3NPZB

Prolactin receptor (prlr) complexed with the natural hormone (prl)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
204
structure length
202
Chain Sequence
b'QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Structural characterization of the stem-stem dimerization interface between prolactin receptor chains complexed with the natural hormone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 34
structure length 202
sequence length 204
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3npzB01
1IAKA 1WFUA 3GO1L 5EUOA 3MRLA 3HRZA 5E6ZA 4ZNEE 2LU4A 3TJEH 2V6HA 1F42A 2GY7B 3LEVH 4AIXA 1P4IL 4LSVL 5JHDD 6FABH 1YEJH 1QLRA 5JW4M 1JHKL 1S9YA 4LHUD 3C5JB 4NDMB 1CGUA 1A6PA 3CLFL 3ARGC 3KPSD 4FZ8L 5HHMD 4I0CC 3MLWH 1FYHB 3O9WB 4NN6C 4XI5D 3KWWA 3RY4A 4Y4FC 4ALAH 4GAFB 1FZKA 1IAMA 1ZWIA 3T0EC 1DDHB 5DUBA 1CDBA 1U8JA 5C08D 2BNQB 8FABB 3NTCH 4X0KA 1KJMB 1CT8B 5D8JL 4MJ5A 1S7VA 4I77L 2VL4A 3QHZL 4NO2B 1P7HL 3UPAA 2IPUK 5IF0B 4KVCH 1J05B 1DN0B 5C92A 3KXFD 4KPHL 2FECL 5CZVL 2E6QA 1LEKB 5F7HA 1ZLWK 3PDDA 3QIUC 1M4KA 1UXSB 1F45A 2P8MB 4JO4L 5IROC 3WKML 4XMKH 1KIPA 4X4MA 5KS9E 4LCCB 3MQIA 2E7BA 1Z5LB 5DD5L 2CKBB 3VI3E 4M3JA 3D25A 4IDJH 4G8GA 5EO1B 3UTTA 5EC2A 3ARXA 3MLYH 5D7JD 1KN2L 2IG2L 4FXKB 5C0BE 3DWTA 2X4QB 1A7PL 1CDJA 4PRPE 4F7TA 3RUGE 4HV8B 5SV4A 4DW2H 2CGRH 3WFEL 1K5NB 3PWPE 4KUZL 2Z4QB 5ICXA 5K93A 4OZGE 4J3SA 5BQ7A 4GS7B 3MRMA 1JPGB 2H8PA 4YQXH 4UNUA 5KSBF 3BIBX 4OAWB 1TJGL 1HHJB 2P5WB 3FQWB 4PGEB 1ZHKB 4RFEB 5CBEB 3IFLH 3DROB 3AREC 4ISVA 4JVWA 3RVWD 2DICA 1BLNA 4DUXA 3MRKB 3FO2A 1A1NA 4MLIA 2X10A 5CZXD 1ZVYA 2A83A 1A7QH 2WIIA 5F7DA 4D9RD 2YUVA 1ZGLP 3ZKND 1A1MA 5F3BB 5LQBL 5EZIH 1MCJA 5FCSH 2EDJA 3HPLA 3H42H 4FQXB 5ILTH 5ACMA 4LSTL 3F7VB 4HBCL 4MHHG 5KVFH 1S78D 3EJZC 4WU7A 2NX5A 1XGYH 1DUZB 4KK5C 4KK9C 2W65B 5DHYB 2HG5A 3CFKA 1KTLA 4KKAC 4PY7B 2DIAA 5GRWA 1VFOA 3CC5B 3WHE0 2ZOLA 1D5XA 2G75A 3C8DA 2V2XA 5SX4I 3ALXA 1E28B 3PQYE 3KJ4C 4KI5C 2W60B 5E0QA 1S9VA 4GRMA 4RAVB 4OFYA 1S9XB 2WP3O 3H3BC 5FOBB 1X9QA 2ZOKA 3OSKA 1IBGL 4XRCB 3FT3A 1W0WB 5ID1A 1I7ZB 3PHSA 3NCCB 3DYOA 1JTPA 4MYWB 3MNWA 2GT9B 4IBLT 1UKSA 1I1YA 2A77L 1NCBH 2HVKA 4P9HL 4JFZH 4HGKC 2APFA 4Y4KA 1F5WA 4PTTB 1WBXB 5D2NE 4AH2B 3U9PH 2AXFB 3VFMA 4S2SA 4ODXA 4K3JL 1OGAE 4EXPX 3GSVA 3NA9L 1F4HA 2UWEB 3HMXL 3T3MF 5B21A 3TN0C 2XTJC 4Z95L 4EI5C 1A6WH 2J5LB 3NZ8B 1GL4B 1IGYB 4R0LB 5BJTB 1OAYL 4CNIA 5C3TA 1PX4A 4HK0B 2XXMB 3VXRD 3ZE0E 1LVEA 1DQLH 2EIZB 2NW2B 1OSZA 3SE9H 4LNVA 4P4RA 1AO7D 4XNQA 5EWIL 3TYGL 4OCMC 3LSOB 4X7DC 4XP9H 5J1AB 1KENH 4NC1E 4X6BA 3LZFH 5F1IA 5FA4A 4OZHB 1GJIA 3ZTJH 1C5BL 3S36L 1OP5K 4Y5XA 4I48A 3EGSA 3WBDA 5IIEB 2CK0H 4PY8J 2YRZA 2H9GB 5JUEL 2DQUH 3HA0A 3PXJA 1M6OA 2H2SD 4FQIH 5IQ7H 3TT3H 5F88A 5HYJA 1ZLVH 4U3CA 2AJSH 3HG1A 3MRJB 4JG1L 4YHMH 3DPBA 3WIIH 1S7XA 2OM5A 3A6CL 4ZFFB 1A3RH 2GSIB 4J4PA 3PXHA 4QRRB 1GGYA 5EG6C 1HSBB 2IADA 2Q3ZA 2HTLD 2G5RA 5CGMA 1I3GH 3SO3B 4TRPH 2CUMA 4RX4A 4LSRL 3HNVL 1T04B 3ES6B 4P5KB 1WV7T 3RWEB 5A2LH 2N1KA 2EECA 4QRPA 1CBVH 1X5GA 2B2XH 3GMOA 5ERWB 4QOKA 1MI5B 3PIQB 3SE4A 1RIVL 1GOFA 1LK3H 1OQOA 5FAAA 4OCYL 3ULUF 3E1F1 4GG6B 4A6YB 3GMLB 4V1DA 5DURD 5T5FL 4K8RD 4KK6D 4M62L 4N0UE 3V6OC 2HN7B 3EO0B 3P2TA 3SDXB 4MB3A 2KZWA 3G6DL 3R8BB 4ZYKA 1N7MH 3HMXA 4I4WA 4Z7OE 3MLVH 3OKKB 4XP5L 3KS0H 3M07A 5MP6L 4NKDB 1T5XA 2X70A 4JPIA 4U31A 1G0XA 4LPTA 1D5IL 3MCLL 1R6VA 5E03A 1QKZH 1NAMB 4NO0A 4I5BA 4PJDE 2P45B 1MQKH 4FQJH 4X4XB 1YPZB 4QRSB 3TZVB 4JM2D 1DANT 1FZMB 1EVUA 4ZNEA 4JFPA 3OJDA 1NEZG 3ZDZE 4Y1AE 4XPAH 1GZQA 2FD6L 3QQ3B 5DI8A 4E5XA 4H20L 4NNYA 2H32A 3PJSA 4N5EC 2CR3A 5HHXH 1FNGB 3ARDB 5JQ6H 4JEGB 1AIFB 1D5ZA 2ZUWA 1I4FA 1LO2L 2NTFB 3IXAB 3GIZL 3D2UA 3HFMH 1NC2A 1OAZL 1GIGL 3FT2A 4UNTA 4K9EH 3HC0A 5SV3A 4HUNB 1NLDH 4PJ7F 3MODL 5L2JA 2XA8H 5JLZA 4YHYB 1NBZA 3IFNL 5LXGH 1DE4A 1MJ7H 2NY2C 5FB8A 3I6GA 3BEWA 5IHZB 1BJ8A 5T1MA 1UM5H 3IDNA 1I7TA 4GT7A 5JORB 4M61B 3MRIA 3S96A 3GSOA 4M5YL 3U7WH 1NEZB 1EO7A 3JSSA 4S1QH 3LKOA 4NRXB 4OCRL 1G9NC 1T1XB 5KBNC 4OF5A 3VXMD 2DLHA 1C12A 5AUMA 1UWEL 1KXVC 3O45A 1YEKL 4JRXA 4OFIA 3F62A 1T4KB 1AJ7H 3P30L 2HJKB 3U0WL 4UMGA 5GZOC 4ZTPL 5IHUH 5IFJB 2NY6C 2OQJA 5K9QI 1OP5H 2C3WA 1NPUA 3KLAA 2OZ4L 4ZODA 4QXTB 5KS9A 1M7IA 1E4WH 5M95B 1RJLB 4P5TD 3CFBB 3FFDB 3NACL 4CU8A 3I9GL 4G43A 4X4YB 4NHUB 5C0BA 5EOQH 3RUGA 4PV8B 4DWHA 4D0BA 3U30B 3LKPB 4K07A 2NZ9D 4LVHB 5FHAH 3MRCA 4UDUB 4YDJB 3KR3H 3RZWA 3PWPA 5CBAB 2VAAA 3F7YB 4PLKD 1BBDH 1U0QA 4OZGA 5C2BH 2R2BB 1H3PL 5DRZA 4LCYB 4M5ZL 4HKZB 1NCDL 1S8DB 4UT6L 1HCVA 5DHVH 3FRUA 5KSUA 5H8DA 3C6SA 5I16B 4ZAKA 1QBBA 1YJDL 3BEVB 4AG4H 3BP4A 3GFUA 1XCQB 4G6ML 4ODWB 1OAQL 2EDLA 3A67H 3Q3GB 5KSBE 4PJ9B 1RUQH 4M6OL 2I27N 2W1NA 4OGZA 3VH8G 4RAUB 4P0DA 5DT1H 2FJGB 1CDHA 2PXYD 5DRWA 1SMAA 2NXYB 4GJTB 1OP3H 1U3JA 3WFCL 2AV7B 2AXGA 4FG6C 3S5LG 4EJ1C 4K94H 5IFAL 2P4AB 3WIHL 4YHIB 4TNVF 1ZAGA 2XICA 3H7BB 5ISZD 3GSQA 1G7QA 1OPGH 1FLRL 4KJQD 1X5FA 3PWVB 3ARBD 3NABL 3QDJB 1BQLL 3V4UL 3FO9A 4FRWA 3I2CH 1INQA 3EZ8A 5F21B 1CD1B 4NQDB 4L4VD 4IRJB 2EO9A 4JO3H 5DR5H 3PQYA 1KCRL 4BK5A 2IANA 4K23L 1BIHA 3KDMA 2BSSB 1W0VA 1ZV5A 1WAAE 4JZNA 2DKSA 3ARFA 1OTTC 3VH8B 5IR1B 2Y36L 4RA0C 5GS2D 2V2WB 1C08A 3BUYA 3QUKA 3AXLB 4JY5H 5HY9B 4QHKJ 1HILB 2OZ4A 4Y4HD 4P2OB 4RGNC 4P4KA 5BOZG 4WW2B 4BSVA 3QG7L 1IAIM 5I74C 4PGZA 1B4JL 1M7DB 4FQCH 5D5MF 3BXNA 3KJ6L 1LP9F 1NBVL 3OAZH 5DC0A 1MJJA 2IMNA 1UXWA 4NQCB 1MLCA 4K8RH 1XGQA 1T21A 2P7TB 3C8KB 3WJLC 1MEXL 3JVGA 2XN9B 5ETUA 1MRFL 1U3HB 4MAYC 3QI9D 3T3ME 4KROD 2MOVA 4LCIH 4NP4L 2X89D 3M8OL 3QWRA 2G2RA 3ALWA 2OXGA 2DQTH 1LD9B 1PEWA 3TO2A 5DMIH 5IVXF 1ZHNB 5DD0H 2BNRB 3WFZA 3CVHL 2Y6SD 4KJPC 1BFSA 4H8WH 2R29H 5LJYH 2R56L 1FFPB 2F5BH 5ICYB 4LGPB 1RUAH 4D94A 4O2FA 3U4EA 4PJAF 4JKPL 1S9WA 4JFDD 3LQZB 5BXFA 1YYLL 1MRDH 1HHKA 1T80A 4XMPH 3PL6C 3WIHA 2VIRA 3GSRB 4WNQA 1U2HA 5HHNB 2OTWA 5CJXC 5LWYL 4P57B 4XPGH 1YZZA 4EBQH 3WFDH 5KJRH 4Y89A 4CVXA 5GRUL 1NLBH 1OARH 5KVDL 1JZ3A 2C9AA 4ONFL 4PRHB 4G9DA 1GOGA 1BZ9A 2PW2A 5JPMB 1K8IA 3IXTB 2WUCH 1TQBC 3LS5L 5CKGA 1PZ5B 1J5OH 4IMLB 4UIMB 3RWGA 3M1BA 1KUMA 2V2TB 3VJ6B 3P9MA 3UTPE 1CLCA 3WD5H 1CI5A 2BVEA 4YNYA 3D85D 1PLGL 2VDRH 3LDBB 4D9LH 3QEQD 3RBGA 4ZO6A 5C0CD 1RZ7L 2J8HA 2O26U 1T2QL 1QSEE 1ZE3C 5I8KL 4ODVL 1KB9K 3ZKQD 2BNQA 5KANI 3T65B 4P2QE 2N56A 3ZL4L 3IETB 2B8OT 2F54E 1ZT7A 2GFBA 2DQCL 3CCHA 1NMAH 3DNKA 4XNZB 2OL3B 1BMGA 1FFQA 4PLOB 3W9DB 4PJ8B 4F9PA 4LU5H 3OX8B 5GXBB 2RB8A 4OD1H 3H9SD 4HIJB 3CVHA 4Y1AA 3EJJX 3EOTH 3ZTNL 3RA7H 1P84J 5GRYA 2EDDA 1U41A 2PETA 4WWID 3N1QC 1JHTB 3G6AB 4LVOC 1PY4A 3QDME 4TSAL 2W59A 2BY3A 4CW1A 2UZXB 5BW7C 3TA3A 4O4YH 3C6LC 2ICCA 3MXVL 5JXEC 5ADOL 4NZTL 1DTUA 4LCWB 3QXTA 1MIEH 1TZHA 2W9DL 5E2TH 3DHJA 1ZT4B 3C60D 2I9LB 2WWMC 3VWKC 3LMJL 4PP1D 1NSNH 1JGDA 4ZPTB 1OAXL 3BD4A 4HUVB 5K33A 3B9VA 3CNKA 1QHOA 4LRIA 4Q9QH 1JPGA 2BJMH 2VLRB 1Q72L 3C2SA 1GPOH 3TF7C 1JK8B 3FOMB 2IAMD 2J4WL 2KPNA 3P3YA 4MA8L 1QSFB 7FABH 2CDGB 4OAWA 1BFVL 3RPKA 1V7MH 4FP8H 1SJXA 2ED8A 3G5YB 5EZLB 5SWZE 1NUNB 3OKEB 1BQUA 1FJ1B 5L88L 3O8XC 4U1KA 5FK9B 2BP3A 4GXUN 2Q87A 2CJUH 3CSYA 4I3RH 4Q9CA 5F3BA 2P44B 1A9EA 3P0YL 4ZOBA 3GMPA 2EEBA 1PYWB 4NQXA 4OLUL 5H35B 1CFVH 5HDBF 3VU2A 1Q0YL 1U8KA 1X6NA 3VFRB 3BZEA 5D1XC 5D1QD 1SHMA 4W81A 1DQDL 4R2GB 5KW9L 5HYIA 4XNXH 4R4ND 5KSAA 5E4EB 4Y16B 3U2SA 3UZEA 3U83A 2Q8AL 2F74A 4XPHL 4K7PX 2FYYB 5FO8B 1E28A 2ICES 5B22A 2W60A 2GJ6D 4IJ3C 1RIUL 1VEPA 3QQ9D 5FUZH 5FUCC 3L3DA 4LPUA 5IHLB 1CFTB 5FYKD 4WO4D 1NGYB 4PGCA 5F1OB 3IGAB 4NOFA 3VFUB 3WEXB 5F6HJ 5CEXB 3OR7A 1NMBH 1FSKC 3X14B 5E8OB 4OBRA 2CDEA 3H0TA 3MRNB 1FGVH 5B4MD 5KSBA 2FJFB 4H5SA 4RCAA 2RFXA 5DD6A 2FGWH 1FL5A 4X5XB 4XVUC 3WO3B 1MUJB 5IEKA 3PNWA 1HXYB 5FUOH 3GIVB 1UWXK 4I18C 2DN7A 3F8UB 5HD8D 4BQBA 4O58H 5DVNA 5C9JB 2ZNWA 4WHYH 4AL8H 4HC1H 1MNUL 1HWHB 2FHFA 4QRUA 5GJTH 2AJZB 3R4DA 4LLAA 3TBVB 5T3ZD 3KYMA 3KPTA 3WJJC 4ZUSA 4UV7H 3OGCA 3GM8A 5GS0L 1S3KH 2VLJD 1E4XL 3FB7B 3TGXA 1S7UA 5F1NA 4QHNB 3SBWC 4FXGA 1X6LA 4OZHA 4MNQE 3IJHA 3VXNA 1BOGA 2RAMA 1OB1B 1YEFH 3P4OA 5JMRA 1WAAA 4ODUB 4CN4A 5CIPA 2H9GA 4XCEA 3SDCB 3RHWK 1UH2A 5DO2D 1GYAA 3OBAA 4OB5H 1MF2L 4Q6IA 3VXQB 3AVEA 3STZA 3DVNB 5FIEA 5GGTH 3FAXA 5EZJB 3RVTD 4ZG1A 1ZHBA 4NKIL 3O4LB 2WNGA 2CO6B 3L3GB 2BHYA 2B4CL 4XZUA 3X12B 4ETYA 4GRWE 4S0TD 3JTTA 3DVGB 3SDAA 3ZSSA 1T22B 4KRPB 4RMVA 5D5ME 2BVTA 1LP9E 1A64A 5E9DA 1H15B 3IDYC 5BV7B 4FQQB 3JWDC 1RUMH 1A3QA 5C7XL 5ERWA 2AGJH 1J10A 1K4DA 1PVHA 2DTSA 2VITA 2XWTB 4LAJH 5AAMA 3X13B 2XTLA 3FQXA 3VXOB 1BM3H 4U1SA 4N90E 1LGVA 3EDDA 4L8CB 4J6RH 3RAJH 5E2WH 4JG0L 4HCRL 1F6AB 3S34H 1I8KA 2VTFA 5EU4B 3UTSD 4X8XA 1WBZB 3BN3B 1I8LA 4H88H 4UZGA 5IVXE 3SKNB 5BO1H 3NCJL 1AGFA 4EN3B 3MLXL 4ELMF 2IPUG 4DGIL 3DSFH 4M48H 1A4KB 4QRTB 1I8IB 4ZO8A 1S7RB 32C2A 5FHBL 4FZEH 2GK0B 4G6AD 3GBML 4OZIF 2OJZH 4PJAE 2A6IA 2GJJA 3V0WL 2WM0A 4QHUB 4RMTA 2ZUVA 2BCKB 2F58L 4YDIL 5DD3H 3LEXA 5I75B 1YPZA 1CICD 3RDTD 3QHFL 1L7TH 1K4CB 1ZGLA 3MC0A 3SJVE 1CVSC 4XPTH 4UQ2B 4K3DL 4GMTL 1KJ2L 2F19L 3PWUB 3SDDD 5FXCH 3V52L 3MUJA 1JNJA 3FHAA 3MPCA 3WNLA 1CLOH 2ICWA 5HPMA 4LHUG 2IPTL 1I85A 5GS1C 3PF2A 1L6XA 4QXUH 4UDTB 3WSQH 3WUWA 1RHHB 5HGDB 4YHKL 5EFIA 3GSNL 3U46B 2VSCA 4NGHH 2ZUSA 4XBPA 1AIFA 3HE6D 4HZLA 1CFNB 4WDIA 3VFSB 1N0LA 4MQSB 2QHLA 1M71A 2QQKH 2ZSWB 3JWNC 3IXAA 1GSMA 4M6MH 2Q86B 3DMMD 3QCTL 5IWLA 2C1PB 3ZLQC 4I9WD 3I84A 1WC7A 4Z6AT 2YWZA 3VXUD 2X9WA 4DTGH 4UB0L 4HMDA 4GAJH 4AK1A 3N1GC 3BE1H 4RWYH 3EYSH 5J89A 5GJSH 2C5DC 5E5RB 1I9EA 1G9NH 1IGJA 2VABB 2C4FT 3QDGE 2GCYB 1NFDB 4NUGH 1OGTA 1W72H 3MV7B 3QEGH 4TUOB 5IHZA 3H9ZA 4P2QA 3QCVH 1O7VA 1JZ8A 1F58L 1OAUH 4NKQB 3WUZA 3VXTB 4GW1B 3Q5YA 5E8DH 1JWUB 4HEPG 1AR2A 2F54A 1QTYT 4LHUB 3DX9B 4LOUC 3RTQA 4GKSA 1GVIA 4DFIA 4ERSL 1N2RB 4N5UA 1CF8L 3DTXA 4BH8A 1UVQB 3KPSB 3CFEA 2ZG1A 1T4KA 5J0BA 5C09E 5HHMB 1QYGL 2MCPH 1Q8MA 2ZG3A 3TCLB 3VXSE 1RZ8B 3IDIA 4PJXB 5IFJA 2CRMA 3MLRL 2F5AL 2V17L 2ICWI 3MJ7B 4HCRA 1DBML 3QDMA 1TENA 1GZPA 3MYZA 1ZA3B 4QXTA 4HKXB 4M1GL 1DP0A 2O5XL 4MWFA 4H25B 5HJ3A 3SKJL 3EJYC 1YN7A 5DUML 1OGAB 1R5IB 35C8L 5I0ZA 3MXWH 1H0DB 1KCUH 4AEHH 4R26H 4Z7UF 4OCWL 4F80A 1FL3B 3H3PL 3OB0K 5TE4H 4WFEE 1NC4D 3QNZB 2AK4B 4YC2C 1BQHG 5GSRA 4NHCL 3V5DA 1KJ2A 5H37H 1IZKA 5I30L 1YEGL 5IVZB 5DYOA 4WV1A 4ZDHA 4LCUB 4IS6B 5J11C 1BFTA 3MNVB 2RQ8A 1QFHA 4JFFB 3TLRA 5FKPB 1E27B 3H9HA 3QIBB 3GSNA 4Y4KC 4C59B 5SWZA 5IMKA 4YGVA 5F9WC 3L5XH 5D7JB 1AQDA 4PJ9A 5IMLB 2FX7L 1EH9A 3JWOL 4HDIA 4JFYB 3CD4A 3EHBD 3O3AB 3QAZB 4HXBH 1G1YA 1VDGA 1AP2B 1WF5A 4ETQB 2IALB 1UH4A 3R1GL 1R3HB 3MV9E 5IGXL 4MJID 2XNAA 3N9GH 1IQWL 1YUHA 1S7SB 1BFOB 3KPLA 1BQHB 1JWMA 2ICWJ 1CXIA 1IGTB 3RVVC 3PWVA 2OSLA 1CS6A 2I60L 3LPWA 4JHAL 2XPGA 4L4TD 4Y5XC 4R96A 1DUYA 3D39B 2EDOA 2D3VA 2J2ZA 2FDBP 4JN1H 4WU5B 4HKBB 1KYOK 2YSSB 5D96B 5D7KE 1RK0B 4JR9L 4ZFGH 3TIDA 1VFAB 3CSGA 5C6TH 3T1FA 5AEAA 2VLKD 5HY9A 5CD5D 2IH3B 2EH8L 2OYPA 1A02N 3Q6GL 1FG2B 3S5LA 4XWOC 5F93C 5M94B 4HJGA 2CXGA 5EZOH 4WW2A 4OIIL 1AI1L 4J4PC 3T8XA 3WS3B 1WZLA 3BP7A 5D1ZA 1BAFL 3QT2A 1AXTH 4GXUM 2NLJA 1ZLSL 4X9FA 1MAJA 2LAGB 5I17B 3EYOB 1HI6A 1NGPH 4QLRA 3PHQB 3BT2H 1Q0XL 2DD8H 3DUSB 4K7FB 4YHNA 3K80A 1KN4L 2JIXA 2BDNH 1IAOB 4M6NH 1NCAL 4L1DA 1TVHA 2A73A 1S7WB 2QKIA 4X8JA 2Q1EA 1HKLH 5DJ2A 3S36X 4P9HC 4MNQA 2R1WA 4Z7VF 4KZDL 3AM8A 3NFPB 3UC0L 2AI0L 1J0ZA 1FV1A 1AQKL 4XX1G 5HYSG 4EDXB 2CMRH 1FFPA 4NUJA 2PW1B 3A6BL 3OB8A 5DLMH 4RFNB 4Y5VB 4LLMB 3KYOB 3LQZA 3GNMH 3GK8H 4K7PY 5DWUL 5FYLD 2HJFB 2J88H 5IP4A 4HUXB 5HGBB 3UO1H 4PG2A 2DWDB 1MCFA 3PUCA 4PJFE 1G7MB 4ZUWB 3WN5A 4OGYH 3GSRA 2YOCA 4DN3L 5HHNA 1FIGL 2DWEB 3OAUH 1AO7B 2FNBA 1V3MA 3E2HB 1IM3A 5SWSD 2FZ3B 2BXYA 4LVNC 4UTBH 4PRAA 3W39A 2OP4L 5CCKL 1WTGT 3BH9B 3B5TA 1LP9A 4UTAH 2EE2A 2E9BA 1NGQH 4JREC 5HYSB 1JNNL 2X1WL 1UQSA 3LKRB 1XIWB 1KEGL 3K4AA 5BVJA 3QNXA 3TYFB 4J12A 3EOBA 1FPTH 2DS4A 3I50H 5CMAB 4PRIE 1DQTA 1M7XA 1Q9WA 2QHRH 1G9MC 3B6SB 4KY1H 1TQCC 2DYPA 2ARWA 5FO9A 3QZWG 5I0DA 3U0TA 1MCHA 4ODSH 4L3CB 2AERT 1DBKL 4J3XA 2B5IB 4XGZA 1A4JB 4X4ZA 4HW6A 5DJXB 1KPRA 4PJAA 3L3HB 2DQGH 1W8NA 1HINH 4RSVA 3MBEC 3HMWL 1A6UH 2YZ8A 3TNMA 1TJIH 4ALAL 2EE3A 5IV2B 1MPAH 4HUWA 4OCNC 1OAKH 1VPOH 2UY6A 3LV3A 4I2XE 2V5MA 4PJHF 4QHLA 4OZIE 3SCMA 5EBWA 5D2LF 3V6FB 2SEBB 1U92B 3HZYB 4HIJA 3CH1A 4ZUTB 3QXVA 4OM0H 4Y2DD 3LB6D 2XOTA 4KAQL 4KVCL 3TO4B 5HVWA 3X11B 1I1CA 5EUKB 3QZWB 5C08E 4MB4A 1PSKH 1F4XH 1T83C 4O2EA 3ZO0A 1RV6X 4YFLF 4QTHB 4R9HA 5BZWA 5BRZD 5TH2A 4QGYA 5C0EB 1VB9A 1NKRA 1IQDB 4XMKL 1NANI 5IW1A 3HAEH 3O2WH 3TPUB 3KXFE 5IT2L 1FO0B 4XWGL 4X99A 4JM2B 1ZANL 3L3KB 5E1HB 4O2CB 3MLUH 5FYJD 1QRND 4GLRI 2AJVH 3E3QC 4IDJL 2YUZA 1YMMB 3T77B 3U1SH 3KPMB 4TPRL 3QIWD 1NL0H 2AEQH 4FFYH 4DW2L 1ZKAA 4LQFH 4HJJL 4POZD 5F9AC 3ULSA 3TFKD 2NYYD 5FV2A 1U8QA 4R90H 4U1LA 4F3FB 1WTLA 2Q20A 1J8HD 2ZNXA 4C56D 2MJWA 4GRLD 5EOTB 5C09A 1FNFA 1VGEL 3LHPL 3QWOB 4RZCA 4UBDC 4U6XB 3WXWH 4YR6A 3L7FB 4YQXL 3UTQA 3MR9A 3K2UL 1QFWI 1QQDA 3GHBH 1WCBA 4ENED 2HFEA 1WWWX 4MNGE 3IJYB 1KOAA 1H3XA 1WT5C 1N6QH 3VD7A 1FYTE 4MA3A 4M7KH 3GMRA 4MD5A 4S1RH 1LK2B 4NQVA 5HPOA 1TZIB 2P5EB 2KH2B 3UTZB 4M7ZC 2IPKB 3VXMB 3HNSH 1J0JA 1J1XH 1Q38A 4WI3A 4X6DF 2EYTA 2C1OB 5EZIL 2VE6A 3H42L 1YEEH 2EDWA 4U2YA 5ILTL 5F7WC 3S4SG 4K55A 1RURH 3ARFC 4DZBB 2ITCB 5KVFL 4Z7UE 5EU5A 1MFBL 4NKOA 5AWNH 2ADJB 1XGYL 4D9RE 1CFTA 4UQ3B 5B8CB 3BFOA 3QXAB 1UKTA 1LEGA 3WLWC 4RNRB 2VR4A 3HR6A 2PO6A 3KLHC 1OTSC 3GHEH 4HGWB 3Q1SH 2VDMH 3T08A 1RIHH 4R8WH 1G6RH 1D5BB 2DM7A 1F4AA 3LPFA 3GIVA 4IRZL 2GY5A 3JVGC 2CIKA 4HAGA 3MV9A 4KI5F 4WWKD 2JJTA 2IBGA 1WITA 2FEEI 1NCBL 2LTQC 4F58H 4H1LG 1W2KT 3S4SB 1OTUD 3TBVA 3RL1A 1QUNA 4MAUL 3TT1H 4NBXB 2A9NH 1YJDC 3BPOB 3P73B 3T3PF 1P7QB 4G9FD 2F9BT 5E08H 3FFCB 2DI8A 2YPLB 1A6WL 2PN5A 3CDYA 1HHIB 4IOIA 4DOHB 4Z7NF 3RKPA 1OB1A 2P8LB 2X40A 1LO3H 2PXYB 4A2LA 4BKLA 1DQLL 4JFED 2N7AA 1PKQB 3O6KL 2ATKB 3PP4H 1RJZA 1SYSB 1QNZH 1P69B 3BPLC 4P5MB 3OKLB 3WFHB 1A6TA 1KENL 1P9MA 3INUL 3LZFL 4ZO7A 4ZXBA 3N1FC 3PDOA 1ZTXL 1I1AD 3VXRE 2FX8L 2FR4B 5E99H 1HEZB 4H1LB 3ARBB 1GGBH 4LASL 4XTRD 4ZNCD 3WHXB 5JOFA 5FA3B 1I75A 1QSEB 1N64L 4PD4J 3JWDH 1DL7H 3L3GA 2VZVA 5IQ7L 4HS6A 3VFNA 2GEEA 5E7FA 5FM5O 5GGUA 3QXWA 1MAMH 4YHML 5JHLH 2JTDA 3CFJA 4LP5A 3RY5A 3WIIL 4XX1E 2X4SB 5HI4D 3O41B 5D71H 3LS4H 5GSVA 3VE0B 5T3XH 4J1UA 4XAWH 5L6YL 2HFGH 4P2RE 4ZD3H 2XWTA 4BZ1H 2Z31A 4D8PA 4TRPL 4F37K 2JCCE 3ARWA 2FJHB 3O9WC 2J8UF 5LGHH 4L8CA 2UVFA 4G7YH 3WLBB 1H3WM 2JELH 4GW5B 5E94A 4U1NA 3QP3A 1P2CB 4EDWH 3OAYH 2B2XL 5E5UB 4Z7VE 1MHPH 2ITDA 2EDQA 1ES0A 3MBXH 1I8IA 1LK3L 2VR5A 4XCYB 4Y19D 1IEBA 4PJFA 3QI9B 1NKOA 3BAEL 1KB5H 4AT6A 1L9NA 1VSCA 2JJUA 4LLWB 4MNHA 5A2JH 4XNYL 1EERB 4F9PC 4GKNA 3UEZA 3CU7A 1N7ML 4XHQA 1K4CA 1XF2B 4PJ7B 1RZKC 2WINA 4YXHH 5DMGC 1I3RA 1U8MA 3PWUA 1YEDB 5AYUH 3BIKB 5H2BB 1M05A 4LCCC 2CLRA 2FBJH 4F7PA 3TA3C 1AFVH 1CVRA 1JYNA 5E8EB 4X6CF 2ATPB 4FQJL 5CEZH 3TCXA 1CFNA 3VFSA 1F2QA 3KYNA 2Q86A 4PRIA 4QO1A 1FN4B 4XPAL 4CVUA 2P48B 4TULH 5F89A 4LSVH 5JZ7D 1UACL 3GJFB 4WY7L 2WWKO 5HHXL 1HYSC 1OD7A 3QRGL 5F1SA 5I8OH 1JHKH 4GS7C 4LRIC 1NFDA 4P23D 4F7EB 5CJBA 1FFNB 5JHDA 4GW1A 1SJHA 3B9KD 2DTMH 3ROOA 3RWFB 1IE5A 3HE7B 4OKVA 1NLDL 4LHUA 3DX9A 5GS3A 2AAVA 4I2XA 5HHOD 1FVDB 4KQ4H 3DRTB 2CLZB 2PYED 1MJ7L 1U8OA 2OJEB 1XF3A 1UVQA 3D85B 4GFTB 1O7SA 3KPSA 3TBWB 3WNPA 4ZFOB 3EO1A 1UM5L 1MLBB 1Z3GH 4LIQE 3T0WA 4I77H 1T0NB 2R1XB 4Y5YB 4PYGA 1HHGA 4S1QL 1XGRA 1JNHA 5C0CB 4FQXC 3DSNA 25C8H 3UTOA 3KG5A 3EW3B 2R4SL 4PTUB 5C08A 4OCLC 4NQEB 2GUOA 5C8JA 1D9KB 5INDB 3D18A 3VFGL 4JKWA 2LV4A 3BQUD 1AGDA 1AJ7L 1MRCH 4XP6H 3T0EE 1R5IA 5IHUL 5KSAC 1IL1A 1WWBX 1UJ3A 4JO4H 3WKMH 3SGEH 4P46B 1P53A 3KXFA 1FL3A 1FZJB 3HZVB 3MA9H 2A6JB 5HSFA 1JFQL 1E4WL 3QNZA 5MEQB 1B0RA 1N5AB 3H9SB 5DD5H 2QSTA 5E56A 3CVIH 5ICZA 3RPIA 4RA3A 1KN2H 2IG2H 4LPYA 5EOQL 3MRHB 1U6AH 1A7PH 2WLYA 1X5YA 2XYCA 3FMGL 4IS6A 1UC6A 3RJQB 5ITFA 4J2XA 1VEOA 4LDOB 3TBTB 3WFEH 4HD9A 4KUZH 4P99A 3LVEA 5DRXB 2WSKA 1JV5A 3MRRB 3RWCB 1JTTA 1NGWB 4E0RB 4JFYA 3NGBB 5CJ5A 1TVBB 2J5LC 5FGCB 2MCG1 4XCFL 1AP2A 4AG4L 1TJGH 4MNGA 3ILQD 4M03A 2YXFA 3DO7B 1FYTA 2ZSVA 3I6KA 3OKOA 4X5WB 3B83A 5I1AB 5DDHA 5DJ0B 4HWEL 4HX1B 2IAMB 4PGDB 3REVB 2XWJB 5C9KA 1R5VB 1BWWA 5HVGB 5C3LD 4U1HA 3WNNA 2HH0H 3ULVD 5D7LD 4PJEF 4G80B 4LSTH 3U6RB 2ZCKH 1UZ8A 1R3IL 2VDNH 4WU5A 2YSSA 2YHGA 1OPGL 3AS0A 1DQML 4LQ1A 5TE6L 5IB5B 2H3NB 3NBNA 4WFGD 1AKJA 2F53B 2RR3A 3BH8A 3I2CL 3UROR 1XGPB 1IT9H 2GW5A 2M8XA 3D87B 4JO3L 5DR5L 5ISZE 2B7DT 4PYHA 2AJUL 3L3OB 4NM8H 2VDOH 2D4FA 1CGVA 3QG6A 1NJ9B 5IB2B 5TFSL 3DO3A 1T1ZB 1PQZB 3ZSTA 1INEL 1IBGH 1VKXB 2WBJB 3SO3C 5IBLD 1YEIH 4JY5L 3RNQB 5L8LB 2ADFH 3P77B 4L4VE 4DK6A 3RWHB 2AQ2A 5FKAB 3PHQA 3WDHA 5I9QC 3DUSA 2A77H 1MFNA 4P9HH 4DK3A 4ZUVA 3V5HA 3RZCB 1A1OB 2EH7L 2DL9A 3MFGB 3RVXC 2L7UA 5ITBL 4PBVC 2EKSA 2ESVB 1QSZA 2R4RL 3V5KB 4K8RL 4Q7DA 4HG4J 1I7UA 3DGGA 1UGNA 1OAYH 5I8CA 1EUUA 3T3PE 1AD9B 1HQRB 5GRVK 4Z7WF 1SVCP 3FB5A 4JRYB 4LCIL 5DHVA 3OR6B 4Z7NE 5EWIH 4U0RB 5JXAH 2C26A 1LE9B 1YNKH 2X9YA 5DD0L 2HJFA 4AENA 3VXRA 4JJ5A 1N6VA 5ANME 1XFPA 2R29L 3NIGF 4LSQH 2F5BL 5GS0C 2H32H 2DWEA 2VLJB 2D31B 4JAMB 1EBPA 3TZVC 4XHJD 4ZTOL 4WFHD 5JUEH 2NY1D 4PJIF 2A6DB 5CFHA 5J3HD 2VB5A 4YXKH 4OM1L 1BREA 5EU6B 1HOCB 4R7DB 3LPGA 1N59B 3BX7C 2X41A 3NFSL 3NVQA 4JG1H 5HYSA 1QLEH 4JFDE 1IKNA 3A6CH 4XPGL 5J7CC 1G9MH 3RVUC 2EC9U 5CEYA 2BNUB 4P2RA 3BP5B 1DCLA 4HUKB 3WFDL 1Q9OB 2X6MA 4N9GB 2JCCA 4LIQL 1T6VN 3FTGB 3VXSB 2BRQA 4PJCF 4XAKD 3ZMRA 1D6EB 3MO1B 3L7EB 3HNVH 1YNTB 1ZT1B 1UEYA 2WUCL 3QFDB 1DVFD 2CDFA 3FONA 4MD0B 3VFOA 1KJ3L 4C83B 4L3CA 1J5OL 4ORGB 1EFXB 5HGHA 2J8UE 1RZIA 1VFBB 1HH9B 4N0FB 4NYLA 4FMFA 4OCYH 3QFJB 3WD5L 1G0YR 3GSXB 1R24B 2QR0B 4HUUA 2VDRL 5T5FH 4R4BA 1U8PB 5IBTH 3IJSB 4PJGF 4U1IA 4C57C 2JK5A 5DZOA 3D0VB 4KRMB 4J3UA 4J3OC 3BJ91 2P8PB 4G8FB 3B2VL 1ZOXA 4XP5H 1WISA 4LLYA 1U92A 4FFVC 4HIIB 4R7NA 4G5ZL 5MP6H 5EOCL 3UTSB 1S7TB 3K4ZA 3Q6FB 4U1MB 4IOSD 5MEPB 1XZ0B 3MCLH 3RNKA 1FVCB 4WI4A 1JBJA 3FZUC 3QEUA 4YWGL 1NMAL 4WHDA 1Z9LA 1PAMA 3QUXB 3FCTA 1X7QB 5C0AE 2DB8A 3U30C 4GUPA 2YD1A 4XPFH 4OZFG 3EOTL 4X6CE 3RA7L 1X5XA 4HBQA 4N0CC 2A74A 5IMMB 5BCAA 2NCMA 1CICB 3RDTB 1T1YB 3WCYA 2X1XR 4JM2A 4WI6A 3UCRA 4K3GA 4OUUA 4O2CA 5C0IB 2R0WL 4QF1B 4O4YL 3SDDB 1LO2H 5IMOA 3CZFA 4MQ7B 1U8LA 1S5IL 1NCCL 3GIZH 4WV1C 1GIGH 2E27L 3V0AC 1QBAA 4XB8A 1B0GA 1EEYB 3BP6A 2YN3A 3VXPB 5E2TL 3BHBA 4PJ9C 5EBGA 43CAA 3IFNH 4NCDA 4YHLH 1NSNL 4HJ0C 3CAFA 1A7OH 3KPNB 4BK4A 5BS0E 3CH8A 3I3BA 3LOWA 1I3VA 3G5XA 2H45A 1GPOL 4I0PB 1CFSA 4M5YH 2M26A 4OCRH 2X4UA 2YC1B 3NCYS 4NM4L 1CXHA 4F9LA 1V7ML 3REWA 1UWEH 1CU4L 5K9OA 1YEKH 1RJYB 1JWSB 2MHAA 5EPMA 3IVKB 2EDBA 5D7IF 3EFFB 2QSVA 3U0WH 1DEEB 1PG7W 1CE6B 2NR6C 4ZTPH 5INCA 3UTZA 3VXMA 1VENA 4YE4L 3PHOA 3GMMB 4I3RL 4IRJC 3DV6B 4Z5RB 4G6JH 5GZNC 3DETD 1KLGB 2OZ4H 4TNWK 3F6IA 4KMQA 5K9KA 2PYFB 4AEFA 1IAIH 2Q7NA 3NACH 4JLRB 3ECBB 4DZBA 2ITCA 3BGFB 1HZHH 3I9GH 3D3VE 3QXDA 3DX8A 4ZS7H 4NJ9H 3VG9C 2E5EA 5GRZA 2EE9A 2C3VB 3QXAA 2EDHA 1KFAH 1BX2B 3F7PC 5FO7B 3NIDF 4XNXL 4P5TA 2C7UA 1FDLL 4WW2C 1RZJL 4MDJB 5MHSD 5D1ZC 5C0FA 4NSKA 2BY1A 1K6QL 2QEJA 3FO1A 5FUZL 1NCDH 4UT6H 5D9SA 3L9RB 3ARZA 1NMBL 1YJDH 3SGDH 4G6MH 3OF6D 1YN6B 1HHHB 2EIEA 2IBBA 2EDYA 3MRQB 1FGVL 5FGSA 2GJ6E 4HS8H 4YHOL 2QSQA 4M6OH 3QQ4B 3OJVC 2FGWL 1B4RA 2ADIB 2ED7A 3VI4E 2IQAA 4HFWB 5FUOL 1SEBB 1ED3B 1I8MA 2XWBB 1QPXA 3AM8C 4O58L 1B3JA 5IFAH 4OTXL 4EI6B 4YFLI 4AL8L 3MOBH 1T2XA 3GMNA 5KTEL 2CLVA 1DQQB 5GJTL 3JWOC 1F90H 3NA4A 3AREA 3BZ4B 5CGYD 2FGZA 2VSDA 4UV7L 5LGJB 1I7RB 5HYEA 2DQHL 5E95B 4PJEE 4H0GA 3NABH 1S3KL 3C5ZB 3V4UH 4PG2C 3WN5C 5FF6B 5IFHL 4MJIB 2R69H 4JHZA 4U6HA 3G04B 5ISZA 3IDGA 1GGTA 1KCRH 1YEFL 4AIZB 3HLAA 4PJBF 3ZE1F 4XNUL 2FR4A 4MA1B 3ZYOA 3KNBA 1OL0A 5DJDB 3ARBA 2GSGB 1JUFA 2X4OB 1KTRL 2XZQH 5I71C 4L4TB 1D5MB 5IESL 5E8PA 4L4VA 4G7VH 2G9HB 4OB5L 5IB4A 4QRRD 2EDKA 1OLLA 4LLQA 3A6OA 4ELMB 1AH1A 2Y07H 2YUXA 4S1DD 1X5JA 2P24A 3G5VB 1B4JH 2X4SA 4FTVB 4OZIB 2VLKB 3TP4A 4PR5B 5L2KB 2VLLB 3I3EA 4L8BB 4Y4HA 1T5WB 1DFBL 4OGAD 2UV3A 1MI5D 5MEOA 4I3SL 2FJHA 1MEXH 3DXAB 2Z8RA 1MRFH 4BFIA 4DVBA 1YY8A 4RGNE 4WI5A 5EUOF 3U9UB 1RQ5A 3FQUB 5E6YA 3O3EB 2R23B 3VRIB 3M8OH 1ZHLB 3S88H 4EVNB 1CWVA 1EX0A 2V7HB 4Z7WE 4U1GC 3CVHH 1BM3L 3I02B 5ANMA 1RZKH 2C4XA 4F15C 5DVMA 4J6RL 4EI5A 5HXMA 1ADQH 1A47A 2R56H 3RAJL 2X89A 5BVPL 4DVRL 4XNZC 1GHFH 3WIFA 5EOCJ 3SCMC 4X9IA 3LEYH 5TQ2L 4PJ8C 5B38G 3DSFL 1XF2A 3HZMA 1J0IA 4BQCA 1WLHA 5GGVH 4FNLH 1HSAB 2OJZL 3FT4B 1YEDA 4PJIE 4TQEH 3RI5K 4JFDA 4IRSD 3FQNB 5LWYH 2NXZB 1G7IB 2VZTA 2VAJA 1ZXQA 5DD3L 5IB3A 1L7TL 3AFLA 4WTZA 1P5VA 4BSWB 1S5HB 3ARDD 3MRDB 4XPTL 5GRUH 3T0XA 5KVDH 1IM9A 4WHTA 1CLOL 1MVUA 3PWJB 2V9TA 2P43B 4QXUL 2R2EA 3LRGA 5DD1H 4ZSOE 3LS5H 3MRBB 4PJCE 2ZG2A 5JDSB 4W4NA 2J8UA 5JO5B 3PG2A 5EBLB 3VG0L 4F57L 5B38B 5HYQA 3L3IA 4F7EA 4M6ML 4GAYB 2FEDD 4KKCD 4TSCL 4H26B 4M8VA 4G6KH 3MRPB 4DTGL 4APQB 4R4FH 5TDNB 4RWYL 4PV9A 1FL6B 3PP3H 2CLZA 1T2QH 4OCXH 4Z7UB 4NKMA 5I8KH 3D85A 4NUGL 3TBWA 2A0LD 1W72L 3QEGL 3VA6A 5CP7A 1OAUL 2ORBL 4QRQA 3VXUE 2APVA 3QEQA 4YPJA 3HB3D 3ZL4H 3ULUC 1MHHB 5E8DL 5E70A 2QADC 2L0DA 5CWSB 1AGBA 4X9GA 3QCUH 1CGSL 1PEZA 2DQCH 3VFVB 2D7QA 2DL2A 4PFEA 1IEAB 3QH3B 3QNYB 5C0AA 1F3JA 2UZYB 5DSCA 4PLJD 2R0KH 3BZFA 4E41B 4Y16C 2BRRH 2NTSP 1A5FL 1XGUB 5KZCB 1CD8A 2FWOB 1HNGA 2BSED 3S6CA 3UYPA 3OKNB 3NMEA 1FZJA 3HZVA 4DGYL 4Q2ZA 3SY0B 4U7MA 4EUPG 1KPVB 5IBUB 4F7CB 4WW1B 3VCLA 5I1KH 1J1OL 1JPTL 3GI9H 5ADOH 5J6HA 5DQ9B 4JDZB 3MXWL 1LO0H 1MH5B 4KZEL 4R26L 2W9DH 4XC1H 4FQ1H 3K74B 5ESAB 2AS5M 5JIPA 2PO6C 5B3NA 2VKWA 4TOYH 1H5BB 2R15A 3BKCH 4NNXB 1TPXB 3LMJH 1LE5A 4OD2B 2R39A 1DLFH 4P3DB 3OGOE 2FL5B 4CRPA 2BMKA 4E0RA 2H41A 3C60A 1DSFL 1HWGB 4MA8H 2JJTC 3BGMA 4JRWA 2BVQB 3EBAA 1V8HA 1QRNB 2YPKB 2NXYD 5I6XB 5DJYB 1A3LL 4POUB 2GJZB 3G5ZB 3L5XL 5T3ZL 4FA8A 1EAJA 5EU3A 4EUPB 1FRGL 5L88H 3QIWB 3FQTB 3IYLW 2VNCA 4AZ8A 2DAVA 4YK4B 5SX5H 3T04D 1LDSA 1U8IB 1KB9J 1ZS8B 2DIJA 2WLZA 4LLDB 3SE3A 3P0YH 4UUJA 2X4RB 1J8HB 1KT2A 3QDJD 4HZAA 5D7IE 5CJOH 2NR6D 3U7AA 2HLFC 1P6AB 4OLUH 3N9GL 3EZJB 4NQDD 3D3VA 2OS7A 1W72A 4KRNA 3SDCC 1Q0YH 2ZCHH 3IU4L 4N1CA 5T1LB 5KW9H 3QUYB 4ZXBC 1E0OB 5DXWA 2VQUA 4UOJA 1XGPA 2NY4D 5BMFH 5F8QC 3O6FB 4UNVA 4JN1L 2UYLA 1BJ1J 2NY0B 5D1QA 4DCQA 4P2OD 2HRLA 3IFOA 3NIDE 2RHEA 1QFUL 3L3JA 5E5MB 1T1ZA 5ESVA 4CAGA 3BIAX 5C6TL 4DKEH 4DGVH 5FKAA 4A6YH 1JZ5A 2GJ6A 1T0MA 2ERJC 5EZOL 5KN5B 1H3UA 5GIRA 2MMXA 5E6IB 3PGDA 3VRJB 2Q6WB 4WO4A 5EC1A 2XN9D 1U3HD 4YIQB 3HS0A 4WENB 1NUGA 1T1WB 5DGQA 2Z31C 5HVHC 3CPLB 3LAFA 1CDGA 5FUCE 1NGPL 3E6HA 4ODTL 4WUKH 3EDKA 1TMCB 3NCYP 4M6NL 1RMFH 2BNRD 4QY8A 4LKXB 4EN3C 3BN9D 5AD0A 3VWJB 4Y8DC 4L29A 5HVFB 2HLAB 4Z0BL 4PG9B 5IQ9B 1NAMH 5DEGA 4F2MB 1ITCA 2OTUA 5GS0H 1RVFL 1E4XH 4YO0B 4WWKB 3L5WA 5I76A 2Z92B 3HUJB 2VN7A 2O5ZH 3AU1B 4WTWA 5F3HA 2NQCA 2W9LA 2YD8A 3KPRB 1IRAY 2VLJA 4G9FB 3MFFB 4JAMA 5DLML 2X2YA 3PWNA 5HGAB 3HCVB 5A2IH 3GNML 3GK8L 4PJBE 1XMWA 2J88L 5HI3C 3T4YB 3QUML 1RHFA 4OGYL 4KKLC 4PGBB 5IVOA 1P4LB 1BD2E 2GK2A 1FORH 4RIRA 4PRHD 4XPBL 3OAUL 4L8SB 3MLTA 4UTBL 3U48A 2Q76B 1AR1D 3IKCA 3FTGA 1EXUB 1WCQA 1D6EA 4TUJA 3ET9F 4PJHB 4UTAL 1R5WB 3ARGB 5D2LB 1NGQL 3QEHB 1MIML 4LEXL 4NN6B 4Y4FB 2FO1A 1FNAA 1VFBA 3LY6A 3PABB 3ORJA 1CQYA 2Z8WC 3I50L 5EUOE 4I0KA 2Y5TB 1R24A 3MCKA 1EVTC 1A2YA 1ETZA 3I75B 1I9RH 4FQ2H 2HT4D 1Q94A 1MSPA 3NCJH 4ODSL 5F7MC 1UENA 3D0VA 3MLXH 4LPWA 5F6IB 1LNUA 5JW5A 4DGIH 2K1MA 2P8PA 4XI5C 1HH6B 5FHBH 3ZYZA 2H2PD 2XQYG 3M45A 3QIUB 4H0IA 3UTSA 3WS6A 4BH7B 2DQGL 3V0WH 1HINL 4O51A 1H3TA 4ONHB 1XZ0A 1A6UL 2ZUUA 3E6FB 1OAKL 1VPOL 3FB8A 5F9JA 3WL9A 3F12B 4YDIH 1PD6A 4Y19B 5T3XE 2FSEB 5F44A 3C08L 4TVSa 5C0JB 3U0PB 2DQIL 4WUUD 1UJ3C 1KJ2H 5IKCA 3IS0X 5GGRA 3V52H 1MY7A 4OM0L 4LCWD 3UXFA 2IPTH 5IMMA 4UINL 4X7TA 1G7LA 5FDWA 1TDQA 3RDTA 1JP5A 4YHKH 3QPQD 4PJCA 2VXVH 1I9JL 3JV4A 5C0IA 1PSKL 4C4KT 2BXZA 1F4XL 4QF1A 3SDDA 3MMEB 4JKLA 1FNEA 1ZMYA 3QCTH 2DJ4A 3QJHB 3LCYA 2R9HD 3IB4A 1OVZA 3QUMA 3BKMH 2APWA 3EYQD 1EEYA 1IC5H 3HE6A 5D7JC 2XY2A 1HDMA 3AGVA 4JQIL 2VQ1A 5DJ8A 3MLUL 1QSFD 3RUGF 3DMMA 2DQDL 5J9PB 1GGIL 2WK2A 3DOSA 4X6DB 2XA3A 2AJVL 5BRZE 5M7QA 3VXUA 3QAZC 3U1SL 4XNMB 3LRSA 4KHXL 4RRPG 2EEDA 4OZGF 4OZFA 3FL7A 2X4TB 2HTKD 4R90L 3ULUD 3W9EA 1T20B 4QCIA 4PLNC 3EFFA 3HG1D 3IDMA 3EYVA 4Q0XL 4D0CA 3RL2A 3RVWC 4WIQA 3MRGA 5HHOB 2V17H 5EO9B 5HI5D 4Z5RA 1SYVB 1DBMH 2BC4B 4R2GD 2XY1A 4M1GH 4X6EA 4C56E 4X7CC 5D96C 3IAQA 4JLRA 3ZKNC 4Z78B 1H3VA 1S7QA 4S1RL 3KJ4B 3TVMD 35C8H 4F33B 3RX7A 1CCZA 2AJYL 4OCWH 5HHVH 3T2PA 3MNZA 3K0WA 3H3PH 3SKOB 5DFTA 3MJGX 5GGQL 1OCWH 2DMCA 1X4ZA 1SQ2N 4UI2A 1RURL 4XXDA 3QDHA 1IC4H 4PD4K 4MCYB 1D3CA 4ZFZB 3OHXB 5JR1L 2H6PB 1YEGH 2NX5E 4HAFA 3L9RA 4YDVA 1DR9A 4WEUD 2VERN 1NC4A 3JTSB 4OI7A 4PB9L 5IM7B 3DX7B 3TN0B 1HHHA 1REIA 4HQQH 2XTJB 5FFLA 4RISH 4M8QB 2A38A 3QB7C 3KPQA 4L1HA 4HKJB 2VDML 3JWOH 3IU3B 1G6RL 4ZOEA 5CSZB 4JANA 4P2CG 3VRLF 3MLSL 4RFOH 1BEYH 1ED3A 4JB9H 3G08B 3HAEA 2D0GA 3F65A 3OXRA 1MVFA 5D7IA 5C07E 1EZVY 4F58L 1DQQA 5DF0A 5LVEA 1YYMH 4RFNC 1NCNA 1NGXA 3BZ4A 1QVOA 2Z93B 4FQLL 2HWZL 2IQ9H 4UV4L 3TT1L 2A9NL 1IGCH 4QHMB 4HUMB 4YEFA 4KVNH 3TIEB 1KV3A 1KTDA 3L95B 1RU9L 5E08L 3B9EA 4GRWH 4MJIA 2CRYA 1XCTA 3G04A 3JV0A 3R06B 3WDJA 1N3NB 1NC2D 3E2HC 3FOLB 2IH1B 3TH4T 2GSGA 2HKFH 1C5DB 2KL6A 4PRBA 3W0WB 3UDWA 3BKJL 5I15H 5GGSB 3PP4L 2X1QA 1P5UA 3MOQA 4RQQB 5ACZA 2MTPA 3FHQA 3O4LD 1TNNA 4AQ1B 5J57B 3RBSA 3IRZA 3GGWA 2NZIA 2ARJQ 4HWZB 4HIEB 5DJAB 1G7JA 4KMTH 1IKNC 2H2SC 4JFEE 5EBMA 5E99L 4KRPD 3G5VA 1EJ6A 4ZS6D 1QPPA 2VLKA 5IUSA 4G8IA 1ZLSH 1DL7L 1UYWL 2E9IA 4NRZB 5CD3A 2ED9A 1QO3B 1IGMH 3CIQA 3M17A 1Q0XH 1KN4H 4AM0B 1NCAH 5EN2A 1MAML 4IDLA 3S3PA 2HTLC 5JHLL 3BDYH 4KGJA 3C2AL 3U9UA 4KC3B 1RK1B 1QEWB 2B5IC 3LS4L 5T3XL 1R3LB 2OL3H 1T66D 1SJEA 2FIRT 2HVJB 1MJUL 1NDGA 4ZD3L 4IHOB 5T1KB 4MX7B 3B43A 4HLZG 4LBEB 2ENYA 4LKCA 4I18A 2R1YA 3GZKA 5IG7A 1IC7H 4KZDH 3UC0H 2AI0H 2D0FA 5LGHL 4E42A 4M1CD 5C0BD 4GQ9H 3DX6B 4G7YL 4PRPD 4CDHA 5J13C 3SGJA 5DTFB 2JELL 4YBQD 5I1LB 3A6BH 3X17A 1G6RA 1QA9A 2NNAB 4PRNA 4W70A 1QOKA 4K8RC 4W68A 4PJBA 5C70A 2ZPKH 1ORQA 1L7IL 2AW2A 1CQKA 3FT4A 1KB5L 4O5LL 3X3FL 4D9QE 4Z7OF 3MGTB 5HDLA 4DN3H 4OLEA 1FIGH 4GG8B 4JFXA 1OWRM 1YNLL 1A8JH 5HI3D 4ZAKD 4GW4A 4JY6B 5DK2A 4Z77A 3D69A 1II4E 2Y25A 4NO3A 3EAKA 1S5HA 3B8YA 4YXHL 1VADB 3OXSB 1OT2A 5AYUL 3MA7A 5ENWA 4JM2C 4BZYA 2DDQL 2NY1B 5SWSA 1VA9A 1VACA 3Q48A 3T1WA 1JNNH 1MHEB 3ZDZF 4MSWB 1KEGH 4FQHB 1WZ1L 3KHOA 4L9LB 5IB1B 1JGVH 2X4NB 4K3EL 1I1FB 3F7QA 1YY9D 2DLFH 2YWYA 4ESKA 3MV7D 1KLFA 4TULL 2BSRB 5TDPA 1JCKA 3ULUH 1FE8H 3EOAB 3U4AA 2I9TB 5I8OL 1DBKH 3T4AB 4J3TA 2JJVA 3DV4B 1DVFB 2VMFA 3UAJD 4LSSL 2DTML 4F9LC 4DEPC 3HMWH 1BVZA 1NUDA 5FGBA 4GKZB 4Z76B 3VFVA 3WO4B 4KQ4L 3O6LL 3GMQA 1EMTL 3AROA 3QH3A 4ZOCA 3V9FA 1Z3GL 1NDMB 1WUNT 2VXQH 1VEMA 2A1WH 2H26B 1JZ2A 4OT1H 4X9HA 1QD0A 1OGAD 25C8L 15C8H 4KAQH 4LF3A 4KXZH 3UBXI 4LLVA 5DVOA 4TVPD 5CLTA 3HI1A 3OKNA 3HZKB 3BWAA 2BVOA 3O3DA 4F7CA 5DMKA 2HT3D 2OK0H 4JRXE 4PJ5E 1TCRB 1MRCL 4XP6L 2VH5H 3O11A 4Y2DA 2AK4D 1UB6B 5E2UL 1N6UA 5I1DB 1U91B 3IFPA 4TTDD 3STLB 4L3EB 4OLYH 4P5TC 4MJ6B 1LO5B 1KB5A 2AEPL 4MCZB 2DI7A 3QWRD 4N0RA 5IT2H 4XWGH 2QV2A 5GS1A 1ZANH 3MA9L 5DMYA 1U58B 2EYSA 1C16A 4JFFD 1QBLH 1FGNL 3HN3A 5BRZA 2NZ9C 3QIBD 3CVIL 4DZ8A 4W4OA 1LEIB 2WBKA 1ZA6B 1U6AL 4PLKC 4TPRH 4Z0XB 3GB7A 4HJJH 2VXUH 2D4DA 1FAIH 3LN9A 1MCPH 1B90A 2AEIT 2FH8A 4XH2A 3OWEA 4KWUA 3QIWA 3MUZ1 1VGEH 3FQTA 3LHPH 4M43L 2DBLL 3QO0B 4HG4K 2WBWB 1JGEA 3E3QE 4TUKL 3GUTB 4OFKA 4BQ9A 3S97C 3K2UH 2E7HA 4NC0B 5A2FA 1XH3B 4C56A 4GRLA 4KDVA 2R2HA 2PXYC 5J6GA 1JPST 2UWEF 3D39D 2NW3B 4HHAB 4XC3H 1K2DA 1OW0A 1CG9B 3LQAC 1CIDA 4L5FH 1GH7A 2BOBB 2HH0L 5DS8A 4KJQC 1G84A 3MGAA 3ARBC 2ZCKL 2VDNL 1AGEB 5F7UA 3U7YL 5IJVB 4QNPF 1MFBH 2YEZA 1BBJB 4OZHF 4PY8I 4N1HB 1TCMA 3B3IB 3BZDA 4BZ2L 5KVEL 3ULVE 1KNOA 2Y06H 1WAAF 1TITA 4N8VA 5D7LE 4NNPH 1OT1A 2JJSA 3QRFM 1IT9L 2W0FB 1KLUB 3PGCB 3MOAH 2FIKB 3BYTA 4HWBL 2OXHA 3DURA 4U1JB 1F3RB 1UCBH 3LKSA 4JFOA 2VDOL 4NM8L 4BQ6A 5A16B 2IANE 3Q0HA 4JZOA 2DJUA 4Y4HC 3MV8B 1N8ZB 4L8DA 4M1DL 4MAYB 4WEBH 3OKDB 5MERB 1TJHH 3QA3A 1RZJC 4IRZH 1YEIL 2ADFL 5C07A 1JYWA 1MCIA 1KCVH 2MKWA 4PJIB 4X7EC 2FBOJ 3GRWH 5FM5M 3VRLE 4Y1AD 3IF1B 1TTUA 2GITB 1ZSDA 4MAUH 4F2MA 1SEQL 4JPVH 3QI9C 4WWKA 1BIIA 3VFPA 2Z92A 4KROC 3HUJA 4PGJA 3UPRB 3AU1A 4OLXL 1G7PA 5F7FA 1DANU 3P4NA 5IOPB 1K9TA 1P6FA 5DRNB 4ZQKA 1FNLA 3PL6B 2BSTB 4EQ2A 4MJ4A 4G9FA 4GG6F 2Y6SC 2RCSL 5HGAA 3O6KH 1CGXA 3LN4A 1WBYA 5JXAL 1YNKL 5C86A 4Q58C 2X4PA 5TE7H 3INUH 3SDXF 3T4YA 1ZTXH 5FECA 5TGBB 2FECI 2FX8H 3MYJA 4JFEA 4MZ3A 2NY3D 3KYKL 4FHBD 1ZLWH 1A6AB 4LSQL 1NFIB 5CKAA 4LSPL 4LASH 1NCUA 1N64H 3S35L 5C1MB 2P1YA 1EEZB 4YXKL 3SGEI 4POYA 1QR1A 1XIWD 4PJGB 1I1AA 3QJFA 1UB5B 3LN5B 5H94B 4ZMAT 3CDGB 2W38A 3R0MA 2AXHA 4PP2B 1YPZF 5I66B 2HP4A 1BZ7B 1R5WA 4WFHE 3QEHA 1QLEL 3AS1A 3MCG1 1G9ML 1Y0LB 5L6YH 2HT2D 5BZDB 1EBAA 1KJVA 1BGXH 2DM3A 4D0DB 3DUUA 4XP1L 2Y5TA 1EAPA 1KPUA 3JV6B 4HWBA 3HPJA 5DQJB 3MX0A 1OWWA 1T7ZA 2XKNA 4NN5B 3O6MH 3P4MB 3T2QA 2C3XA 43C9A 5C0RL 1MHCA 4HH9B 4HIHB 3TJHD 4Z8FL 1QACA 4YHPA 1LHZA 1XGTA 5ID0B 3SEPA 1T7VA 1XF5B 3KPOB 3BAEH 4BH7A 1K3IA 4Q6YA 4TVPH 2VWEC 1O0VA 4ONHA 5IBTL 3OKMB 4XNYH 4JFQA 2AK1H 3F12A 4LVOB 4P59L 3TO4D 5MENB 5JPNA 2BY0A 1ITBB 1N26A 1CGTA 5EO0B 4U2ZA 4CADA 2BNQE 5KG9A 2JB6B 2G5BA 2XFXA 4JQVA 5FV1L 1JI1A 4X83A 1D6VH 2OR9H 1AC6A 4ONOA 3GSUA 4UAOC 3O4OC 4JDVB 3VWKB 4LEOB 5DK0B 4XPFL 4ELKB 4IRSB 3MJ8B 1YMMD 3VA2C 3K3QA 1UACH 2VN4A 2I07B 2O5YH 4WY7H 5IVNA 3QRGH 2DIBA 3RU8L 1F11B 2R0LL 1P7KB 4YZFF 3C5SA 2GAZB 2JJWA 5SWQA 4OV5B 4OF7A 3PWLA 5CGTA 4LLUA 1U95B 3C60C 5TPWL 1HXMA 4YPGA 4NO5A 3O8XB 5DFWH 2ADGB 4PP1C 5KSVB 5F1KC 3LIZH 3GJEB 1JVKA 2XZAH 1ZVSB 1G7HB 4P23A 2IAMC 4YHLL 1A7OL 1BVLA 3V4PL 2DQFA 3B9KA 3P9LA 3WDIA 5I73B 1HQ4B 5CILH 3SKMB 1UM6H 3SE3C 3ULVL 3RRQA 1NBYA 5D1XB 5GRVL 3TBSB 5AYQA 1SYVA 2P5ED 3HR5A 2PYEA 1CXEA 2P5WE 3MBEA 2WV3A 2R4SH 5C0DB 3H6JA 1B6DA 1UCTA 4RDQG 4PJ5A 3VFGH 3G9VA 2FO4B 1FFRA 3PE9A 4L9DA 1Q9LA 5DJ6B 5ALCL 4RGMC 4G6JL 5DJCB 5D1QC 4CVZB 3BQUA 1JFQH 1FSKB 1IAIL 2D03H 4U6YA 1MWAB 4HF5L 3MGOA 4R4NC 4NQUA 4F7MA 1HZHL 3K81A 3O3BA 4ZS7L 5EIQA 4DFHA 1T83A 4NJ9L 1IZJA 3FMGH 1KFAL 3IRPX 2A6KB 1U93A 1QLFA 1MFDH 3QQ9C 4UOW0 4LNRB 1XR8B 5HHQA 2DI9A 4QHKI 2J6EH 4WO4C 4NPYB 3C9NA 4PPTA 3V0VA 3I6LD 1FP5A 3IU3A 4B53A 2HKHL 2O61B 5A3ID 1X5AA 4HIXH 4J8RB 5B4MC 4XCNA 4WW2F 1JN6A 3SHSA 3TNNB 5J12C 3TBYA 4XCFH 2YK1H 4HS3B 1JZ4A 1TIUA 1P7QD 2EICA 3FFCD 4OZ4B 3VGGA 2YPLD 4HS8L 5D6CA 5HD8C 1FCCA 4X6FA 3BSZH 1XF4B 1YC7A 2HYMA 4HWEH 5T1DH 4U0RC 5I1CH 4G8EA 4QHMA 1T3FA 5E8NB 2UWEE 2J7LA 2ZZUT 3MOBL 4J3VA 1R3IH 3FOLA 5I1IL 1F4WL 1WT5A 1F90L 5C6PB 5TE6H 1DQMH 3FQRA 5AG8A 2FHBA 2X7LB 5GGSA 3V6ZA 2V5TA 5D7LA 1IAKB 1KG0A 5L0QC 1QSED 2JB5L 2R69L 3MRLB 3HRZB 3BKYL 1M1SA 2BHZA 2ZUXA 4QNPE 1NMCB 4OZHE 2GTZA 1J1PL 3EO9L 3V7AG 2AJUH 2BVPA 4P2QD 5DO2C 2EXYD 5ESQB 5CZKA 1QLRB 2AKRA 5TFSH 2XZQL 3TPKA 3QULA 1INEH 2NY4B 5E1AA 4BFEA 1FNSL 3RTQD 1EUTA 1H8OA 4G7VL 1Z2KA 1KIRA 3RVTC 3ARYA 4LARL 2HRPH 1EEUA 2Y07L 1B0WA 3FRPA 1XR9A 4KK8D 4GRWF 2B20A 3KWWB 4AEEA 12E8L 1ZWIB 3B2UD 4QWWD 5IW6A 5DUBB 3QDMD 2EH7H 3G6JA 4QRRE 1U8JB 1VFUA 5ITBH 3AUVA 5DZLA 2KUTA 4X0KB 1TNMA 5F9OH 2R4RH 5EIIA 2HJLA 4OUOA 4MJ5B 6CGTA 1ONQB 1J11A 1Q9KA 5E9DE 4Z7QF 4XVSL 5C0GA 3RWDB 3S88L 1MI5E 4OLWL 5JW4R 3W11D 1SVZA 3WS6C 1P1ZB 4N8CH 3CU1A 4JGUA 1QFOA 4CMMA 3ZZ1A 3ARVA 4GG6E 4CJ1A 1RZKL 3N1MC 5E00A 1ADQL 3MGTA 1GHFL 4PB0L 4GG8A 4JGMA 3BMVA 5CLWA 1FO0H 3LEYL 4G6AC 4U3HA 4ZTOH 3SDXE 4KUCF 2FB4L 1Q1JL 1UKQA 4WGVB 2CKBL 3D25B 4G8GB 3UTTB 5EC2B 4MLSA 4OM1H 3RWJA 5GGVL 2Y1VA 4KV5F 3H7LA 4FNLL 1DLHA 1CDYA 1CICC 3RDTC 4ZUUA 2ZJSL 2B1AH 4F7TB 1E4KA 1IAII 3GSWA 3V7MA 4TQEL 2YMXH 2EDFA 1DQJA 3NFSH 3DIFA 2W07A 3T0DA 1IEHA 3SDDC 1IC1A 4KKBD 4Z18A 3RWIA 5ICXB 1CL7L 4MS8D 1YPZE 3Q5OA 5LAXA 2VDLL 4JM4H 1I1FA 4LIQH 3RIAF 3MRMB 3R0NA 2H8PB 3HE6C 1IKFL 4B50A 2O93L 4M3KB 3NCMA 2QJDA 3DMMC 5DD1L 1KJ3H 3HE7D 4N8PA 4LDLB 5J06A 3QISA 3C5JA 4D3CH 4KH2A 4JN2B 4NDMA 3RGVD 3FO2B 1A1NB 3SGDI 4PRDB 3DV4A 5DC9B 1SJVA 1DVFA 2A83B 2WIIB 4G6KL 1A1MB 1PW3A 3O9WA 4MQXD 4R4FL 4R97C 4GKZA 2H1PL 3S3SA 1DDHA 4OCXL 3B2VH 1MCLA 8FABA 4NQED 1KJMA 1CT8A 1D9KD 1Z9MA 4WU7B 4G5ZH 5EOCH 4CJ0A 5JA9A 1VFMA 4NO2A 2D7NA 5DFVD 3CFKB 4RMQA 1KTLB 5IF0A 2EXWD 1J05A 2ZOLB 3QCUL 1DN0A 1D5XB 2G75B 4P46D 1CDIA 2UUDK 2V2XB 4YWGH 4EXKA 1LEKA 3GJFK 4LPVA 2JIXD 1TCRA 4YC2B 1S9VB 2OI9B 4GRMB 5I1DA 3S37H 1UB6A 1UXSA 2BHUA 2R0KL 2ZOKB 3DUHA 2P8MA 3FT3B 2BRRL 1C1EH 1J86A 5ID1B 1ADQA 4FXLA 3MNWB 1I1YB 1Z6JT 5J11B 2XRAH 1U58A 4LCCA 4WUUB 2R0WH 4J3WA 2XT1B 1Z5LA 3B4NA 2CKBA 4Y4KB 1S5IH 2F8XC 5EO1A 4QT5B 1NCCH 5F9WB 3GI9L 5I1KL 4GO6B 2E27H 1AY1H 2RJMA 4FXKA 3VFMB 4ODXB 2X4QA 1LO0L 1QBML 1IGIH 1YEHH 2APBA 4HV8A 4XC1L 4FQ1L 4YZFE 3P11L 5TF1H 1SBBA 5F6HI 4TOYL 3PV7A 1INDH 1JE6A 1JRHH 1K5NA 3BKCL 3RFZC 2Z4QA 4CNIB 2VDKH 1KXTB 3HHRB 3T0AA 1DLFL 2VLME 2GI7A 5C6WH 1H3GA 1F00I 4P4RB 4XNQB 3GUTA 1DBJH 4NM4H 1WZMA 2P5WA 1HHJA 3FQWA 4X6BB 5F1IB 1ZHKA 3LQAH 4RFEA 5FA4B 5FOJA 5CBEA 4PGEA 3DROA 1CU4H 2F8VA 3EHBC 4Y5XB 4QXWA 4I48B 3EGSB 2Y5EA 2VZSA 3WFBH 4H1LH 3MRKA 3BESR 3BVNB 4HHAA 3ROLB 4YJZL 4MVBD 4AYFA 4YE4H 1M6OB 1OF2B 2DF3A 2F53D 5F88B 3UYOD 5HYJB 4MA1C 4FQXA 5CJOL 3E0GA 4JO1H 4TNVK 3F7VA 3HG1B 2DM4A 4RGOH 3UDWC 5GS2H 3KLDA 2ZCHL 1S7XB 4NC2B 1ERNA 1DUZA 4GQPH 2W65A 5DHYA 2IADB 3QDJE 4PY7A 3NPSC 1FDLH 2WBJD 3CC5A 2W0FA 1RZJH 4FFWD 5BMFL 4NQDE 3CDCA 3GI8L 2R2CA 1K6QH 3TVMB 5CD5C 2DM2A 3D9AH 4QRPB 4RAVA 3TH3T 1S9XA 3GMOB 5FOBA 3OKDA 4QOKB 2J3SA 4XRCA 4OSUH 1W0WA 2YS4A 1I7ZA 3RZCD 4DKEL 1L6ZA 5K9QG 2Y7QB 2GT9A 5D70H 4DGVL 3CK0H 3SJVD 4A6YL 2UVEA 4V1DB 3ARRA 1RULH 2ESVD 2AP2A 3K7UA 4OJFL 4NCC2 4YHOH 4PTTA 3WHE1 1CDUA 1WBXA 4AH2A 3TESA 2AXFA 4ZYKB 4JRYD 4C55A 2LVCA 3OF6A 4I4WB 1FFOB 2UWEA 4FMKA 1CR9H 4NQCE 4OTXH 4WUKL 5KTEH 3SGJC 1T5XB 3NZ8A 1IGYA 2X70B 4R0LA 2PKDA 4JPIB 5BJTA 1RMFL 3CXDH 3L1OL 4HK0A 4G6FD 4UT7L 1Y6MR 4ODHL 2EIZA 4NO0B 4I5BB 1NAML 2NW2A 2MPAH 2DQHH 5E2JA 4BQ8A 4GBXD 4ZOAA 3S3JA 3N06B 3LSOA 2WQ8A 4LVNB 5J1AA 5IFHH 3QDGD 2O5ZL 2BNRE 2UUDH 1GZQB 3MV01 5EU6D 5DI8B 4E5XB 1EFQA 1MCCA 3ZYIA 4XNUH 5IIEA 1A6AA 4BELD 2H32B 3PJSB 3NAAH 4UT9H 3W2DH 2YD3A 4PJFF 5JW4Q 2X42A 1D5ZB 4M9OA 4TSBL 1I4FB 5IESH 1BJ1H 4X98B 3D2UB 5MI0C 1NC2B 3ME0A 5KAQF 3FT2B 3LN5A 5H94A 2C4FU 3HC0B 3R8QA 3VXSD 4MGXA 5JIIA 3MRJA 1FORL 5L2JB 5T5NG 5JLZB 2BY2A 4JO2H 1NBZB 4MHHI 4ZFFA 2GSIA 1TQCB 4MXVF 1HKFA 4QRRA 1DE4B 4N0YH 1HSBA 5FB8B 5BZDA 2YD5A 3CUPB 1CLYH 1DFBH 3BEWB 5DEZA 5T1MB 4YUEH 1EFXD 3IDNB 1I7TB 5KOVC 4I3SH 1UA6L 1W0YT 1KELH 3MRIB 4PRHE 3GSOB 3S96B 1T04A 3ES6A 3QFJD 2IMMA 3LKOB 4P5KA 4U33A 2MSPA 2VRAA 3B9AA 3RWEA 5AUMB 3P4MA 1MI5A 3O45B 3PIQA 1SM3H 3SE8H 3DRQB 4GG6A 4A6YA 3GMLA 3L6FB 2FLBT 4Z7QE 1XF5A 4XT1C 5FGBC 2CSPA 4B5EA 1I9RL 4FQ2L 2HN7A 1NFDF 5BVPH 4DVRH 4YGAB 3EO0A 3KLAB 3OKMA 1NCTA 3SDXA 5KS9B 4MXQD 2DLEA 2YA1A 4YBLB 5TQ2H 1M7IB 4R6UA 1MWAL 3OKKA 3SPVB 3CFCL 4G43B 5C0BB 2JB6A 4PRPB 2ENSA 3RUGB 3QUXD 4NKDA 4D0BB 5J4MA 4R3SB 5I1GL 3MRCB 3VD4A 3PWPB 1NAMA 2VAAB 2Z9TA 4KV5E 4PJXF 4X4XA 4Y2DC 4OZGB 3FN9A 4QRSA 3LB6C 3TZVA 5DRZB 5LGKA 1FZMA 3FRUB 5KSUB 3C6SB 4IRSA 3QQ3A 4ZAKB 1H5BC 1TPXC 5GGRY 1N5YH 2LAAA 3BP4B 3HI6H 4OI8A 1CXKA 2VXVL 1FNGA 3ARDA 3AS2A 3VG0H 4W4OC 4F57H 4U6VL 4NWTH 2NTFA 2WAHA 4DKDC 5F97E 4LCWE 4P9MH 5D7KD 4TSCH 5JA8B 3BKML 5DRWB 5ALBH 3S9DB 4LHQB 5CINL 1T03H 2AXGB 1IC5L 4I0PD 1JMXA 1ZVSA 3QIWC 4WRLA 1OSPH 1UWXH 2VDPL 2B1HL 4S1SL 1T6WA 4YK4C 4M02A 3GSQB 4POZC 1F8TL 1G7QB 4K3HA 3TFKC 4OI9A 2NYYC 2ORBH 5JORA 2VLRE 3SKMA 4M61A 2OMBA 3FO9B 1NEZA 4GRLC 1INQB 1LO4H 4NRXA 7CGTA 1T1XA 4M7ZB 1QSFE 4QTIL 5F7KC 1F6FB 1CGSH 3PQYB 4YDKH 1JMZA 2IANB 4GMSH 2NY5L 4FFZH 1E4XI 1W0VB 4ENEC 1OW0C 1HNFA 3MUHL 2HJKA 4S11A 2JKXA 3ARFB 3ZHDA 3BRDA 2APTA 5GHWH 2E9JA 1A5FH 2OTPA 3CMOH 2HMID 1OHQA 1MCBA 3ULUE 2VUOA 1BJMA 4WI2A 4P4KB 4DGYH 5E24E 4IOFD 1RJLA 5DQDH 3CFBA 3FFDA 1MWAA 4BSVB 2D0HA 4NQSB 5D2NB 5FYKH 1J1OH 1JPTH 1X4XA 4X4YA 4GXVH 3WXVL 4NHUA 1MFCL 2JJSC 2E8YA 2J8OA 4PV8A 5KANG 1KGCD 3SO5A 4KJWD 4KZEH 1MJJB 3LKPA 1UXWB 5HHVL 4UDUA 4YDJA 1MLCB 1KBGL 2E6PA 1X5HA 3E8UL 1XGQB 2W92A 4LNRA 1T21B 3U4BL 5CBAA 4OF6A 3ZDYF 1OCWL 1V3KA 3AB0C 3F7YA 4NPYA 3TWCL 5ETUB 3ESUF 2R2BA 3X3GL 1IC4L 1JYVA 4N1EA 2LTQB 1K3ZA 4LCYA 4HKZA 1S8DA 5L9DL 2G2RB 5I16A 5I19H 1IVLA 1DSFH 3TO2B 4M7JL 4MXWL 3BEVA 2ZUQB 1XCQA 4HT1H 4LRNL 2BVUA 1A3LH 4ODWA 4HQQL 4RISL 5T3ZH 3Q3GA 3QO1B 1OD9A 1FRGH 3CX5K 4O2FB 3TC9A 4RAUA 2FJGA 4WWKC 1S9WB 4RFOL 1BEYL 5BXFB 1OTUC 2OMNA 4JB9L 4XMLL 2AV7A 3H3KA 1HHKB 3C5ZD 2FLRT 1WIPA 4LAQL 2M1KA 4YHIA 2VIRB 1BOYA 4WNQB 1YYML 3H7BA 2QSCL 4JPKL 3IU4H 1HN1A 4LFHD 2OLDA 2IQ9L 4OD3H 3F58H 2B39A 1IGCL 3QDJA 4KVNL 4CVXB 5TQ0H 4ZO9A 2A2QT 5CSGA 4XCCH 3V8OA 1CD1A 4NQDA 5DVKA 4IRJA 1J88A 4G9DB 2PW2B 1BZ9B 1V7NL 1K8IB 5ESQA 2BSSA 1DJSA 3MLZL 1JGUH 4L8SC 2HKFL 4X80H 1QFUH 3BUTA 3VH8A 5IR1A 1I1AC 5I15L 4OF3A 2V2WA 3RWGB 3M1BB 2MNUA 3AXLA 4FTVD 3P9MB 1HILA 5L2KD 4XTRC 3EFDH 4YNYB 4P2OA 1PKOA 5AZEH 4YXLH 4JFHE 4N0UB 5CJQH 2Z8VC 4KMTL 2QQLL 3ZKSD 5I1JH 3DXAD 3V95A 3FN3A 1M7DA 1YDPB 3O4LE 4OQTL 3RKDD 1KSRA 4NQCA 4HULB 3GBNL 1IGML 4ODTH 5HI4C 5IJKA 2P7TA 3C8KA 1FH5H 1ONQA 2XN9A 1U3HA 4XBEH 3BDYL 1N0XL 1ZT7B 5F6IC 2JCCF 4PJDB 4Z0BH 2GFBB 3CCHB 4HXAH 5AAWA 3RWDA 1RVFH 2OL3L 1LD9A 1P1ZA 1ZHNA 4PREB 4B41A 2BNRA 3CVHB 4Y1AB 3FO0H 1IC7L 3OTTA 3DHMA 4NWUH 3S35X 3LD8B 4GQ9L 4HGMA 5ICYA 2IFGA 1ZLVK 4CW1B 4Y2OA 1QHPA 3TA3B 2NXZD 2ZPKL 2ZKHH 4JQVC 4D2NA 4HPYH 3QUMH 5I18H 3H9YA 1TZHB 4XPBH 5HTSA 2XXCB 4P57A 4UILH 2K3TA 1JGDB 1ORSB 4U7SA 1FYTD 1JIBA 2NY3B 3OB0H 1SY6H 3TV3H 4PRHA 1OOAA 3P0GB 4MXVE 5JPMA 2ZUTA 4OZFH 1JTOA 3IXTA 4O9HH 1MIMH 3QUZD 4LEXH 1L0QA 4S10A 4APQD 1PZ5A 2N7BA 4IMLA 3VMOA 4UIMA 5JZ7C 2V2TA 4JN2A 3OZ9H 1JGVL 2HFFB 4U1KB 3VJ6A 2D7TL 4JM2F 2DLFL 2R0ZL 4PRDA 4MB5A 3CSYB 5J56B 1JPSH 3B5HA 4P23C 1AKJD 3ULUL 1A9EB 3W82A 1FE8L 1MCKA 3GMPB 4NQXB 3B9KC 4AIOA 4OQTA 1WK0A 1NFDE 1U8KB 1LMKA 3MV7E 3BZEB 3T65A 1A7RL 2IEPA 5JHDE 3IETA 3WYRA 5KSAB 3ZT5A 3U2SB 3B5GA 4E41D 3DGCR 2F74B 2IFFH 1FZOB 5KZCD 2OL3A 1NH6A 1OY3B 3C08H 3W9DA 4PJ8A 3FB6B 2DQIH 3KPSE 3OX8A 3L3DB 3IDUA 5HHME 2VXQL 2A1WL 4DUVA 4OT1L 4PGCB 4PJXE 2YD2A 3OR7B 4UINH 1JHTA 15C8L 3BQUC 1F3DJ 2DQJH 3G6AA 1IGFH 4DQOL 1I9JH 2CDEB 3H0TB 5KSBB 4WUUA 3LQMA 4H5SB 2OK0L 2RFXB 4YFDB 5DD6B 4QT5A 1FL5B 2VH5L 4LCWA 1A9BB 5IEKB 3PNWB 4HPOH 4OLYL 3OJ2C 1ACYL 4TVPE 1J0HA 1JGLH 1ZT4A 2I9LA 3UJTL 1RD6A 4JQIH 5I8EB 4QRUB 1GRWA 2OR7A 1QBLL 2DQDH 4ZPTA 1GGIH 2AK4E 5CUSL 1CK0L 4HUVA 3KYMB 2VLRA 2GKIA 4ZUSB 4JHWH 3OGCB 1JK8A 4KHXH 3FOMA 1C5CH 1S7UB 5F1NB 1QSFA 2CDGA 2VXUL 4FXGB 4JFFE 1FAIL 1MCPL 3IJHB 3VXNB 3G5YA 1BOGB 5EZLA 3P4OB 4G42B 3OKEA 1FJ1A 4NIKB 1CDCA 1LWRA 5D7SL 3ILQC 3NN8B 5FK9A 5CIPB 4Q0XH 5IHBA 3BVNA 1TFHA 1JF5A 4XCEB 1KACB 3ROLA 1OF2A 5T1LD 4CKVX 3HC4H 1J87A 4P2RD 4Q6IB 3DLQR 1MREL 3QUYD 4LPCA 3RX5A 4NN7B 1PYWA 5H35A 3STZB 4LDEB 3O6FD 3ULVC 2NY0D 3VFRA 5K59F 4XC3L 1ZHBB 2IC2A 3MROB 3ZKMD 2IGFH 3MUGB 4U49A 2AJYH 4L5FL 4QKXB 4XZUB 3J8F7 4JCLA 3W5MA 3JTTB 4Y16A 3SDAB 1R3KB 4U7KA 5GGQH 3D39E 2FYYA 5FO8A 1Z9OA 5I9QB 3TVMA 5E9DB 3C09B 4GH7B 2EKJA 4M7LT 5JR1H 2EEAA 5BV7L 1YECH 1Z0NA 5LCVH 5E6ID 1K4DB 3ZDYE 3WEXA 1NGYA 3VFUA 2VITB 3D0LB 3IGAA 5HDQH 5CEXA 2Y06L 5FCUH 4NNPL 4PB9H 2Y7QA 3C87A 3X14A 3FQXB 5CHNB 5E8OA 1HIML 4U1SB 2XQBL 3PGFL 4AJ0A 3MOAL 3MRNA 1JNLH 5IBLC 1OP3K 1UCBL 2FJFA 3WUWG 2GQHA 3BW9B 1I8KB 2L4OA 4X5XA 4WEBL 1AGFB 1MUJA 2EDTA 1HXYA 5C0ND 1TJHL 2JE8A 3VWJD 3MLSH 2WW8A 3DARA 1U3ZA 1ZVHA 1B2WH 1FFOA 2WIMA 32C2B 5C9JA 1KCVL 3UJIH 4ONGL 2A6IB 2QQNH 2AJZA 2QQQA 3GRWL 3O2VH 3EYUH 3P0VL 1TLKA 4FQLH 3KPRD 2HWZH 4UV4H 3LEXB 5FYLH 4JPVL 1ZGLB 3FB7A 1RU9H 4QHNA 5IK3B 1FC2D 3VD9A 3NZHH 3UPCA 1KCSL 2ICWB 5HPMB 1KXQE 3MTRA 1TETH 3WUWB 4ODUA 2PTTB 5EFIB 4P3CH 4XBPB 3BKJH 3SDCA 4HZLB 1LDPH 4WDIB 2AEWA 3L5IA 1M71B 3H2WA 4X98A 1A0QH 1E4KC 5TE7L 4KXZI 4XHJC 2NY1C 1WC7B 3OAZK 3VXQA 5J3HC 3FJTA 5D6DC 3DVNA 1FHGA 4Q9BA 4L9LC 2R8SH 1AO7E 1NEUA 3ARGD 3EOYG 5EZJA 4RMRA 1IGJB 3O4LA 1NFKA 2L7JA 1UYWH 1OGTB 3CUPA 3X12A 3BI9X 4P2QB 4Y4FD 3DVGA 1T22A 3T0ED 3UJJL 3N50A 1AGCB 4HSQA 3I85A 2F54B 2B0SL 2KQMA 3C2AH 4BFGA 1H15A 3RTQB 2P49B 4FQQA 5CS7A 4GKSB 5D4QA 4WHCA 3DTXB 4BH8B 2Y9RT 3EIFA 1MJUH 3CFEB 1BGXL 1DVFC 3X13A 3DRQA 4JGJA 4F8TA 3L6FA 3VXOA 3IDIB 3D1MC 1UJTA 4GAGH 1V3LA 3WO4C 1F6AA 3QDMB 1CLZL 2N4IA 3QIUD 5EU4A 1GZPB 1WBZA 3SKNA 2CXKA 3O6ML 4EN3A 2PR4L 3BO8B 4MWFB 5HJ3B 4JJHA 1X5ZA 1A4KA 4QRTA 1YN7B 3SPVA 1S7RA 1L7IH 2GK0A 4PRPA 2YZ1A 3GRWA 4O5LH 4TVPL 4R3SA 3X3FH 4QHUA 1YNLH 4YH6A 2BCKA 2I5YH 2AK1L 3OJMB 3HC3H 4OCSL 3QYCA 5GSRB 4UQ2A 5CSBA 3V5DB 4W6WB 1KJ2B 4FS0A 5DYOB 4WV1B 4ZDHB 5A2KH 2DDQH 5FYJH 4QGTA 4UDTA 1D6VL 2OR9L 1RHHA