3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
3K0WA 4HJGA 4LSPH 4OTXL 4NBXB 1FZKB 4BFIB 3U6RA 1YEFH 1OAUL 2H6PB 4XBPB 3BRFA 2ZCLH 3TWCH 4XH2B 2E6JA 4Y5XB 5IHZB 1HSAA 1LDPL 4JM2C 3QNYB 3OR6A 2EDFA 4PJCF 2D0HA 2D7QA 3G5YA 1NCNA 3RKPA 3P0VH 2NW2A 3S9DB 5I75B 3VH8G 2QR0B 3C6LB 3NFSL 2H1PL 5JORB 4IRJB 2DQTH 1YN7B 4NJ9H 4WCYH 3BVNB 4MQ7A 4KKAC 1G7HB 1K8DA 1Y0LA 3FT4B 3DUHA 3I75B 3IB4A 4I5BB 2XZZA 2DYPD 4UDUB 4PGDB 2VTFA 3RL1B 5L9DH 3TPUA 3LRGA 4D0BA 5J8OA 2H9GB 1Q1JH 1J8HB 3KPPA 5DZNA 4UZGA 3B43A 3L6FA 4TPRL 4EXPX 4AH2B 2YC1B 1IEBB 1VACB 3IDYC 1L7TL 2EC8A 1AGBB 3SO3B 5GSRB 5DMKB 5TGBB 3BN9C 4OCRH 1GGUA 5C0AD 4NO0B 1AIFA 3Q3GB 2OI9B 4PGZA 5L2KD 3MRPA 3UZVB 4Q9QL 2NY2B 2DQGH 2ZCHL 3WUWA 2UWEF 3H6JA 4JDTL 3EZ8A 4HIEB 2YUXA 3O9WC 4EVNA 5AEAA 1CFVH 3FT3A 1A7QH 4RISL 3QIWB 3V8CA 2DLEA 5DVMA 4E41D 1Y18B 1R24B 3GIVB 4PRPD 4EXKA 4G8IB 3MRCA 4CVWA 3P9WB 4Q2ZB 5DGQA 5F1SA 1ZLWH 4S1QH 1MWAA 3HCVB 2Z31C 4ODWA 5KSVA 4PRNA 1U95A 3S88L 3CX5K 1K4DB 5E8EA 5J6HA 3D25A 1B6DA 4POUB 1KCVL 3HZKA 4OGZA 2R2HB 4LOUD 1JPSL 4X6BA 1UVQB 1FN4B 2K7PA 3O4LB 4RAUB 2C3WA 5T1MA 2FEEL 3DUUB 1E4WH 1HINL 4JFDA 5FA3A 3VE0B 5I0DA 5C0BB 2ARJB 3MCLH 4X83A 4U1HB 4K9EC 4MAUH 1NFKA 5C0FA 3TYGH 2FD6L 5ERWA 4ZO8A 4CMMA 2Y4SA 1PKQA 4JRXD 5A2IH 3MX0A 3MRFB 1NCBH 3CH1A 1GPOL 3Q1SH 2DBJA 3PGCB 1GZPB 1FBIH 4ZDHA 5F7WC 4QYOA 1JGEB 4JO1H 4YQXL 4L8SB 4PJDB 1Q9OB 2YPVH 1IAIL 2B1AL 1QA9A 3EIFA 3GM0A 2AJUL 1IGTB 1CYGA 4P57A 5BW7A 4ORGB 4G7YH 4J3WA 5C09A 7FABH 3RWIB 2OP4L 4NKIL 3VD4A 3UTSE 2D7TL 2Y36L 3CPLA 5I71C 1WBZB 5SWZB 4LNRB 3HMXA 3D39E 3QG7L 1AGEA 3P4LA 3OGOE 3P11H 4QHUB 4D9QD 2V5YA 3QEGH 1S78D 3FJTA 1UT9A 1CDIA 3OV6A 4TTDC 1CLCA 4HGWA 5EBGA 5AAMA 3MBEA 3GMRA 1FG2B 3QUZD 4LCCC 4WI4A 4LSQL 4XNMB 3GMPB 5DO2D 5BMFH 1CFTB 5D1ZA 5CLWA 3JTSB 4PG9A 4LCUB 3ARXA 3C9NB 3DTXA 1J8HE 2OL3B 4MD4A 3GI9H 2XXCB 5GGUA 1BJ8A 3SN6N 3BSZL 4RFNC 5DRNB 5DJCB 1A6UL 3OQ3B 2CSPA 4X8JB 1IAII 1BOYA 2OR8A 2A73B 4OGXH 5D1XA 2W0LA 1T5XA 3HAEB 2FR4B 1EVUA 1RUQL 1U93B 5B38B 4DVBB 2Q87A 4UILH 3F12A 3PG2A 1QLFB 2XN9A 3CU7A 3WO3B 5GRYA 4NWUH 1N4XH 5D7LA 4HKJA 3VXTA 3GMMA 1U9KA 4JR9H 5JZ7D 4JPVL 1AI1L 3BESR 4JRYD 4Z95L 2DM7A 5E8NA 2VLJB 4M1CC 4HFWA 1PY4A 5EO9B 3JWDC 3A6BL 2HVJB 3TJHC 4O5LH 4AG4H 1W0VA 4R7NA 4FOMA 2VZSA 3CSBA 4P5KB 2D03H 1YEGL 4LFHD 4DCQB 1QUNA 3O4LE 4YGAB 3BWAB 4PGCB 5FV2A 5F1OB 1QZ1A 1U8LA 3AS3A 5C0BE 4Y5VB 4GS7B 2OJZH 5DQDH 3WNPA 1T66C 2FEDC 5TQ2H 3U7WH 5HYQB 4N0FA 3V6ZA 4KJWC 5IMKB 3WIHL 4PYHA 5INCB 4HH8A 5L0QB 4K23H 3CDGA 4NKQB 1EFXB 5C3TA 2HT4C 1FNSH 4PJHA 1FL5B 3QO0B 1HXYB 4GMSL 3FRPG 3QCTH 1T4KA 2VDLL 4EJ1C 5FYKH 4PJDE 4HWZA 4PY8J 4E5XB 5DJYA 4WWKD 3SJVD 3B6SB 3W9DB 1RURL 2BC4B 2R1WB 4MS8C 4U1IA 1OPGL 2UYLA 4C56B 5AYUH 3W39B 4AJ0A 3ULSB 5SWZE 3LV3B 2EIDA 1DBMH 4P23A 3WN5A 1RIHH 5FIEA 2QADD 4ZD3L 5E9DB 4X6FA 2RAMA 1FLTX 1AKJA 1N6UA 2RBLA 4MXVF 4POZC 3A67H 4QF1B 5D7IB 3TIEB 1IAMA 2XQYK 5B39A 2VL4A 4OLZH 2PXYD 4FN0A 1B0GB 3LQMA 1IM9B 1TZGH 4PJ5A 4F33A 3T0EC 3O3UN 1BP3B 5CD3B 1FFOB 5FM8A 3W0WD 4PV9B 2X44D 2ZG3A 5TH2B 1OF2A 3TNNB 1A9BA 1KJ2B 1PQZA 3NN8A 5D4QA 1S9YA 1LP9B 2AJ3B 3MQIA 4XMLL 1J0YA 2VE6B 2ICES 3B2UC 5F8QC 1I8MB 2NYYD 5F1NA 3GI8H 5D5MA 3ZKXB 3C08H 1MFEL 1FE8L 1ADQA 3SCMC 1OTTD 2VC2L 4GG8B 1JN6A 4L4TA 4C4KT 4JZJB 4ODHL 5FECA 3DIFB 4FP8L 4LMQI 1Z3GH 4JFED 4XHJC 4YXKL 4M6OH 3MJ6A 5D93B 5AAWA 3QH3A 4JY6B 1FJ1A 1AD9B 2COQA 2MTPA 2VLJE 3N1MC 3QDMA 3G04B 1HHKA 2EDNA 3UP1A 1AP2A 2C4FU 1T03L 1F4HA 4GQ9L 4O2FB 4RSVA 5CBAA 4TNVK 5DT1L 2FZ3B 2IGFL 4P4RA 1S7VB 1JGLL 5C0IB 4PGEB 4GLRI 3QWRD 3TBYA 3O6ML 3OAZH 1N0XH 4G6FB 3NFNA 4ESKA 5EU5B 4PJAA 2VXSL 1PEZA 5DURD 2WAHA 3E2HC 1AO7B 1T83C 2WBJD 3L5WB 3GKWH 4WNQA 2ZSVB 2CGRH 1NANI 5HI4C 1NFDA 1YJDL 1I9RL 3OKEA 2IJ0C 3DWTA 5CSZB 1T21A 2R23A 4P49A 2V2WB 1KLGB 2VZOA 3QCVH 3AM8C 2G5BB 3RWCA 1Z0NA 4P4KB 4XTRD 3DMMB 2R4SL 4YWGH 4Y1AA 1FCGA 5E6IC 1HHIA 1ORSA 1MLCA 5F7NC 1N0LA 2VKWA 3GJFH 4PJHF 4NO3A 4NQVB 1A7OL 4OGAD 2CK0L 2XZQL 3L9RA 4QOKA 1ZSDA 4DGYH 5LVEA 3KDMA 4QRPD 1MIEL 3PP4H 3BRDA 3BXNB 1ODAA 2R56L 3OKOB 2AEQL 5IR1A 1I8KA 3VXMB 3SHSA 2X1PA 1FG9C 2BFVH 2YA0A 4I13B 3TBVA 2E7BA 4W68A 3SKJL 1FNLA 5E9DE 3W5NA 1EHAA 3MNVB 1S3KH 5LGHH 4M6NL 4MVBD 1N59A 2IBZX 2YEZA 3LMJH 3RWFB 4XZUB 3WIIL 1UH2A 4L8CA 3FONA 1GYAA 5D7IE 2PYEA 5IB4A 3QEQD 3A0OA 4GW4A 4OCXH 4Z7NE 4MYWB 5I8EA 1WTGT 3WD5L 1BIIB 1KJ3L 4YAQA 4ALAH 1HN1A 2NY2C 4EN3A 3QUYB 2GFBA 4PTUA 3JTTA 4TTGA 3AB0C 3L3IB 3MV8A 3O41A 3UO1H 3VDBA 1JNHA 4HWEL 1DEEA 3VFUB 3I2CL 3PL6C 4JHBA 1KPUB 3PWNB 5D7SL 3MBXL 1P7QA 3UBXB 4JQVC 1JHLH 2E9BA 4NPYB 4H25B 1K3ZA 5DUMH 4QXWA 1LP9E 3LVEA 5ID1A 5EU7C 3PJSA 2AJYH 4KKAD 1YQVL 4LAQH 4M03A 1OTUD 5DC9B 5D5MF 5DDHA 4IRSD 4UBDD 2R69H 4RWHA 1NCUA 2AAVA 1F8TL 3EO0A 2G60H 1WC7A 5C7XL 3PHQB 4M02A 2EECA 1JGVL 4FXLA 5HGHB 4RMUA 4JN2B 2C1PA 3T4AA 1AGCB 2YBRA 3DGCR 2AEPH 3HZMA 4UUJB 3TA3C 3HNTH 1VGEL 1E4JA 5DI8B 2GJ6D 1DZBA 2XA3A 2ZP0T 4YO0B 4PLNC 3O9WD 1W72B 4KRMB 2VABB 3CLEL 5FCUL 4HQQH 2CLRB 3GSOB 1AO7E 2W60A 1WF5A 4M6MH 1MCWM 4X4XA 3H9YA 1INQA 4PJAF 3MODH 2IPUG 3TCLA 1K8IA 4N90E 4X6DB 3FAXA 3RUGA 1FV1B 1K5NB 5I15H 4XCNB 5E03A 1IEAB 2X4UB 5IQ7L 4WFEE 2Z31D 3JWDL 1HXMB 4MQXD 4YPJA 2IBBA 5HDBF 1HKLL 2ZUTA 5IFAH 4HJ0C 4Z7OE 5M94B 1M4KA 3N1PC 3QIBA 2E8ZA 4LSTL 2YPLD 4NQXA 2J8OA 5TQ0H 1UACL 3EOBB 1C5CL 3GSVB 4YHKL 3IDXL 3MV9B 2IH3A 2VDMH 5CZXC 4Y2DB 4O58L 3RTQA 2ZUQC 4PLJC 2F74A 3BPLB 5I19H 1UXSB 4N68A 4Z0BL 1AR1D 3TH3T 3VXME 1AHWA 3QFJA 5AWNL 2W0FA 1BQLH 5FFLA 2XWTB 4JQIL 4GAJL 1QBLL 4OQTA 3M1BA 3HUJB 3UYRH 4TNWK 1WTLA 2CRIA 3D69A 5ABDE 2WINA 1U8HB 3PE9A 5IOPB 3QI9B 2ADIB 3WCYA 4CNIB 4MD0B 2QQNH 4YLQT 5ITFB 3PWPD 2CDEA 2IC2A 1CQKA 3CSGA 3U0WL 5FUCE 1U8IA 1NAMA 4XNQA 2A1WH 2D7PA 4WY7L 3QISA 4MZ2A 4PJGB 4POYA 1UYWL 2EEDA 3CVHB 1NGXB 1UM6L 5ACLA 2ADFH 2DTMH 4OLXL 2VXVL 1TCMA 1CTOA 3QQ4A 4Y7MA 4P2OB 1CFQB 2J1KA 2AKRA 1MCRA 2IPKA 1NC2D 1JGDA 3UX9B 4L8BB 3CXHJ 5FF6A 1DBJH 1KNOB 4FFZH 2YUZA 4KRPB 3MJGX 1BZ9B 2EH8H 3U4BH 1CICB 1JZ8A 2CIKB 5D96C 2E7CA 4NQCE 3SE8L 1MCOH 1BBDH 3ZHLA 2EH7L 3O3AB 4PRHB 4KY1H 2VIRB 4WFHE 3RL2A 1QFOA 2NY0B 3U82B 1IKFH 4JHAH 4L3CA 5I6XC 1A64A 5IROA 1FYTA 2BVEA 5K59E 2XWBA 1N8ZB 2AV1B 3V5HA 3C5ZD 2WK2A 2X5PA 3RZWA 5L8LB 1NMAH 1DQMH 5EUOB 3TZVD 3QXWA 5JXAH 4JFXB 1BVKB 3GSNH 3B9KA 2F58H 4JB9L 1DVFC 1T1XA 4KKLC 2GAZA 4RGMB 1RSFA 3BAEH 2FBOJ 4X6DE 4LCWA 4JAMB 3MXVH 1W0WA 4WFFD 4TNWF 4APQC 1MNUL 3GKZA 5FHBL 3EDFA 3OXRA 2AJVL 3OAYK 1TCRA 4JZNB 4M1CD 3RUGF 5C0EA 5D2LA 3ILPB 4M6AA 4NT6A 3NH7H 3TJHD 5JXEA 1NDMA 1ZVYA 4E42B 4ONFL 3FN9A 3V5DA 1C1EH 2HFFA 1TNNA 1TVBB 4UQ3B 3ROLB 1DFBH 4D9RD 4X4YA 3MV9E 4LCYB 1MFBH 5FYKU 2VR5A 5E08H 1GGCH 5FGCB 3OXSB 2BSSA 3MV01 2HH0H 3RZCB 1CLOL 2FX7L 2B7DT 2FB4H 4JFOB 1BJMA 1HHGB 1X4ZA 2PETA 4KMTL 4U1JB 5FB8B 3NACH 2FSEB 1F4XL 1MIMH 3HUJE 5IB3B 4PRDA 1KN4L 2HFGL 2HWZH 4K8RH 1BQHG 5C71A 1YNLL 4M7LH 4JKWA 5I1DA 5GJTL 3C5SA 5F88A 4XT1C 2IG2H 4MD5A 3U36B 2DLFH 1RHHB 3TT3L 2VZ3A 1AQDB 1CE1H 3BGFB 1FIGL 4MS8D 1IL1B 1PFCA 3OJVC 4PJGE 3CFCH 2OTWA 1TLKA 4Y16B 3MLTB 3RVTD 1ZT7B 1FQ9C 3V5KB 1F00I 5BRZA 3MTRA 3UPCA 4WUUA 3L5HA 2W9LA 2R0LH 4I0PD 2OX5A 1P9MC 4PTTA 5E7FA 4HK0A 4POZD 1NUDA 1RZ8A 3ARGA 5L2JA 1X7QA 1D5ZA 1UH4A 3OKLB 1HH6A 4LPCA 4KDWA 4PRIB 1HILB 4HKZA 4U4BA 1KEGL 5IESL 5F7YC 3T4YB 1B4RA 4PRHE 3RWDB 2AABH 2IMNA 4PP2B 2C5DC 5IVZA 1QLRB 3FO9A 4FXKB 4WV1C 1RV6X 1VSCA 5DUPL 4PUBH 5I16A 3WLWD 1JNNH 2OQJB 3WJJA 1LE9B 3RY6C 4P2QB 1OGAB 1KLUB 5EUOE 3BMWA 5IW6B 5F1IB 3EYVA 2KZ1B 3L5XH 1FDLL 4CMHC 3R0MA 5E99L 4N8VA 3D3VB 4OZGB 5KJRH 4U1LA 4JPWL 5E5MA 4M48H 1T1YB 5E2JA 4ODSH 5IB2B 1S9XB 1KELL 5E8OA 3U83A 1FFPA 1FVEB 1YNKH 5I18H 4C57C 3BKMH 2NY1D 5JW3H 1D6VH 1RK0A 3BZ4B 2PNDA 4Q6IB 4OTXH 5JIIA 3T2NH 5A3ID 2R1XB 1YPZA 3OF6A 5EIIA 3MV11 2WBWB 2HLFD 3O3DB 1OAUH 4NZRL 1H5BC 4EUPA 3ZKMC 2IH1B 3V95A 4HV8A 1LDPH 3RWGA 5FGCE 3THMH 3QBTB 4XCEA 4QRRB 3H0TB 4Z7VB 5GGTA 5JHDA 3DUSA 3QUYC 5T1KA 4WO4B 4RFOL 2PO6A 3VDAA 4OKVA 2MOVA 4YNYA 1BD2B 3NFSH 4JJ5A 2FJFB 2VLKE 3PQYE 2D7OA 1YMMA 5IM7A 4B50A 2NY4C 3VXRA 4ZAKA 1S7QA 4WHTB 4OFIA 4I3RL 3OJDA 3C6LD 4ZOAA 2IMMA 2Q7YA 4IRJD 1YYML 2CH8A 3D2UA 2O5YH 1ND0A 3V6BR 4OFYA 1A6PA 4XX1E 2I24N 4J8RA 2HN7B 4NYLB 3V9FA 1E4XI 4TPRH 4GRLC 1Z2KA 3CU1A 5T3ZD 3RX7A 2WV3A 1L7TH 2Y06L 1NBZB 1OSPL 3IDMB 3MOBL 4NFBA 3VD7A 4IHOB 4FG6D 1HCVA 3AXLB 2JIXA 3QPQC 2ADGA 3GSUB 4HBCL 1J8HD 1G7LA 5HGAB 3LKNB 2ZCHH 4JDTH 1TVDA 3AAZA 5KSAC 4KMQA 4L8DB 4PJCB 1U8MA 2GT9A 3DXAD 4K71B 4NO0D 1CG9B 2BHZA 3GSQB 4GH7B 5D1QC 1G9EA 2EO1A 5SWQB 2NY2D 1D7FA 4PRIE 1R3KB 1BFVL 3TNMA 1MVUB 1XGQA 2XTJC 2G9HB 5GGQH 4N0RA 4NN5C 5DMGC 4HWUA 4JREC 3FQNB 2C1OA 3W2DL 4MA3B 1NCDL 3N50A 3TO4A 1KCVH 5CP7B 1Z0MA 4YHIA 4J4PC 3VXQA 1T7WA 4P2QE 1OGAE 5F97E 4PG2A 1HINH 3MROB 5JPMA 2DIJA 4Y4HB 1BZQK 3KNBA 2EKJA 3D3VE 3O4LD 4LVHB 4OZGE 5GRWA 1BJ1J 1S7XA 2UWEB 4KKCC 3MRJB 2EXWD 4XCFL 4Y2DC 4N9GA 5C0BD 3K3QA 2A38A 1GPOH 1KCUL 2KBGA 4TUKH 4NRXA 3VH8A 5DEZA 5HHMB 2FJGB 3FO1B 3IDGB 4YQXH 3FB5A 3LPFA 4LQ1A 1SJHA 1IAIH 2B1AH 3NTCL 2AJUH 1E27B 3FB8B 1YPZF 1NJ9A 2OP4H 4NKIH 2A0LD 2X4SB 1CE6A 5DQJB 4RNRB 3ARFC 5A43C 5DJ8B 1G7MB 2D7TH 2Y36H 2WZPD 4GFTB 4QRRE 2NY3C 4Z7VE 3ES6A 3QG7H 5GRZA 5B8CB 3T0XA 1RZFL 1BD2E 4XVSL 2B8OT 4NQSB 1RZIB 4M1DL 2KQNA 4AMKL 2XZAL 1DUZB 1QVOB 4LLUB 3MRGA 5SWZD 3MRMA 5EIQA 1EJ6A 4M8QA 5JW4N 4LSQH 3KPRB 1KC5L 1RZKL 4N0UA 1A1MB 4R4FL 5C0GB 3MUGA 2DM4A 2QSCL 3GK8L 4KJPD 1G7QA 4PLJD 2NXZB 1OB1B 3BSZH 5C9JA 4UIMB 1K4CA 5K9OA 4KRPC 4AIZB 4NKOA 1F45A 1FVDA 1L7IL 1P7HL 5F3HB 1QD0A 1C5DA 4HJGB 1RUQH 4QEGA 3NZ8A 4NO2B 4HUVA 1AFVL 5ETUA 5C0DA 3VD3A 4PJCE 1I85A 4WVRA 5HHQB 3WS6A 1HSAB 1CXKA 3B3IA 3HHRB 2UZIL 3G5YB 4JPVH 4ZMAT 1AI1H 2NW2B 2XT1B 2ZWLT 2EYSB 5JNYA 2EEAA 1VFAA 3LOWA 2NW3B 3A6BH 5DFVC 4Z78A 4TSAL 2I60L 1Y0LB 4DN3L 3EJYD 1MAKA 3KPOB 5CUSL 3PDOA 1YEGH 2VLJD 3TPUB 2HT2D 2C3VB 4D0BB 1CS6A 3KPPB 1J5OL 5AG8A 1UFUA 3R1GL 3L6FB 4G7VL 1HKFA 5K93A 1NMCB 1CVRA 4KJYB 5HDQL 4AEHL 1AIFB 2UWEE 3MRPB 3WUWB 1XGPA 32C2B 2JTDA 4EVNB 1I1AC 4ZUSA 3GSWA 2HTKD 5HHME 3SDDC 4X98A 1EFXD 1Z5LA 2E27L 3VGEA 3FTGA 4HIHA 1G1YA 2M26A 5F3BA 1BFOA 2QTEA 2JLLA 5C92A 5HYJA 3BIAX 5TDOA 5I1IL 4ODWB 5E8PA 5KSVB 3VI4E 4N5EC 4NUJA 4F7MA 5E8EB 5IEKA 1SMOA 1LNUA 3C8DA 3D25B 3IT8D 5J6HB 1FLRL 2WANA 3HZKB 2BY1A 3RIFK 4ZD3H 3TV3L 1WFOA 1H15B 1ZHKB 4X6BB 2V5RA 4C56D 3FQTA 2DWDA 3O2WL 5H2BA 4LPYA 4OI7A 1R3HA 1CDGA 2YUWA 5FA3B 2EDHA 5ACZA 1R3LA 4UV4L 3U0PB 3DVIA 5C0FB 3OR7B 1JWSA 4KMLB 1FNGA 3IXTB 3KPRE 4F15B 1GH7A 5ERWB 5DQ9A 5DD1L 4CMMB 4P2YA 1RIUL 1PKQB 2FIKA 2N1KA 4GLRH 3LB6C 4K7PL 1M7DA 1XT5A 4IMLA 3CH1B 3VMNA 1A2YA 1KIPA 4P46A 4NIKB 1IM9D 1T5WA 4ZDHB 3TVMC 4FQ1H 2E6PA 3FQUB 3EFFA 1NANH 3HRZA 4QYOB 4EZMA 1JCKA 3B9DA 4YDJA 3LN4A 4XMLH 1QA9B 1B4JH 1SBSL 3NIDF 1A7PL 5LGKA 1IBGH 1U42A 5C09B 1MFEH 1FE8H 3GNML 4M4RA 4X80L 2NZIA 2DWEA 3OKYA 2VC2H 1EUTA 2AXGA 4PFEA 5ESVA 1BJ1H 3CPLB 4OF8A 4ZUWB 4ODHH 2Q8BH 4FP8H 4ERSH 4Q9CA 2E9IA 3BMVA 4YXKH 2L7UA 4JPKH 4BQ8A 3DYOA 2O26U 5SWSA 3PUCA 2J3SA 4X7EC 4S1RL 4I77L 4MSWA 1T03H 4GQ9H 4HGWB 5DT1H 1JGLH 3MBEB 4WI2A 1FVCA 3GMRB 4F9LC 4KVCL 1ZTXH 1NUNB 4YH6A 3O6MH 3FRPA 1VEOA 4PG9B 2VXSH 4Q6IC 1KTDB 3IDNB 1XF3A 4MD4B 1CLZL 5GGUB 1PZ5A 1LEKA 2DIAA 4HT1L 1I9RH 3UEZA 3BD5A 5F7MC 2Y1VA 2GUOA 3UBXI 2R0KL 4G6FD 5D1XB 1T5XB 2VZVA 3DVNB 3BI9X 4H1LH 1AO7D 3ZE0F 1CGWA 2R4SH 1Q0YL 4N90D 3CX5J 2BVYA 1GIGL 1MREH 2XN9B 4XAKE 5JOPE 1F11A 4UDTA 1M6OA 4WFED 3MO1A 1GZQA 4HKJB 5C70A 3QIUA 3VXTB 3GMMB 1A7OH 4P4KD 1AXTL 1FNEA 3DMMD 2D3VA 4RMSA 4CN1A 2CK0H 4JO2H 2XZQH 4K9EH 3DLQR 1MIEH 4OAWB 2R56H 4HFWB 2AEQH 3C8HA 5E2WL 5L6YL 2D31A 4XPBL 4RQQA 1W0VB 2WM0A 4R7NB 3SKJH 2PKDA 4K2UL 4WHDA 2HJKA 2WUBL 1VENA 5T5FL 4M6NH 4Y4FC 1XGRA 3U1SL 4NKDA 3ARDC 5GHWL 3WIIH 3VXMD 1CCZA 4HDIA 2VYRE 5D2NC 3FQWA 5IMOA 4ENEC 1U8LB 3WD5H 4CGTA 2CKBL 5FK9A 1KJ3H 1OY3B 3I3EA 4N0FB 3V6ZB 2RQ8A 4D9LL 3RAJL 3FKUS 4HWEH 1KJMB 3ROOA 1PKQE 5GXBB 1WFUA 2XRAL 3G5ZA 4PJHB 3MBXH 1TQBB 5D7SH 4JQXC 5ACMA 3QUYD 4P0DA 2GSGB 5IBTH 2CDGA 1EGJA 1X5XA 1Y6MR 1UM4L 1T4KB 4YHYC 4HWZB 2ID5A 4ZUTA 5DJYB 1H8SA 4YUEL 4QWWC 2NMSA 1F58L 4CN4A 5C09E 3VJ6B 1MRDL 1QSZA 4U1IB 1YQVH 2Y5TB 2UYLB 2Y5EA 5M95B 4NN6B 4IIQC 4P23B 2WBKA 4P9ML 3WN5B 4P5TC 1TETL 1F8TH 1AKJB 5CJOL 1SY6L 5SV3A 4MLSA 4J1UA 1JGVH 4H0IA 2BNUA 4K3JL 4PJIA 2OM5A 4MMZC 4LVHC 5GZOC 3ALXA 5HHPA 3QPQD 4BK4A 4RAVA 5B39B 1EHLH 3NZHH 5HHNA 2V6HA 3AUVA 4UOW0 1VGEH 4WFHD 2XXMB 3S98A 3EZJB 1YN6A 1XIWA 4F33B 4PJ7A 4TUJA 1CU4L 5FAAA 3CLEH 4XNYH 2KDGA 3B2VL 4LHQB 1OF2B 1A9EB 1A9BB 4PJBA 1PQZB 4K55A 4JFYA 3BH8B 3SDXA 1KLFA 5IQ7H 4H0GA 5DMGD 2KKQA 3OHXA 3JWDH 3W11C 2N7BA 3LD8C 3O8XA 5FO9A 2XN9E 1XF5A 5F70A 1UACH 4J4PD 4H8WH 4L4TB 5LG1A 1C5CH 2MJWA 3NCEB 1IILE 3IDXH 2LQRA 2DD8L 4LGSB 4YHKH 5E8DL 5C8JA 1RUAL 4UNUA 3SGKC 3VXNB 1L0XA 5I1AA 1FJ1B 1NGWA 3QDMB 4Y19E 4Z0BH 1HHKB 1JWUA 1AP2B 1YYLL 1OT2A 1X5KA 3MV9D 4JQIH 4GAJH 4P4RB 1NBVL 2DQUL 1QBLH 4Y2DD 4OCLC 2ITCA 2ENSA 3CJJA 3WNMA 3GFUA 3NFNB 2C4FT 1QO3A 4PJAB 4R2GB 3PDGA 3RX5A 4MJIA 5JLZA 4WNQB 1IKNA 1BM3L 1NFDB 3OKEB 3VG9C 4XC3L 2IWGA 2I27N 1T21B 2EDQA 4JDZB 2R23B 3KYOA 3U0WH 1ZLSL 5H35B 4TVPE 3RWCB 4WY7H 1B90A 3QI9D 4WWID 1A47A 5HVFB 2EDRA 4PJHE 3W9EB 4XWOC 2GY7B 4OLXH 4HZLA 1ORSB 4LARL 4NO3B 2ITDA 2B1HL 4FRWA 3EOTL 3FOMA 3TJEH 4JZOA 2EXYC 2PYFA 1U8QA 3L9RB 4QOKB 1ZSDB 2OTUB 4OSUL 1P6FA 4P2OD 3GIZL 4W4OC 5IR1B 1F97A 1YEJL 4EQ2A 3TBVB 3SE8H 3BD4A 1D5BA 2EH7H 5SV4A 1OAQL 1N59B 2LTQC 4U6XA 4KRPD 1PAMA 1CICD 4L8CB 3FONB 3ZL4L 2ERJB 1ZA6A 2EYTB 4HUUA 4U3XA 3ZHDA 4M93C 5IB4B 3RWJA 3HZVA 4GW4B 5MENA 4PJIF 1NGQH 3W81A 4X9IA 5CMAA 3AU1A 4PRHD 2JJSC 4YAQB 5I8KH 4EN3B 1A6AA 3ZTNL 5IGXL 2GFBB 4PTUB 3DOSA 3JTTB 4R4NC 3MV8B 3O41B 4JB9H 3ULUF 1JNHB 1TJIH 4G9FD 1JRHI 1DEEB 4KTYA 2V5SA 1U8NB 3KLHC 3BDYL 4N1CA 1FORL 3UDWC 2C4XA 1T80A 1P7QB 1WFNA 4XPTL 5I73C 1MNUH 5FHBH 3RVXD 4PJBF 2YD6A 3DROA 4D2NA 3G08A 3SDXF 1MRCL 2EZ0D 5ID1B 3PJSB 4ONFH 5L7XL 4HBQA 1V5JA 1ACYL 4I4WA 4XNZC 1IGFL 4PJEA 3K1DA 4L4TE 3ULVC 4ELMA 2IPUK 5DDHB 4ORZC 1ZHLA 2QJDA 4UOW1 2DF3A 4MNQB 3WL9A 3GRWL 4ODXA 3P9LA 3PIQA 3DRTB 3IXAA 1J0KA 3EO0B 4HCRH 1CLOH 2FX7H 1WC7B 2VLLA 3QDME 4NQDB 4LNVA 1S8DA 1I7ZA 3SBWA 1T6VN 3TP4A 2C1PB 2YBRB 5KW9H 1F4XH 2YPLA 4JKMA 2EDOA 3MCKB 2EKSA 2ZCKL 4JM4H 1KN4H 2HFGH 3TO2B 4KZEL 4PJAE 1YNLH 3BUTA 3GJEA 2ZUSA 5GJTH 5GS0C 1X5YA 2W60B 3ZO0A 3VWJC 4X4XB 4RWYL 1INQB 1U92A 5DRZA 3X17A 4M5YH 1NFDE 3HE6B 4KK6D 1K8IB 5HPMA 2Z92A 3RUGB 3TT3H 2Y6SD 3NCFB 4R6UA 5T3ZH 1CIUA 2IALA 4KQ3L 1GGIH 1FIGH 5HDBE 5CKAA 4TSCL 5GGRA 1MCBA 5EU4B 5F93C 4N5ED 4DEPC 1ZLWK 2VDRL 1UJ3A 3QIBB 4NQXB 2LABA 5ALBL 2AEWA 4BUGA 4S0TD 2E7LC 4QRQA 2IH3B 3ESVF 4UQ2A 2FBJL 5DWUH 1V7NL 3RTQB 2BXZA 4Y16D 4QOKE 2QHRL 4DZBA 2F74B 3L3OA 4WTWA 1YC8A 1AHWB 2W0FB 4M3JA 1KEGH 5I0ZA 5D1ZC 3HE7C 4J6RL 5C0ND 3NPSB 3M1BB 4K3HA 3N1FC 2QLVB 4PRID 5IBUB 3D69B 2WINB 3TVMD 4OCWH 3G9VA 1RIVL 4BQBA 4PP1C 3QWQB 3AY4A 5E4EB 5K9KB 4LEOA 1CD0A 4FQPA 3MV8E 2YR3A 1U8IB 3WFDL 4X5LA 4XNQB 2MQ0A 3L3JA 5E99H 4NRZA 1GXEA 5FOBA 4P2QD 1OGAD 4JPWH 3VXPA 3QNXA 1XEDA 1WICA 3QQ4B 2EDKA 4ZYKA 4MXQD 1KELH 3PABB 2IPKB 1ZHNB 1JF1A 1U36A 5JHLL 1RQ5A 2N7AA 3CH8A 3WNLA 1E4XH 3D3VD 3LEVL 3VFNA 1BVZA 5FF6B 1ZGLM 2IF7A 4LPWA 2KQMA 1AGDA 1C8PA 3O4OC 4NZRH 4WTXA 4KTEH 1TZIA 1FZMA 4PJEF 4MNQE 2ZJSL 5DTFA 1QFPA 3RQ3A 4ELMF 4ZXBA 3RL2B 3T3ME 4NQDE 5J06A 3TLRA 4L3CB 4RFOH 2D4DA 1N2RA 1JHKL 1FYTB 2XWBB 1ZOXA 3V5HB 5IT2L 4GG6A 3VMPA 4QRRD 1T22A 1FO0A 3B9KB 4I3RH 4WO4D 1T1XB 1BD2D 3E8UL 1YYMH 1U91A 4EI5B 1W0WB 3RUGE 4S0SD 3MXWL 3V6OE 3OXRB 5DK3A 1TCRB 4GKNB 4JANA 2ORBL 2DQCL 5C0EB 5D2LB 2WIIA 4NT6B 2Y06H 5I74B 1OSPH 2BSTA 3MOBH 4KFZC 4OIIH 1G7JB 4MCZA 2X4NA 1YEEL 1TQCB 4BA8A 4CU7A 4HBCH 1T3FA 1I1FB 3V5DB 5H37H 3IKCA 4H1LG 4X4YB 1OWWA 5HI3C 3RU8L 2BSSB 2YZ8A 3SPVA 4PBXA 2FATL 3QUMA 1UB6B 1PEWA 2GY5A 1XCQA 5I1EL 3VXSB 1IARB 1RZ7L 2X10A 4OD3L 5A2FA 2VSCA 4WU5B 1IM3A 4PRDB 4FQXA 4UTAL 4NOBA 5LCVL 3W2DH 1NCDH 4LVEA 2HMID 1LO0L 4F7EA 4N8CL 1LDSA 3T0AA 5I1DB 1IRAY 5GS2D 4OLVL 5F88B 2AI0L 2VISA 4D0DB 4NN7C 3ARBC 1L4IA 3I84A 1IC1A 4U1KB 4ZTOL 3GUTA 4MJ2A 1CFNA 4NWTL 1CF8L 2Y07L 2NTFA 5IFHL 1EAPB 2I5YL 4XCFH 5BRZB 4WUUB 4NP4L 1TJGL 2BP3A 2ATPA 4DOHB 3DHMA 5FYLL 1KCUH 4HK0B 2HFEA 3SE4C 5FDWA 5GZOD 1ONQA 5L2JB 1X7QB 1D5ZB 2B2XL 3RNQB 1HH6B 1WT5A 3K4ZA 3ZKND 4X7SL 4Y4KC 3NTCH 4YHZL 4HKZB 2LU7A 4FQ2L 1G0DA 1ZT4A 2W59A 2VB5A 5HHMD 1WFTA 1EFQA 4LLQA 4OFDA 4XB7A 4N0CC 5BJTA 3MGTB 5IVZB 2LAAA 3FO9B 3PV7A 5D8JL 3LDBB 3Q6FB 5K9JL 1RZFH 2DLHA 4UIKL 4XVSH 3B9VA 4M1DH 4AMKH 2XZAH 2UV3A 15C8L 1JF6A 5KN5A 4LIQL 3GMQA 1A4KA 1WGOA 5KTEH 5IF0B 3SGJA 4GG6F 3EYVB 1KTLA 3MOQA 3ULVL 3MPCA 3HI6L 1KC5H 1NMBL 4N8VB 2ZUYA 4ZS7L 4IRZL 4BFIA 4R4FH 4U1LB 5E5MB 1SM3L 3KJ4B 4XBEH 1I4FA 2QSCH 3GK8H 3WE6B 3CFDA 4XH2A 5E8OB 5IHZA 2JJTA 4XI5D 5D2LE 4Z7UA 3UTSA 3KYAA 1RK0B 2H2PD 3KPRD 5HHOA 4GRWH 1T20B 3VFPA 1L7IH 3D39A 3VFGL 4F9PA 3HTLX 4JY5H 1YPZB 3C6LA 2JCCA 2NXZD 4EOWL 4E0RA 3HR5A 1AFVH 3LQAC 3K46A 1YN7A 2JE8A 2PTVA 1O5DT 3EOYG 5GS0L 4EUPB 2GJZB 3N1QC 1QLEL 4HV8B 3RWGB 3OAZK 4XCEB 4LGRB 4NQEA 5CWSA 2UZIH 5JHDB 5T1KB 3VXSE 3FFDA 5BCAA 2PO6B 4P3CL 5GS1A 3NCBB 4YNYB 4JJ5B 3ZDYF 1YMMB 3LIZL 5IM7B 2P47B 3CMOL 4O4YL 4H0HB 2YC1A 1IEBA 1VACA 3VXRB 1S7QB 1NCCL 2I60H 5DMKA 5I1KL 3QULB 5TGBA 4DN3H 3OJDB 4KROB 5CUSH 1I8LC 3VFTA 3INUL 3BP4A 3D2UB 3GJFK 1ND0B 4L9LC 5TF1L 4HG4J 1X5ZA 4LLDA 5CIPB 3ZYIA 3MMEA 1J5OH 3KHQA 1BWWA 3R1GH 3WFEL 4YC2C 2VR9A 2QQLL 4G7VH 5EU6A 3ZDZE 4CL7A 2WW8A 1VESA 2ICWI 1LK2A 1LO4L 1V3KA 4LPVA 3QIWA 5HDQH 1KIUA 3RHWK 2JIXB 1YA5A 2ADGB 1G7LB 4RDQF 1J12A 4X5XB 3T09A 3QJFA 4WUUE 1XMWA 5BRZE 4D8PA 4UT9L 4DOHE 4JHZA 5BV7C 3HCVA 3VRIA 1XH3B 3AAZB 3T3PE 5E6YA 4P2RB 1U8MB 1K4DA 3BZFB 2GT9B 4HUMB 4HX1A 1T04A 4ZUUA 1AQKL 2AJSL 2FL5A 1GAFH 1S9WA 3H3PL 2OXHA 3QRGL 5EORL 2AXHA 1D9KC 5GGVL 3PV6B 1TNMA 3TNMB 4XAKD 1XGQB 1WQVT 2OS7A 5JOPD 3O2DL 3DUUA 2OSLA 1VCAA 2P45B 3G6JB 1I3UA 4JVUA 5I1IH 3WNKA 4GRMA 2C1OB 1MCWW 4YHLH 3TO4B 1FLRH 5B21A 4K3DL 4YHIB 2G75A 1WISA 1WUNT 1LO2L 2W9EL 3QDJB 2W65A 3CLFL 3O2WH 1OQOA 1U2CA 2ILLA 3K2UL 4UV4H 1J9CT 1OHQA 4FABL 1JGEA 4X9BA 3UAJD 1IEHA 1MFDH 1Z9SA 1S7XB 2HKFL 1IGTA 3IJHA 1A7RL 5DD1H 4JFDD 4K7PH 2ED9A 4N9GB 1GOFA 4HIXL 1BF2A 2F5AL 1TZHA 4NRXB 4S10A 2WP3T 3VH8B 3L5IA 4OD1L 5IW3A 3FB5B 1MAML 1SJHB 1A7PH 1JPGA 1HNFA 2JCCF 1NJ9B 4X80H 3RWHA 1BWMA 4AYFA 5IJKA 1CE6B 3KR3L 3RVVD 2FHCA 5BO1L 3C60C 3ES6B 5JHDE 4JG1L 1EEUA 1UG9A 1ZLVH 3QQNA 5C09D 3T0WA 5LQBL 4Y89A 4GQPH 2WWMD 4I77H 3MRGB 1KCKA 3MRMB 2VH5L 3KGRA 3VXRE 4M8QB 3QYCA 4KVCH 3BEWA 3SQBA 2FR4A 4LSPL 1OAZH 2H3NA 2YRPA 5FYJE 4HC1H 4N0UB 1VA9A 3WDJA 4OJFL 3MUGB 1IQWH 3QDHA 3FN3A 4UB0H 3MBED 4HT1H 1YY8A 1VFBA 5C9JB 1K4CB 1ZVSB 3LN9A 5K9OB 3Q6GL 3OTTA 4NKOB 2HRLA 5KSUA 1EEZA 3K4DA 4NJAL 4OIBA 5D1ZD 5DVOA 1C5DB 3P0VL 3WV0A 3NZ8B 4BZ2H 1J1OL 1OTSC 1Q0YH 3FZUC 4U0RB 4X7FC 4MAYC 5ETUB 5C0DB 1GIGH 2IQ9L 3PHSA 1KOAA 4P2RE 2HVJA 5D1XD 4PLKC 1OWRM 4IDJL 2WSKA 1WBYA 3S36L 3EYOB 4DCQA 1JL8A 5EO0B 3FMGL 4KRNA 2XN9D 2P8MB 3N85H 3G6JE 3D0LA 5JNYB 1KPRB 5GSVA 5E2WH 2W0KA 3MRQA 5D7LD 5L6YH 2Q1EA 3LHPL 4XPBH 4S2SA 1INDL 4Z78B 4YHPA 2FH8A 1P2CA 3C09B 5INCA 3GSNA 4K2UH 3T1FA 2WUBH 5D71L 1CGYA 3PDOB 4K7PX 3U1SH 1TPXC 4PV8A 3QDJE 5GHWH 5K33A 3FN0H 1RJCA 4MWFA 4U6VH 1YQ2A 1NC4A 3JV0A 1P84J 1QTYT 5EZLA 1QBML 2IPTL 4ODBD 1KBGL 2CKBH 3KS0H 1GSMA 3T2OA 4D9LH 3RAJH 4E5XA 3REWA 3F58H 3G9AB 2R2EA 3B6SA 3W9DA 4PJDF 1MI5A 5CCKL 2BC4A 3MGOB 2XRAH 1VFMA 1JHTB 5IW1A 2DLGA 3W39A 3QP3A 3ULSA 5HXMA 4FQIL 4IOSD 3LV3A 4X5WA 4ZUSB 3GSWB 1X9QA 1UM4H 5EFIA 4TVPD 5E9DA 3FTGB 1B88A 5F3BB 1BFOB 2SEBB 4YUEH 4XXCA 4R96B 1F58H 3RGVA 4QF1A 1MRDH 5HYJB 1MFCL 4HLZG 5JIHA 5TDOB 3SDAC 5E8PB 4F7PA 3DX6B 2E5EA 4NUJB 4Z7WA 1LNUB 4AQOA 1B0GA 2YS4A 5CEZE 1TETH 5AUMB 4ZFZB 4UOJA 3N1GC 1SY6H 3FQTB 2DWDB 1CGXA 1I1YA 4K3JH 5H2BB 5HY9A 1R3HB 3ARWA 3CUPA 1MCSA 4H26A 4P23D 1YEIL 5ACZB 3GB7A 1R3LB 2BRQA 3LQAL 4I0CC 1JWSB 1AKJD 4KPHL 2AJ3A 4PJ8B 4N0UE 4KHXL 5DQ9B 3SGEI 3ARGC 5KVFL 1QSEB 3VWKC 1V8HA 2VLRA 3B2VH 4W6XB 2H32H 3KAAA 1FSKC 5HTSA 3WNNA 2VDKL 4CVZA 1KIPB 4P46B 4LKCA 4KDVA 1CIDA 2DQJL 3EFFB 3HRZB 2FJHB 4W6WB 1EHXA 5DK0A 1AD9A 3QEGL 1A14L 3O6FA 5DA0B 4Z9KB 3BO8A 2DWEB 3D85A 1S7VA 3SE9L 5ESVB 2R2CA 5E8DH 1QFWI 2DD8H 2DS4A 4XMPL 5H37G 4M7JL 3OKKA 4MZ3A 4YK4C 1CWVA 2V7HA 1AO7A 4LLVA 5SWSB 3H9SB 4L4TD 4MSWB 1YYLH 4LLWA 1ITCA 3BIBX 4AENA 4N1HB 1NBVH 2DQUH 3CK0L 4I8DA 1FVCB 5BV7L 1KLGA 5C1MB 1IGYB 1WV7T 4ZNCD 2G5BA 3QDMD 2APBA 5IV2A 5HDLA 6FABL 4NCC2 4R0LC 1PZ5B 1LEKB 5E2VL 1BM3H 4QRSA 1XR9B 4XC3H 5CS7A 5FA4A 1BOGA 4R2GD 1ZLSH 4M7ZC 1J0HA 3LAFA 2M2DA 2XI9A 5TDPA 1AE6L 5IIEA 1FH5L 1H0DA 2XY2A 4UDTB 1JRHH 1M6OB 4KI5C 4L4VB 5T3XL 3N06B 1UXWA 3RKDD 4AG4L 1CLYL 2B1HH 3E3QC 3MO1B 1GZQB 5FO7A 3AGVA 3MC0A 4DN4H 3QIUB 4XCCH 3EOTH 1FNEB 1KN2H 5BZDA 1X5HA 2XICA 3RWFA 4OLEA 4ZAKC 5HYJE 3GIZH 3U7WL 2D31B 1YEJH 4I9WE 1HH9A 1UA6L 4HK3N 4RQQB 1C7SA 4ZPVA 1S7RB 4Z7NF 4XPGH 2HJKB 1BFSA 4QOKD 2R15A 2XKSA 4Z7WF 1V3MA 2GK0A 2LV4A 4K23L 1OAQH 4YBQD 1XGRB 3A6CL 4XVJH 1GOGA 3MLYL 5KSBA 3AROA 3ZL4H 4KI1A 2Q7NA 1MY7A 1A6ZA 4P59L 4OQTL 4NPYA 5BS0A 5FK9B 3QA3A 5IGXH 3LH2L 1KCLA 4OBSA 3ROOB 2PYED 4BUHA 1QSEE 4YR6A 3VFVB 1FORH 3G5ZB 2H41A 1F3RB 4XPTH 4EN3D 2CDGB 4OLUL 4DGVL 1NAML 4LASL 4XP6L 1DBML 3MV8D 3ELAT 4NQCA 1FHGA 4UINL 1JMZA 2G2RA 2W92A 1MRCH 5L88L 1ZAGA 5KVDL 1P7QD 2E7MA 5C6PB 3MLPA 3CXHK 4JN2A 4LKXA 3O6KL 1IGFH 4JKLA 5F9OL 43C9A 1ZGLP 2YD5A 1MQ8A 1VPOL 3GBNH 3GSOA 5SWSE 3BT2H 3H9SE 4J1UB 2BNUB 4GBXC 4ZSOE 2DQFA 4YXLL 2IAMA 5HHPB 4JGJA 5KS9B 4RAVB 5HHNB 1IGML 1K5NA 4XCNA 2ZCKH 1IEAA 2X4UA 2YXFA 4NZDA 2OBGA 3WO4B 1YN6B 1MHHA 1XIWB 1GJIA 5F7KC 4PJ7B 2J5LC 4KZEH 3MA7B 5ID0B 2D9QB 4FFWD 4ZFOL 4Z7OF 4PJBB 2OMNA 3EOBA 5IVNA 4MCYB 3GSVA 2VAJA 4JFYB 1JPST 3SDXB 5T5NG 3OHXB 4M6OL 4ZG1A 1HHHA 1UXSA 1XZ0B 3O8XB 5FO9B 1XF5B 3NGBB 5IMMB 4L4VE 2XWTA 1RUML 4YIQA 5ALBH 5T3XD 3OKNA 2HJFB 1H3GA 5C8JB 5DLML 2FBJH 1V7NH 5EBLA 1EX0A 1N0XL 2QHRH 3QIBD 4FFVD 3BOVA 5I1AB 3ZT7A 4PYGA 1A02N 1NGWB 1PG7W 2W38A 1JWUB 2G5RA 4WHYH 5CJ8A 4Y5YA 2IEPA 1NSNL 4J6RH 3MCG1 1OCWH 3MREB 4BH8A 3SDCA 3RTQD 2ITCB 5KVMC 1EMTL 4JN1L 4LSDA 4KQ4L 4QLRA 5DJ6A 1QO3B 1MCEA 1NGXA 3QFJD 4D94A 4FTVA 4DKEH 4MJIB 3KWWA 5JLZB 1RIVH 2ICWJ 3ARPA 5C0RL 5DHYB 3FL7A 3S96A 3KYOB 3WFDH 2AQ1A 2DTSA 5F7HA 3STLA 4O2EA 1XF2A 1RJYA 4P48A 4GMTL 4MB5A 2Q8AL 2NY6B 2FYYA 5JHLH 1HHJA 5KVEL 3FOMB 5C6TL 5LGHL 4JZOB 3LMJL 3BKCL 3BZDA 4WW2A 2VRAA 1LEGA 3DSNA 4JE4B 4Z7QF 1N8ZA 2AV1A 3CNKA 4JFXA 2R2BA 1D5BB 2ZJSH 4LHUG 4KK9D 2FH6A 4U6XB 3JZ7A 4PRBB 5DGRA 1ZA6B 4JAMA 4HUUB 3UPAA 5KS9E 5BZWA 3RWJB 3SY0A 5MENB 2V5TA 3QCUL 4LOUC 1TXKA 5CMAB 3AU1B 3ULUE 4LF3B 5IT2H 4YGVA 1A6AB 1T89A 2WQRA 1OOAA 2VITA 1ZKAA 4PJ7E 3WIHA 3BRGC 4O00A 2RJMA 4AL8L 3EBAA 3SKUD 1FYTD 3E8UH 5HI5D 2DKSA 1U3YA 3PWVA 5F6HI 3X3GL 4PJBE 1TVBA 2DKUA 4UQ3A 1X6LA 3MXWH 5GJSL 25C8H 3B9KD 3SDXE 3DROB 3TFKC 2ORBH 2DI7A 2DQCH 2R69L 3W5MA 3OXSA 3G08B 3RZCA 2G60L 2X4OA 1WEJL 2J2ZA 4EI5D 1YEEH 3V4UL 5FB8A 4I4WB 2APFA 3PXHA 1QSFB 2VLKA 3PQYA 4ELMB 1ZHLB 1TENA 5IK3A 5JXED 3WL9B 1G6RL 2X40A 4U2ZA 4BELD 4ODXB 3HUJF 3P9LB 3IXAB 2FATH 4G80A 2QSTA 1QG3A 3QJHB 2VLLB 4M6ML 4HKXA 4LL9A 1S8DB 1WLHA 4OB5L 1I7ZB 1RZ7H 2EO9A 5DFWH 5I1EH 3OX8B 4OD3H 3IETA 3QQ9D 5J9PA 1V05A 2EKSB 5GGTL 4UTAH 5LCVH 5J89A 4QXTA 1S78C 4P46C 1LO0H 3VXSD 3KPNA 2WQ8A 4N8CH 3TIDA 3GJEB 5DHVH 4Y16A 4MJIE 1ZT7A 4JM2A 3V5KA 3IAPA 5DRZB 2AI0H 3QUZC 5C2BL 5HPMB 4X0KB 3VGAC 3SOBL 1F02I 2OR7A 5DO2C 2IALB 3UJIL 5GGRB 3VRLE 1CT8B 3BUYA 3EW3B 4ZTOH 4NWTH 1JNLH 1CF8H 4XAWL 3PWJA 1D5IL 1ULVA 1K2DB 4BFBD 3V0WH 1UJ3B 2FX8L 4G8GB 5FKPB 4M7KL 5IFHH 2I5YH 2ARJQ 4NP4H 1IT9L 1TJGH 1F4YL 5FYLH 3P0YL 2FGWL 1NBQA 3VGGA 4QRQB 1A1NA 4UQ2B 3UYRL 4DKAA 4KUCF 4L3EA 1JV5A 2P5EA 4TULH 3WBDA 4X6EA 4DZBB 3L3OB 5BRZD 4WUUD 4X7SH 5C2UB 1C12B 3D5OF 1PG7L 4YHZH 4WW2F 5JW4R 4FQ2H 5JZ7C 3ARGD 3K8MA 1A5FL 3WS3A 3MV7A 5F72S 4QTIL 2BDNL 5EZOL 5D8JH 5F96L 5JIKA 4B41A 3R8QA 2EDTA 5F9AC 4BSWA 4UIKH 1MWAH 4TYUA 3JVGC 1T1YA 4RX4A 3HRPA 2H45A 4XP5L 5MENE 5KOVC 5DVLA 4OI9A 2XIDA 4UT7L 1FVEA 2HJLA 4LIQH 2GKIA 1S5HA 4LEOB 3H2WA 4LLAA 4OD2A 5FGBC 1DSFL 3L3JB 3ULVH 3HI6H 4O9HL 2BZDA 1QFUL 4H1LA 4NRZB 4ZS7H 1NMBH 3D9AL 4IRZH 4QHMB 5FOBB 3VXPB 1SM3H 1OW0A 3QNXB 4UAOC 1G84A 1HEZA 4ZYKB 5IB1A 2X1QA 4JCLA 3RIAK 1BBDL 1JF1B 5GGRY 5INDA 4LBEA 3CAFA 4GOSA 4U1GB 2VUYA 3VFNB 1EEQA 3HPJB 3VFGH 2ZNWA 4EOWH 5MEPA 5F71A 2FJFA 1QSFE 4ELME 1BQHB 5AZ2L 5E95B 1TZIB 1NMAL 5GS0H 5DTFB 4OZFH 4K7FA 1QLEH 3BP6A 4ZXBB 1EPFA 4FQLH 2YD2A 1S7TA 3K81A 4L5FL 3OF6D 3U46A 1ED3A 4LVNB 2B5IC 4R9HA 5DVNA 4AZ8A 4YHOL 5ISZA 1MF2L 3ECBA 3MXVL 3QAZB 3MZTA 4NYLA 2QADC 1LQSR 3LIZH 4O4YH 1JWMA 1T22B 1IGJA 1NBZA 5DRXA 5JHDD 1NCCH 3IDMA 3K1KC 3IDIA 5I1KH 5T1KD 4IHOA 2PO6D 3GSUA 3INUH 3SKNA 3WMSA 2PXYC 1YMMD 1U91B 5TF1H 1DN2A 5I17A 5D6DC 3DO3A 4JM2F 3B5GA 3VXRD 3WFEH 3S35L 2QQLH 5E08L 4JANB 1GGCL 4KROD 1SBBA 1LO4H 3E6FA 2WIIB 4OM0H 2X4TA 2BSTB 5FYJD 3D2UD 3MRIB 4YFLF 1P7KA 4GKOA 4OFYD 2X4NB 4Q97A 3IVKA 1T3FB 4G8GE 2ADJA 1CXEA 3IKCB 1P6AB 4CDHA 1EHNA 1J18A 1PJ9A 5CJQL 1UWXH 1J11A 2F8OA 3S3SA 1ZXQA 4MA3A 2Z8SA 5CJXA 3RY5A 1AQKH 2JIXD 2NYYC 2AJSH 5CP7A 5IP4A 4M7LL 3SPVB 3H3PH 1OTTC 3QUMB 3QRGH 3RIAF 4ODVL 2NXYB 5EORH 2IG2L 4Q0XL 1XCQB 3MLWL 3F7VA 4NC1C 5B3JF 3U30B 2VAAB 1CE1L 1GRWA 4FQXB 1OP5H 4UNTA 4Y4HA 1QHOA 3U4EA 1WZLA 6CGTA 1LO2H 2W9EH 4OZGF 4R3SA 4GXUM 4R97B 2VISB 3CLFH 1PYWA 1AD0A 1T2QL 2XFXA 5JR1L 3TO4D 3K2UH 3GGWB 3IRPX 2FJGA 3EKCA 3FO1A 4FABH 2WBJC 1CL7I 3RGHA 1CFNB 1A4JA 2HKFH 2NTFB 4IS6A 2Z0BA 1SMAA 1AY1H 1C16A 2B20A 2AS5M 2ATPB 1AR2A 4NZJA 4HIXH 2F5AH 2HFEB 1W2KT 4XTRC 5FDWB 2V9TA 4KVNL 1ONQB 4OD1H 1YUHB 1MAMH 1P4BL 4Z7VF 1A1OA 2DQHL 1HCFX 2X4RA 4OGAC 5FOJA 1ZT4B 3KLDA 4XXDB 3KR3H 5BO1H 1AXSA 5F7UA 3NCYS 5SX4I 4JG1H 3KPRA 3QHTC 4JG0L 3E6HA 1A1MA 5C0GA 4TOYL 1IGIL 5LQBH 1M05A 3MLZL 4HUWA 4ODSL 4MVBC 3Q48A 2YRZA 1YC7A 3M45A 2VH5H 5DK2A 3TN0B 5KN5B 3GMQB 4AIZA 1A4KB 5CEZD 2P48B 2ZOLA 1G7IA 2CXKA 4U6YA 1KTLB 3STZB 2GQHA 4TRPL 3T2NL 2NY6C 4NO2A 4AEEA 4OJFH 5EBMB 1I4FB 4RAHA 3CFDB 5JPNA 4HH9A 3S4SG 5HHQA 3GJFB 3GMLA 5IKCA 3Q6GH 3THML 4Z7UB 2NY7L 5FYKE 3UTSB 4B0MM 5HHOB 5IJVA 4NJAH 3VFPB 1HYSD 3D39B 2BY0A 4JFHE 3MFFA 5I1LA 4X7TA 1H3VA 2JCCB 2EYSA 3TBSA 1J1OH 4E0RB 3HR5B 3MOAL 1CDUA 3GZKA 4W6YB 1T1ZA 2X1OA 2IQ9H 3T0EA 2BHYA 2BERA 2NW3A 3Q5OA 4IDJH 1SEBA 2I26N 4ELKB 3MNZA 3S36H 3KPOA 4DAGH 2A9ML 4NQEB 1OT1A 5CWSB 1OTUC 5HGBA 3ZDYE 2C3VA 3FFDB 2O5YL 1RZJC 3FMGH 3QXUA 4IRSC 4UBDC 4YJZL 5GS1B 2GW5A 5D7JB 4CU6A 3K8LA 3AVEA 2AQ2A 2VXUL 3T1WA 3LHPH 1QQDA 1INDH 4OUUB 1MCFA 4KJYA 4WHYG 1ACZA 5D71H 3SCMA 1DN0A 3VFTB 3BP4B 4LLDB 32C2A 4YDIH 3MMEB 4KH2A 3WJLA 1QBMH 2IPTH 5EU6B 1KBGH 3JUYA 1LK2B 4R7DA 3KJ6L 4LHJB 4W81A 2E8YA 4BYHA 4QNPE 1KF9B 2ESVA 3DX7A 2R1YB 4J3TA 2KUTA 1GGBL 3QJFB 5GGQL 4D8PB 5CCKH 4GUPA 1TITA 3K2MC 3VRIB 5SX5K 4WW1A 2XA8L 3OGCA 4MQXC 5E94B 3SGEH 4FQIH 4HX1B 1T04B 4ZUUB 4XP9L 3VI4F 2FL5B 3B5TA 3QHFL 1S9WB 1H15A 1ZHKA 1NBYA 3KPMA 2X09A 3BPNB 1T2XA 1QP1A 1FPTH 3I85A 4FQHA 3AM8A 2OSLB 1MFCH 1WCQA 1KB5L 1RUPL 4N9OB 3U0PA 4GRMB 3OR7A 1AR1C 5E6IA 5CEXA 3IXTA 3RI5K 3NCJL 2E6QA 2VDPL 4M4PA 2G75B 3TFKD 1R3JA 4JCMA 5HYJD 4OF3A 3RVUD 2IQAA 2W65B 3WSQL 5EA0L 1FGNL 1MLBA 2BOCA 4I9WD 1YEIH 4TUKL 4XWGL 4IJ3B 3GO1H 3BYTA 4WI3A 4BZ1L 1RU9L 4NHUA 3FQUA 3LQAH 3ZE2E 4KPHH 2DOCA 3CDYA 4KHXH 4LP4A 3IJHB 5EOCL 1E28A 3P77A 4NZTL 5KVFH 1EBPA 3S36X 3VFWA 2VDKH 4Z7UE 5DR5H 5HHOE 1G0YR 2VWEE 1TZHB 4ZUWA 2DQJH 1F6FB 2MMXA 1DL7H 3O3EA 5ECJE 1I3GL 4WFGE 3MUJA 2JCCE 2GITA 5JDJA 1A14H 4FFYL 4KGJA 1JPGB 4HAFA 1PBYA 4ZNEA 4P46D 5CJ5A 1EO7A 3RWHB 1G9NC 1WWAX 1RHFA 3PL6A 3SE9H 2C26A 4NQEE 4XMPH 2R9HD 4JQVA 4M7JH 2HYMA 2RB8A 4AY0A 1KTDA 3IDNA 3O0RL 5MERB 3C5JA 3EAKA 1V3JA 3ILQC 1A6VH 5DS8B 2VXTL 3RNKA 3MYJA 3CK0H 4U6HA 1MH5B 5BV7H 5F6IB 3BEWB 1MY5A 3DVNA 3DETD 1EVTC 2H3NB 4G42A 5HD8D 5SWSD 4Z5RA 1JK8A 3BGAA 3C5ZC 5F6HJ 3PWUA 1I8IA 3TZVC 6FABH 3BX7C 4X4ZA 2EE3A 3QEHA 5EU6E 5E2VH 1YY8B 1VFBB 4MA7L 1T0NB 1A3LL 2A83A 5KSUB 1EEZB 2X89A 3CFEA 5EUKA 3TA3A 3MJ7A 1AE6H 1FH5H 2EIEA 4OAWA 4Y19A 2VLME 1MJUL 5T3XH 3RRQA 4KUZL 3SE3A 1CLYH 1WBYB 3X13A 2V9QA 2BHUA 3MNWA 3MJ8A 4H8WC 12E8L 5HVWA 3JWOC 4MNGE 3D0LB 5GSVB 3MRQB 4XHQA 3QIUD 1UA6H 4S2SB 4YHPB 1P2CB 4YE4L 2VDQL 3GSNB 3T1FB 1F6AA 1L0YA 1KJMA 3A6CH 4PV8B 5A16B 1UENA 3MLYH 4MWFB 1NC4B 4P59H 3QDGA 4OQTH 5EZLB 2GSGA 2R8SL 1VDGA 1CDJA 3DARA 3LH2H 3REWB 2APXA 2APTA 2YKLL 2R2EB 4G3YH 4A6YL 1J7VR 1MI5B 3VJ6A 4EEEA 1WJ3A 1KB9J 3F62A 2Y5TA 3BPOC 3J7HA 5IW1B 2K1MA 5CBEA 4OLUH 4DGVH 1NAMH 4X5WB 4LASH 4XP6H 3RVTC 5EFIB 5BOZG 3DVGB 4UINH 4JRWA 5L88H 4I0PC 5I9QC 5KVDH 2P43B 2FX9H 3RGVB 3B9AA 2UZXB 4NUGL 1I9IL 3O6KH 4F7PB 5F9OH 1MFAL 4LLMA 4Z7WB 1NGPH 5MI0C 3BKJH 1S5IL 1VPOH 3JXAA 3I6GA 5E1AA 2DDQL 4OZFG 1I1YB 1A9EA 5HY9B 4UV7L 4YXLH 3CUPB 4H26B 4MA8H 4HS3A 4V2CB 2WIMA 3UZQA 3GB7B 3BH8A 1IGMH 4FQ1L 4I18B 4DKFL 4RGNB 4ZOBA 3WLWC 5B3NA 3LRSA 2JJUA 1B4JL 3QZWG 1IBGL 2CDFA 2P46B 2P7TA 4XNUL 3TH2T 1FL3A 1FYHB 1WT5C 2VLRB 2QL1A 1CR9L 3ULUD 1RZJL 4CVZB 5I8CB 2YSSA 4LKCB 1XIWD 5IFJB 1LEIA 2Q8BL 5F9WB 2OLDA 4ERSL 4RRPG 3IRZA 3VXNA 4JPKL 5DK0B 3LEYH 4ZS6D 3O6FB 2NY1C 5FUZL 4N0YL 4O02L 1U3ZA 3BO8B 1RUMH 4PJ9B 3D85B 1OM3L 5A3IC 1EDQA 1T7VA 1ZTXL 1VEPA 5DLMH 2HLFC 4GXVH 4APQA 3OKKB 3O8XD 1DCLA 3IYLW 3FOLA 3LKOB 1JFQH 3SGJC 3TH4T 2V7HB 5DJZA 4OF7A 4LLVB 4MA1B 1UB5B 1IMHC 4LLWB 5A2LH 4AENB 1NSNH 3O3BA 4XPFL 1E4KC 4JDZA 5H35A 1EMTH 4AIXA 3TF7C 4Y5XC 4JN1H 4HIIA 4KQ4H 5IV2B 1UADC 3W9EA 2A6KA 4IOIA 4OKDA 3QXDA 3V2AR 1U8JA 4LQFL 4JRXB 1MREL 2I9TA 1EH9A 5I75C 2FLRT 4QRSB 2HG5A 1Q9LB 3C6LC 2D0FA 1EV2E 4LDOB 4NSKA 4IRJC 2NQCA 5FA4B 1EAJA 5C0RH 5J11B 1BOGB 1KULA 4M9PA 4JO2L 1KENL 4K9EL 2RCSH 4MJID 1NLBH 2OTUA 1MI5E 5TDPB 3WYRA 5MEOA 5IIEB 3MLXL 4XCYA 1H0DB 1XF4A 4XRCB 4XPAL 4FG6C 1P5UA 1U41A 1UXWB 4DFHA 5LWYL 1G1CA 4GMTH 2Q8AH 1QKZL 5FO7B 3VGDA 2X42A 5KVEH 5C6TH 5DYOA 1ZT1A 5BZDB 5C9KA 3BKCH 3SO3C 2B4CH 2EYTA 1M7XA 2XPGA 1L6XA 2VQUA 2OI9C 2NY6D 4CN6A 4NQTA 1HH9B 4KV5F 4Z7WE 4ZPVB 4IOFD 2ATKA 4F7TA 1L6ZA 2GK0B 4TNVF 1P9MA 5ESAA 1U8NA 1NUGA 3QIWC 5KSBB 2DI8A 1ES0A 1A6ZB 1LHZA 5IBTL 3QCUH 5BS0B 4LVOB 4RGNE 3VXUA 3QA3B 4X99A 4BZYA 2VQ1B 3U9PL 5HVHB 5I76A 1G9NL 5GISL 4AL8H 3TBTB 3A6OA 4YR6B 3D6GA 2VLRE 3BJLA 5MEND 4WI7A 5CLTA 3X3GH 1CGUA 1CBVL 5EBWA 5DD6A 4WV1A 5GJSH 1AH1A 2YA2A 4NQCB 2H26A 4MNQA 2EXWC 2NPLX 3RY6A 2G2RB 3DRTA 2D7NA 3WFHA 5J4MA 3F5WA 1WEJH 3UTTA 4NQDA 3OBAA 1I75A 1NQBA 5I1CL 3V4UH 2CKNA 4LKXB 1EHLL 3NZHL 3OJ2C 2DLIA 3QQ3A 3MCKA 1FNHA 1U3HB 43C9B 4MLIA 4JFZH 1HWHB 3CZJA 4YDVA 4CADA 1G6RH 3TO2A 1MCQA 3GDBA 2DM3A 3H7BA 1H3UA 4XNYL 1KEML 1IC7L 2A0LC 2NY5C 1KXQE 4L8SC 4OB5H 3GSRB 3HE6A 2DQFB 2WUCL 2IAMB 3WHE0 3X3FH 1QFWM 3GMNA 3V6OA 1NFDF 1JZ7A 3MRLA 5GGTH 5IVXA 1Q72L 5GRJL 4WEMB 1MHHB 2OJEB 5EU4A 5DMIH 2O93L 3VFOB 1H5BA 5D9SB 1LE5A 3ETBF 1KYOK 4JRXE 5EOTA 4N1EA 5F9JA 5C2BH 1KSRA 3DURA 4H8WL 1FO0L 3ARVA 3WFZA 3SOBH 4QHKI 3JWOL 2C3HA 4S1DC 3IAGC 3QSKB 5JQ6L 3MA9L 1ZLUH 3UJIH 4KJPC 5IJKC 3OMZA 1HHHB 3BH9A 5D70L 3VD5A 4AQ1B 3CIQA 4XAWH 3P9MA 1D5IH 3BE1H 2QSVA 2FX8H 4M7KH 4LHUA 3VGHA 1IT9H 1OARL 4YIQB 3BDBA 3OKNB 4IEFB 1F4YH 3P0YH 2FGWH 1II4E 1RMFL 3EYUL 5EBLB 5HDOA 1EEYA 5DRWB 4GRLA 1UKSA 5EU3A 1RI8A 2F9BT 5JMOC 1M7IA 4IMKA 3KPQB 2WLYA 1Z9LA 1PG7H 4Y5YB 1M1SA 2EICA 1C08A 3QB7C 5K9KA 5BVJB 3MRBB 2ZG1A 3SDCB 4BH8B 1A5FH 5CGMA 4QTIH 2BDNH 5EZOH 5IHBA 5KSAA 4UT6L 2Q6WA 5DJ6B 3CD4A 5F96H 5KSBE 4DJMA 4UI2A 1T7YA 4FTVB 3VW3L 3KWWB 5HGGS 3EJYC 4XP5H 5D1QA 4JFQA 2VERN 4JFPA 5BS0E 1Q9WA 4UT7H 3OPZL 3PABA 5T5NF 4OM1L 1ZHNA 2HT2C 3S96B 2CUIA 4ZUVB 4KK5D 3TJEL 4YDLB 4MHHI 3WLBA 1DSFH 1B0WA 4O9HH 5HVGB 2DQIH 2Q76A 1QFUH 1F5WA 3D9AH 4KKBD 5ICXA 3STLB 4O2EB 1H3TA 4M8VA 2PUQT 2YOCA 1XF2B 1RJYB 2AERT 3CFIC 3M17A 5EZIL 1TTUA 4KGLA 1ZLVK 2FYYB 1HHJB 4Y5VC 4GS7C 1AXIB 2FWOA 4L1HA 3ILQD 4JFEB 2P5WA 1KCRL 2XACC 3HG1A 4Z7QE 4WW2B 1RK1A 2FHFA 1LEGB 2AK4A 5J1AA 3T3MF 2HTKC 5L0QC 4FQCL 1NGQL 5AZ2H 5I8KL 2OR9H 3BIKA 5MP6L 2R2BB 1RFDL 4G8FA 1IQDA 4L5FH 1TJIL 3AREB 3V6FA 5GGSA 4NQUA 4YHOH 5J12B 1MF2H 4EI5A 5DURB 5C07A 1GCFA 5BZWB 3HMWH 3SY0B 3UPRA 5LXGH 3CDCA 4ZXBD 4GKNA 2CKBA 4YGVB 2YA1A 2VITB 5HYSG 1G7JA 5D72L 5IVXF 4J3SA 3ARFA 4CU8A 1I1FA 3H42L 3PWVB 3TT1H 3HC0A 1Z6JT 4XXCC 5ELIA 3S35H 4URTB 1VEMA 2E7HA 2NTSP 3NFPA 2L7JA 3KPSA 4DFIA 4HCRL 5DJDB 2X4OB 4D3CL 1PG7X 1UB6A 4PY7A 3VXSA 2P8LA 4WU5A 5KW9L 2VLKB 3WHE1 3PQYB 5CJQH 3N9GH 4JM4L 5FYKD 5EOQL 5CZKA 3HC4L 5IK3B 4WIQA 4JFHD 5HYIA 3IU4H 4G80B 1DR9A 1VFOA 4ODVH 4HKXB 4Q0XH 1SY6A 2A6JA 4M5YL 4NBZB 5A40E 3MLWH 4NGHL 4D0DA 1CDCA 3FFCA 1DJSA 3IETB 5J9PB 3RJQB 5T3ZL 3ZKXC 3MRKA 2HFTA 1GGIL 4ONGH 3BN3B 4QXTB 1UZ6F 4U1KA 2NXYD 3KPNB 3TIDB 4JZJC 4FTVE 2F19L 1MCIA 2Z35A 4JM2B 1EAPA 5SX4H 5D93C 4FQXD 2H32A 1T2QH 5JR1H 4HG4K 1DLFH 4G6AD 5T1LA 4Q58C 4G5ZL 5DWUL 5KZCB 5L8KB 3TBWA 3BUYB 3R06A 3RNQA 4HXBL 3PWJB 1MHCB 1Q9KA 1BMGA 1XGUA 2PR4L 5F7EL 3WKNA 4HS6B 2NZ9C 3LKQB 1A1NB 4KVNH 3MGTA 5CGYD 3ZE1F 4JFEE 4L3EB 1JV5B 2P5EB 2D2OA 5FGRA 3B9EA 3Q6FA 4X6EB 1P4BH 4OCWL 3UJJL 2DQHH 3IDYB 3SKMA 4P4KC 3H7LA 3DMMC 4MXWL 5C0CA 4Z77A 2DM2A 4X9FA 5IF0A 2HA1A 3IJSA 3WS3B 3MV7B 1NUFA 1OGTA 3N0PB 4KAQL 3LQZB 1I3VA 3O6LL 4NNXA 1HSBA 1WCBB 4JG0H 2XY1A 3DO7A 4TOYH 4BSWB 1IGIH 3SDDA 3S35X 1ORQA 3MLZH 2JELH 3WE6A 4XB8A 2J88L 1UC6A 2ZSWA 4XP1L 2HJLB 1S5HB 2BX5A 4OD2B 1E4XL 1T20A 3JV6A 5D2LF 4KXZI 4TRPH 4OIAA 4H1LB 2J4WL 2M1KA 2HT3D 3BP5B 1QRNA 4KTEL 3RVWD 3TN0D 4TSBL 1HEZB 1IZJA 5IB1B 2NY5L 2GJZA 4PGBA 1P4IL 2NY7H 2WLZA 1IVLA 5INDB 4LBEB 1JZ5A 2DMBA 5TPWL 4MQSB 3BJ91 2Q3ZA 5FUCC 1DP0A 5MEPB 3TPKA 1OAKH 4WI5A 3MOAH 1K9TA 1U8PA 2VL5A 1PGRB 3UTSD 2VXQL 5HHOD 3X11A 5GS3A 4K7FB 3D39D 1FP5A 3BP6B 3QULA 1S7TB 3GM8A 4PY8I 4WFGD 3U46B 4HULB 1ED3B 2A9MH 1EJOL 2XG5A 5ISZB 3ECBB 3WDHA 3BD3A 4LMQE 4HF5L 5CIPA 3QEQE 5I2IA 2MKLC 9CGTA 1KCSL 1J0IA 2VXUH 3FRUA 5ITBH 3MJ9L 4NNYB 3T2QA 1JWMB 4XP4L 4NQED 1H3XA 1PZUB 1IGJB 5DRXB 5HJ3A 3IDIB 3REVA 4OIIL 3ZDZF 5C86A 1DQTA 3MLSH 3U2SA 2JKXA 2OL3L 3SKNB 4X5XA 5D7JD 5I71B 3UC0L 4WJ5A 4LPXA 1R5VA 1XH3A 2X9YA 5I17B 4OI8A 2IBGA 1UQSB 1I7RA 4KK8D 4P2RA 3BZFA 1LVEA 2YD1A 3E6FB 4NCC1 3T3PF 3KJ6H 2X4TB 1P7KB 3IVKB 5KOMC 1GGBH 2MCG1 3PV6A 2ADJB 3CC5B 3QUXA 2EDWA 5EU6D 1JTTA 3LSOA 4LCCB 4LPUA 3G6JA 2NR6C 4QCIB 4ZQKA 2XA8H 3QIWD 4Q9RH 3ZYZA 1QOKA 2AJXH 4XP9H 4L3EE 5ILTL 2P5EE 3QHFH 3GRWA 4RFNB 3QDJA 4P3DA 3Q5TA 3V4VH 4EIZC 2VLMD 5B3JE 3F7VB 4HUXA 2CUMA 3O2VL 1P5VA 1KB5H 1RUPH 3MV7E 1PDKA 2YUVA 2GJ6E 5H94B 1EO8L 3NCJH 3U4EB 2BNQA 2VDPH 3S4SA 2F15A 1I3RB 1G9MC 2CRYA 5DEFA 4R3SB 5IBLD 2HP4A 3BPLC 3WSQH 2MKWA 5EA0H 1FGNH 1PYWB 1AD0B 1FNFA 2XFXB 1HNGA 2AXFA 2H8PB 4XWGH 1OLLA 4BZ1H 1P84K 1RU9H 1R6VA 4RA3A 2P49B 2IADA 3X12A 2Z4QA 1MJ7H 1A4JB 5EOCH 4IS6B 2CJUL 4NZTH 2EDDA 3KVQA 1C16B 4KZDL 3ARZA 4Y4FA 3RBSA 1JPTL 2XZCL 5DD0H 3QI9C 3WIFA 5DFTA 3BPCB 1A7NH 3ZHKA 3RDTA 3UTZB 4YZFF 1C5BL 1I3GH 4CDGC 5EC2A 1A1OB 1DUYA 3EGSA 2JB6A 4FFYH 5CINL 4NCDA 2D4FA 4QRUA 2X4RB 3UCRA 1ZVHA 2DJSA 3T0BA 5KTEL 1B6UA 2BXYA 2ZNXA 4XVUC 2VDOH 5I66A 4DGIL 1AXSB 4P2OC 2GHWB 4JQXA 1KFAL 3DBXA 5ISZE 3E6HB 4S1DD 2OZ4L 4XBEL 4XC1L 1M05B 4HUWB 3O0RH 2VKXA 3PWPE 4OZHB 1ZVSA 2Q3AA 2GIYA 2VJXA 5DK2B 2VXTH 1CICC 1LO3L 2ZOLB 3H8NA 4HGMA 1G7IB 4U6YB 5BXFB 4EDWL 4JY5L 1J86A 3EDDA 1KJ2L 1SYVB 1KIQB 3V7AE 2NY0C 3PHOA 2JB5L 1F6LL 4P5TA 5JPNB 4HH9B 3GMLB 5IKCB 4MA7H 4LPTA 1A3LH 5IJVB 3EYOA 1D6EA 4V1DA 4K3GA 3MFFB 3VD9A 5EO0A 5I1LB 3RVXC 4X7TB 2P8MA 2JJWA 3TBSB 4RGMC 1T1WB 1T1ZB 1KPRA 3G5VA 2ENYA 3OZ9L 3T0EB 1MJUH 2EZ0C 3BZEB 1NEZG 3KPLB 3G6JF 4KUZH 1SEBB 4HAGA 3SO5A 3MNZB 5J3HC 4DTGL 4QGYA 3OL2A 5LAXA 3JBG7 5HGBB 1JPFA 1T89C 3EOAB 5J57B 12E8H 1EXUA 2QV2A 1DANU 5HPOA 1VERA 2CLVA 5DXWA 4GSDL 4BQ9A 3DJ9A 1QQDB 4HGKC 1RUKL 4YE4H 2VDQH 2QQKL 2Y7QA 3FHQA 5TFSL 3SCMB 1DN0B 4NZUH 3ZDXE 3MGOA 3RZCC 2Z9TA 3M07A 1JHTA 2Q86B 3SGKA 2C7UA 3L3KB 2R8SH 3F7QA 5IQ9A 4R7DB 5JA8B 5EH1A 1GAFL 4KK6C 2ESVB 4AEIL 1QFHA 3DX7B 2SEBA 2YKLH 1NC4D 2Y6SC 4R96A 4A6YH 2KPNA 1Q0XL 4GUPB 3TEUA 3GHBH 4WW1B 3ZSSA 3DX6A 1YEHH 3OGCB 1EIBA 3U48A 3VI3E 3E2HB 4YHLL 4J7RA 1PX3A 1R5WA 5DD5L 4G9DA 2R29L 4FXGA 5AUMA 3FT2A 1MI5D 4ZFZA 2KL6A 3BGFC 5KBNC 1NBYB 1IC5L 3KPMB 1K6QL 2LVEA 4NUGH 4FQHB 1I9IH 4HS8H 4Y16C 5E9DD 2C9AA 4QO1A 5I30L 1MFAH 2HLAA 1CXIA 5E6IB 5CEXB 4PJ8A 1MFDL 3RGVD 5IUSA 1S5IH 1OD9A 3NOIA 1R3JB 3WEXA 5DHVA 5C0NC 2DDQH 5J6GA 3S3JA 2FLBT 1QSEA 2IQAB 4HSQA 4OZHE 4UV7H 1N3NA 1MLBB 5ALCH 2BOCB 3JUZA 3HC3L 3HR6A 4WI8A 3DV6A 4O51A 1S7SB 1PSKH 1UCTA 4NHUB 4K8RD 3CFKA 3HI1A 3R8BB 2FJHA 3NABL 2CPCA 4W4OA 4DKFH 3PGDA 4OZIB 4J3XA 5AZEL 2DB8A 4DK3A 2AP2A 1WBXA 3EYQD 1E28B 3P77B 4XNUH 2V2TA 2F54A 1CR9H 3VFWB 3L3GA 4RGND 1RZJH 3CSPA 1DBBL 3O45A 1T7XA 3DXAB 1G6VK 3O3EB 1F2XK 4R4BB 4MXQC 4KDTC 2GITB 2JJSA 2VLRD 1RJZA 4MDJA 4G43A 3ALPA 3H9SA 4ONHA 5FUZH 3AB0B 3LZFH 3T0EE 2F5BL 4N0YH 4O02H 4ZSOA 4JPIA 2XNAA 4CJ0A 3BQUA 2PTUA 3PL6B 5DJAA 1OM3H 3UDWA 4BM7A 1IGYA 1OAZL 2CXGA 1YJDC 3O6FD 4HC1L 3DGGA 1U3JA 4PD4K 3RJDA 1QPPA 4TUOA 1IQWL 3G6AA 4X6CA 1GOHA 4UB0L 4PJ9D 3D85D 4LSRL 3B5HA 3RIFF 3L5JA 1F42A 3C5JB 4OCMC 3P4MA 4LSUL 4DUWA 1N7ML 1XR9A 4LK4A 3RNKB 1OW0C 3MYJB 4XPFH 3TYFB 1W72L 4LSVH 2WP3O 4U6HB 1CFSA 4XVTL 4G42B 4UNVA 1BBJA 4Z5RB 1JK8B 4BZ2L 2NZ9D 4D0CA 3PWUB 1I8IB 3MLRL 5CD5D 4LQFH 5T33H 4WO4C 3QEHB 4L4VA 1A6WL 4WDIA 4FZEH 2YRLA 2A83B 4Z76A 2ESVE 4NRYB 1CGSL 3CFEB 1KENH 2O5ZH 2NNAA 5EUKB 3TA3B 2ICWA 3MJ7B 4HPOL 3MLXH 3N85L 1OD7A 4Y19B 3ZSTA 1ZWIB 4XPAH 3DSFL 1G9ML 5LWYH 3RPKA 1S7RA 1QKZH 3VWJA 4OZFA 4TVSa 3X13B 1CQYA 3MNWB 3MJ8B 1QRKA 3FN0L 3OWEA 4U6VL 2NCMA 3PNWB 4LRNL 2E9WA 4OCYL 2RGSA 4ETYA 1ZEAH 2EE9A 3QZWA 3F7PC 3H3KA 1F6AB 2FEEI 3F58L 5DA4A 4K71C 2E7LA 2Z8RA 3VFVA 5MEQB 2UUDH 3QDGB 2HMIC 2ZUQB 1URLA 4RRPA 4Z0XA 3U0TA 5T3ZE 1ZS8A 3V4PL 5DJ2A 3D18A 3CVHL 3DX8B 4OZIE 3U9PH 3HE7A 3HNVL 1G9NH 5CJXC 5GISH 5F7DA 4FZ8H 3LRHA 3NCYP 3GSXA 5BS0D 5CBEB 3MLVL 1CBVH 4P5MA 3DXAE 4G6KH 2R4RL 1D3CA 4OQ1A 4M5ZL 2FNBA 4Y4HC 4DWHA 4X7DC 5E7BA 4ZNEE 5I1CH 3S34L 2ZUVA 5KS9A 4NQCD 3O2DA 4X7CC 1J8KA 4H5SA 5A2KH 3ZKNC 4LLMB 4OFPA 1AGFA 2AV7A 1AC0A 1HIMH 3B8SA 3MA7A 3I6GB 5E1AB 5ID0A 1KEMH 1IC7H 2CRMA 4F57L 1U3HD 2F8VA 3PWLB 2WUCH 4X6CF 5EU7E 3WFBL 4MCYA 4HS3B 2OYPA 1TVHA 1N5AA 4LAJH 4L4JA 1Q72H 4QHNB 5GRJH 2NR6D 4M61B 1ROWA 3LRSB 5D96B 1FC1A 4N5UA 1XZ0A 1CXHA 2IAMD 4G6ML 3ULVF 1UWXK 2CDFB 2P7TB 5B8CC 5IMMA 1FL3B 5CKGA 3S97C 2HJFA 1FO0H 2YSSB 3JWOH 3BHBA 1LEIB 5I6XB 5JQ6H 2HRPH 3MA9H 4G8EB 1KIRA 3ZYJA 3DV4A 5D70H 2Z8WC 4K3EL 4H20L 4X9GA 4XI5C 1LILA 2MPAL 1NCWL 4P9HC 2H2PC 1DVFB 1OP5K 5JDSA 1OARH 1PD6A 3MREA 1JJUA 2GYSA 2NXZC 4JLRA 4O2CA 4GKSA 1RMFH 3EYUH 3EHBC 4DQOL 4APQB 3MRDB 1VADB 3FOLB 1EZVY 5DJZB 4RMRA 1U6AL 3ZKSD 4CUCA 2AQ3A 2EIZB 1B0RA 3T65A 4LFHG 1QYGL 4JY4A 3O3BB 4RMTA 4F80A 5DHYA 5E00A 3Q2CA 3QUMH 3PF2A 4HIIB 4UT6H 5C08A 3S6CA 2A6KB 4IOIB 4RGOL 3QXDB 1U8JB 2BVUA 2NX5A 3QDGE 3VW3H 1JRHL 2I9TB 5FHAL 3SDCD 3T8XB 2HG5B 1P69B 2ED7A 3OPZH 4OM1H 4NSKB 3STBA 4DN4L 4XCCL 1KN2L 4GRWB 5EDXA 4FTVD 4XVUD 5MEOB 4JKKA 4XCYB 2RR3A 1XF4B 2OK0L 5EZIH 4AEFA 1WAAE 4XPGL 1T6WA 3Q5YA 5E0QA 1UH3A 4U1MA 1HQRA 3IFOA 1ZT1B 5DYOB 3ARBA 4XVJL 3IKKA 1KCRH 1NMCC 4HMCA 4PRBA 3CSYA 4Y88A 2P8PA 43CAA 3DX9B 1A3RH 1XGTA 4KV5E 2XPGB 4LDEB 1J1PL 3AS2A 4FQCH 2IFFL 4KUCD 2BCKA 3I50H 35C8H 1B9ZA 3P4NB 4LF3A 5KS9F 2ATKB 4F7TB 3EYSH 2NY0D 3KG5A 5MP6H 5FEBA 3WJLC 1RFDH 1HZHL 4OFVA 1ZMYA 5IEHA 3KYMA 4FMFA 5ESAB 3VU2A 2R0ZL 2X41A 4PJ7F 3SE4A 1JZ6A 1MCCA 3FB6A 1ES0B 3I6KA 4HJJL 3HLAA 4CBPA 2V9RA 5J13B 3SQOL 3QPXH 1SJXA 1YEKH 4Y4KA 4UU9A 3ARED 2H2SD 3VXUB 4X99B 3CFJA 5JMRA 3E0GA 5I76B 5D72H 4IDLA 2BNRA 4QHLB 1EO5A 1PX4A 2ZG2A 3UZEA 4YFLI 3H9ZA 5J3HD 3MRRA 3H42H 2ZUXA 2EE6A 2A74A 1QSFA 5EBWB 5DD6B 3UAJC 3U79A 4U1NA 3ISWA 4WV1B 4Z8FL 5GRVL 2LVCA 4ETQA 1I7TA 1HI6B 2H26B 5A1AA 3GBNL 3WFHB 1H8OA 3F5WB 3QJHA 4D3CH 3UTTB 2EEBA 3CFBA 3BT2L 4ZFFA 4MQTB 4RMWA 5LBSL 4ZFGL 4Q9BA 3OX8A 4F15C 2I9LA 5C6WH 4CMHB 1D5MA 1CZ8L 1JZ2A 3QQ3B 2MHAA 3RZCD 4YDVB 5EOQH 4CADB 3HC4H 3VXOA 3H7BB 1PY9A 3VG0L 4C56E 3RVVC 2VLKD 3PQYD 4NGHH 1JI2A 4X0KA 2VQTA 3GMNB 5BW7C 3MR9A 1J1XL 1WITA 3MRLB 4NKMA 5IVXB 1CT8A 2WWMC 4JO4L 1H5BB 1FZJA 1LE5B 1K2DA 2XKNA 2F19H 2LE9A 3VRLF 3PP3H 3P2TA 4G8GA 5FKPA 5EOTB 5F9JB 4MJ4A