1GCFA 1Q0YH 5C0CA 4S11A 1KEGL 2AV7B 4C4KT 4RIRB 3FB7B 4MZ3A 4PJIB 1WWCA 1KB5H 4M9OA 1RIUH 5KSBB 4KU1A 5DD3H 1CXHA 1CU4L 3RIFK 5HHXL 3MJ6A 4ZFFB 3MOQA 1ORSA 3KLAA 2HJFA 2HTLD 4LF3A 4IMKC 3T1WA 4XI5C 3PP4H 4Y5YC 3VJ6A 5EZJB 2IALB 1ACYH 1H8OA 1YEFL 1CTOA 3OJVC 4ETQA 1IM3B 4UAOC 1TQBB 12E8L 1TDQA 3SGEH 3B2UC 2VLME 5I66A 1S9XA 5BS0B 3UTSD 1LMKA 4MXQD 3U9PL 4F15C 4JPIA 1EHLH 3B6SA 2WP3T 3QFJA 4YDKH 3RX8A 3T0DA 3IDMB 4NO2A 5EBMA 1FRGL 5IW6A 4LCWE 4OGYH 1IAKB 3I9GL 4P3DB 1CBVL 5DUBB 5KVDH 4BM7A 3EOAB 3GFUA 4PRDA 3UTZB 4U05A 5DMJB 2VC2L 1T2XA 1IKNA 4OQTH 1QFUL 4TRPH 2C3GA 2HLAB 4QYOB 5F3HB 1RZGB 1EAJA 1DQJB 4Q7DA 1XCQB 2ZCLL 1PG7L 5EBGA 2E7LC 4X4ZA 3D3VD 4NRYB 2DD8L 3T3ME 4HXBL 2W0FA 4UMGA 4UTAH 2ZCHH 1UWEL 3FQRB 5C9JB 3CMOH 1NDGB 3TYGH 1JWSA 4RFNC 3B2VH 4X5XB 3NN8A 4E9LA 3VFNB 3KXFA 3N9GH 1L7IH 1CD1A 3ES6A 4NKMB 4DQOH 2VISA 1OD7A 1R5WB 1FGNL 4FP8L 1AD9A 1WBYA 4ZNCD 1NMBL 4GRMB 5DC4B 3X17A 1QSEA 2AABL 1JFQH 5H37G 5IJVB 4JY4B 2B0SH 4PJEE 2PN5A 1F6FB 1XGTB 3UBXG 3MBED 4L9LB 3DSFH 2MWCA 4O4YL 3OGCA 3TPUB 4PRBA 1ZWIA 2DDQL 2HVKB 1I9IL 4NDMA 5JQ6H 1KCRH 2B4CL 5C08A 3SGJC 1XCTB 3V6OE 2BNUB 5JXED 5MHSD 1E27B 4IDLA 1HSBB 3HB3D 4NOFA 1X6LA 5F7LB 3WFBL 4KJPD 4JVWA 3MUHL 4K7FB 3O6FD 5JUEL 4K94L 3CH1A 3BAEH 3IFPB 5LGJA 2WIMA 3U7YH 1F45A 2OQJA 3EFDH 4HHAB 4NPYA 5ILTL 2JJTA 5DK2B 1PY9A 4M8QB 3L3OB 4P5MB 5LBSL 3GKZA 4R4FH 1R5VA 5EWIH 3FZUD 3LIZH 3O4LB 4HPYL 1HHKA 3QUMA 2R1WB 1J18A 4HK0A 4X7CC 3DETC 4JG1L 4CU8A 3BPNC 3QZWB 1T0MA 4PJDA 4OZGE 5HGDA 3BJ91 1HKLL 5IHZA 3GI8H 1M7DB 1X5XA 2FYYA 4PJ9D 4K8RH 2FBJH 3RWEA 3WFCL 2IG2L 1YZZA 4MA1B 4WJ5A 4M5YH 2NY5C 4LAQH 5FO9A 3E1F1 3FFCB 3SDAA 5KG9A 3FRPG 5F6HJ 5LGHH 4K23L 1W0VA 5IB1A 1D5MB 2QR0B 4UT9L 5CSGA 5M7QA 3HE7D 3NCBB 1YQVL 3AMKA 4BJLA 3WV0A 3UAJD 5JHDA 1JK8B 2NTSP 1EEUA 3BP5B 2CRMA 2FJGB 3QG6A 2W65A 3FJTA 2AEIT 3QEHA 2H1PH 1VGEH 4K9EH 1JRHH 1PEWA 3N0PB 2I07A 3VDBA 2X89A 3NZ8A 5JDSA 4F7PA 1GZQA 1KNOA 1E4WH 1QKZH 3NCJH 1BZ7B 2NZIA 3P0GB 3PGFH 1WZLA 3CK0L 2WP3O 1NFDA 5EZLB 1JNJA 2CR6A 1NCAH 3L6FB 1JGLH 4QHNB 4AG4L 1AHWC 4X6CA 3NIFF 5JLZA 4XBEL 1WF5A 1BVLA 3BSZL 1CF8L 3T2NL 2FX9H 4JFOA 5IVXA 4JY6B 4MJ5A 5EO0A 2DICA 4N90D 5FYKU 3BGFB 3LZFH 2CO6B 4ONOA 3ALWA 1QR4A 1A6AA 3FCTB 4I5BB 5EBWB 1P9MA 4RGOH 2NY7H 2PYEE 4DN3L 4PRIE 3EO0A 1HYSC 1A7PH 3QIUD 4XCCL 4EI6B 3MNVA 5TE4L 5ESQA 4ZOEA 4PUBH 5IW1A 1NEUA 2Z0BA 3C6LD 3AM8C 4X4MA 2VDML 3HLAA 4N0YH 5EOTB 3T77B 4KQ4L 4NSKB 2M26A 1QPXA 2EZ0C 1DZBA 4L3EE 1JNLH 4PJHF 3OGOE 4LHJB 1LE9A 1DLFL 1KELH 2NY5H 3IKCB 2HT3C 1TFHA 2ATPA 4JEGB 3Q2CA 1JWUA 3WE6A 4ODUB 4UNUA 5CCKH 3I6KA 1X44A 4P2QE 4UT7L 1DBKL 4F57L 5F7DA 1PYWA 3QPXH 1PLGH 1UCBH 3JVGA 1JHKH 5J13C 2OS7A 4HUWA 1KN2L 4MNQA 3U0PA 1X4ZA 2O5YL 4GO6B 4G5ZH 2HTLC 4EN3C 5KVGL 5E5RB 1UXWB 4R2GD 1ND0B 5A3ID 5C0RH 1Z3GH 3K2MC 1V3LA 4ZS6D 4PJ7B 3MGTA 3CPLB 4PIRF 1I7RA 3D69B 2H41A 4LVOB 4NZTL 1OTTC 1J0JA 4MD5B 5HHVH 1MCEA 2P5EA 4PGZA 4O5LH 1FN4A 3INUH 3EKCA 4BFGA 4U6YA 1U8HB 4MXQC 5IUSA 1S8DB 2VUYA 1JZ2A 1T5XB 5GZOC 2ARJA 3EYOB 5FCUL 4P4KC 2PTTB 5GSRA 3NZHL 5C6TL 4Y1AA 5B38A 3KPSB 3S6CA 5J9PB 1U6AL 3QG7L 5CEZE 4LSSH 5D1XA 3QUZA 3ZE2E 1KFAL 3PG2A 1FNHA 1A22B 5FOBB 2XT1B 5KVFL 1N5AA 4GS7B 4KRLB 3C5ZC 3O41B 5TE6L 3LS4L 2VDOL 2YPLA 1B6UA 3GJEB 4NQED 5FYKE 4DOHE 4OIIL 3KYOA 3RTQB 3CFEB 3BI9X 4HWEH 4OZIB 2EIZA 5E70A 4YGAB 5C6PB 3DECA 3OKYA 4AIXA 2EDWA 4G8GD 4QRRE 3DUUA 5L2KD 5KTEL 2N7AA 2WM0A 1F5WA 3ARPA 3BZDA 4XP5L 1AXTL 3HZYA 4CVXA 1NQBA 2I26N 1OCWH 3F7YA 5DVOA 3MBXL 1U8IA 1Z6JT 1IFHL 3T8XB 2IH3B 3MJ7A 5FYLD 1FNFA 4IRJA 3KNBB 4PG2A 3ESUF 4PRPE 2C1PB 4LCYA 2DKSA 5DSCB 2BX5A 3SDCB 2PNDA 4NBZB 4HCRL 1C16B 3IDYC 3B5HA 2IAMA 3VRIB 4O2EA 4PGEB 4NQCE 3NH7H 3WD5L 2NY4D 2WSKA 1L0XA 3GSRB 4X98B 3TO4D 4Q2ZB 2P5WB 3C08L 2DB8A 3EOBB 4XTRD 1IT9H 1F2QA 1BD2E 2Z31A 1MF2H 4LDLB 5IMLA 1CFQA 4JKLA 2LFGA 8FABA 4AMKH 4HLZG 4ZFZB 3HB3C 5IFAL 4KJPC 1P7KA 5E2UH 3IU4L 4CVZA 4JANA 4LHUD 2PR4H 3L3KB 5SWSA 5FYJD 3ZE1E 3QRFM 5DJZB 3O3AB 4YHMH 2G9HA 4KVCH 4FQQA 4IMLB 3HAEA 3AFLA 5IHBA 4ZSOB 5I16A 5F7EH 1QRND 3ARGD 4G6JH 4PREB 1E4XI 2DIAA 1KTRL 1J8HA 1E6JH 1JYWA 3JV0A 4OFKA 4OF6A 1OPGL 3FZUC 1FSKC 4CJ0A 1RULL 4FQJH 5ESVA 2YA0A 2HJKB 1MEXL 3PE9A 4Y0GA 4NN7C 3SQBA 3KLHD 4KV5E 2VLRA 4PJ9C 3ILQC 4KK8C 4G43A 1HHIA 1V5JA 1C1EL 4MA8H 3TIDA 2DJSA 5GJTH 1QSZA 1YQ2A 2H8PA 3U48A 3KPPA 3OKLB 5DUML 3GSUA 5DD5L 3Q3GA 2R39A 4I9WE 2AK4D 4F8TA 2GCYB 4KFZC 5CMAB 3HE7C 5J6GA 4PRHD 3UAJC 1K6QH 3G6JB 1S7XB 2B8OT 2GTWA 4I0PC 3QO0B 3QI9A 4JFDB 1QTYT 5LAXB 4DUWA 4P46C 2H6PA 4OCYL 4JKPH 2O61B 4I48A 5BJTB 4I2XA 2AJUL 1F13A 4UV7L 5E08L 1NCTA 2VR4A 2DQCL 5TDOB 4XAWL 5KSUA 3CFJA 5I9QC 3ARZA 1IC4L 2R69H 3BHBB 1K4CA 1T1YB 2XWJB 5HGGS 2VAAB 4RMUA 1H3VA 5D7LD 5I74C 3RUGA 3PQYD 2CUHA 2XQYK 5FO8A 4LCUB 5CZVL 4P5TB 4TQEH 4PR5A 4DGVH 1D9KA 4AIZB 4GG6E 4L8BB 4X4XB 4TPRL 1RIVH 4ETYA 1FFNB 5C70A 4Z7NE 1MFBH 4ZPVA 5HHNB 2M1KA 1GAFH 1ZGLP 3VCLA 2BMKA 4HJGA 1IMHC 3TVMC 3QCVL 4M1GH 1S9YB 3QIUC 4OZHB 2BSRB 2NX5B 2QQKH 4S1RL 3FT4A 2ICWJ 1H3GA 3C6LC 4UILH 4XWOC 4V2CB 1S9VB 4PJ5A 2IFGA 4LPVA 1I9JH 4JFFB 3GSNL 5CINL 5E4IA 1VA9A 1ULVA 2R1YA 5DQJA 4RX4A 4DKDC 3LD8B 5ICXB 3QUXA 4TYUA 4YPGA 4POZD 4LEOB 3O2VL 5EZOL 4Z0BH 5JOEA 1DL7H 1FV1A 2X4OA 3K1KC 3HMXL 1MWAL 3TLRA 1LK3L 1WGOA 4HUXA 1HZHH 3WFEL 2ILLA 2DIJA 3QCTH 3EO9H 1LD9A 2APVA 3QDGD 1F4XL 4KVNH 4ZOAA 4K07A 2CIIB 3MJ8A 3X3GH 4O2FA 5I1LA 3DXAD 1CT8A 2W92A 1RJCA 1BAFL 2ZOLB 1YMME 3PF2A 4HUUA 5HGBB 4QGYA 3TGXA 3SKJH 3FMGL 3RHWF 4ZS6C 4P9ML 1MREH 5CKGA 1OGTA 3WXWH 4FQCL 1DQMH 3RP1A 4DW2L 5CLTA 5C0BA 1KLGA 3BUYB 1EFXD 1BGXH 1A1MA 5HI5D 4XPFL 2FSEB 3FFDA 2OL3A 4YGVA 4BSVB 4PJBE 4OCRL 4GMSL 5TH2A 4OUOA 4Q0XL 2PETA 3O81A 1AIFB 3DX8A 4LCWB 3MYJB 4K3HA 1XGUA 4OLXL 4MD0A 7CGTA 4N0RA 4YXKL 2NY2D 2H9GA 3ARBB 4RMRA 2AQ1A 5D2NE 5MERB 4LNRA 1U8LA 4JCLA 4U6VH 3BO8A 1CE1L 5C0AE 3BVNB 5HGHA 4NQTA 2OR9L 4I8DA 3S34L 2VJXA 4Y4KA 5EN2A 1EPFA 3QNXB 4X9FA 3V4PL 1FVDB 2IANA 1IL1B 4OAWA 1Z9MA 3KAAA 4LU5L 1A9EB 1IAII 3QQ9D 3AMLA 4JPVH 4WW2B 3V9FA 3RIFF 4X5LA 5I1AB 5D7KE 3S35L 1QVOA 4A6YB 2AI0L 3S8WA 3I6LD 4OKDA 1J1OH 5ACZA 1BWWA 3AREB 1OSZB 5TDPA 2MKWA 4OKVB 4BZYA 1ZAGA 4ZAKA 5DURD 4P23B 5HJ3A 1PAMA 2AAVA 2HRPL 3ZYZA 2A77H 3TO2B 1KPRB 2Y06L 4JN2A 4UQ3A 4PJXF 5I71C 1CN4A 1OAZH 3GMOA 2X4RB 1K8IB 3GJFK 1ZXQA 3L3HA 4Y2DA 5DC9B 3ROLB 3QJFB 3TBWB 5F9JB 5K9KB 5E03A 4PJEB 5HVGB 4OJFH 2VTFA 1O0VA 1BECA 1BQHA 4EI5D 4JZNB 1KIPA 1CL7I 2L4OA 4PLJD 4XTRC 4JQVA 3R4DA 5BMFL 4WI5A 1E4JA 4N0CC 2BK8A 2EH7L 2R2CA 2L7UA 1NCCL 1JUFA 4WNQA 2Z91B 4WY7H 2ERJC 2G75A 3S37X 3U0WL 1K8DB 5E9DA 4GXVH 2V9RA 4HWUA 4H0IA 4F7CA 5DQDL 5L8LB 2R2EA 2NR6C 4D0DB 2F74A 1N64H 3U79A 3L5XL 1T0PB 5BV7L 4IRSB 1IAIM 2DQGH 4G7YH 7FABH 3ARGC 1YECH 5D8JH 4R4BA 3QQ3A 4FQXB 1XZ0A 3O11A 3T0EE 3K3QA 2FGZA 5KS9A 1QHOA 5EU4A 5L9DH 5ADPH 1XR9B 3V6ZA 2ZP0T 4OZGB 4ODVH 1KB5L 2CDEA 2CLRA 3DTXB 3KLHC 3GSXA 4RAVA 1RIUL 4W70A 3R8BB 5DD3L 3QJHB 4ZUTB 2CMRL 3U7WH 1NAMH 4KJYA 4IMKA 4F7EB 1NGXB 5DD0L 3TH4T 1ZT4B 4Y5YA 3SPVB 1B0GA 1QSFA 2GJ6D 1I9RH 2OBGA 4ZS7L 4Z77A 1KGCD 1FO0A 2FH6A 1IM9A 4KK5D 4HFUH 4R3SB 1MI5E 1ACYL 4RWYH 4NWUH 5DJXB 4NNXA 5FA4B 5KAQG 1H3UA 4C83B 3IB4A 4EIZC 2P7TB 5FYLH 1IAOB 4PGDA 4FS0A 3T0AA 1AGCA 3D39A 3BWUC 3D5OF 3QDME 2DQTH 4B50A 3ZZ1A 2CJUL 1EHLL 4YDKL 2FEEL 1UEYA 1INQA 1TZIA 5ALBL 3E6FA 3IDIB 4Y5VC 1G0YR 2AJXH 5IEHB 5EC2A 1KJMB 35C8H 2J7LA 2F54D 2X44D 3NFNA 4OQTL 1OGAA 3VMOA 3OJMB 4Z78A 4TRPL 1SYSB 5HVFB 1F3JB 2OZ4H 3MCKA 5E0QA 1M6OB 4MAUH 4MDJB 1A47A 3DVNB 4M02A 1DBAH 1PY4A 3WFZA 4NWTL 2WWKT 5D2LF 3S36L 4GAJL 1PG7X 4PJGE 4WDIA 1LO5B 1G9NH 5JXAH 2CUMA 3DMMD 1AJ7H 3TYGL 3BQUB 5FYJH 3GIZH 5KJRH 3B2VL 1BPVA 3DYMA 3H3BC 2PYEB 4PRIB 1NC4B 1ZGLB 1JE6A 1MIML 3SE9H 4HKJA 1JGVL 4POYA 4CN1A 1UB5B 3JWOH 4JR9H 4OM1H 5D71L 1A02N 4Y89A 4TNVK 2HFFA 4ZUWA 3BD3A 3QZWG 5CD5D 2EE3A 5IF0A 3CVHA 2E7HA 3KYMB 4E41E 2PYFB 2FRGP 1JFQL 4HH8A 5I17A 2B0SL 2IQAA 1GL4B 1RZJC 2VSCA 4GRWE 4L3EB 3DSFL 4M6NH 4MNGA 2HP4A 4JDZB 3G6AA 5JQ6L 5ERWB 3SGJA 1KCRL 4HC1A 4Q6IB 1DEDA 3OAZK 4NUJB 2DQUH 3MLVH 1I7ZA 1R3LA 2CXKA 3ROOA 4P2QB 1V7NH 2MQCA 3U2SB 3I2CH 5LCVH 2J8UF 25C8L 1X4XA 1N3NB 3QHTC 4PY7A 5TFSL 3LKRB 1RV6X 5GGSA 4FN0A 2FJHB 3BAEL 2CLZB 1TJIH 1ZLVH 4H5SA 3U7YL 3EFDL 1FL3A 1H3XA 2J6EH 2XG4A 2YOCA 2BNRE 1A3LH 5EIIA 2MCPH 3MCLL 2CQVA 5FUCC 3DX9B 3DHJA 4R4FL 3S96B 5EWIL 3QXVA 3LIZL 5LG1A 3VFWB 3G5VB 5F44A 2DM7A 4R26H 1TCRB 1UC6A 4QRPD 3PDOB 3KR3H 4QRSA 4XC1H 3S3PA 3QEQD 2AJZA 5C0JB 1WJ3A 1V7MH 3VXTB 4K8RL 3IRPX 4ZPTA 5BRZD 5I75C 2FBJL 2SEBB 2FBOJ 3CZFB 5INCA 3WXVL 2FL5B 2FO4B 3BESR 4M5YL 4LAQL 4HIIB 5LGHL 1UZ6E 1V8HA 4XNYL 4GUPB 1TTFA 1ZVYA 1J8KA 3FTGB 4Z7QF 2NY2C 5I6XC 2XPGB 5JMOC 5AUMA 3KYKL 1AGBA 2VDPL 4XCFH 3BH8A 4DOHB 3EO1A 1VESA 3WMSA 2H1PL 1VGEL 1Q8MA 3QQ9C 4K9EL 1KYOK 1DUYB 1UEMA 1JRHL 4QRRB 1WFOA 5GJSH 4IBLT 1RZJH 2WBJD 2H2SD 5F71A 2CIKA 3NCJL 4NT6B 4F7TB 3BH9A 4JO2H 1VSCA 2EXYD 3W81A 2IWGA 4GW5B 1AHWA 4UUJA 1NCAL 1G1CA 3IT8D 1I3VA 3LKPB 3QIWB 4KMLB 2B5IC 2VITB 4LLQB 1D3CA 4PRPB 5I76B 2JLLA 4D9RE 1UADC 4KQ3H 2OI9C 4MB4A 5BW7C 4JREB 5DI8A 5CBAA 4PJHE 1A6ZB 2FX9L 4JGUA 4NQCB 1BP3B 1QBMH 3BKML 2AGJH 4R96B 4EI5C 1CQKA 4OCNC 3EGSA 4RGOL 2MHAA 4PLJC 2WWKO 4EUPA 3W11D 2BY2A 3NCMA 3BGAA 3C09C 3V95A 4MDIB 4N1CA 5EU7C 3MLXH 1BD2B 3N1GC 3VD4A 4JZJB 3AVEA 3GI9H 4NRZB 2ESVA 1BEYL 3AM8A 3SKMB 4BK4A 1F02I 1L0YA 2E27L 3V5DB 1YYML 4F58H 3P73B 3VG0L 2VERN 1U8JB 1GGCH 1QPPA 2BVOB 3UDWC 5EOCH 5DHYA 1IGCH 2BVTA 2Z93A 4KWUA 4WV1C 2I5YH 1OP5K 3GUTB 2LVCA 1KELL 1NH6A 1U8OA 3MRJB 3D2UD 3D87B 4IJ3B 3RU8H 3CD4A 4YHZH 4HMEA 5DJ0A 1S78C 3MR9A 3WLBB 4UIKH 5CSBA 3B9DA 3FHAA 3MO1B 4JPWH 5CCKL 1I8MB 4U1IB 2FDBP 5FK9A 4M61B 1L6ZA 2LV4A 4FTVD 1EBPA 5ENWA 1RK1B 1F4HA 1PLGL 1UCBL 2EDTA 1JHKL 1S7VB 1U3HD 1TVDA 2XKSA 5IIEA 1XF5B 2C4FT 4EN3A 1J86A 4M1DH 2RFXA 1UQSB 4HKBA 1NLBH 2C9AA 1P4IH 5E6YA 3V0AC 1V05A 3RY6C 3VD9A 1Z3GL 4KK5C 5EUKB 3JV4B 2ZG1A 5MENE 5AZ2H 2YUWA 3GMNA 4PD4K 4BH7A 1U0QA 1BJ1J 2GTZB 4U1LA 5F7NC 3VXUE 3BPOC 4JPKH 3UTSA 5HHVL 3VWKD 4M43H 4O5LL 4J8RA 2GUOA 4P4KA 5SX4I 1A7OH 1H5BB 3OB8A 1FBIH 5HY9B 3PABB 2WBWB 5JA8B 3DUSB 4R0LB 4QHMB 4YBLC 5HDLA 3RRQA 2MKLC 3DO7A 3T2OA 5CJOH 4LSSL 1F3DH 1ZEAL 5GRWA 3D85B 2VB5A 1BFVH 4PTTA 2BVQB 3C5ZA 3FRUA 3DRTA 3K74B 4M93C 3TNMA 3MREA 1FZKB 3L3DB 1RUKH 3A6OA 1EZVX 5DJCA 4HZLB 4IOIB 1TETL 4XNMB 3WCYA 4U1GC 1ITCA 2AXJA 4ZNEE 4GG6B 1S5IH 3DMMC 3NCYS 1WTLA 4JFPA 4APQB 3I3DA 5D7IE 1FC2D 3GGWB 2G5BA 4TVPE 1IJ9A 5D1QA 1N6UA 5EUOE 1OCWL 1ZSDB 3U0TB 2ZSWA 5E5MB 5J4MA 2FR4B 2XNAB 3TYFB 2XZQH 2EIBA 4NP4L 3N50A 4TTDD 2NXZD 1N0LA 5EC1A 5CD5C 4H26A 5AWNH 4WTZA 4XNUH 3IGAA 4JRYE 2LE9A 4QLRA 1T1WA 4G8IB 3ECBB 1NGZA 3RBGA 5FKPB 2EEAA 3FONA 4M6ML 5B4MD 1K85A 5GGQH 5C71A 5IMKB 1Q9OA 1RJYB 1I3RA 4LAJH 5DD6B 3WIHH 5F97E 1C5CH 4B7IA 5FAAA 1IT9L 3RNKA 2Z4QA 4YUEL 1YY9D 1MF2L 4HZAA 3V4VH 2XI9A 3VFVA 5FV1L 5HYJA 2GT9A 3AXLA 4OZ4B 4DVBB 5E2UL 2PR4L 4LSUH 2R0KH 5HSFA 1EIBA 2AV1A 1YMMB 2YWYA 4W4OA 3TV3H 1SJHA 1Y18B 2HJLA 1NSNH 5F7EL 3M07A 3QUKA 4G6JL 5DDHA 2YN5A 4HGMA 1IGIH 1E6JL 2Q8BL 3I75A 5H94B 4XCNB 3LEVH 2DL9A 2VLKE 3OJDB 4PY8J 1Z9LA 1LK2A 2QSTA 1MELA 3P4OB 5FKAA 4MJID 4NO5A 4DEPC 5E2TH 3JTTB 4R4NC 3NPZB 1N0XH 3BZEB 4MA8L 3H7LA 4PJBB 3IETA 4Z7OF 4MAYA 5GJTL 5IKCB 4LVNB 2XWTA 5HXMA 5I1HH 5A2IH 3E0GA 5SWQB 2VZ1A 3IDXH 1DBML 5DEZA 4JJ5A 1G6VK 1OTSD 4LHUG 5T3XE 1J88A 2YC1A 3U7AA 5D2NB 3EYUH 5E1AA 4TOYL 4I3RL 1XIWD 3MA7B 4XNZB 4I0PA 5C0AB 1EAPA 3MRBB 4AEIH 4P46A 4MWFA 1OAKH 3MUJA 4P2RD 2YUVA 2V9QA 1S3KH 5C07D 4K3GA 1UWXH 3G5ZB 4PFEA 1R3KB 2W9EL 1A4JA 4PRNA 4B5EA 2QSCH 3K4DA 1IBGL 3P4NB 1ODAA 3UO1H 2WBJC 4HUNB 1URLA 2H3NA 2MMXA 2FO1A 2EXYC 1OL0A 2FNBA 3HE6B 3MV7D 2R69L 1AY1L 1MHCB 3HC4H 3CU1A 2QADD 1CCZA 1KLUB 4RMVA 3HS0B 3RVUD 2ZSVB 4DZBA 3U46B 3WFHA 3TCXA 3PV6A 4TQEL 3RX5A 2EICA 1XGRB 4HS6B 5F7HA 1BX2B 3CXHJ 4Y4HC 1HILA 1UJ3C 1FE8H 1MFBL 2EDBA 3FOLB 3W11C 3TVMA 1GAFL 5CIPB 5C0EB 4NO3A 2D3VA 3QIUA 2BSSB 3MLTA 4R97B 4TNWK 1ZHBA 4ZQKB 2VXUH 4OTXH 4CADB 2QQKL 3H0TA 1YEIH 4HGWA 2PXYB 3CFKB 2A6IA 2WUBH 1EFQA 3FN3A 5A2LH 2RJMA 4JFEA 3QH3A 1I1RA 1I9JL 1XGYL 4FHBD 4OZFH 2EO9A 2A6JB 3MA9H 5F8RC 3BIKB 5D2LA 3BT2H 1NEZA 5INDA 2F53E 3QFDB 5GGRB 3GIVB 4TUKH 3HI6L 4DJMA 1DL7L 4NZJA 3KVQA 5H2BA 5AYUL 4Z7VE 3T0EB 1T4KB 2D4DA 5I8KL 1XF3A 4PJFF 3LH2L 1N2RA 5GSVB 1TQBC 1MPAH 3EO9L 4KVNL 1C5DB 2GHWB 2YD5A 1BIIA 3L7EA 5F6HI 5HYSA 1U3HC 3SOBH 5T3ZL 4WGVB 2BNQE 4WI3A 1OT2A 1WT5C 1HSAA 2A83B 3OHXA 3CCHB 4NUGH 4D3CH 4HBCH 2BCKA 4HS8H 3C9NB 4HIXH 3SKJL 1MI5B 3M1BB 1MREL 4FFZL 2VDLH 2E7MA 3WXWL 1U92B 1DQML 2R2BA 3VWKC 3PNWB 4KKBD 1SEBB 1NJ9B 1BGXL 2J8UA 2N56A 1M05B 3QDMB 4TSCH 5IBUB 3RNQA 1UKQA 3T65A 3MLPA 1VB9A 5JW4N 3QIBB 3QFJE 1RZIB 4X5WA 1DVFB 2FEDD 3BWAA 1JMZA 4ZO6A 1WCBA 4TTGA 3MV9E 4J6RH 3FN0L 5I8OL 4PJXE 4U6VL 1OAQH 4NQEA 1KTLA 3IDJA 5AZEH 4E5XB 4MQTB 3UTPD 4V1DD 3SDCD 1JHTA 3LEXB 3LKSA 1WAAE 1B0WA 3X11B 4JPVL 4NJ9H 1DJSA 1FFOA 2DLGA 4LLUA 4PJGB 3T2PA 5E2JA 3HMWH 4GOSA 4HCRA 3PWLA 1BVZA 1J1OL 1T7ZA 3S35X 5D7JB 1I7UB 2E9IA 1HH6B 3KXFE 4JFYA 3QA3B 4Y19D 5IM7A 5HDBE 5DQ9A 4YE4L 3B9KA 3ZDZF 4DZ8A 4KKAC 1I8LC 4I18B 4JM2D 2R2HA 3BRGC 3IDUA 1U8MA 4E41B 2VABB 3FQTA 1T03H 5DO2C 4TUOA 2FATH 4GRWB 5B4MC 1GOFA 4U3XA 3VMPA 5J56B 5IFJA 2PW1A 5TGBA 2JCCE 3ARFD 5I1GH 2GFBB 4ZFOB 2P8PA 3G04A 1P2CA 4CMHB 3GSVA 3KJ4B 1E6OL 2HKFH 4HH9A 5C6WH 4JAMA 3U82B 4KRMB 1GGBL 1ROWA 1FNSH 3ARUA 5HBBA 2XZAH 4ZFGH 3GSQB 4XC3H 1NFIB 4L3AA 1TZHB 3F7RA 4IM8A 2BVEA 2UYLA 4P2OB 3UBXA 3SY0A 1M4KA 3NAAH 3L3IB 2D31B 1YEJL 2DQGL 4ZTPL 5GGTL 1PKQE 2BNRB 7FABL 5D8JL 4HIHA 1Z9OA 4QHLA 3WIFA 1OQOA 4YR6A 3LN4B 1HXYB 4QF1A 1A6TA 5L9DL 4UOW0 5ADPL 3MSPA 4JRWA 3IVKB 4N8VG 1XT5A 3O45B 4JFDD 4YEFA 5E4EB 1ZT1A 4Y16D 3U7WL 1NAML 1T0NA 4K3DH 2LU7A 3GHEH 3FAXA 4OSUH 2XOTA 3X12A 4XXDA 4BQCA 3ULUC 1OTSC 3HPLA 1EERB 1XH3A 3GMLA 3O6KH 4HFUL 4NWUL 1FVEA 4PJCF 4S1DD 4RWYL 4KXZH 1XIWC 3OXSA 3UMTA 3AS3A 4NC1E 4QTHB 5FM5O 5DWUL 2LABA 2V17H 3K0WA 2AXGA 3IJHB 4TSAH 5C0GA 1KB9K 3B4NA 2P45B 3H9ZA 3QEGH 2BC4A 1BZ9B 4Y5VA 3BGFC 3OSKA 3FRPA 2FHFA 2PCPB 1WBXB 4Z95H 5JR1H 2AJXL 5D70H 3AC0A 1NBZB 5F9WB 1YNTB 3WJLC 4NO0B 4PJIF 3DRQB 2QADC 2OZ4L 3HI1B 3PQYA 5KSBF 2DQEH 4JDVB 4J3TA 3QDJE 5B3JF 2NCMA 4QEGA 2EC8A 4ODWA 4U6XB 5DUPL 4PJHB 3DURB 3FO0L 4KROB 1ZLUK 1G9NL 4RBPH 3BEWA 5F1IB 1HN1A 3S36X 3GIZL 2PW2A 5KJRL 1NMCB 2HG5B 1QEWB 2J8OA 5C0DA 1MVFA 3SE9L 4R8WH 4GG8A 3OV6A 4XPAL 1ZT7B 1R3JA 1J05B 1MWAA 3MNZA 1R24A 3F7QA 3JWOL 4JR9L 4M6OL 4OM1L 4QRUA 1LO4H 5ICZA 3I02A 1L9MA 4LCIH 4XCYA 3SDYH 1DANT 1F8TH 3MX0A 4P59H 2KKQA 2OTUB 2IGFH 2R4SH 4PTUA 1R3IH 1X9QA 3EOYG 3QRGL 3P0VL 1KSRA 5IQ9A 4M6NL 4U1JA 2C1OB 4Z6AT 1S9WB 1T66D 3HNVH 2F5BH 2VL5B 1CG9B 4XAKE 4ELME 2DQUL 3IS1X 4LIQH 3MLVL 5C2BL 5J6HB 2NY6D 2C7UB 1V7NL 3HR5B 5KSAD 3JSSA 3U9UB 3I2CL 5EZIH 4J4PC 5L88H 1P84J 4X4YA 4NHCL 1JMXA 3GZKA 4ZYKA 2BHZA 3GMRB 4LPUA 5HTSA 1BQLH 2HYMA 1JWMA 4KJQD 3TIEA 5E6ZA 5ID1A 3VFPB 2A9NH 1TJIL 3MXWH 3PWPD 4YHKH 1QRKA 3D1MC 2D2OA 2EE2A 2J6EL 4LCWD 15C8H 1A3LL 1OB1B 4M7JL 2MCPL 1JNNH 1FAKT 1IC5L 2EKSA 5MENB 5E94B 4LSPH 4RNRB 3CUPA 3T4AA 4LP5A 1RZ8B 3VXUB 2EDEA 3SKNA 1KCSH 4R26L 3SDDB 1UZ8A 3HG1E 5K9JL 3KR3L 3M8OH 4KKBC 4TULH 3LDBB 1MHEB 2DLTA 1V7ML 4YXLH 3GBMH 3NCYP 2MSPA 4XMKH 1RZFL 4PG9B 2E6QA 2FEDC 5EOCJ 1AXSB 1S7RA 3MOBH 4KRPD 3D18A 3ARED 2NXYD 4NYLB 1JZ5A 1HHJA 4N0FA 3KG5A 1U42A 4RGMB 3KPMB 4ZUSB 3O3DA 3L7FA 3ILPB 4MD4A 5E8EB 4M03A 3VFUA 4ISVB 1A6UL 2YA2A 4AH2B 4XP4L 1IEBA 3SDCC 1MFEH 5F72S 5B22A 2YPLE 1QR1A 1PBYA 3SKOA 4ORZC 4YIQB 5E95B 4D8PA 5J7CC 5F9DC 1A6WH 2BVPB 1AGEA 5KN5B 1TVBA 5GJSL 1GGIH 4O02L 4BZ2L 4F37K 1RZKC 3VXPA 5JOPD 4OZFG 3WO3B 5D7IB 2AJVH 5EUOB 2ICWI 3RKPA 5CP7A 3K46A 4HIJA 4KY1H 1VFAA 5IOPA 2QQLH 3S97C 5L6YL 1Z5LB 2YRPA 1P4LA 3MLUH 4FXGA 1MJUH 3D9AH 5BW7A 4QOKD 5LVEA 1JNHB 3RX7A 4WHDA 4JM2C 3BZ4B 2FB4H 4KQ3L 3REWB 1VPOH 2EYRB 5I1JH 3BP6A 1G7QA 3H6JA 3W0WE 4JRYB 3PGCA 5TQ0H 5MEOA 5JPMA 3NCFB 1GRWA 1QBML 4EI5A 3S3SA 2AGJL 1RMFH 2EC9T 3W9DA 1RURH 3PDGA 4ZDHA 1H15B 1NANH 4MQXC 3NCEB 2Q6WB 4D9QD 5JW3H 3L5HA 3MLXL 2MTPA 4CVWA 1CDGA 3GI9L 1CFBA 1NCUA 3FHQA 1C5BH 4KKLD 2EECA 4F58L 4MXVF 5TPWH 1H8SA 1PKOA 3UDWA 4Y4FD 1GGCL 2NW3B 4NM8H 3QWQB 4WV1A 4L8DA 1IGCL 3ULUF 3UJTH 5ITFB 5DMIH 4XB8A 1AR1D 5HGAA 4LKCA 2ITCA 6FABL 1QFPA 5HHOD 1DDHA 4L8CA 1J8HE 4JPWL 2CKBB 3TBYA 1X5FA 2VLKB 4IHOB 3RVVD 1MH5B 3IFNH 3QWOB 4J3UA 4P3CL 5E6ID 1G6RH 4FA8A 1B0RA 4M7LL 3ZKND 3B9VA 1FFPB 2W60A 2JK5B 2AKRB 2FWOB 4Y16C 1KCUH 3FO9B 3LSOA 3U4EB 2CLVB 4LCCB 2APBA 1R5IB 3WL9B 1FYTA 1VFBB 2JKXA 1NLBL 1RZKH 1P4IL 5C0CD 1LEIB 1NBYA 3JWDC 4S1DC 4EIGB 3NTCH 1CZ8H 2XZZA 4M62H 4XVSH 2G2RA 1AO7E 2E5EA 5DMKA 1B2WH 3DYPA 4RA3A 3DV6B 1HCVA 2ED9A 1DP0A 2H32H 2HVJB 4PGCB 2QSVA 3GJFA 1IEHA 5FUZL 1FBIL 1PFCA 4I2XE 3VXMA 4GBXD 1QZ1A 1ETZA 1EJOH 2Q86A 1KUMA 5CJOL 4KZEH 1BFVL 4L4VA 3TCLA 5GGVH 3ZLQC 2CK2A 4MB3A 3ULVD 4GRLB 1A2YA 3SGEI 1DN2A 4NKDB 1LEGA 4XMLH 1FH5H 2EDKA 2DM3A 3IXAB 4JRXA 1RUKL 1DBBH 1FL6A 2XA3A 3PHOA 3FB5A 4OIBA 2FEEI 3RUGE 4MJ6B 1OP9A 2EXWD 4NOBA 4PLKD 3VFGH 5DJ2A 1S5IL 1IEAA 5I8CB 5IV2B 4XVTH 2GSIA 1IQDB 1SJEA 4PJ7F 5D93B 1A64A 4PBWD 2HA1A 1ADQL 3FQWA 1BHGA 5FECB 3LKQB 4QNPF 1FNEA 3V5KB 2XZQL 4JLRB 4XP6L 3GNMH 2NZ9D 4WWKB 5IB2A 2AERT 2E7CA 5EA0H 3DLQR 1G7PB 4WIQA 5AWNL 2ZUQB 4XNUL 3LAFA 1Q9LA 1X5HA 1H0DB 2C3VA 3KPNA 4EQ2A 2F53B 1IGML 4WI8A 1JN6B 2BSTA 5D6DC 1L4IA 4M6AA 4H1LH 3VFOA 1U8NA 3MV8E 3QAZB 3WIHL 1C5CL 3WNMA 3VU2A 4Z7VB 4JFZL 1MAML 2QQNH 1QSED 3JWDH 2NY6C 4XB7A 3VE0A 4OZIF 1CFSB 2NY3D 2Y9RT 4XRCB 4BSWA 2XTJD 3V0WH 1I1YA 2YD1A 4Z18A 2BNQB 4N9GB 3ZDYE 1F42A 2R0KL 5GRXG 3ZE0E 5GRVK 1MUJB 4M48H 3AROA 1DEEA 3IF1B 3TV3L 3G9AB 2RIKA 4KTDH 4QKXB 3PWNB 5C08D 1VEOA 4WU5A 4FRWA 1B3JA 1IGIL 4HT1L 2H2PC 5C2UB 3ARBC 4G9FA 4QO1A 3LKNB 2D7TH 3RWHA 4GAYB 2ZJSH 3QHFH 4CW1B 3LEVL 4F2MA 4PYGA 3VXNB 2R9HD 1A7RL 4YDLB 5ALCH 5C0BE 4MA3A 3U30B 1N0XL 1YC7A 4WW2C 5CEZL 3LRSA 2Z92A 5GS1A 1T04A 1OW0A 3O6LL 4DVRH 3V6FB 2Y5TB 2W9DH 3QFJB 2OXGA 5T1KB 1KTKE 3F7PC 2VRAA 5HHPB 2X05A 3AREC 1YDPB 4X6FA 5A2KH 4XNXH 1FZOA 3UJIH 3MV9B 2AP2A 3M17A 5FYKL 5K9OA 3O2DA 4PRDB 4L4TA 4WI6A 3EYUL 3GSWB 4P23C 2NTFA 4PJXB 3F6LA 3K1DA 2DM4A 2Y07H 1EEYA 1OAKL 4LP4A 3RWFB 5L7XH 3RGVB 2OR8A 4X80H 3MRLA 1S3KL 3SDAD 5C09E 1KJVB 3VXRE 4AZ8A 2WIIB 3VWJD 1KT2A 4KI5F 2WBJA 3WJJA 2QSCL 4GW4B 1JCKA 5FGCE 3H9HA 3BW9B 4MVBD 1I1AB 3MQIA 5JHDD 1T21B 4KDVA 4U1NA 4Z7WA 2IPKA 2V5TA 3KXFB 3STZB 3GMQA 1ES0B 3HC4L 4PJCA 3X13A 5T1LB 5SWZE 3V6OC 5GGUA 2QKIA 4U7SA 4P5KA 5HVWA 2X89D 1JRHI 3U6RA 4KMQA 2JJSC 4OT1H 3KWWB 1FIGL 4Y4HA 4J3VA 3GMMB 3FB6A 1MRCH 1EMTH 5FM8A 1UJ3A 1ZA6A 2O5XH 4LSRH 5DZLA 1D5ZB 5J8OA 1KIUA 5ANME 1FE8L 1UKSA 2W38A 3OZ9H 1KIQA 3WSQH 4KKNA 4PYHA 5FO7A 5DEGA 2JCCB 4HUMB 1KJ2H 3G6JF 4NDMB 2EIDA 1ZS8B 2AV7A 2Z8RA 4RIRA 3FB7A 4OTXL 3LS5L 4U33A 4WFEE 1YEIL 4BFEA 2WUBL 5KSBA 4Y4FC 3UZQA 5A2FA 5IBUG 2JJUA 3MA9L 1X6NA 4HGKC 2I27N 3T0WA 4X8JB 4CMMB 1AR1C 3D2UA 1TXKA 4TUKL 1PKQB 5MEPB 2IALA 3BPLB 1KENH 2YD3A 4X0KB 1ZLUH 1B4JH 2I24N 3BYTA 3MGOA 3UCRA 3QQ4B 2EDOA 4FTVA 1MPAL 1UFUA 3RVVC 5BS0A 2X40A 1N26A 4Z76B 2Y6SD 2ORBH 4HK0B 4YJZL 5IB3A 5ISZE 1BF8A 2XN9E 5E6IC 3ZKNC 1WT5A 4OFYD 3SOBL 5IHZB 5ECJE 2JB6B 3IDMA 1FLTX 5EO1B 1VEPA 4P3DA 1IAKA 4XHJC 4L29B 5DUBA 5J12C 1CLYL 3EOAA 3UTZA 2BHYA 4LQFH 1MNUH 5FO9B 5ICYB 3CSGA 4OZHF 3D85D 4QYOA 2HLAA 5F3HA 3VGDA 2FLRT 1RZGA 2VDLL 1DQJA 1XCQA 3F7VB 4NRYA 2LQRA 3QG6B 1GIGH 2NY1B 4NN5B 4GH7B 5DGQA 2OMBA 4LSVH 4HD9A 3FQRA 4TSCL 4Y7MA 5HDQH 5HI3D 1NDGA 3QEHB 4N8CH 4WHTA 4GLRH 3LCYA 4NBYB 1YNKH 4GBXC 3VFNA 3NZ8B 5JDSB 1I8KB 2V9TA 3B3IB 1UGNA 2RAMA 4NKMA 2P5ED 4PS4H 1R5WA 3OMZA 3KPRE 4L8SC 1JGDB 3SN6N 4OBRA 1CGTA 1HIML 5AZEL 3QDJB 4Y1AD 3LQZB 3RA7H 4JY4A 2X4QB 4PLKC 5DHVB 4YBQD 5D1XD 3QUZD 4FQLH 1XGTA 3TBVB 4JE4B 4JFOB 5EO0B 4HIEA 2HVKA 1UJTA 1DQQA 4QXGH 1IGTA 3OAYH 1NL0H 3WKMH 3MJGX 4Q6IC 1XCTA 2ENSA 3WDJA 3SO5A 2BNUA 4D9LL 2EYTB 4OV5B 4MQSB 2NZ9C 4F80A 1E27A 5C0NC 1I8LA 4KHXH 5E2VH 4MS8C 2APWA 3IS0X 3FOMB 3V79C 3ARDB 3EDFA 4LRIC 2OCFD 3IFPA 1T03L 1WFUA 2DQJH 3ZT6A 2OJZL 1KTDB 5DK2A 4M8QA 3L3OA 3AS1A 4IRJD 5J1TC 4ZOBA 1WZMA 3E8UH 5IWLA 3O4LA 3BIAX 4ELMB 1DUZB 2R1WA 1Q1JH 2D7QA 4QCIB 1P4BL 2RBLA 3QZWA 43CAB 2HKFL 4UU9B 3T3MF 2IAMD 5GS0C 4WFHE 2XTJC 4HWBL 1RJZB 1M7DA 2BY3A 1PYWB 1FNSL 2N4IA 3W5NA 1UM6H 4NQVB 3EHBC 2XZAL 5C7XH 1CDCA 43C9B 3GM8A 4ZTOH 3K8MA 1A3RH 1E4XL 1EEQA 3FFCA 2Z31D 4EBQH 2MPAL 1D5MA 2QR0A 3IFOB 1HINH 3MTRA 1RQ5A 1W72H 4EDXA 3ULVH 1JK8A 2FJGA 3QPQD 3LN5A 3HG1B 4MJIA 5SWSD 4HBQA 3UTTA 4FQ1L 4B7LA 4PJEF 3MLSH 5E2WH 2JJTC 4NRXB 1CLOH 5FM4A 2ARJB 2CO7B 1P7QB 3THMH 1OARH 4OSUL 4PJAF 1BZ7A 3PHQA 5SX5H 1A1NB 1EGJA 3L6FA 4Q9CA 1IVLA 2IADB 1RJLB 4G42B 4QHNA 4NIKB 5CD3B 5IR1B 1DR9A 1SYVB 1P53A 1N5AB 4U6TA 1G7HB 3AY4A 2YPLB 4TSAL 1NMAH 3RY5A 3SDAC 1JGUL 2EC9U 1DQDH 5JZ7D 4JY6A 1JHLH 2P44B 2VXQL 3OX8B 5CFHA 3VWJC 4LRNL 1AKJB 4I5BA 1CXLA 5EBWA 1UA6H 3LV3B 1CICD 4MVBC 5JR1L 2OP4H 2VZ3A 3L95B 3MV7A 4CVXB 3SGDH 3QI9D 3UTOA 4EI6A 3ZTJH 4OZGF 3JBG7 4JZJC 2ZNWA 4JCMA 4YAQB 1W2KT 2DQEL 2IQ9L 2J88H 3DARA 5EOTA 4LCYB 4NSKA 4ODTH 2FGWH 1TJGL 1TPXB 1KN4H 3W0WB 3DX7B 1RVFH 4PRAB 3IKCA 4X9HA 3TA3D 3HI5H 3OG6B 2D7PA 4H20H 1EVTC 4ODUA 3ZT7A 4R8WL 1RIHH 3P0YL 3P40A 1O5DT 4OUUB 4OGAC 4CBPA 4N1EA 1D9KD 4DN4H 1AP2B 3SDYL 1JTTA 1F8TL 2YXFA 3X14B 4P59L 1TTUA 2P8MB 2NW2B 1P9MC 2C3WA 4JHBA 1R3IL 2HTKD 5TDNA 1M7XA 5BZDA 5CBEB 4LFHD 3VXSE 3RVXC 1UXWA 4LPYA 1EZVY 2G9HB 1T7WA 5DVKA 3QUMH 4PJ7A 1IILE 3CPLA 4M7LT 3I6GA 3HNVL 5EBLB 3D69A 2F5BL 4PJ5D 1J8HB 1KBGH 4LIQL 5IGXH 2APFA 4MD5A 3N1QC 1RHFA 4J4PA 5JW5B 5EZIL 1JZ6A 1U8HA 3QUYB 4RX4D 5D96B 1T5XA 1DN0A 3QUXD 1YNLH 4LARL 2ICES 2PTTA 1BQLL 3GMPB 4XPHH 1H5BC 1MIEH 3KPSA 5I1CH 3C60D 5J9PA 3MXWL 4YHKL 4HQQL 4LASH 5IW3A 2Q76A 2OM5A 4JQXC 15C8L 3DPBA 1JNNL 3SJVD 2GY5A 4KC3B 4ODXB 3Q3GB 4M5ZL 4L3CB 2M2DA 1X5IA 5DD1H 4PJ8B 3ZKMC 1D5XB 2NMSA 4LSPL 2ZG3A 3O41A 5HPOA 1L9NA 1AO7B 3GJEA 5GPRA 4FZ8H 1P1ZB 3RTQA 3CFEA 3M8OL 4TULL 2AQ3A 3UTSE 1WISA 1N8ZB 4K71C 2XA8H 3GBML 5HI3C 2HN7B 1FG2A 4I48B 3CX5K 4XMKL 1ORQB 4I2XB 4APQC 3MOBL 2X42A 3MLZH 3WUWG 1NCWH 2YEZB 3T8XA 2IH3A 4XT1C 2FJFB 5DZOA 4D94A 1VERA 2AJSL 2A0LD 5KSUB 1E0OB 2C1PA 5IHLB 1K4CB 5DSCA 3SDCA 1EO8H 3P9MA 5T33H 3MOAL 3D3VE 1MFEL 3FAWA 1C16A 3RUGB 3VRIA 4PGEA 4YBQC 5F89B 5D1XC 3QUZC 2Y36L 1SJXA 1A6WL 2XV6B 5LXGH 1GGIL 3GSRA 3V4UL 5K9QI 4Q2ZA 2P5WA 5KZCB 3EOBA 2AJVL 2ICWB 3KHQA 2DN7A 4GFTB 4Y4KD 1ZLSH 2XKNB 4G6MH 2IAND 2QQLL 4ZFZA 3MLUL 2H32A 2ZNXA 4CJ1A 3R0MA 2FB4L 1VPOL 4J3SA 2Z35B 4GAGH 5TE7H 3L3KA 3O9WD 3BISA 1CL7L 5TQ0L 3MFGB 3O3AA 5DJZA 2VDNH 5HYIA 4IMLA 3ZE2F 1NLDL 4MMZC 4ZSOA 3DGGB 4G9DB 1RMFL 1EH9A 4XMPH 4ZAKD 1VKXB 4PREA 4IRJC 3F58H 4ERSH 3MV8B 5GGTA 2X4OB 2E6PA 5JW3L 1EHNA 4YHPB 2HJKA 3MUY1 1S7SB 2K9UA 5MHSE 2IAMC 3UEZA 5TPWL 1G9MC 4QXUH 4OCXL 3MJ8B 3VGAB 4NM8L 4OIAA 3W39B 2WNGA 1HWGB 2AXFB 3F5WB 3RZWA 3OKLA 2ZUYA 5E8PA 2AEWA 3UJTL 5DMIL 4LPWA 4L1DA 4WU7B 4MCZB 1WIOA 2GCYA 4XVJH 1HDMB 5CMAA 4ONGL 5E9DD 3NFSH 1JVKA 3EFFB 5D2NC 1KJ3L 4HJ0D 3G6JA 3QPQC 1S7XA 4XNZC 3RIAF 2HFTA 4JFDA 5CP3A 5LAXA 1CGSH 5BXFB 3WKNA 3IFNL 4LLAA 2VIRB 3C8DA 5C0BB 4BSJA 4K7PY 5BJTA 2O61A 1G6RL 4Y16A 4ZXBB 1VENA 5ITBL 1A1MB 2HFGL 4Y2OA 1KCUL 4H1LA 3K81A 2CDGB 5DMGD 3VRLE 5IVOA 1X5JA 5CSZB 1OF2B 1Z0NA 1YN6B 4MD0B 2XWJA 3HE6C 4CN4A 2VAAA 4XVSL 2BDNH 1K4DB 1KB5B 4LVHC 3BO8B 1MFAL 1QUNA 1B2WL 2E3VA 3ZTNH 4LCUA 3I84A 4P5TA 4KPHH 4XI5D 3ZE1F 2DL2A 2KUTA 5JZ7C 4CGTA 2GK2A 4L8BA 4X4XA 5C09B 1QSFD 3TJEL 1ZHKB 3VXRB 3MJ9A 1SEQH 3HC0B 1FFNA 2FIRT 1MFDL 1QVOB 1CICC 5LWYL 3OAUH 5FGCB 3RWDB 1PEZA 1ZA3B 4KZEL 5ACZB 1X5LA 4AL8H 3UYRH 3MRFB 5FGSA 5TDPB 1ZHNB 3IXTB 1S9YA 3QI9C 5GGVL 4OZHA 1WFTA 2NX5A 3ZL4L 4R97C 4KV5F 5SWZB 4BQ6A 3MNWB 3P3YA 4JFFA 1ZVSB 4C54A 2YK1H 1ZK9A 4NQDD 4JN2B 2H45A 1G9MH 1KPVB 2NY0B 3ZHLA 3VFGL 3VW3H 4Y2DB 4XPBH 5HHMD 5ICXA 4N90E 1OGAD 4LEOA 4QXTB 3TA3C 5ANMB 4J1UB 1BQHB 1AD0B 1KIPB 2IPUK 1QA9B 1B90A 2R29L 5F70A 1QFWH 2X70B 1Q9KA 3EYSH 3GNML 2CIIA 3TZVB 4YX2H 4DK6A 4WNQB 3JV6B 1UCTA 5EA0L 1V3MA 1NBQA 1GXEA 1EO7A 2MQ3A 3HAEH 4KZDL 4PP1C 3G6DL 1QOKA 5HGBA 3GBLA 5D6DA 5DLMH 2YD4A 2JB5H 1HNGA 1ZTXH 3L5WB 5CGTA 5I1KH 3WS6C 4BKLB 1J12A 3BUYA 3CH8A 1MCIA 1BFOB 5I1DB 5ISZB 3V0WL 1GVIA 2XN9B 5IFHH 4GG6F 4BSVA 1RK0B 3VMNA 3PWVB 1T5WB 4Z7NF 1HEZA 3QIBC 4FZEL 3C60C 4LCWA 3JUYA 4JFQB 3MYJA 4M48L 4KTDL 5DEFB 1VFOA 4FMFA 4M9PA 1ZANH 1ZOXA 3QQNA 3ARBA 2IPTH 5FYJU 1WWWX 2GI7A 4KKCC 4WENB 1A7QH 2D7TL 2DBLH 4Q74A 4ODBD 3BVNA 4YHIB 4YDJB 4OFIA 2X1QA 2PO6B 3QNXA 1FVDA 5ALCL 1IL1A 4WW2A 3VG9B 1A9EA 4PGDB 3GHBH 3GKWH 4YFLF 5I1AA 4HJJH 4DVRL 4A6YA 4HKZB 5T5NG 2W9DL 3AREA 1OSZA 1KPUB 2GITB 3DETD 4OKVA 3HZMB 3LN9A 5KOVC 3Q1SL 5D7JC 4G8FB 4XNXL 3UJIL 3SDXE 1GZPB 4P23A 5EORH 3OQ3B 4MX7A 1RAMA 3TO2A 1KPRA 3KPRB 4RGND 4NQEE 5L7XL 2X4RA 1K8IA 2D03H 3KPOB 4I18C 2DYPB 3ROLA 4HDIB 4IS6A 5F9JA 3TBWA 4DGIH 1SVCP 2R0WH 4PJEA 4G8GE 5L2KE 4P2YA 2F15A 3RJDA 4JZNA 1CR9H 2YKLH 4FQHB 4X7EC 3T09A 1F6AB 1MQKH 1H3PH 1TENA 4OLZH 1GGYA 3KPLB 4DWHA 1QHPA 3M45A 5FYLE 1BREA 3QXDA 3V6OA 1S5HA 2Z91A 2AQ2A 3RPIA 1SM3L 1QLRB 1K8DA 5BCAA 4UBDC 3MROB 1M71B 3WO4B 4PJBF 4ZUWB 5I8EB 2G60H 5CJQH 4UOJA 3DX6B 1JYNA 3O9WC 4D0DA 1QQDB 4WI2A 3V6BR 3E2HC 4WVRA 1MRCL 1EMTL 2D0GA 4FFYH 5IMOB 2BXZA 2O5XL 5IESL 2O5ZH 2DQHH 2VXSL 4JB9H 1FC1A 4FQXA 3RWGB 3HZVA 3MRMB 4HK3N 4MNHB 1FYHB 3W5MA 3PP3H 1XR9A 1N5YH 3W82A 4OZGA 1I7ZB 3RKDD 1UM4H 2QHRH 2VNCA 3AU1B 1LDPH 2VLJE 2PUQT 1HE7A 1H9VA 5E4EC 4ZUTA 3ARXA 4F7EA 5FYJE 1NGXA 2CPCA 4JQVC 1ZT4A 4AIOA 2IFFH 4DKFH 2W0KA 1QRNE 4WO4B 5HHOA 1CGXA 4R3SA 1BJMA 3DI2B 2ESVD 2DQDH 3P77B 3QCUH 4LLYB 5DJXA 5FA4A 2DTMH 1B4JL 4C83A 4JHAH 4LLWB 3QXAA 1IAOA 3VXOB 4OCWL 2EZ0D 3IDGB 4RFOH 4M00A 4OD1H 2AJYL 3BPNB 2OL3H 4YHLL 2ORBL 3S88L 2B7DT 2K7QA 2GEEA 4XVUD 1NGWB 3BZFB 4U4BA 3OKEB 3TT3H 4QRQB 1FG9C 1PZ5B 4ODHH 3IDIA 5DMGC 4Z9KB 3UJJH 5T3XL 3REVB 5IEHA 1EEZB 2WBKA 1KJMA 3BKJH 2VE6B 4AENB 4LQFL 1MNUL 2AK4E 2Q7YB 4GAFB 1D5IL 1FNAA 5CGMA 3SCMD 4H8WH 2FX7H 5F9WC 2CK0H 1M6OA 4MDJA 4I0KA 4PRHE 2Y1VA 1U93B 1FVCB 3DVNA 3NIGE 3EJYD 5ID0B 1DFBL 4EN3D 5KANI 3EDEA 5J06A 2EH8L 4LSVL 4OBSA 1UYWH 1LO5A