3NQ3A

Bovine beta-lactoglobulin complex with capric acid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
162
Chain Sequence
b'LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin
publication title Two modes of fatty acid binding to bovine beta-lactoglobulin-crystallographic and spectroscopic studies
pubmed doi rcsb
molecule tags Transport protein
total genus 40
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3nq3A00
1TOUA 1BEBA 4BQUA 3UEVA 1RBPA 1ZNKA 1TOWA 2GC9A 2MO5A 4EDEA 5L8NA 1I06A 2Q9SA 1KXOA 2AKQA 2HYSA 3FIQA 5DG4A 1G5WA 1X71A 2MM3A 2QO4A 3APVA 1ACDA 3U0DA 4YH0A 2GTFX 4ZJ0A 1LFOA 2LKKA 1FDQA 2KTDA 3P6FA 1SY2A 1KT5A 3FW5A 2BLGA 5HA1A 3NQ9A 4QGVA 1YWDA 4K19A 5HZ5A 3WJGA 5H8TA 1DZMA 4DQ3A 2DM5A 1EALA 2G79A 2O62A 1LIDA 5EDCA 4IAXA 4ZFXA 4ORWA 5F7GA 4XMDA 3ELXA 1BSOA 3HWFA 1TXLA 1BRQA 4GRJA 1LPJA 2HZRA 1AVGI 1ML7A 3NX1A 4TKJA 4QZTA 1DC9A 1T8VA 4BOEA 1NP4A 5HA0A 4I3CA 3HWDA 1CRBA 2OFRX 2LBVA 2HMBA 4YMYA 5CE4A 4M7MA 1U18A 3WXQA 4AYHA 1BWYA 3FW4A 3PP6A 1P6PA 4OMXA 2FR2A 4OS0A 2L9CA 4ORSA 5HZQA 5L8OA 5IO5A 1HBPA 1IW2A 1YWCA 3WJBA 1AELA 3HK1A 1BLRA 1XKIA 4HPCA 5F6ZA 2HNXA 2RQ0A 3FA7A 2AH7X 4LZVA 3D97A 4TKHA 1A2DA 1Z24A 1G85A 1TVQA 4ORXA 4AZMA 4ES7A 4N7CA 1OEEA 4GNWA 4YFRA 1ADLA 1OPBA 2AT5X 3P6HA 1JJJA 2RD7C 2RCQA 2W2BA 3DSZA 2AT6X 2FR3A 1KQXA 3MVFA 3FR2A 1TW4A 3C77X 4AZOA 1VPRA 3O22A 1ZNGA 2FT9A 4AZQA 2XSTA 2AT3X 1MX7A 4Y0RA 3FR5A 3VG4A 4RUUA 2OVAA 3ZQ3A 1BSQA 4ZH9A 4OMWA 1OEKA 1BSYA 3PEDA 5EZ2A 1IFBA 1ZNEA 4XMEA 3OJYC 1QY0A 2JU8A 1BJ7A 1H91A 4O9SA 2FLJA 1YWAA 2L5PA 3ZUOA 1GT4A 1DZJA 2OFMX 3P6DA 1ALBA 3VG3A 3KFIA 1S7DA 1S44A 4D6AA 1QFVA 4OS3A 2L68A 1YUPA 3BY0A 5BVTA 2L67A 3CBSA 3CQNA 1JV4A 1G7NA 1IIUA 4HPBA 3CMPA 3F9DA 1E06A 4EXZA 1GT3A 1RLBE 1IKJA 1LIBA 5FAZA 4QGXA 4IB7A 4YCHA 4EEJA 4TKBA 5D45A 5AQ6A 3P6EA 2EU7X 3WJCA 3K3LA 2CBSA 2HLVA 3GAQA 3B2JA 1QG5A 1VYFA 2KT4B 3CR6A 5D47A 3WJFA 1MDCA 4XMHA 3G7XA 4LKTA 2JOZA 5HZ8A 1I05A 4ALOA 4ZHHA 3SAOA 3UEUA 4ZGUA 2ALLX 2OVDA 1HMRA 1XCAA 4WBKA 5H9NA 4ODDA 3IA8A 1HMSA 1QY1A 4MVLA 2FWVA 3KQ0A 1CBQA 4AZNA 1GXAA 2K23A 4HPAA 1UREA 2K62A 3FELA 5LJBA 4IB9A 3WJEA 3FMZA 5HZ9A 1EUOA 2HZQA 3B2KA 5HWZA 3FA6A 1PM1X 3FR4A 2FS6A 4WFVA 4GNYA 3KFGA 4AW8A 4GKCA 5JR8A 3BX8A 1KT7A 1S2PA 2W2FA 1SXUA 2X46A 4GETA 3ZUIA 4AZPA 1KZXA 1X8QA 1ZNDA 4IMOA 3U9PC 2PY1A 3C78X 3PPTA 2ANSA 5C0NA 2JU3A 4ZHFA 4NNTA 1G74A 1NP1A 3TGBA 1O1VA 5B29A 1UZ2X 3P6GA 5EEEA 2RCTA 1CJ5A 4A1YA 1LKEA 2JU7A 4DQ4A 2QO6A 1SY0A 3NPOA 4BVMA 4TJZA 2LFOA 2CM4A 1GM6A 3EBKA 1I04A 4YCEA 4YKOA 3TF6A 4I3BA 2AT0X 5D8JA 1PEEA 2QOSC 1EPBA 4Y0PA 4IMNA 1CBIA 3FA8A 2ASNX 5BVSA 5HCEC 4GH7A 2WR6A 2OZQA 4YBUA 3FENA 3NQ3A 2NNEA 4YBPA 2GJ5A 4NNSA 4NP1A 1N0SA 1DV9A 1T68X 4ALBA 5LKFA 3ELZA 4IB6A 1KT6A 3T1DA 1X8PA 1BRPA 3CQRA 1MX8A 3I17A 1R0UA 3HWEA 3B2IA 1OEJA 4ZHGA 4EFGA 4NYRA 1FELA 5F6BA 1LNMA 1E02A 1BM5A 1U17A 2A2UA 4YGHA 1KT4A 4I9RA 2LB6A 5IO6A 5EPQA 4M6SA 2XKLA 1MUPA 5BVQA 4NLIA 3STNA 4PSQA 1LIEA 1B56A 1YP6A 4OS8A 5KIDA 2FS7A 2Q2MA 4QGWA 1BBPA 2NP1A 1EPAA 5HZ6A 3VG6A 1A18A 1SY1A 1FEMA 3BU9A 4I9SA 3VG5A 1ICNA 4A1HA 1D3SA 3TGCA 2A3FX 4HFOA 1X89A 3B2HA 2QM9A 4CK4A 1SXYA 1ERXA 3UEXA 3FA9A 5L8IA 1OBPA 1YIVA 5EEDA 3BX7A 3STKA 1E00A 4ZCBA 3BSZE 2W2AA 1GT5A 1GX9A 1LIFA 2F73A 3WJDA 1B8EA 1GGLA 1QY2A 1DF3A 1LF7A 1CBRA 5HCDC 1SA8A 2X45A 1QQSA 1O8VA 2ACOA 1HQPA 1B4MA 3D95A 2OVEA 3JSQA 4WFUA 2FTBA 1ERBA 3HWGA 4QYPA 5D48A 1QWDA 3P6CA 1JBHA 3PH5A 2CM9A 1X8OA 4D6BA 4ZHDA 3TZSA 4LKPA 4ZHCA 4YDAA 4XMCA 1DZKA 1AQBA 1GKAB 3KZAA 2IFBA 3IFBA 2NNQA 4ZR2A 1VYGA 2WQ9A 1OPAA 3FEKA 4A8ZA 3EYCA 1AB0A 4IBAA 3AKMA 1X8NA 1PMPA 3BDRA 3RSWA 2MJIA 5HTEA 3WVMA 2G7BA 2WSJA 5F1EA 4NLJA 3PH6A 4MVIA 1SXXA 4LZUA 4QYNA 3MBTA 3FEPA 5H9KA 5HTDA 2Q39A 3EM0A 4ORYA 1CBSA 5K06A 1ICMA 5EDBA 5LJHA 5H9LA 1YP7A 2JN3A 1QABE 3APUA 5DPQA 4ARHA 1YWBA 2CBRA 2WWPA 1SY3A 3BRNA 2AL0X 1KQWA 2YG2A 4I3DA 1E5PA 4YDBA 3APWA 5IO7A 3KFHA 1LICA 1A3YA 2WQAE 3Q6LA 1MVGA 4A60A 3KFFA 3D96A 5D4AA 1EW3A 4AZRA 1JYDA 3PECA 3FLLA 3BLGA 2A0AA 4YKMA 4YFPA 2Q2PA 1FTPA 2RA6A 1B0OA 2A2GA 5LJEA 1A57A 4MVKA 5FFHA 2E4JA 1ZRYA 1HBQA 1OBQA 1FENA 4TNNA 5LJGA 1L6MA 4XMGA 5KHPA 3EMMA 1NGLA 5LKEA 3EBWA 4NYQA 4Y0SA 5F58A 3CBCA 4HPDA 4KIIA 3I0AA 4N7DA 1OBUA 4ORUA 1EQDA 3U03A 1GT1A 3O19A 4R0BA 1IFCA 1O1UA 3AKNA 1KGLA 1I4UA 3BS2A 2ACPX 4IAWA 3WBGA 3UEWA 2Q4NA 2WEXA 3JS1A 1GKAA 2WEWA 2NNDA 3NADA 2R74A 4RUNA 3NR3A 5KICA 1JYJA 1FE3A 1GX8A 4UU3A 4IB8A 3O2YA 5LJKA 4Y0QA 5HCCC 2CZUA 1HN2A 2CZTA 4ZH6A 2FRSA 3NX2A 4QZUA 1QFTA 4GE1A 4UU2A 3C76X 3NP1A 5HAEA 1X8UA 2POAA 5LJDA 1EXSA 3B2LA 2AMMX 1HMTA 3DTQA 2N93A 3L4RA 3STMX 2AT8X 2LBAA 2R73A 3CWKA 1T0VA 1U0XA 3TGAA 4YFQA 4XMFA 3VG7A 5B27A 4QAEA 4YGGA 1D2UA 2G78A 3BU1A 1DFVA 1ZNLA 2A13A 1PBOA 3QKGA 3VG2A 1EIIA 2P8GA 1DZPA 1KOIA 3RZYA 2QO5A 1KT3A 5HBSA 5FENA 1JJXA 4TQ2A 5H9AA 1KZWA 4YGZA 1ZNHA 4ORRA 3F8AA 3APXA 5LJCA 1JZUA 2WUTA 1IKEA 1SXWA 2R56A 1EIOA 3S26A 4TLJA
chains in the Genus database with same CATH superfamily
3ZI8A 1TOUA 1BEBA 4BQUA 3UEVA 1RBPA 3Q34A 2RTEB 1ZNKA 1TOWA 2GC9A 2KD2A 2MO5A 2JGSA 1SREA 4OELA 3VE2A 4EDEA 5L8NA 1I06A 1SRFA 2OY8A 2Q9SA 1KXOA 2AKQA 2HYSA 2QOMA 3FIQA 5DG4A 1G5WA 2IZFB 4BGFA 1X71A 2MM3A 2QO4A 3APVA 1ACDA 3U0DA 4YH0A 1RXHA 2OF9A 1SWQA 4GDAA 2PI3O 2GTFX 4ZJ0A 1LFOA 2LKKA 1FDQA 2KTDA 3FYFA 3P6FA 5B5FA 1SY2A 1KT5A 2MHDA 3FW5A 2BLGA 5HA1A 4Z2PA 3NQ9A 4QGVA 1YWDA 4K19A 4AZPA 4O3ZA 3WJGA 2Z4HA 5H8TA 4DCBA 5HZ5A 1HY2A 1DZMA 3AEHA 1JIWI 2DM5A 2Y32A 4GD9A 2G79A 4DQ3A 1GX3A 2O62A 1RSUB 1LIDA 3EW1A 4O3XB 3OD9A 4IAXA 4U8UM 4GGTA 4ORWA 5EDCA 3RE5A 4ZFXA 5IXGA 5F7GA 4XMDA 3ELXA 1BSOA 1STPA 5IRUA 3HWFA 1TXLA 2C4IA 2C1SA 1BRQA 4GRJA 1LPJA 2HZRA 1AVGI 1ML7A 4CPIA 3NX1A 4TKJA 4QZTA 3S26A 3ZZVA 1OSPO 1DC9A 1T8VA 4BOEA 2BT9A 1NP4A 1N9YA 2VFBA 5AJCA 4I3CA 4MIRA 3HWDA 5HA0A 3V8UA 1CRBA 4BX6A 2OFRX 4YVBA 2LBVA 3VHHA 2HMBA 1VWIB 3OE3A 5FQ6E 4M7MA 5CE4A 1U18A 4YMYA 4BX7B 3WXQA 4AYHA 1BWYA 5FQ8E 3FW4A 3VPJE 3P02A 1SWLA 1P6PA 3PP6A 2DJFA 4U8UO 1KL4A 3T2WA 3HOLA 1HXZA 4Z2VA 4OMXA 1JQPA 2FR2A 2L9CA 4ORSA 4OS0A 5HZQA 5L8OA 1N7YA 5IO5A 4O4SA 1HBPA 3RKGA 1IW2A 1YWCA 2JMBA 3WJBA 3HK1A 2F01A 1AELA 1XKIA 1BLRA 4HPCA 5F6ZA 2HNXA 2RQ0A 3FA7A 2AH7X 4LZVA 3VU1A 2BC3A 3D97A 4TKHA 1A2DA 1I9HA 3RDQA 1Z24A 1G85A 1TVQA 1VWFB 2RTGB 4ORXA 4AZMA 4ES7A 4N7CA 1OEEA 3F6ZB 1VWMB 4GNWA 1ADLA 1OPBA 2AT5X 3P6HA 3T6LA 4YFRA 1JJJA 2RD7C 2RCQA 4GZVA 2W2BA 2GTLM 2MWHA 3DSZA 2AT6X 1JMZA 1MOYA 2FR3A 2G8CO 4ID2A 1KQXA 3MVFA 3FR2A 2IZGB 1SWOA 1TW4A 3PQSA 2IZJA 3C77X 1SWNA 4AZOA 1VPRA 3O22A 1ZNGA 2FT9A 4AZQA 2RTJA 2XSTA 2AT3X 1MX7A 1VWEB 3FR5A 4Y0RA 3VG4A 4RUUA 2OVAA 3ZQ3A 1BSQA 4ZH9A 4C5PA 4OMWA 1OEKA 1EI5A 1BSYA 3PEDA 5EZ2A 2FKGA 1IFBA 3PQUA 4O4UA 2OYBO 4CSBA 1ZNEA 2RTCB 1VWCB 1SWRA 4XMEA 3OJYC 2UZ2A 1QY0A 2JU8A 3JQOA 1BJ7A 1H91A 4LQZA 4O9SA 2VDFA 1VWKB 3WZQA 1YWAA 2FLJA 2L5PA 2AVIA 1GT4A 2GTLO 1DZJA 2OFMX 3P6DA 4L3RA 1ALBA 3ZUOA 3VG3A 4BX6B 2A8GA 3KFIA 1S7DA 1S44A 1WBIA 1Y0GA 3S5XA 4D6AA 1QFVA 4OS3A 2L68A 1YUPA 3BY0A 2RN4A 3RE6A 5BVTA 2L67A 3CBSA 3CQNA 1JV4A 2OVSA 4CDEA 1G7NA 3WZNA 1SWCA 2X34A 1IIUA 4CDCA 4HPBA 4GU8A 3CMPA 3F9DA 4MISA 4CDDA 2X32A 1E06A 3X00A 2X8SA 2RTOB 4EXZA 1GT3A 1RLBE 4HWMA 1IKJA 1LIBA 4KCAA 5FAZA 2G5LA 3SZIA 3RY1A 3WZOA 4QGXA 4IB7A 4YCHA 4EEJA 4TKBA 5D45A 5AQ6A 3P6EA 2OL6O 2EU7X 3WJCA 4BX7A 4CDFA 3NBXX 3K3LA 1VWPB 1STRB 2CBSA 1Y9LA 1AVDA 2HLVA 3B2JA 2ZAIA 3GAQA 1QG5A 1VYFA 2KT4B 3CR6A 5D47A 3WJFA 1MDCA 4XMHA 3G7XA 3WYQA 4LKTA 5FQ7E 2JOZA 5HZ8A 1KGLA 1I05A 4ALOA 5B5GA 2OF8A 4ZHHA 1SRHA 4NW4A 3SAOA 5K67A 2OY7A 3RDUA 3UEUA 4ZGUA 2ALLX 2OVDA 1HMRA 1XCAA 4WBKA 5H9NA 4ODDA 3IA8A 1HMSA 1QY1A 4FBOA 3CKGA 4ZGFA 3WOVA 4MVLA 3SOTA 1VWHB 2FWVA 3KQ0A 4KT5A 1CBQA 1MEPA 1GXAA 4AZNA 2K23A 3PDFA 4HPAA 1UREA 2K62A 3FELA 3SZHA 1KL5A 5LJBA 4IB9A 1EALA 3WJEA 1PTSA 3FMZA 5HZ9A 1EUOA 2HZQA 3B2KA 5HWZA 3FA6A 1PM1X 3CKFA 3FR4A 2FS6A 4JO6A 4WFVA 4GNYA 3KFGA 2OL7A 4AW8A 4Y5DA 3AUMO 4GKCA 1VWOB 4FGIB 1IJ8A 1SWFA 1K24A 1NDJA 1Y55X 1KT7A 1S2PA 1SMPI 1SXUA 1SWDA 1SWAA 2OY1O 2RTFB 2W2FA 2X46A 4GETA 1KZXA 4O3YA 4U3QA 1X8QA 1ZNDA 4FQBB 4IMOA 1VWDB 4O4XA 2JW1A 3U9PC 2PY1A 2FKJA 3FIDA 5K68A 1Y52X 3C78X 3MX7A 1NQMA 3PPTA 2ANSA 1K3BA 5C0NA 2JU3A 4OEMA 4NNTA 5B3MO 1N43A 1G74A 1VWRB 2X8FA 4ZHFA 1NP1A 3TGBA 1O1VA 5B29A 3ZW1A 2FHNX 1UZ2X 3P6GA 5EEEA 2RCTA 2I5VO 4A1YA 1CJ5A 1LKEA 2JU7A 4DQ4A 2QO6A 1SY0A 3NPOA 5B2AO 4BVMA 3NQKA 2LFOA 4TJZA 3RWXA 4FBVA 2CM4A 1GM6A 2ZSCA 1I04A 2RTIB 3EBKA 4YCEA 4YKOA 4CPEA 1KL3A 3TF6A 4I3BA 2AT0X 4IRWA 5D8JA 3D9WA 1PEEA 3S60A 2QOSC 1EPBA 4Y0PA 2X4MA 1CBIA 3FA8A 2ASNX 4IMNA 3SLTA 1I78A 1SWEA 2IZEB 4GH7A 2WR6A 2OZQA 4YBUA 1SRIA 3HPEA 5HCEC 5BVSA 3FENA 3NQ3A 2RTBB 2NNEA 4YBPA 3MG5A 2GJ5A 3VHIA 4NNSA 4CPHA 4NP1A 1N0SA 4Z27A 1DV9A 3H3IA 1T68X 4I95A 4ALBA 2RTRB 5LKFA 3ELZA 3HTYA 1HQQA 2OY5O 4IB6A 1KT6A 1KFFA 3T1DA 1SWSA 3P24A 1X8PA 4GUZA 2X55A 1BRPA 3CQRA 3GE2A 4Z6JA 1MX8A 3I17A 4WHIA 1R0UA 2BS6A 5IRAA 3HWEA 3B2IA 1OEJA 4ZHGA 4JHQA 4EFGA 3ZUIA 4NYRA 2F09A 1FELA 4MVEA 2IZHB 5F6BA 1UYOX 1LNMA 1E02A 3ZWEA 1LDOA 3N91A 1BM5A 1U17A 2A2UA 2RTKA 4YGHA 2BS5A 2DJGA 1KT4A 2Y3EA 4I9RA 5IRWA 4OKAA 3LHNA 1SRJA 2LB6A 2IZLB 5IO6A 5EPQA 4M6SA 3QQ2A 2XKLA 1MUPA 5BVQA 4NLIA 3STNA 4PSQA 1LIEA 2A5BA 2IZIA 1B56A 1YP6A 4KC7A 4OS8A 3ZW1B 5KIDA 2FS7A 2IZKA 2Q2MA 4QGWA 3RBYA 2BSZA 1BBPA 2NP1A 1EPAA 1N4JA 5HZ6A 3VG6A 1A18A 1SY1A 1FEMA 3BU9A 1VWQB 4I9SA 1ICNA 1SWBA 1D3SA 3VG5A 3WYPA 4A1HA 4BJ8A 2OFBA 2RTPB 2A3FX 3TGCA 2IZBA 5BYPA 1VWAB 4HFOA 1X89A 3B2HA 5B11O 3VE1A 3RDOA 2QM9A 4CK4A 1SXYA 1ERXA 3UEXA 1JMXA 4ML7B 1W6FA 4CPFA 3FA9A 2IZCB 5L8IA 1WUBA 1OBPA 1YIVA 5EEDA 4JGLA 3BX7A 3EW2A 4CPHB 4NV8A 1E2TA 4U46A 3STKA 1E00A 2MF6A 4CV7A 3E3CA 3T6FA 4ZCBA 4PJ2A 2HKDA 1SWJA 3BSZE 2RTLA 2W2AA 1GT5A 1GX9A 1LIFA 1NC9A 2F73A 1HXLA 3WJDA 1B8EA 1GGLA 4QQ1A 1QY2A 5B10O 4BCSA 1DF3A 2M4LA 1LF7A 1SWKA 1CBRA 5HCDC 1SA8A 2X45A 4U9CA 1QQSA 1DF8A 1O8VA 2ACOA 3ZW0A 1HQPA 1LCZA 3HOEA 4KC8A 4ON1A 1B4MA 3D95A 3PK2A 2RTHB 4EQAC 1VWBB 1AVEA 2OVEA 3BX8A 4GK9A 4Y59A 3JSQA 4WFUA 2FTBA 1ERBA 2IZAA 2X8TA 3HWGA 4QYPA 1QWDA 3P6CA 5CYBA 5AJBA 5D48A 4EKVA 1JBHA 1RXJA 3PH5A 2CM9A 1X8OA 4D6BA 3ZW2A 4ZHDA 3TZSA 4LKPA 3MM0A 4ZHCA 1SWTA 4XMCA 4YDAA 1DZKA 1AQBA 1GKAB 1LUQA 2WPUA 2QMIA 2YMSA 3KZAA 2IFBA 5JD2A 3KVNA 3IFBA 2NNQA 5CSEA 4ZR2A 1VYGA 2WQ9A 1OPAA 3FEKA 4A8ZA 3EYCA 1AB0A 1FJ1E 4IBAA 3AKMA 1X8NA 1PMPA 3BDRA 3RSWA 2MJIA 4Z28A 5HTEA 3WVMA 2G7BA 2WSJA 5F1EA 4NLJA 2KTSA 2A5CA 2LA7A 1SXXA 2VFCA 3EC5A 1RXKA 3PH6A 4MVIA 4LZUA 4QNIA 4QYNA 3MBTA 1SWUA 3FEPA 5H9KA 1RSTB 5HTDA 2Q39A 1MK5A 3EM0A 4ORYA 1CBSA 5K06A 3VHMA 2RTAA 1ICMA 5EDBA 5LJHA 4GJSA 5H9LA 1YP7A 4GGRA 1LDQA 1QABE 1VYOA 2JN3A 3APUA 5DPQA 4ARHA 1SLGB 1VWLB 1SRGA 1YWBA 2CBRA 2WWPA 2Z4IA 1SY3A 1LELA 2AL0X 3BRNA 4O3WA 1KQWA 1MM9A 2FGSA 1E5PA 2YG2A 3APWA 4I3DA 3KFHA 4YDBA 5IO7A 1LICA 1A3YA 2WQAE 3Q6LA 3S5VA 1LCVA 1MVGA 2RTQB 4A60A 5JR8A 3KFFA 2CAMA 3D96A 3SLOA 5D4AA 1EW3A 3RDSA 3ZW0B 1JYDA 4L1NA 4AZRA 4DNEA 3PECA 3FLLA 1UYNX 3BLGA 3RY2A 2A0AA 3T2XA 4YKMA 4YFPA 2Q2PA 1FTPA 2RA6A 1B0OA 2A2GA 5LJEA 1SWGA 1A57A 4MVKA 5FFHA 2E4JA 1ZRYA 1SLFB 1HBQA 4QRLA 1OBQA 2OFAA 2RTDB 1RAVA 1FENA 4GGZA 4TNNA 3RDMA 5LJGA 1L6MA 2RTNB 4MEEA 4XMGA 3VGWA 3SZJA 5KHPA 1VWNB 3EMMA 4I6SA 4BX5A 1NGLA 5LKEA 3EBWA 4NYQA 4Z2OA 4Y0SA 1VWJB 5F58A 4BBOA 3CBCA 4HPDA 1SLDB 4KIIA 3I0AA 4N7DA 1OBUA 4ORUA 4U8UN 1EQDA 3U03A 1GT1A 4KH8A 3O19A 2QCBA 4R0BA 4FBRA 1IFCA 1O1UA 3AKNA 3RDXA 1I4UA 2FHLA 2X56A 2ACPX 1NBXA 1W5RA 3BS2A 3FDCA 4I60A 4IAWA 3WBGA 3UEWA 2OL8O 2RTMA 2Q4NA 2ZAGA 1SWHA 2WEXA 3D4RA 1JJUA 2BHVA 1GKAA 3JS1A 2WEWA 2NNDA 3NADA 2R74A 4RUNA 3NR3A 5KICA 1JYJA 1FE3A 1GX8A 1SLEB 4UU3A 4IB8A 3O2YA 5LJKA 4Y0QA 4COTA 4IABA 5HCCC 2CZUA 5CHKA 1HN2A 2CZTA 4ZH6A 2FRSA 3NX2A 4NV7A 4QZUA 1QFTA 3LTWA 4GE1A 4UU2A 3UAQA 3C76X 3NP1A 5HAEA 1X8UA 2POAA 5LJDA 1EXSA 3B2LA 2AMMX 1HMTA 3DTQA 2N93A 1Y53X 3L4RA 1PBYA 4O4OA 4O49A 3STMX 2AT8X 1NQNA 1VWGB 2LBAA 5L3YA 2R73A 3CWKA 1T0VA 3SLJA 1U0XA 2AF5A 3TGAA 4YFQA 4XMFA 1STSB 3OBLA 2I5ZO 3VG7A 5B27A 4QAEA 5F2BA 5AEOA 1N9MA 2Y3FA 4INNA 4YGGA 1D2UA 2G78A 3BU1A 1DFVA 1ZNLA 2A13A 1PBOA 3QKGA 3VG2A 1EIIA 2P8GA 1DZPA 1KOIA 1SWPA 1Y9TA 2GTLN 3RZYA 2GH7A 2QO5A 1KT3A 5HBSA 3LV4A 5FENA 1JJXA 4GDZA 4BX5B 4TQ2A 5H9AA 1KZWA 4YGZA 4JNJA 2KW1A 1ZNHA 4ORRA 3F8AA 3APXA 5LJCA 1JZUA 3WZPA 2WUTA 1IKEA 1SXWA 1W4TA 2R56A 4GJVA 1LCWA 1EIOA 2IZDB 2UYWA 4TLJA 4B55A 2C1QA
chains in the Genus database with same CATH topology
3ZI8A 1TOUA 1BEBA 4BQUA 3UEVA 1RBPA 1ZNKA 1TOWA 2GC9A 2KD2A 2MO5A 4EDEA 3VE2A 5L8NA 1I06A 2Q9SA 1KXOA 2AKQA 2HYSA 3FIQA 5DG4A 1G5WA 1X71A 2MM3A 2QO4A 3APVA 1ACDA 3U0DA 4YH0A 2GTFX 4ZJ0A 1LFOA 2LKKA 1FDQA 2KTDA 3FYFA 3P6FA 1SY2A 1KT5A 2MHDA 3FW5A 2BLGA 5HA1A 3NQ9A 4QGVA 1YWDA 4K19A 5HZ5A 4O3ZA 3WJGA 2Z4HA 5H8TA 1DZMA 1JIWI 2DM5A 4DQ3A 1EALA 2G79A 2O62A 4O3XB 1LIDA 5EDCA 3OD9A 4IAXA 4U8UM 4ZFXA 4ORWA 5F7GA 4XMDA 3ELXA 1BSOA 3HWFA 1TXLA 1BRQA 4GRJA 1LPJA 2HZRA 1AVGI 1ML7A 3NX1A 4TKJA 4QZTA 3S26A 3ZZVA 1DC9A 1T8VA 4BOEA 2BT9A 1NP4A 5HA0A 5AJCA 4I3CA 4MIRA 3HWDA 3V8UA 1CRBA 2OFRX 2LBVA 2HMBA 5FQ6E 3OE3A 5CE4A 4M7MA 4YMYA 1U18A 3WXQA 4AYHA 1BWYA 3VPJE 3FW4A 3P02A 3PP6A 1P6PA 4U8UO 3HOLA 4OMXA 2FR2A 4OS0A 2L9CA 4ORSA 5HZQA 5L8OA 5IO5A 4O4SA 1HBPA 3RKGA 1IW2A 1YWCA 2JMBA 3WJBA 3HK1A 1AELA 1BLRA 1XKIA 4HPCA 5F6ZA 2HNXA 2RQ0A 3FA7A 2AH7X 4LZVA 3VU1A 3D97A 4TKHA 1A2DA 1Z24A 1G85A 1TVQA 4ORXA 4AZMA 4ES7A 4N7CA 1OEEA 3F6ZB 4GNWA 4YFRA 1ADLA 1OPBA 2AT5X 3P6HA 1JJJA 2RD7C 2RCQA 4GZVA 2W2BA 2GTLM 2MWHA 3DSZA 2AT6X 2FR3A 4ID2A 1KQXA 3MVFA 3FR2A 1TW4A 3PQSA 3C77X 4AZOA 1VPRA 3O22A 1ZNGA 2FT9A 4AZQA 2XSTA 2AT3X 1MX7A 4Y0RA 3FR5A 3VG4A 4RUUA 2OVAA 3ZQ3A 1BSQA 4ZH9A 4OMWA 1OEKA 1EI5A 1BSYA 3PEDA 5EZ2A 4O4UA 1IFBA 3PQUA 1ZNEA 4XMEA 3OJYC 1QY0A 2JU8A 3JQOA 1BJ7A 1H91A 4LQZA 4O9SA 2FLJA 1YWAA 2L5PA 5FQ8E 1GT4A 2GTLO 1DZJA 2OFMX 3P6DA 4L3RA 1ALBA 3ZUOA 3VG3A 4FBRA 3KFIA 1S7DA 1S44A 3S5XA 4D6AA 1QFVA 4OS3A 2L68A 1YUPA 3BY0A 2RN4A 5BVTA 2L67A 3CBSA 3CQNA 1JV4A 2OVSA 1G7NA 1IIUA 4HPBA 4GU8A 3CMPA 3F9DA 4MISA 1E06A 2X8SA 4EXZA 1GT3A 1RLBE 4HWMA 1IKJA 1LIBA 4KCAA 5FAZA 4QGXA 4IB7A 4YCHA 4EEJA 4TKBA 5D45A 5AQ6A 3P6EA 2EU7X 3WJCA 3NBXX 3K3LA 2CBSA 2HLVA 1Y9LA 3GAQA 3B2JA 2ZAIA 1QG5A 1VYFA 2KT4B 3CR6A 5D47A 3WJFA 1MDCA 4XMHA 3G7XA 4LKTA 5FQ7E 2JOZA 5HZ8A 1I05A 4ALOA 4ZHHA 4NW4A 3SAOA 3UEUA 4ZGUA 2ALLX 2OVDA 1HMRA 1XCAA 4WBKA 5H9NA 4ODDA 3IA8A 1HMSA 1QY1A 4FBOA 4ZGFA 3WOVA 4MVLA 3SOTA 2FWVA 3KQ0A 4KT5A 1CBQA 4AZNA 1GXAA 2K23A 4HPAA 1UREA 2K62A 3FELA 5LJBA 4IB9A 3WJEA 3FMZA 5HZ9A 1EUOA 2HZQA 3B2KA 5HWZA 3FA6A 1PM1X 3FR4A 2FS6A 4WFVA 4GNYA 3KFGA 4AW8A 4GKCA 4FGIB 4CSBA 5JR8A 3BX8A 1KT7A 1S2PA 1SMPI 1SXUA 2W2FA 2X46A 4GETA 3ZUIA 4AZPA 1KZXA 4O3YA 4U3QA 1X8QA 1ZNDA 4FQBB 4IMOA 4O4XA 2JW1A 3U9PC 2PY1A 3MX7A 3C78X 3PPTA 2ANSA 5C0NA 2JU3A 4ZHFA 4NNTA 1G74A 2X8FA 1NP1A 3TGBA 1O1VA 5B29A 3ZW1A 1UZ2X 3P6GA 5EEEA 2RCTA 1CJ5A 4A1YA 1LKEA 2JU7A 4DQ4A 2QO6A 1SY0A 3NPOA 4BVMA 3NQKA 2LFOA 4TJZA 3RWXA 4FBVA 2CM4A 1GM6A 3EBKA 1I04A 4YCEA 4YKOA 3TF6A 4I3BA 2AT0X 5D8JA 1PEEA 3S60A 2QOSC 1EPBA 4Y0PA 4IMNA 1CBIA 3FA8A 2ASNX 5BVSA 5HCEC 4GH7A 2WR6A 2OZQA 4YBUA 3FENA 3NQ3A 2NNEA 4YBPA 2GJ5A 4NNSA 4NP1A 1N0SA 1DV9A 3H3IA 1T68X 4I95A 4ALBA 5LKFA 3ELZA 3HTYA 4IB6A 1KT6A 3T1DA 3P24A 1X8PA 1BRPA 3CQRA 3GE2A 1MX8A 3I17A 4WHIA 1R0UA 2BS6A 3HWEA 3B2IA 1OEJA 4ZHGA 4EFGA 4NYRA 2F09A 1FELA 4MVEA 5F6BA 1LNMA 1E02A 3ZWEA 3N91A 1BM5A 1U17A 2A2UA 4YGHA 2BS5A 1KT4A 4I9RA 3LHNA 2LB6A 5IO6A 5EPQA 4M6SA 2XKLA 1MUPA 5BVQA 4NLIA 3STNA 4PSQA 1LIEA 1B56A 1YP6A 4KC7A 4OS8A 3ZW1B 5KIDA 2FS7A 2Q2MA 4QGWA 3RBYA 1BBPA 2NP1A 1EPAA 5HZ6A 3VG6A 1A18A 1SY1A 1FEMA 3BU9A 4I9SA 3VG5A 1ICNA 4A1HA 1D3SA 3TGCA 2A3FX 5BYPA 4HFOA 1X89A 3B2HA 3VE1A 2QM9A 4CK4A 1SXYA 1ERXA 3UEXA 4ML7B 3FA9A 5L8IA 1OBPA 1YIVA 5EEDA 4JGLA 3BX7A 3STKA 1E00A 4CV7A 3E3CA 4ZCBA 4PJ2A 3BSZE 2W2AA 1GT5A 1GX9A 1LIFA 2F73A 3WJDA 1B8EA 1GGLA 4QQ1A 1QY2A 1DF3A 2M4LA 1LF7A 1CBRA 5HCDC 1SA8A 2X45A 1QQSA 1O8VA 2ACOA 3ZW0A 1HQPA 3HOEA 4KC8A 1B4MA 3D95A 4EQAC 2OVEA 4GK9A 3JSQA 4WFUA 2FTBA 1ERBA 3HWGA 2X8TA 4QYPA 5AJBA 1QWDA 3P6CA 5CYBA 5D48A 1JBHA 3PH5A 2CM9A 1X8OA 4D6BA 3ZW2A 4ZHDA 3TZSA 4LKPA 4ZHCA 4YDAA 4XMCA 1DZKA 1AQBA 1GKAB 2YMSA 2QMIA 3KZAA 2IFBA 3IFBA 2NNQA 4ZR2A 1VYGA 2WQ9A 1OPAA 3FEKA 4A8ZA 3EYCA 1AB0A 4IBAA 3AKMA 1X8NA 1PMPA 3BDRA 3RSWA 2MJIA 5HTEA 3WVMA 2G7BA 2WSJA 5F1EA 4NLJA 2KTSA 2LA7A 3PH6A 1SXXA 4MVIA 4LZUA 4QNIA 4QYNA 3MBTA 3FEPA 5H9KA 5HTDA 2Q39A 3EM0A 4ORYA 1CBSA 5K06A 1ICMA 5EDBA 5LJHA 5H9LA 1YP7A 2JN3A 1QABE 3APUA 5DPQA 4ARHA 1YWBA 2CBRA 2WWPA 2Z4IA 1SY3A 3BRNA 2AL0X 4O3WA 1KQWA 2YG2A 4I3DA 1E5PA 4YDBA 3APWA 5IO7A 3KFHA 1LICA 1A3YA 2WQAE 3Q6LA 3S5VA 1MVGA 4A60A 3KFFA 3D96A 3ZW0B 5D4AA 1EW3A 4AZRA 1JYDA 4L1NA 3PECA 3FLLA 3BLGA 2A0AA 4YKMA 4YFPA 2Q2PA 1FTPA 2RA6A 1B0OA 2A2GA 5LJEA 1A57A 4MVKA 5FFHA 2E4JA 1ZRYA 4QRLA 1HBQA 1OBQA 1FENA 4TNNA 5LJGA 1L6MA 4XMGA 5KHPA 3EMMA 4I6SA 1NGLA 5LKEA 3EBWA 4NYQA 4Y0SA 5F58A 3CBCA 4HPDA 4KIIA 3I0AA 4N7DA 1OBUA 4ORUA 4U8UN 1EQDA 3U03A 1GT1A 4KH8A 3O19A 4R0BA 1IFCA 1O1UA 3AKNA 1KGLA 1I4UA 3BS2A 2ACPX 4IAWA 3WBGA 3UEWA 2Q4NA 2ZAGA 2WEXA 3D4RA 3JS1A 2BHVA 1GKAA 2WEWA 2NNDA 3NADA 2R74A 4RUNA 3NR3A 5KICA 1JYJA 1FE3A 1GX8A 4UU3A 4IB8A 3O2YA 5LJKA 4Y0QA 4COTA 4IABA 5HCCC 2CZUA 1HN2A 2CZTA 4ZH6A 2FRSA 3NX2A 4QZUA 1QFTA 4GE1A 4UU2A 3UAQA 3C76X 3NP1A 5HAEA 1X8UA 2POAA 5LJDA 1EXSA 3B2LA 2AMMX 1HMTA 3DTQA 2N93A 3L4RA 4O49A 4O4OA 3STMX 2AT8X 2LBAA 2R73A 3CWKA 1T0VA 1U0XA 3TGAA 4YFQA 4XMFA 3OBLA 3VG7A 5B27A 4QAEA 5AEOA 4INNA 4YGGA 1D2UA 2G78A 3BU1A 1DFVA 1ZNLA 2A13A 1PBOA 3QKGA 3VG2A 1EIIA 2P8GA 1DZPA 1KOIA 1Y9TA 2GTLN 3RZYA 2QO5A 1KT3A 5HBSA 3LV4A 5FENA 1JJXA 4GDZA 4TQ2A 5H9AA 1KZWA 4YGZA 2KW1A 1ZNHA 4ORRA 3F8AA 3APXA 5LJCA 1JZUA 2WUTA 1IKEA 1SXWA 2R56A 1EIOA 4U9CA 4ON1A 4TLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOU A;  1BEB A;  4BQU A;  3UEV A;  1RBP A;  1ZNK A;  1TOW A;  2GC9 A;  2MO5 A;  4EDE A;  5L8N A;  1I06 A;  2Q9S A;  1KXO A;  2AKQ A;  2HYS A;  3FIQ A;  5DG4 A;  1G5W A;  1X71 A;  2MM3 A;  2QO4 A;  3APV A;  1ACD A;  3U0D A;  4YH0 A;  2GTF X;  4ZJ0 A;  1LFO A;  2LKK A;  1FDQ A;  2KTD A;  3P6F A;  1SY2 A;  1KT5 A;  3FW5 A;  2BLG A;  5HA1 A;  3NQ9 A;  4QGV A;  1YWD A;  4K19 A;  5HZ5 A;  3WJG A;  5H8T A;  1DZM A;  4DQ3 A;  2DM5 A;  1EAL A;  2G79 A;  2O62 A;  1LID A;  5EDC A;  4IAX A;  4ZFX A;  4ORW A;  5F7G A;  4XMD A;  3ELX A;  1BSO A;  3HWF A;  1TXL A;  1BRQ A;  4GRJ A;  1LPJ A;  2HZR A;  1AVG I;  1ML7 A;  3NX1 A;  4TKJ A;  4QZT A;  1DC9 A;  1T8V A;  4BOE A;  1NP4 A;  5HA0 A;  4I3C A;  3HWD A;  1CRB A;  2OFR X;  2LBV A;  2HMB A;  4YMY A;  5CE4 A;  4M7M A;  1U18 A;  3WXQ A;  4AYH A;  1BWY A;  3FW4 A;  3PP6 A;  1P6P A;  4OMX A;  2FR2 A;  4OS0 A;  2L9C A;  4ORS A;  5HZQ A;  5L8O A;  5IO5 A;  1HBP A;  1IW2 A;  1YWC A;  3WJB A;  1AEL A;  3HK1 A;  1BLR A;  1XKI A;  4HPC A;  5F6Z A;  2HNX A;  2RQ0 A;  3FA7 A;  2AH7 X;  4LZV A;  3D97 A;  4TKH A;  1A2D A;  1Z24 A;  1G85 A;  1TVQ A;  4ORX A;  4AZM A;  4ES7 A;  4N7C A;  1OEE A;  4GNW A;  4YFR A;  1ADL A;  1OPB A;  2AT5 X;  3P6H A;  1JJJ A;  2RD7 C;  2RCQ A;  2W2B A;  3DSZ A;  2AT6 X;  2FR3 A;  1KQX A;  3MVF A;  3FR2 A;  1TW4 A;  3C77 X;  4AZO A;  1VPR A;  3O22 A;  1ZNG A;  2FT9 A;  4AZQ A;  2XST A;  2AT3 X;  1MX7 A;  4Y0R A;  3FR5 A;  3VG4 A;  4RUU A;  2OVA A;  3ZQ3 A;  1BSQ A;  4ZH9 A;  4OMW A;  1OEK A;  1BSY A;  3PED A;  5EZ2 A;  1IFB A;  1ZNE A;  4XME A;  3OJY C;  1QY0 A;  2JU8 A;  1BJ7 A;  1H91 A;  4O9S A;  2FLJ A;  1YWA A;  2L5P A;  3ZUO A;  1GT4 A;  1DZJ A;  2OFM X;  3P6D A;  1ALB A;  3VG3 A;  3KFI A;  1S7D A;  1S44 A;  4D6A A;  1QFV A;  4OS3 A;  2L68 A;  1YUP A;  3BY0 A;  5BVT A;  2L67 A;  3CBS A;  3CQN A;  1JV4 A;  1G7N A;  1IIU A;  4HPB A;  3CMP A;  3F9D A;  1E06 A;  4EXZ A;  1GT3 A;  1RLB E;  1IKJ A;  1LIB A;  5FAZ A;  4QGX A;  4IB7 A;  4YCH A;  4EEJ A;  4TKB A;  5D45 A;  5AQ6 A;  3P6E A;  2EU7 X;  3WJC A;  3K3L A;  2CBS A;  2HLV A;  3GAQ A;  3B2J A;  1QG5 A;  1VYF A;  2KT4 B;  3CR6 A;  5D47 A;  3WJF A;  1MDC A;  4XMH A;  3G7X A;  4LKT A;  2JOZ A;  5HZ8 A;  1I05 A;  4ALO A;  4ZHH A;  3SAO A;  3UEU A;  4ZGU A;  2ALL X;  2OVD A;  1HMR A;  1XCA A;  4WBK A;  5H9N A;  4ODD A;  3IA8 A;  1HMS A;  1QY1 A;  4MVL A;  2FWV A;  3KQ0 A;  1CBQ A;  4AZN A;  1GXA A;  2K23 A;  4HPA A;  1URE A;  2K62 A;  3FEL A;  5LJB A;  4IB9 A;  3WJE A;  3FMZ A;  5HZ9 A;  1EUO A;  2HZQ A;  3B2K A;  5HWZ A;  3FA6 A;  1PM1 X;  3FR4 A;  2FS6 A;  4WFV A;  4GNY A;  3KFG A;  4AW8 A;  4GKC A;  5JR8 A;  3BX8 A;  1KT7 A;  1S2P A;  2W2F A;  1SXU A;  2X46 A;  4GET A;  3ZUI A;  4AZP A;  1KZX A;  1X8Q A;  1ZND A;  4IMO A;  3U9P C;  2PY1 A;  3C78 X;  3PPT A;  2ANS A;  5C0N A;  2JU3 A;  4ZHF A;  4NNT A;  1G74 A;  1NP1 A;  3TGB A;  1O1V A;  5B29 A;  1UZ2 X;  3P6G A;  5EEE A;  2RCT A;  1CJ5 A;  4A1Y A;  1LKE A;  2JU7 A;  4DQ4 A;  2QO6 A;  1SY0 A;  3NPO A;  4BVM A;  4TJZ A;  2LFO A;  2CM4 A;  1GM6 A;  3EBK A;  1I04 A;  4YCE A;  4YKO A;  3TF6 A;  4I3B A;  2AT0 X;  5D8J A;  1PEE A;  2QOS C;  1EPB A;  4Y0P A;  4IMN A;  1CBI A;  3FA8 A;  2ASN X;  5BVS A;  5HCE C;  4GH7 A;  2WR6 A;  2OZQ A;  4YBU A;  3FEN A;  3NQ3 A;  2NNE A;  4YBP A;  2GJ5 A;  4NNS A;  4NP1 A;  1N0S A;  1DV9 A;  1T68 X;  4ALB A;  5LKF A;  3ELZ A;  4IB6 A;  1KT6 A;  3T1D A;  1X8P A;  1BRP A;  3CQR A;  1MX8 A;  3I17 A;  1R0U A;  3HWE A;  3B2I A;  1OEJ A;  4ZHG A;  4EFG A;  4NYR A;  1FEL A;  5F6B A;  1LNM A;  1E02 A;  1BM5 A;  1U17 A;  2A2U A;  4YGH A;  1KT4 A;  4I9R A;  2LB6 A;  5IO6 A;  5EPQ A;  4M6S A;  2XKL A;  1MUP A;  5BVQ A;  4NLI A;  3STN A;  4PSQ A;  1LIE A;  1B56 A;  1YP6 A;  4OS8 A;  5KID A;  2FS7 A;  2Q2M A;  4QGW A;  1BBP A;  2NP1 A;  1EPA A;  5HZ6 A;  3VG6 A;  1A18 A;  1SY1 A;  1FEM A;  3BU9 A;  4I9S A;  3VG5 A;  1ICN A;  4A1H A;  1D3S A;  3TGC A;  2A3F X;  4HFO A;  1X89 A;  3B2H A;  2QM9 A;  4CK4 A;  1SXY A;  1ERX A;  3UEX A;  3FA9 A;  5L8I A;  1OBP A;  1YIV A;  5EED A;  3BX7 A;  3STK A;  1E00 A;  4ZCB A;  3BSZ E;  2W2A A;  1GT5 A;  1GX9 A;  1LIF A;  2F73 A;  3WJD A;  1B8E A;  1GGL A;  1QY2 A;  1DF3 A;  1LF7 A;  1CBR A;  5HCD C;  1SA8 A;  2X45 A;  1QQS A;  1O8V A;  2ACO A;  1HQP A;  1B4M A;  3D95 A;  2OVE A;  3JSQ A;  4WFU A;  2FTB A;  1ERB A;  3HWG A;  4QYP A;  5D48 A;  1QWD A;  3P6C A;  1JBH A;  3PH5 A;  2CM9 A;  1X8O A;  4D6B A;  4ZHD A;  3TZS A;  4LKP A;  4ZHC A;  4YDA A;  4XMC A;  1DZK A;  1AQB A;  1GKA B;  3KZA A;  2IFB A;  3IFB A;  2NNQ A;  4ZR2 A;  1VYG A;  2WQ9 A;  1OPA A;  3FEK A;  4A8Z A;  3EYC A;  1AB0 A;  4IBA A;  3AKM A;  1X8N A;  1PMP A;  3BDR A;  3RSW A;  2MJI A;  5HTE A;  3WVM A;  2G7B A;  2WSJ A;  5F1E A;  4NLJ A;  3PH6 A;  4MVI A;  1SXX A;  4LZU A;  4QYN A;  3MBT A;  3FEP A;  5H9K A;  5HTD A;  2Q39 A;  3EM0 A;  4ORY A;  1CBS A;  5K06 A;  1ICM A;  5EDB A;  5LJH A;  5H9L A;  1YP7 A;  2JN3 A;  1QAB E;  3APU A;  5DPQ A;  4ARH A;  1YWB A;  2CBR A;  2WWP A;  1SY3 A;  3BRN A;  2AL0 X;  1KQW A;  2YG2 A;  4I3D A;  1E5P A;  4YDB A;  3APW A;  5IO7 A;  3KFH A;  1LIC A;  1A3Y A;  2WQA E;  3Q6L A;  1MVG A;  4A60 A;  3KFF A;  3D96 A;  5D4A A;  1EW3 A;  4AZR A;  1JYD A;  3PEC A;  3FLL A;  3BLG A;  2A0A A;  4YKM A;  4YFP A;  2Q2P A;  1FTP A;  2RA6 A;  1B0O A;  2A2G A;  5LJE A;  1A57 A;  4MVK A;  5FFH A;  2E4J A;  1ZRY A;  1HBQ A;  1OBQ A;  1FEN A;  4TNN A;  5LJG A;  1L6M A;  4XMG A;  5KHP A;  3EMM A;  1NGL A;  5LKE A;  3EBW A;  4NYQ A;  4Y0S A;  5F58 A;  3CBC A;  4HPD A;  4KII A;  3I0A A;  4N7D A;  1OBU A;  4ORU A;  1EQD A;  3U03 A;  1GT1 A;  3O19 A;  4R0B A;  1IFC A;  1O1U A;  3AKN A;  1KGL A;  1I4U A;  3BS2 A;  2ACP X;  4IAW A;  3WBG A;  3UEW A;  2Q4N A;  2WEX A;  3JS1 A;  1GKA A;  2WEW A;  2NND A;  3NAD A;  2R74 A;  4RUN A;  3NR3 A;  5KIC A;  1JYJ A;  1FE3 A;  1GX8 A;  4UU3 A;  4IB8 A;  3O2Y A;  5LJK A;  4Y0Q A;  5HCC C;  2CZU A;  1HN2 A;  2CZT A;  4ZH6 A;  2FRS A;  3NX2 A;  4QZU A;  1QFT A;  4GE1 A;  4UU2 A;  3C76 X;  3NP1 A;  5HAE A;  1X8U A;  2POA A;  5LJD A;  1EXS A;  3B2L A;  2AMM X;  1HMT A;  3DTQ A;  2N93 A;  3L4R A;  3STM X;  2AT8 X;  2LBA A;  2R73 A;  3CWK A;  1T0V A;  1U0X A;  3TGA A;  4YFQ A;  4XMF A;  3VG7 A;  5B27 A;  4QAE A;  4YGG A;  1D2U A;  2G78 A;  3BU1 A;  1DFV A;  1ZNL A;  2A13 A;  1PBO A;  3QKG A;  3VG2 A;  1EII A;  2P8G A;  1DZP A;  1KOI A;  3RZY A;  2QO5 A;  1KT3 A;  5HBS A;  5FEN A;  1JJX A;  4TQ2 A;  5H9A A;  1KZW A;  4YGZ A;  1ZNH A;  4ORR A;  3F8A A;  3APX A;  5LJC A;  1JZU A;  2WUT A;  1IKE A;  1SXW A;  2R56 A;  1EIO A;  3S26 A;  4TLJ A; 
#chains in the Genus database with same CATH topology
 3ZI8 A;  1TOU A;  1BEB A;  4BQU A;  3UEV A;  1RBP A;  3Q34 A;  2RTE B;  1ZNK A;  1TOW A;  2GC9 A;  2KD2 A;  2MO5 A;  2JGS A;  1SRE A;  4OEL A;  3VE2 A;  4EDE A;  5L8N A;  1I06 A;  1SRF A;  2OY8 A;  2Q9S A;  1KXO A;  2AKQ A;  2HYS A;  2QOM A;  3FIQ A;  5DG4 A;  1G5W A;  2IZF B;  4BGF A;  1X71 A;  2MM3 A;  2QO4 A;  3APV A;  1ACD A;  3U0D A;  4YH0 A;  1RXH A;  2OF9 A;  1SWQ A;  4GDA A;  2PI3 O;  2GTF X;  4ZJ0 A;  1LFO A;  2LKK A;  1FDQ A;  2KTD A;  3FYF A;  3P6F A;  5B5F A;  1SY2 A;  1KT5 A;  2MHD A;  3FW5 A;  2BLG A;  5HA1 A;  4Z2P A;  3NQ9 A;  4QGV A;  1YWD A;  4K19 A;  4AZP A;  4O3Z A;  3WJG A;  2Z4H A;  5H8T A;  4DCB A;  5HZ5 A;  1HY2 A;  1DZM A;  3AEH A;  1JIW I;  2DM5 A;  2Y32 A;  4GD9 A;  2G79 A;  4DQ3 A;  1GX3 A;  2O62 A;  1RSU B;  1LID A;  3EW1 A;  4O3X B;  3OD9 A;  4IAX A;  4U8U M;  4GGT A;  4ORW A;  5EDC A;  3RE5 A;  4ZFX A;  5IXG A;  5F7G A;  4XMD A;  3ELX A;  1BSO A;  1STP A;  5IRU A;  3HWF A;  1TXL A;  2C4I A;  2C1S A;  1BRQ A;  4GRJ A;  1LPJ A;  2HZR A;  1AVG I;  1ML7 A;  4CPI A;  3NX1 A;  4TKJ A;  4QZT A;  3S26 A;  3ZZV A;  1OSP O;  1DC9 A;  1T8V A;  4BOE A;  2BT9 A;  1NP4 A;  1N9Y A;  2VFB A;  5AJC A;  4I3C A;  4MIR A;  3HWD A;  5HA0 A;  3V8U A;  1CRB A;  4BX6 A;  2OFR X;  4YVB A;  2LBV A;  3VHH A;  2HMB A;  1VWI B;  3OE3 A;  5FQ6 E;  4M7M A;  5CE4 A;  1U18 A;  4YMY A;  4BX7 B;  3WXQ A;  4AYH A;  1BWY A;  5FQ8 E;  3FW4 A;  3VPJ E;  3P02 A;  1SWL A;  1P6P A;  3PP6 A;  2DJF A;  4U8U O;  1KL4 A;  3T2W A;  3HOL A;  1HXZ A;  4Z2V A;  4OMX A;  1JQP A;  2FR2 A;  2L9C A;  4ORS A;  4OS0 A;  5HZQ A;  5L8O A;  1N7Y A;  5IO5 A;  4O4S A;  1HBP A;  3RKG A;  1IW2 A;  1YWC A;  2JMB A;  3WJB A;  3HK1 A;  2F01 A;  1AEL A;  1XKI A;  1BLR A;  4HPC A;  5F6Z A;  2HNX A;  2RQ0 A;  3FA7 A;  2AH7 X;  4LZV A;  3VU1 A;  2BC3 A;  3D97 A;  4TKH A;  1A2D A;  1I9H A;  3RDQ A;  1Z24 A;  1G85 A;  1TVQ A;  1VWF B;  2RTG B;  4ORX A;  4AZM A;  4ES7 A;  4N7C A;  1OEE A;  3F6Z B;  1VWM B;  4GNW A;  1ADL A;  1OPB A;  2AT5 X;  3P6H A;  3T6L A;  4YFR A;  1JJJ A;  2RD7 C;  2RCQ A;  4GZV A;  2W2B A;  2GTL M;  2MWH A;  3DSZ A;  2AT6 X;  1JMZ A;  1MOY A;  2FR3 A;  2G8C O;  4ID2 A;  1KQX A;  3MVF A;  3FR2 A;  2IZG B;  1SWO A;  1TW4 A;  3PQS A;  2IZJ A;  3C77 X;  1SWN A;  4AZO A;  1VPR A;  3O22 A;  1ZNG A;  2FT9 A;  4AZQ A;  2RTJ A;  2XST A;  2AT3 X;  1MX7 A;  1VWE B;  3FR5 A;  4Y0R A;  3VG4 A;  4RUU A;  2OVA A;  3ZQ3 A;  1BSQ A;  4ZH9 A;  4C5P A;  4OMW A;  1OEK A;  1EI5 A;  1BSY A;  3PED A;  5EZ2 A;  2FKG A;  1IFB A;  3PQU A;  4O4U A;  2OYB O;  4CSB A;  1ZNE A;  2RTC B;  1VWC B;  1SWR A;  4XME A;  3OJY C;  2UZ2 A;  1QY0 A;  2JU8 A;  3JQO A;  1BJ7 A;  1H91 A;  4LQZ A;  4O9S A;  2VDF A;  1VWK B;  3WZQ A;  1YWA A;  2FLJ A;  2L5P A;  2AVI A;  1GT4 A;  2GTL O;  1DZJ A;  2OFM X;  3P6D A;  4L3R A;  1ALB A;  3ZUO A;  3VG3 A;  4BX6 B;  2A8G A;  3KFI A;  1S7D A;  1S44 A;  1WBI A;  1Y0G A;  3S5X A;  4D6A A;  1QFV A;  4OS3 A;  2L68 A;  1YUP A;  3BY0 A;  2RN4 A;  3RE6 A;  5BVT A;  2L67 A;  3CBS A;  3CQN A;  1JV4 A;  2OVS A;  4CDE A;  1G7N A;  3WZN A;  1SWC A;  2X34 A;  1IIU A;  4CDC A;  4HPB A;  4GU8 A;  3CMP A;  3F9D A;  4MIS A;  4CDD A;  2X32 A;  1E06 A;  3X00 A;  2X8S A;  2RTO B;  4EXZ A;  1GT3 A;  1RLB E;  4HWM A;  1IKJ A;  1LIB A;  4KCA A;  5FAZ A;  2G5L A;  3SZI A;  3RY1 A;  3WZO A;  4QGX A;  4IB7 A;  4YCH A;  4EEJ A;  4TKB A;  5D45 A;  5AQ6 A;  3P6E A;  2OL6 O;  2EU7 X;  3WJC A;  4BX7 A;  4CDF A;  3NBX X;  3K3L A;  1VWP B;  1STR B;  2CBS A;  1Y9L A;  1AVD A;  2HLV A;  3B2J A;  2ZAI A;  3GAQ A;  1QG5 A;  1VYF A;  2KT4 B;  3CR6 A;  5D47 A;  3WJF A;  1MDC A;  4XMH A;  3G7X A;  3WYQ A;  4LKT A;  5FQ7 E;  2JOZ A;  5HZ8 A;  1KGL A;  1I05 A;  4ALO A;  5B5G A;  2OF8 A;  4ZHH A;  1SRH A;  4NW4 A;  3SAO A;  5K67 A;  2OY7 A;  3RDU A;  3UEU A;  4ZGU A;  2ALL X;  2OVD A;  1HMR A;  1XCA A;  4WBK A;  5H9N A;  4ODD A;  3IA8 A;  1HMS A;  1QY1 A;  4FBO A;  3CKG A;  4ZGF A;  3WOV A;  4MVL A;  3SOT A;  1VWH B;  2FWV A;  3KQ0 A;  4KT5 A;  1CBQ A;  1MEP A;  1GXA A;  4AZN A;  2K23 A;  3PDF A;  4HPA A;  1URE A;  2K62 A;  3FEL A;  3SZH A;  1KL5 A;  5LJB A;  4IB9 A;  1EAL A;  3WJE A;  1PTS A;  3FMZ A;  5HZ9 A;  1EUO A;  2HZQ A;  3B2K A;  5HWZ A;  3FA6 A;  1PM1 X;  3CKF A;  3FR4 A;  2FS6 A;  4JO6 A;  4WFV A;  4GNY A;  3KFG A;  2OL7 A;  4AW8 A;  4Y5D A;  3AUM O;  4GKC A;  1VWO B;  4FGI B;  1IJ8 A;  1SWF A;  1K24 A;  1NDJ A;  1Y55 X;  1KT7 A;  1S2P A;  1SMP I;  1SXU A;  1SWD A;  1SWA A;  2OY1 O;  2RTF B;  2W2F A;  2X46 A;  4GET A;  1KZX A;  4O3Y A;  4U3Q A;  1X8Q A;  1ZND A;  4FQB B;  4IMO A;  1VWD B;  4O4X A;  2JW1 A;  3U9P C;  2PY1 A;  2FKJ A;  3FID A;  5K68 A;  1Y52 X;  3C78 X;  3MX7 A;  1NQM A;  3PPT A;  2ANS A;  1K3B A;  5C0N A;  2JU3 A;  4OEM A;  4NNT A;  5B3M O;  1N43 A;  1G74 A;  1VWR B;  2X8F A;  4ZHF A;  1NP1 A;  3TGB A;  1O1V A;  5B29 A;  3ZW1 A;  2FHN X;  1UZ2 X;  3P6G A;  5EEE A;  2RCT A;  2I5V O;  4A1Y A;  1CJ5 A;  1LKE A;  2JU7 A;  4DQ4 A;  2QO6 A;  1SY0 A;  3NPO A;  5B2A O;  4BVM A;  3NQK A;  2LFO A;  4TJZ A;  3RWX A;  4FBV A;  2CM4 A;  1GM6 A;  2ZSC A;  1I04 A;  2RTI B;  3EBK A;  4YCE A;  4YKO A;  4CPE A;  1KL3 A;  3TF6 A;  4I3B A;  2AT0 X;  4IRW A;  5D8J A;  3D9W A;  1PEE A;  3S60 A;  2QOS C;  1EPB A;  4Y0P A;  2X4M A;  1CBI A;  3FA8 A;  2ASN X;  4IMN A;  3SLT A;  1I78 A;  1SWE A;  2IZE B;  4GH7 A;  2WR6 A;  2OZQ A;  4YBU A;  1SRI A;  3HPE A;  5HCE C;  5BVS A;  3FEN A;  3NQ3 A;  2RTB B;  2NNE A;  4YBP A;  3MG5 A;  2GJ5 A;  3VHI A;  4NNS A;  4CPH A;  4NP1 A;  1N0S A;  4Z27 A;  1DV9 A;  3H3I A;  1T68 X;  4I95 A;  4ALB A;  2RTR B;  5LKF A;  3ELZ A;  3HTY A;  1HQQ A;  2OY5 O;  4IB6 A;  1KT6 A;  1KFF A;  3T1D A;  1SWS A;  3P24 A;  1X8P A;  4GUZ A;  2X55 A;  1BRP A;  3CQR A;  3GE2 A;  4Z6J A;  1MX8 A;  3I17 A;  4WHI A;  1R0U A;  2BS6 A;  5IRA A;  3HWE A;  3B2I A;  1OEJ A;  4ZHG A;  4JHQ A;  4EFG A;  3ZUI A;  4NYR A;  2F09 A;  1FEL A;  4MVE A;  2IZH B;  5F6B A;  1UYO X;  1LNM A;  1E02 A;  3ZWE A;  1LDO A;  3N91 A;  1BM5 A;  1U17 A;  2A2U A;  2RTK A;  4YGH A;  2BS5 A;  2DJG A;  1KT4 A;  2Y3E A;  4I9R A;  5IRW A;  4OKA A;  3LHN A;  1SRJ A;  2LB6 A;  2IZL B;  5IO6 A;  5EPQ A;  4M6S A;  3QQ2 A;  2XKL A;  1MUP A;  5BVQ A;  4NLI A;  3STN A;  4PSQ A;  1LIE A;  2A5B A;  2IZI A;  1B56 A;  1YP6 A;  4KC7 A;  4OS8 A;  3ZW1 B;  5KID A;  2FS7 A;  2IZK A;  2Q2M A;  4QGW A;  3RBY A;  2BSZ A;  1BBP A;  2NP1 A;  1EPA A;  1N4J A;  5HZ6 A;  3VG6 A;  1A18 A;  1SY1 A;  1FEM A;  3BU9 A;  1VWQ B;  4I9S A;  1ICN A;  1SWB A;  1D3S A;  3VG5 A;  3WYP A;  4A1H A;  4BJ8 A;  2OFB A;  2RTP B;  2A3F X;  3TGC A;  2IZB A;  5BYP A;  1VWA B;  4HFO A;  1X89 A;  3B2H A;  5B11 O;  3VE1 A;  3RDO A;  2QM9 A;  4CK4 A;  1SXY A;  1ERX A;  3UEX A;  1JMX A;  4ML7 B;  1W6F A;  4CPF A;  3FA9 A;  2IZC B;  5L8I A;  1WUB A;  1OBP A;  1YIV A;  5EED A;  4JGL A;  3BX7 A;  3EW2 A;  4CPH B;  4NV8 A;  1E2T A;  4U46 A;  3STK A;  1E00 A;  2MF6 A;  4CV7 A;  3E3C A;  3T6F A;  4ZCB A;  4PJ2 A;  2HKD A;  1SWJ A;  3BSZ E;  2RTL A;  2W2A A;  1GT5 A;  1GX9 A;  1LIF A;  1NC9 A;  2F73 A;  1HXL A;  3WJD A;  1B8E A;  1GGL A;  4QQ1 A;  1QY2 A;  5B10 O;  4BCS A;  1DF3 A;  2M4L A;  1LF7 A;  1SWK A;  1CBR A;  5HCD C;  1SA8 A;  2X45 A;  4U9C A;  1QQS A;  1DF8 A;  1O8V A;  2ACO A;  3ZW0 A;  1HQP A;  1LCZ A;  3HOE A;  4KC8 A;  4ON1 A;  1B4M A;  3D95 A;  3PK2 A;  2RTH B;  4EQA C;  1VWB B;  1AVE A;  2OVE A;  3BX8 A;  4GK9 A;  4Y59 A;  3JSQ A;  4WFU A;  2FTB A;  1ERB A;  2IZA A;  2X8T A;  3HWG A;  4QYP A;  1QWD A;  3P6C A;  5CYB A;  5AJB A;  5D48 A;  4EKV A;  1JBH A;  1RXJ A;  3PH5 A;  2CM9 A;  1X8O A;  4D6B A;  3ZW2 A;  4ZHD A;  3TZS A;  4LKP A;  3MM0 A;  4ZHC A;  1SWT A;  4XMC A;  4YDA A;  1DZK A;  1AQB A;  1GKA B;  1LUQ A;  2WPU A;  2QMI A;  2YMS A;  3KZA A;  2IFB A;  5JD2 A;  3KVN A;  3IFB A;  2NNQ A;  5CSE A;  4ZR2 A;  1VYG A;  2WQ9 A;  1OPA A;  3FEK A;  4A8Z A;  3EYC A;  1AB0 A;  1FJ1 E;  4IBA A;  3AKM A;  1X8N A;  1PMP A;  3BDR A;  3RSW A;  2MJI A;  4Z28 A;  5HTE A;  3WVM A;  2G7B A;  2WSJ A;  5F1E A;  4NLJ A;  2KTS A;  2A5C A;  2LA7 A;  1SXX A;  2VFC A;  3EC5 A;  1RXK A;  3PH6 A;  4MVI A;  4LZU A;  4QNI A;  4QYN A;  3MBT A;  1SWU A;  3FEP A;  5H9K A;  1RST B;  5HTD A;  2Q39 A;  1MK5 A;  3EM0 A;  4ORY A;  1CBS A;  5K06 A;  3VHM A;  2RTA A;  1ICM A;  5EDB A;  5LJH A;  4GJS A;  5H9L A;  1YP7 A;  4GGR A;  1LDQ A;  1QAB E;  1VYO A;  2JN3 A;  3APU A;  5DPQ A;  4ARH A;  1SLG B;  1VWL B;  1SRG A;  1YWB A;  2CBR A;  2WWP A;  2Z4I A;  1SY3 A;  1LEL A;  2AL0 X;  3BRN A;  4O3W A;  1KQW A;  1MM9 A;  2FGS A;  1E5P A;  2YG2 A;  3APW A;  4I3D A;  3KFH A;  4YDB A;  5IO7 A;  1LIC A;  1A3Y A;  2WQA E;  3Q6L A;  3S5V A;  1LCV A;  1MVG A;  2RTQ B;  4A60 A;  5JR8 A;  3KFF A;  2CAM A;  3D96 A;  3SLO A;  5D4A A;  1EW3 A;  3RDS A;  3ZW0 B;  1JYD A;  4L1N A;  4AZR A;  4DNE A;  3PEC A;  3FLL A;  1UYN X;  3BLG A;  3RY2 A;  2A0A A;  3T2X A;  4YKM A;  4YFP A;  2Q2P A;  1FTP A;  2RA6 A;  1B0O A;  2A2G A;  5LJE A;  1SWG A;  1A57 A;  4MVK A;  5FFH A;  2E4J A;  1ZRY A;  1SLF B;  1HBQ A;  4QRL A;  1OBQ A;  2OFA A;  2RTD B;  1RAV A;  1FEN A;  4GGZ A;  4TNN A;  3RDM A;  5LJG A;  1L6M A;  2RTN B;  4MEE A;  4XMG A;  3VGW A;  3SZJ A;  5KHP A;  1VWN B;  3EMM A;  4I6S A;  4BX5 A;  1NGL A;  5LKE A;  3EBW A;  4NYQ A;  4Z2O A;  4Y0S A;  1VWJ B;  5F58 A;  4BBO A;  3CBC A;  4HPD A;  1SLD B;  4KII A;  3I0A A;  4N7D A;  1OBU A;  4ORU A;  4U8U N;  1EQD A;  3U03 A;  1GT1 A;  4KH8 A;  3O19 A;  2QCB A;  4R0B A;  4FBR A;  1IFC A;  1O1U A;  3AKN A;  3RDX A;  1I4U A;  2FHL A;  2X56 A;  2ACP X;  1NBX A;  1W5R A;  3BS2 A;  3FDC A;  4I60 A;  4IAW A;  3WBG A;  3UEW A;  2OL8 O;  2RTM A;  2Q4N A;  2ZAG A;  1SWH A;  2WEX A;  3D4R A;  1JJU A;  2BHV A;  1GKA A;  3JS1 A;  2WEW A;  2NND A;  3NAD A;  2R74 A;  4RUN A;  3NR3 A;  5KIC A;  1JYJ A;  1FE3 A;  1GX8 A;  1SLE B;  4UU3 A;  4IB8 A;  3O2Y A;  5LJK A;  4Y0Q A;  4COT A;  4IAB A;  5HCC C;  2CZU A;  5CHK A;  1HN2 A;  2CZT A;  4ZH6 A;  2FRS A;  3NX2 A;  4NV7 A;  4QZU A;  1QFT A;  3LTW A;  4GE1 A;  4UU2 A;  3UAQ A;  3C76 X;  3NP1 A;  5HAE A;  1X8U A;  2POA A;  5LJD A;  1EXS A;  3B2L A;  2AMM X;  1HMT A;  3DTQ A;  2N93 A;  1Y53 X;  3L4R A;  1PBY A;  4O4O A;  4O49 A;  3STM X;  2AT8 X;  1NQN A;  1VWG B;  2LBA A;  5L3Y A;  2R73 A;  3CWK A;  1T0V A;  3SLJ A;  1U0X A;  2AF5 A;  3TGA A;  4YFQ A;  4XMF A;  1STS B;  3OBL A;  2I5Z O;  3VG7 A;  5B27 A;  4QAE A;  5F2B A;  5AEO A;  1N9M A;  2Y3F A;  4INN A;  4YGG A;  1D2U A;  2G78 A;  3BU1 A;  1DFV A;  1ZNL A;  2A13 A;  1PBO A;  3QKG A;  3VG2 A;  1EII A;  2P8G A;  1DZP A;  1KOI A;  1SWP A;  1Y9T A;  2GTL N;  3RZY A;  2GH7 A;  2QO5 A;  1KT3 A;  5HBS A;  3LV4 A;  5FEN A;  1JJX A;  4GDZ A;  4BX5 B;  4TQ2 A;  5H9A A;  1KZW A;  4YGZ A;  4JNJ A;  2KW1 A;  1ZNH A;  4ORR A;  3F8A A;  3APX A;  5LJC A;  1JZU A;  3WZP A;  2WUT A;  1IKE A;  1SXW A;  1W4T A;  2R56 A;  4GJV A;  1LCW A;  1EIO A;  2IZD B;  2UYW A;  4TLJ A;  4B55 A;  2C1Q A; 
#chains in the Genus database with same CATH homology
 3ZI8 A;  1TOU A;  1BEB A;  4BQU A;  3UEV A;  1RBP A;  1ZNK A;  1TOW A;  2GC9 A;  2KD2 A;  2MO5 A;  4EDE A;  3VE2 A;  5L8N A;  1I06 A;  2Q9S A;  1KXO A;  2AKQ A;  2HYS A;  3FIQ A;  5DG4 A;  1G5W A;  1X71 A;  2MM3 A;  2QO4 A;  3APV A;  1ACD A;  3U0D A;  4YH0 A;  2GTF X;  4ZJ0 A;  1LFO A;  2LKK A;  1FDQ A;  2KTD A;  3FYF A;  3P6F A;  1SY2 A;  1KT5 A;  2MHD A;  3FW5 A;  2BLG A;  5HA1 A;  3NQ9 A;  4QGV A;  1YWD A;  4K19 A;  5HZ5 A;  4O3Z A;  3WJG A;  2Z4H A;  5H8T A;  1DZM A;  1JIW I;  2DM5 A;  4DQ3 A;  1EAL A;  2G79 A;  2O62 A;  4O3X B;  1LID A;  5EDC A;  3OD9 A;  4IAX A;  4U8U M;  4ZFX A;  4ORW A;  5F7G A;  4XMD A;  3ELX A;  1BSO A;  3HWF A;  1TXL A;  1BRQ A;  4GRJ A;  1LPJ A;  2HZR A;  1AVG I;  1ML7 A;  3NX1 A;  4TKJ A;  4QZT A;  3S26 A;  3ZZV A;  1DC9 A;  1T8V A;  4BOE A;  2BT9 A;  1NP4 A;  5HA0 A;  5AJC A;  4I3C A;  4MIR A;  3HWD A;  3V8U A;  1CRB A;  2OFR X;  2LBV A;  2HMB A;  5FQ6 E;  3OE3 A;  5CE4 A;  4M7M A;  4YMY A;  1U18 A;  3WXQ A;  4AYH A;  1BWY A;  3VPJ E;  3FW4 A;  3P02 A;  3PP6 A;  1P6P A;  4U8U O;  3HOL A;  4OMX A;  2FR2 A;  4OS0 A;  2L9C A;  4ORS A;  5HZQ A;  5L8O A;  5IO5 A;  4O4S A;  1HBP A;  3RKG A;  1IW2 A;  1YWC A;  2JMB A;  3WJB A;  3HK1 A;  1AEL A;  1BLR A;  1XKI A;  4HPC A;  5F6Z A;  2HNX A;  2RQ0 A;  3FA7 A;  2AH7 X;  4LZV A;  3VU1 A;  3D97 A;  4TKH A;  1A2D A;  1Z24 A;  1G85 A;  1TVQ A;  4ORX A;  4AZM A;  4ES7 A;  4N7C A;  1OEE A;  3F6Z B;  4GNW A;  4YFR A;  1ADL A;  1OPB A;  2AT5 X;  3P6H A;  1JJJ A;  2RD7 C;  2RCQ A;  4GZV A;  2W2B A;  2GTL M;  2MWH A;  3DSZ A;  2AT6 X;  2FR3 A;  4ID2 A;  1KQX A;  3MVF A;  3FR2 A;  1TW4 A;  3PQS A;  3C77 X;  4AZO A;  1VPR A;  3O22 A;  1ZNG A;  2FT9 A;  4AZQ A;  2XST A;  2AT3 X;  1MX7 A;  4Y0R A;  3FR5 A;  3VG4 A;  4RUU A;  2OVA A;  3ZQ3 A;  1BSQ A;  4ZH9 A;  4OMW A;  1OEK A;  1EI5 A;  1BSY A;  3PED A;  5EZ2 A;  4O4U A;  1IFB A;  3PQU A;  1ZNE A;  4XME A;  3OJY C;  1QY0 A;  2JU8 A;  3JQO A;  1BJ7 A;  1H91 A;  4LQZ A;  4O9S A;  2FLJ A;  1YWA A;  2L5P A;  5FQ8 E;  1GT4 A;  2GTL O;  1DZJ A;  2OFM X;  3P6D A;  4L3R A;  1ALB A;  3ZUO A;  3VG3 A;  4FBR A;  3KFI A;  1S7D A;  1S44 A;  3S5X A;  4D6A A;  1QFV A;  4OS3 A;  2L68 A;  1YUP A;  3BY0 A;  2RN4 A;  5BVT A;  2L67 A;  3CBS A;  3CQN A;  1JV4 A;  2OVS A;  1G7N A;  1IIU A;  4HPB A;  4GU8 A;  3CMP A;  3F9D A;  4MIS A;  1E06 A;  2X8S A;  4EXZ A;  1GT3 A;  1RLB E;  4HWM A;  1IKJ A;  1LIB A;  4KCA A;  5FAZ A;  4QGX A;  4IB7 A;  4YCH A;  4EEJ A;  4TKB A;  5D45 A;  5AQ6 A;  3P6E A;  2EU7 X;  3WJC A;  3NBX X;  3K3L A;  2CBS A;  2HLV A;  1Y9L A;  3GAQ A;  3B2J A;  2ZAI A;  1QG5 A;  1VYF A;  2KT4 B;  3CR6 A;  5D47 A;  3WJF A;  1MDC A;  4XMH A;  3G7X A;  4LKT A;  5FQ7 E;  2JOZ A;  5HZ8 A;  1I05 A;  4ALO A;  4ZHH A;  4NW4 A;  3SAO A;  3UEU A;  4ZGU A;  2ALL X;  2OVD A;  1HMR A;  1XCA A;  4WBK A;  5H9N A;  4ODD A;  3IA8 A;  1HMS A;  1QY1 A;  4FBO A;  4ZGF A;  3WOV A;  4MVL A;  3SOT A;  2FWV A;  3KQ0 A;  4KT5 A;  1CBQ A;  4AZN A;  1GXA A;  2K23 A;  4HPA A;  1URE A;  2K62 A;  3FEL A;  5LJB A;  4IB9 A;  3WJE A;  3FMZ A;  5HZ9 A;  1EUO A;  2HZQ A;  3B2K A;  5HWZ A;  3FA6 A;  1PM1 X;  3FR4 A;  2FS6 A;  4WFV A;  4GNY A;  3KFG A;  4AW8 A;  4GKC A;  4FGI B;  4CSB A;  5JR8 A;  3BX8 A;  1KT7 A;  1S2P A;  1SMP I;  1SXU A;  2W2F A;  2X46 A;  4GET A;  3ZUI A;  4AZP A;  1KZX A;  4O3Y A;  4U3Q A;  1X8Q A;  1ZND A;  4FQB B;  4IMO A;  4O4X A;  2JW1 A;  3U9P C;  2PY1 A;  3MX7 A;  3C78 X;  3PPT A;  2ANS A;  5C0N A;  2JU3 A;  4ZHF A;  4NNT A;  1G74 A;  2X8F A;  1NP1 A;  3TGB A;  1O1V A;  5B29 A;  3ZW1 A;  1UZ2 X;  3P6G A;  5EEE A;  2RCT A;  1CJ5 A;  4A1Y A;  1LKE A;  2JU7 A;  4DQ4 A;  2QO6 A;  1SY0 A;  3NPO A;  4BVM A;  3NQK A;  2LFO A;  4TJZ A;  3RWX A;  4FBV A;  2CM4 A;  1GM6 A;  3EBK A;  1I04 A;  4YCE A;  4YKO A;  3TF6 A;  4I3B A;  2AT0 X;  5D8J A;  1PEE A;  3S60 A;  2QOS C;  1EPB A;  4Y0P A;  4IMN A;  1CBI A;  3FA8 A;  2ASN X;  5BVS A;  5HCE C;  4GH7 A;  2WR6 A;  2OZQ A;  4YBU A;  3FEN A;  3NQ3 A;  2NNE A;  4YBP A;  2GJ5 A;  4NNS A;  4NP1 A;  1N0S A;  1DV9 A;  3H3I A;  1T68 X;  4I95 A;  4ALB A;  5LKF A;  3ELZ A;  3HTY A;  4IB6 A;  1KT6 A;  3T1D A;  3P24 A;  1X8P A;  1BRP A;  3CQR A;  3GE2 A;  1MX8 A;  3I17 A;  4WHI A;  1R0U A;  2BS6 A;  3HWE A;  3B2I A;  1OEJ A;  4ZHG A;  4EFG A;  4NYR A;  2F09 A;  1FEL A;  4MVE A;  5F6B A;  1LNM A;  1E02 A;  3ZWE A;  3N91 A;  1BM5 A;  1U17 A;  2A2U A;  4YGH A;  2BS5 A;  1KT4 A;  4I9R A;  3LHN A;  2LB6 A;  5IO6 A;  5EPQ A;  4M6S A;  2XKL A;  1MUP A;  5BVQ A;  4NLI A;  3STN A;  4PSQ A;  1LIE A;  1B56 A;  1YP6 A;  4KC7 A;  4OS8 A;  3ZW1 B;  5KID A;  2FS7 A;  2Q2M A;  4QGW A;  3RBY A;  1BBP A;  2NP1 A;  1EPA A;  5HZ6 A;  3VG6 A;  1A18 A;  1SY1 A;  1FEM A;  3BU9 A;  4I9S A;  3VG5 A;  1ICN A;  4A1H A;  1D3S A;  3TGC A;  2A3F X;  5BYP A;  4HFO A;  1X89 A;  3B2H A;  3VE1 A;  2QM9 A;  4CK4 A;  1SXY A;  1ERX A;  3UEX A;  4ML7 B;  3FA9 A;  5L8I A;  1OBP A;  1YIV A;  5EED A;  4JGL A;  3BX7 A;  3STK A;  1E00 A;  4CV7 A;  3E3C A;  4ZCB A;  4PJ2 A;  3BSZ E;  2W2A A;  1GT5 A;  1GX9 A;  1LIF A;  2F73 A;  3WJD A;  1B8E A;  1GGL A;  4QQ1 A;  1QY2 A;  1DF3 A;  2M4L A;  1LF7 A;  1CBR A;  5HCD C;  1SA8 A;  2X45 A;  1QQS A;  1O8V A;  2ACO A;  3ZW0 A;  1HQP A;  3HOE A;  4KC8 A;  1B4M A;  3D95 A;  4EQA C;  2OVE A;  4GK9 A;  3JSQ A;  4WFU A;  2FTB A;  1ERB A;  3HWG A;  2X8T A;  4QYP A;  5AJB A;  1QWD A;  3P6C A;  5CYB A;  5D48 A;  1JBH A;  3PH5 A;  2CM9 A;  1X8O A;  4D6B A;  3ZW2 A;  4ZHD A;  3TZS A;  4LKP A;  4ZHC A;  4YDA A;  4XMC A;  1DZK A;  1AQB A;  1GKA B;  2YMS A;  2QMI A;  3KZA A;  2IFB A;  3IFB A;  2NNQ A;  4ZR2 A;  1VYG A;  2WQ9 A;  1OPA A;  3FEK A;  4A8Z A;  3EYC A;  1AB0 A;  4IBA A;  3AKM A;  1X8N A;  1PMP A;  3BDR A;  3RSW A;  2MJI A;  5HTE A;  3WVM A;  2G7B A;  2WSJ A;  5F1E A;  4NLJ A;  2KTS A;  2LA7 A;  3PH6 A;  1SXX A;  4MVI A;  4LZU A;  4QNI A;  4QYN A;  3MBT A;  3FEP A;  5H9K A;  5HTD A;  2Q39 A;  3EM0 A;  4ORY A;  1CBS A;  5K06 A;  1ICM A;  5EDB A;  5LJH A;  5H9L A;  1YP7 A;  2JN3 A;  1QAB E;  3APU A;  5DPQ A;  4ARH A;  1YWB A;  2CBR A;  2WWP A;  2Z4I A;  1SY3 A;  3BRN A;  2AL0 X;  4O3W A;  1KQW A;  2YG2 A;  4I3D A;  1E5P A;  4YDB A;  3APW A;  5IO7 A;  3KFH A;  1LIC A;  1A3Y A;  2WQA E;  3Q6L A;  3S5V A;  1MVG A;  4A60 A;  3KFF A;  3D96 A;  3ZW0 B;  5D4A A;  1EW3 A;  4AZR A;  1JYD A;  4L1N A;  3PEC A;  3FLL A;  3BLG A;  2A0A A;  4YKM A;  4YFP A;  2Q2P A;  1FTP A;  2RA6 A;  1B0O A;  2A2G A;  5LJE A;  1A57 A;  4MVK A;  5FFH A;  2E4J A;  1ZRY A;  4QRL A;  1HBQ A;  1OBQ A;  1FEN A;  4TNN A;  5LJG A;  1L6M A;  4XMG A;  5KHP A;  3EMM A;  4I6S A;  1NGL A;  5LKE A;  3EBW A;  4NYQ A;  4Y0S A;  5F58 A;  3CBC A;  4HPD A;  4KII A;  3I0A A;  4N7D A;  1OBU A;  4ORU A;  4U8U N;  1EQD A;  3U03 A;  1GT1 A;  4KH8 A;  3O19 A;  4R0B A;  1IFC A;  1O1U A;  3AKN A;  1KGL A;  1I4U A;  3BS2 A;  2ACP X;  4IAW A;  3WBG A;  3UEW A;  2Q4N A;  2ZAG A;  2WEX A;  3D4R A;  3JS1 A;  2BHV A;  1GKA A;  2WEW A;  2NND A;  3NAD A;  2R74 A;  4RUN A;  3NR3 A;  5KIC A;  1JYJ A;  1FE3 A;  1GX8 A;  4UU3 A;  4IB8 A;  3O2Y A;  5LJK A;  4Y0Q A;  4COT A;  4IAB A;  5HCC C;  2CZU A;  1HN2 A;  2CZT A;  4ZH6 A;  2FRS A;  3NX2 A;  4QZU A;  1QFT A;  4GE1 A;  4UU2 A;  3UAQ A;  3C76 X;  3NP1 A;  5HAE A;  1X8U A;  2POA A;  5LJD A;  1EXS A;  3B2L A;  2AMM X;  1HMT A;  3DTQ A;  2N93 A;  3L4R A;  4O49 A;  4O4O A;  3STM X;  2AT8 X;  2LBA A;  2R73 A;  3CWK A;  1T0V A;  1U0X A;  3TGA A;  4YFQ A;  4XMF A;  3OBL A;  3VG7 A;  5B27 A;  4QAE A;  5AEO A;  4INN A;  4YGG A;  1D2U A;  2G78 A;  3BU1 A;  1DFV A;  1ZNL A;  2A13 A;  1PBO A;  3QKG A;  3VG2 A;  1EII A;  2P8G A;  1DZP A;  1KOI A;  1Y9T A;  2GTL N;  3RZY A;  2QO5 A;  1KT3 A;  5HBS A;  3LV4 A;  5FEN A;  1JJX A;  4GDZ A;  4TQ2 A;  5H9A A;  1KZW A;  4YGZ A;  2KW1 A;  1ZNH A;  4ORR A;  3F8A A;  3APX A;  5LJC A;  1JZU A;  2WUT A;  1IKE A;  1SXW A;  2R56 A;  1EIO A;  4U9C A;  4ON1 A;  4TLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...