3NQ6A

Crystal structure of the mutant p180a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor 6-azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISAGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the mutant P180A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor 6-azaUMP
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nq6A00
4O53A 1GYLA 1RR2A 3C2RA 1SR9A 1WAUA 3C6CA 3NL5A 3W3OA 3NM1A 5AHLA 3HGJA 4Y6GA 1D9EA 3MW7A 1OK4A 4ZQNA 1RZMA 6ALDA 1KLZA 2G5WA 2HSAA 1QR7A 4CCDA 2QJIA 3GB6A 1LOQA 4FIRA 3HG4A 4WY0F 4IOTA 1ICSA 3LI0A 2ZZ5A 2EF9A 3TW7A 3UY7A 4MFEA 4NXKA 1SPQA 1FXPA 2VFIA 4NJJA 3TAOA 2GUUA 3RLVA 5LNWA 4A2SA 2R8WA 2VENA 3MYOA 3QSRA 5CZSA 1O94A 1JUBA 4LS2A 3W7HA 2HS8A 3N9SA 5IBXC 3GDMA 1SZFA 1OHLA 2DZVA 3WFAA 1O4UA 3NL3A 4NNCA 1KV5A 1OK6A 1EP1A 2RKXA 2YR1A 2ZFAA 3CWOX 4O16A 4IQLA 2AQWA 4AVFA 1MZHA 3CB8A 2V2CA 4OBTA 1I2RA 4DF0A 1TTPA 3WK3A 1G4SA 3QQ1A 2CZ5A 1GTHA 4FXSA 3L5LA 5A8GA 3NR0A 3JRKA 3W2MA 2V8ZA 3O05A 4OQVA 1VCVA 2Z0IA 1G6CA 4LOCA 2EGZA 4MZ1A 3V1PA 2VKZG 3LBMA 1WDWA 4MUZA 2E6AA 5AYXA 3OVPA 2I1OA 3VNDA 1GVQA 5HUOA 1IGSA 1Q6RA 1PHQA 4UFLA 4EOUA 5AC8A 4IMGA 2VEIA 4WXYA 1JQXA 3PAJA 1VH7A 4O52A 2QCEA 5DLCA 2QF7A 3W7DA 2E5CA 3PSVA 1KTCA 2UV8G 4JX6A 1C9DA 4DO5A 1XKYA 4XKYB 3PG8A 4IUOA 3S6DA 3TC7A 5D02A 4HKPA 3IIXA 3O8AA 4BI6A 2NV1A 3M5YA 5K2ZA 1OX5A 2QCMA 3DHFA 5K3VA 3OG3A 4LS0A 4IX0A 1K02A 3PC0A 1KFEA 1D3GA 2QAPA 3HG3A 1X7FA 3O15A 4M6PA 3TMQA 1AL7A 2DZPA 3IIPA 4A3UA 2NX9A 4DPQA 3W2NA 2H90A 3Q58A 1KFBA 5K4ZA 4FNTA 3GKAA 1XFBA 2PRHA 3EX1A 3SW6A 3T7VA 3N2MA 1JCMP 3CIWA 4GUHA 4G1KA 3WJXA 4KFOA 1PE1A 1PIIA 5FEWA 3W74A 4O4VA 4DBEA 2P10A 5KZDA 4WY0A 2GVGA 4XBSA 3NQ6A 5C6MA 4QJ1A 1QMLA 1OYCA 3S9YA 1ZAHA 3P74A 5SWUA 3PB2A 1QPOA 2A21A 1YDVA 4Q32A 3TE9A 5KTLA 4QQ3A 3WK2A 4MLJA 3GLCA 4JX5A 1Y0EA 2Y7FA 2ZA3A 3M16A 1B4EA 1ME8A 4JTHA 4WXZA 4JIQA 1A5AA 2Z6JA 1SO3A 3QW3A 2A0NA 3PS7A 3P80A 2YFNA 4JTGA 2EHHA 2H3DA 5FEZA 2CU0A 2P1FA 3HGSA 4BK9A 4OT7A 4XWUA 3E0IA 5EYWA 4N02A 1TQXA 4UUIA 3H54A 2HMCA 4QIUA 3B04A 2WSQA 4YL2A 5TQLA 5D05A 1F7BA 3OA3A 1KBJA 3BLEA 2QKFA 4X22A 1DKWA 1VHNA 1QOQA 3CC1A 1VZWA 3NA8A 5LKYA 2QDGA 1TPC1 5BNKA 3DI0A 1HTIA 5AN7A 4WX2A 3RU6A 1F2JA 2ISVA 2VEPA 5E0KA 4X9SA 3MHUA 1KM4A 2A1YA 2J24A 2Z6IA 4LRSA 1VPXA 1NF7A 1NF0A 1QCWA 4PODA 4FNSA 1P4CA 1A5BA 4HNUA 2QAFA 3L5MA 3UD6A 2ABAA 2X16A 2ZZ6A 4UC5A 3UZJA 4AF0A 2ZYFA 1QAPA 4OU1A 2C18A 3E12A 4ZMGA 1WBJA 4RZ6A 1L6WA 1GVFA 5KZEA 3ANYA 1G69A 2CZFA 3FA5A 3CTLA 3GDTA 2BXVA 3NZRA 5IBXA 1YLVA 3LGEA 3TR2A 3BGGA 2PRLA 2WJZA 1LCOA 4IMFA 3A5VA 4DELA 4R7JA 4K39A 2VEKA 1FCQA 1O5XA 2YPIA 1TPWA 1N55A 2ZRYA 3W7PA 5HJLA 5FF3A 3STEA 3LM7A 1JCXA 1YYAA 3G1DA 4YLWA 5G2IA 3PM6A 1EWEA 1FDZA 1LLWA 3F4NA 3WJZA 3NGJA 4LC8A 1XUUA 3TXVA 2X1RA 3LOTA 1FY6A 2DZXA 3P7YA 2Y89A 4UTTA 2NX1A 4FX6M 1QO5A 4GUIA 5LGXA 3L66A 5KZMA 2CLEA 3QMTA 1GG1A 3JR2A 1XBZA 4HT3A 5C55A 3W6YA 2J9XA 3TV8A 3G3MA 2OCZA 4JTTA 4GC4A 3P82A 3HO8A 1H1YA 2BX7A 1I2OA 4PL2A 5E93A 4UTWC 1JJKA 3ZWSA 1TPH1 1ZAJA 1RQHA 4K38A 4P61A 3HIJA 1QPQA 2H3BA 3TJXA 2OT0A 1UASA 3G1XA 3LCIA 2RDWA 2VXNA 4O1DA 3TSBA 4IXHA 4H6KA 2P0OA 1GVOA 3H53A 3W2LA 3OVRA 1OABA 1M7OA 3BG9A 4GXMA 1FWRA 5BW6A 2A6NA 3PUEA 3KX6A 3SIZA 4LUJA 4M6VA 1TTJA 1Q45A 2E6FA 4JTJA 1DJQA 3W88A 8TIMA 1YPIA 4N9DA 3UWWA 2ZA1A 4MJZA 3W1XA 3ABOA 4GRSA 4GBUA 2FPVA 1SO4A 2GVLA 4E38A 3G1HA 5D04C 1HL2A 4FX8A 3OEXA 2RDTA 1VYPX 1DOSA 2GQ8A 4MPQA 1OF8A 3VE9A 2DU2A 4XUGA 4UR8A 1A5CA 1TMHA 1SFLA 3QEZA 5I3FA 4O11A 3O16A 1K8XA 3EWBX 4YCPA 1PV8A 1LZOA 4FHAA 1XUZA 2CLLA 4Q33A 5DXXA 2C19A 4BI5A 3L65A 1IXPA 4GUFA 3BG5A 4ZQMA 5DCEA 4RZ4A 1H62A 4Y9AA 3A21A 3QQ0A 2C15A 3UZ5A 1BEUA 4GUGA 2QCCA 5HINA 4M7TA 2VFHA 3B05A 1H1ZA 1LBFA 3HGOA 3GAKA 3QMSA 1XBVA 3NDOA 4IMCA 3TQVA 3DENA 1TYGA 3PBWA 1OFDA 3B0PA 3THQA 3PBVA 5G1TA 3STGA 1GOXA 1H7RA 3LXAA 3SJ3A 3UYCA 4RR4A 1Q3NA 3ZWTA 1U83A 1ME7A 1TPUA 1YPFA 4ORMA 1WX0A 2B7PA 1XXXA 3O1NA 3P8JA 4IX2A 1QNVA 4LUIA 4CQ8A 2B7OA 1M5WA 4O8RA 3TFCA 4X3ZA 3NQ2A 4RV8A 1WBHA 2FTPA 5F2IA 5L9FA 3HOJA 2Y7EA 2DJXA 1TPVA 2H8XA 2NLIA 3KVKA 3MI6A 2QCDB 3ABRA 3N19B 4CLMA 4GWEA 5LHEA 2AGKA 2V5BA 1DBTA 2JGQA 3L68A 3A22A 3QJAA 2WOQA 3KVMA 2CWNA 3NOEA 1CX9A 3QFEA 4LV9A 3HPZA 3NZ1A 3DBPA 2J88A 4UIOA 2DORA 3S42A 3LHTA 3G1VA 3IVTA 3MP4A 3OHIA 4QITA 1W3NA 5AYZA 2ZZ4A 3NL6A 1VRDA 3WK0A 1H61A 4UTTC 4O15A 4OV4A 5AHIA 3KRUA 1WOAA 3HGRA 2Y88A 3UWZA 3TUUA 4MYAA 3C2EA 5G2HA 5BMXA 1EEPA 2WNQA 4L4LA 5C54A 1W54A 4GUJA 1KM0A 4FNPA 1XDLA 1O95A 3W1RA 2ATSA 4RK8A 3B4UA 3TK7A 1ZFJA 2QCDA 4AWSA 4JTKA 4KFPA 1ME9A 2V9DA 5J5RA 1SZNA 2JBMA 4ADUA 3CHVA 1DJNA 1JULA 4WJEA 2NUXA 1J5TA 3OBKA 2Y85A 1H60A 3M47A 3W22A 1LOLA 1FDYA 1KLYA 1VGAA 4OV9A 2RH9A 4JEQA 4DXVA 2Z1BA 1TTQA 3T78A 2A7NA 1GPWA 5CPMA 1Q6LA 4OGZA 1I4NA 1YXYA 3W7OA 1J4EA 4JXCA 4ML9A 5K4XA 4D2JA 4JTUA 1I2QA 5D37A 2YCEA 3C56A 5LZLA 2CLIA 3RK8A 4S1FA 4Y8FA 1PL9A 2C0AA 3PB0A 4KWWA 1TIMA 3L21A 1EUAA 3KFTA 1LDCA 3FS2A 1L2UA 4H4IA 1PVNA 1Z44A 1Q6QA 3QC3A 2CZDA 3UY8A 4TMCA 2E68A 3D0CA 1RPXA 1SO6A 3W7KA 1KW1A 4LS1A 4UR7A 1WQ5A 3G1SA 3G8RA 5DBUA 1X8FA 1UB3A 2AAMA 4FNUA 1R47A 1SSDA 1V7YA 5LGZA 3P5YA 3KRZA 5CZTA 1ZENA 5D2TA 3USBA 5D09A 3I6RA 1RVGA 5AOUA 2F84A 4LVDA 5K9XA 5HUPA 5C5YA 5DN1A 5DY2A 3W7CA 4B5NA 4O4WA 1GYNA 2W0UA 4IWWA 4J9JA 3PULA 3GR7A 4LRTA 5F2GA 4K6AA 1VYRA 2QUVA 1NAL1 1PCKA 3LV5A 1F6KA 1AW2A 4UCGA 2FQIA 3DZ1A 5KMYA 5HWNA 4NNBA 4QNEA 4JR5A 3UWVA 3EX2A 2TSYA 4TO8A 3C2FA 2XN0A 3IVSA 4WZHA 3S5YA 5KINA 4JN6A 1H7OA 1G7VA 1Z48A 4JICA 1B9BA 1LRTA 2PE4A 3S5OA 4ONVA 3DXIA 3L9CA 4K7YA 3W75A 5CKSA 3LCWA 1ML1A 4UTMA 2RFGA 4NVTA 4JIPA 3W84A 2H6RA 2E09A 3GDLA 1KTBA 3W71A 3G0UA 3FEMA 5ABTA 1LORA 2C3ZA 2DZUA 2W6RA 1OFRA 1KM6A 3CWNA 3AJXA 4BFAA 1P5BA 4JTEA 4KFNA 3FKRA 4O10A 3BPWA 4QISA 2VFEA 3GXNA 1VLWA 1P1XA 5I3GA 2ZRXA 3W7EA 4H3DA 3M7WA 2NXIA 1RQBA 1CI1A 1UJPA 1EWDA 3E02A 2QR6A 3TKFA 4MY8A 4WQ6A 1VC4A 4XZ9A 3LTPA 5DBTA 4HSOA 1W1ZA 3T44A 4BF9A 3B8DA 5EKYA 3KOFA 1I45A 1HO4A 5BMWA 2BZNA 2YGYA 1OFAA 3QSTA 3RFAA 3MMTA 4NT0A 4O12A 4Y90A 4LVFA 3E49A 1FBAA 2Y61A 1VQTA 5LSMA 1XI3A 2X30A 3QH2A 3EXRA 1VS1A 5D2YA 2NXGA 3BARA 5DELA 4RXGA 3NQAA 4IXXA 2GVJA 3TSMA 4NZFA 5DCBA 3GK0A 3LXBA 3LTSA 3FJLA 4POCA 2TPSA 4DF2A 3W7QA 5K9DA 5G5IA 3CIXA 2J9YA 1H7NA 4K8EA 3FKKA 4TR9A 5F1UA 3NAVA 4AH7A 3DFQA 3CPRA 4NXSA 1L9WA 1VJIA 2NWRA 2CLFA 2ATMA 1SU5A 3S8HA 2QJGA 3NQGA 5IM51 3R5EA 3TIMA 5D2VA 5BRBA 5D30A 5EBUA 1AW5A 4JDYA 3CEPA 1IIHA 4ICNA 3LHZA 2JGYA 1EX5A 3W7RA 1YXCA 2GPTA 4MYXA 3SECA 3W07A 1KM2A 4O28A 2EAWA 5I3KA 3TW6A 3DH7A 3TCEA 1BWKA 2VC6A 1K3UA 2J6XA 3LB0A 3O6YX 4QSHA 4UTJA 4MLRA 2EKCA 4CNOA 3W1MA 4FB7A 3DGRA 4RXFA 4JS3A 3SR7A 4HPXA 4IJBA 3F03K 3NPVA 3R13A 3TSDA 4R33A 3M44A 2C14A 3EWZA 2Q3RA 3U8GA 3THAA 4EWND 1TB3A 3FFSA 2GQ9A 3CEUA 3STCA 2A6LA 4JY8A 4ZQPA 1WA3A 3G8EA 3O6DA 4AWUA 3B06A 2GJNA 1UUMA 1LLZA 1RD5A 5I3JA 4DF1A 4A21A 3LI1A 5U4NA 4PH6A 1QOPA 1L6SA 3IGXA 4TU1A 1JCYA 1SO5A 3PSWA 1TV8A 1K03A 1DHPA 1WXJA 5G2WA 3TX9A 2E77A 5KITA 2B7NA 1DL3A 5D2WA 3W7JA 3HJZA 2C13A 2ZBTA 4A2RA 3L0KA 5E1QA 1SW0A 2Q8LA 2LLEA 2FIQA 4IMEA 5G1YA 3NQEA 4AHPA 1OG0A 4BI7A 2A7PA 4O50A 1GG0A 4NJGA 1QPRA 4BWLA 3C0JA 2O7SA 4HIBA 4ADSA 4C1LA 1F74A 1S5WA 3W1QA 3UXDA 4CCCA 3P8IA 3G24A 3A24A 3LV6A 3R12A 1P0NA 1A5SA 1XC4A 1THFD 4PFMA 3HBLA 1EP2A 3LX9A 3Q37A 3C3NA 3EXSA 1VR6A 2G97A 3SZ8A 3N3MA 3V75A 2TRSA 1F05A 3A9IA 4N4PA 3W70A 2V0TA 3GZ3A 3LXCA 2GJLA 5C2XA 1SUXA 3O06A 3QZEA 1I8JA 4UTKA 1GZGA 3BGJA 3IV3A 3CM4A 1XCFA 3SY5A 4K8HA 5CG7A 3E9AA 1YXDA 4LV4A 5K9CA 4MJMA 1DQXA 4NZJA 2WNNA 3W86A 4X2RA 3BV4A 4HNTA 3Q2DA 3HMJG 1EPXA 4Y96A 4UNKA 2WO5A 3EWYA 4C1KA 4CCEA 2Y62A 1F6PA 2QCFA 4M7SA 5HNRA 1K8ZA 2R94A 1OF6A 4ZL1A 1KFJA 3GNDA 5HWMA 3KHJA 2PURA 5J5DA 5CPNA 3ABSA 2RDUA 3KRSA 3W2UA 5LNVA 3NXFA 1GTEA 5AC7A 3QPYA 4JNMA 1FWSA 4U28A 4FEZA 3B0VC 2VFFA 4I7UA 1JUEA 2W79A 3G1AA 3U2OA 2E5BA 2WV8A 3EX3A 3GAYA 5H91A 3PG9A 4N9BA 1ALDA 2YSWA 2CZEA 3UWYA 3QYQA 2BSLA 1KFLA 2DZTA 1IXNA 1Z41A 5CPOA 5D33A 2Q8ZA 3LRLA 1FWNA 3M5XA 3W72A 1SZEA 5LNRA 3TA6A 3S1VA 5AFDA 2VEMA 4DBDA 4FNRA 3W7NA 5D38A 1BWLA 4AB4A 1MEHA 2WSYA 4E2BA 1R2SA 1QPNA 1F76A 3NEVA 2IQTA 2ZRVA 4MFDA 4FO4A 4ADTA 3P84A 1BKSA 1FX6A 3BK0A 1YTKA 4OHQA 5A5WA 1Q6OA 5CSRA 2YYTA 3P60A 4N6EA 1JQVA 1B57A 1OJXA 4ZVJA 1ADOA 1TPDA 2ZTKA 1C8VA 5I3HA 1GQNA 3I7QA 3N2XA 3N34A 2ZZ2A 4I7VA 3HQ1A 3PWAA 4I9AA 4K37A 2A5HA 3W1TA 3PUDA 4KKXA 3W85A 2C1HA 4A22A 1M7PA 1LBMA 5GVJA 4ALDA 5T26A 4CQ9A 5AHEA 4AMAA 2KZHA 1GVSA 4XBKA 2A2IA 3G22A 4PA8A 4DO6A 3TXZA 4CNNA 3OIXA 1W5OA 5HMSA 4RLIA 3I65A 1JCNA 2F7FA 3P67A 3BG3A 1JR1A 3ZR4A 2YXGA 5F4XA 3GNNA 3TROA 1ZY9A 1W31A 1GEQA 2ZZ3A 1OVDA 2ZQ0A 3IGUA 3UWUA 2OMAA 1JVNA 2ZDRA 4WOZA 3FLUA 1R2TA 3L5AA 4LU0A 1ZCOA 2YYUA 3IEBA 2D73A 1EIXA 3EB2A 4JX4A 3RNDA 2V2HA 1H63A 3TMLA 1PS9A 4RJEA 4JTLA 1LP6A 2NUWA 4R53A 1AG1O 1OYBA 3OVQA 3W7MA 3AO0A 5FF0A 2CLKA 4GFSA 2NXHA 1W5PA 4MY9A 3CU2A 2A85A 1G4EA 3NQMA 1GWJA 1LRQA 1PCWA 1JRBA 2RHGA 4M5PA 5FF2A 4GNJA 1KFCA 5L6UA 2DZSA 1HO1A 1FCVA 4TIMA 4AXKA 4HNVA 4XQ6A 1NSJA 2Y63A 5HQEA 1IIGA 3W1NA 2WSRA 3G0SA 4N4QA 3T55A 4AHOA 3KVLA 1WV2A 3QM3A 2QDHA 1KM1A 1ICPA 3PF3A 2FB2A 1ONRA 1TPFA 1R2RA 4U4MA 3VFLA 1QO2A 3TQKA 3EKLA 4FF7A 4QNWA 2Y7GA 1TCDA 1BTMA 1S5VA 2ZZ1A 1K7XA 3SGUA 3MHGA 3MBDA 2OJPA 3N14A 1SW3A 1G67A 2R14A 3M5VA 4O0KA 3FOKA 2C16A 4MOZA 4MIMA 3GKFA 2JKEA 4K36A 1EA0A 2WNZA 3R89A 2Y6ZA 4NUWA 3W1LA 4UMAA 2WPBA 4DEFA 3Q94A 3LCGA 3WJWA 1GJPA 2V82A 5CPLA 2ZRUA 4O18A 3BLFA 3HPSA 1QDSA 3VKJA 2QCHA 2HTMA 2XN1A 4NX0A 3W2JA 4Z1DA 2QUUA 2BWGA 4WUIA 2X1SA 2FB3A 1T99A 3EWWA 3T4CA 2CLOA 1LBLA 1TSIA 3C2VA 1X1OA 3EWXA 3W87A 5HR7A 3BLIA 3DKLA 4GE8A 3CT7A 1XM3A 2TMDA 3DFOA 4OE7A 2Z2UA 1W8SA 5MHBA 2B4GA 5AHNA 2ZRWA 3IRDA 3UNDA 3WK1A 3LTYA 1ZAIA 3S5ZA 1JCLA 4N6FA 1LYXA 3W2KA 1KTNA 1KM5A 1L6YA 1TRDA 4FIQA 3C2OA 1G4PA 3ELFA 3FYOA 1TTIA 4AWTA 4ZQRA 1XDMA 2E1DA 4N2YA 1C29A 4O1AA 4GJ1A 1H7WA 1FQ0A 3MJYA 4KWVA 1X1ZA 3W1AA 3NQFA 3DI1A 3TDFA 3RMJA 4BR1A 5D2XA 5AC6A 3NPXA 4WY0B 4MZYA 1AMKA 3TU9A 3MI2A 4M19A 4JTIA 3PBUA 3TAKA 3QRHA 3W1UA 3MO7A 3INPA 4HSNA 4MY1A 3LLDA 4ZQCA 3M41A 1FWWA 2XFWA 2C6QA 2YW4A 3BW4A 2NZLA 3NQ8A 3PBYA 4W9TA 2X1UA 3SGZA 2CLHA 5FF7A 2J9ZA 4PCFA 1FXQA 1H7XA 5CSSA 5F2LA 4CQAA 4UTIA 3E96A 5DCDA 1XBXA 1U5JA 5D32A 2QEZA 4E0CA 3S1WA 3MBFA 3LLFA 3SSJA 4YMZA 5HULA 4WOQA 2ABBA 4JD4A 5BOOA 1EP3A 1GT8A 4QAIA 4UTUA 1A50A 3GXTA 2CLMA 4HN4A 5F4SA 3RLUA 4N9EA 3EKZA 3LCHA 3GX9A 2YW3A 4UFKA 1B3OA 3ATZA 3W9ZA 2B0MA 2FFCA 4AHQA 1H5YA 5FEXA 3NQDA 3A5FA 3VE7A 2PRMA 3NPWA 1AW1A 2NUYA 3NM3A 3EXTA 4O14A 5U7SA 1Z42A 1O60A 3DKJA 4LVAA 4RCXA 1W5NA 2YDAA 4O57A 4O19A 3QF0A 3G18A 4ZQOA 1M6JA 1X6UA 3LERA 2V5LA 1H50A 3B03A 1SQ7A 4UMCA 3N9RA 5F4WA 3LCXA 4EVZA 1K7EA 3PR2A 2HS6A 1R30A 1VLIA 3BO9A 4UTHA 1I2PA 3YPIA 1VHCA 1K8YA 4R34A 3LCFA 1VCGA 1H7PA 3QPZA 1OFBA 1S5TA 3LBCA 4O54A 1HUVA 1XL9A 1LM1A 1KFKA 3LDVA 2WQPA 4A29A 3UQNA 1KM3A 5G4EA 5DY3A 5FF4A 4EIVA 1FCUA 3G3DA 4LC6A 2E6YA 3EWUA 1NFBA 1MEWA 1TV7A 1UBSA 2V30A 4Z0SA 3LHYA 1OX4B 1ZHAA 3P5ZA 1OFEA 3M0ZA 2X1TA 3N73A 3QMRA 4NJIA 2ZA2A 3FYPA 3UWQA 5I3IA 5AYYA 4O13A 3MUXA 4UXDA 3DFPA 3IIVA 1P0KA 4NJHA 3O6CA 1EB3A 3DFTA 2E5DA 3GR8A 2YFOA 4TX9A 2BLEA 3DFNA 5CGQA 1D3HA 2GOUA 2ZZ7A 1JCJA 1RQEA 4LY8A 1G7UA 4Z08A 1VCFA 3G1FA 3CQ0A 3G0XA 3MP3A 3P81A 3IIOA 2OZ0A 1J2WA 2H8ZA 1WOBA 4HHPA 3M5ZA 4IMDA 3MI3A 3L2IA 1JRCA 5EMUA 2FPTA 1OX4A 1F73A 4NJKA 4XKYA 2ISSA 4JGDA 1IF2A 4Z1AA 1W56A 3WJSA 1LROA 3DU0A 5LNSA 2GQAA 4LT9A 1YTDA 3M9YA 4O1BA 1RV8A 3MP5A 1OFOA 1S3HA 4I7WA 1UCWA 1MO0A 4UNLA 3GXPA 3WJYA 3O63A 3GDKA 1DV7A 2DZWA 2WKJA 4IPJA 1CW2A 4UFIA 3TH6A 4PEKA 2EPHA 3I7SA 3B0UX 1KV8A 3VCRA 3GVGA 3KVJA 4P2VA 1NVMA 3NL2A 4NQ1A 3HG5A 5TBOA 3M43A 3MWAA 2VFGA 3NYZA 5DXYA 1MEIA 3BW2A 1DORA 2ISWA 1TPEA 3LHWA 2OT1A 1JUKA 4FNQA 2DJLA 4E2DA 5HWJA 4JY9A 1FUYA 3W23A 3NNTA 3HF3A 4JDBA 2BTMA 3QW4B 2B7QA 4O17A 5AHFA 5AHMA 1ZNNA 2CW6A 1DQWA 3C61A 2V2DA 3TJLA 3ATYA 5KSWA 2JKAA 3I7RA 4DO4A 4Q4KA 3R8RA 3NQVA 3A23A 3W7IA 4N9CA 3U6WA 4S2BA 4AEOA 4XTIA 5LNUA 4S2CA 4RX0A 1YTEA 2NWSA 2PC4A 3L0NA 4UFJA 3KAOA 2I9EA 1G4TA 2QUTA 4DQWA 1W5QA 1DVJA 5FESA 5K7JA 3S0CA 4JTFA 4YXGA 1O5KA 2JKPA 2VELA 4Z1BA 7TIMA 1OYAA 4EF9A 1N7KA 1EUNA 2A4AA 3I68A 4IPIA 5FI8A 4UTWA 4FXRA 3LCLA 4OWGA 4UFHA 2NV2A 5TIMA 1HFBA 2PCQA 1E51A 4UFMA 5F2MA 3IGSA 2FPYA 4WD0A 3R2GA 5D03A 1T0OA 4LNYA 3ZS4A 4NX5A 1FDJA 3PY2A 2E6DA 5CZ0A 1T96A 2FDSA 4MZ8A 4Z1CA 1TRIA 1TJPA 1TJRA 3STFA 2TYSA 2X2GA 3NO5A 2FLIA 2V81A 1FWTA 1NEYA 3MYPA 2QCNA 3NG3A 4LWWA 1YDNA 3ABQA 3CLMA 4Z0JA 4PL1A 4EF8A 1W0MA 1ICQA 2YX0A 3HB9A 3C52A 1MXSA 1TO3A 5AB3A 5EPDA 2A7RA 1K7FA 3G1YA 5HR6A 4DPPA 1IXOA 1W37A 3W83A 4ZZ9A 3HPXA 2ALDA 3S5NA 3FJ6A 1N8FA 3LRKA 4AF0B 1AK5A 3IVUA 1FCBA 4IGHA 1GVRA 3H55A 1TREA 2CFFA 3EEGA 1WYIA 2I14A 4O0ZA 1HG3A 1W3TA 2ZRZA 4YWIA 1TPB1 1V5XA 4PTNA 3UXAA 3LHUA 1IXQA 1MSSA 6TIMA 3GIYA 1KBIA 3S1UA 4L4MA 1A53A 5EY5A 4TMBA 4ORIA 1UUOA 1LRNA 3C8FA 4K7VA 1OFPA 1R46A 1ZALA 3GDRA 3VI2A 3F4WA 1YDOA 2YZRA 3EX6A 2XN2A 4QM1A 3DFSA 5G4WA 3UPBA 1VYSX 1T8XA 4JYDA 1SZGA 3TNOA 3LRMA 2O7QA 2OX1A 4RZ5A 4BWLC 3IIZA 1I2NA 2NX3A 1TQJA 3NVTA 4M6QA 3BW3A 4LW7A 3W73A 2Q3OA 2QJHA 2QCLA 3NQ7A 1QWGA 5H2ZA 2G96A 1W5MA 4FX7A 3NPUA 3C4UA 3F1QA 1F5ZA 1TV5A 4LTSA 2R91A 4HNNA 1B4KA 3HG2A 3EX4A 3SI9A 3FIGA 5EL1A 2G95A 1LOSA 2VFDA 3BVJA 4AAJA 4CNPA 3LHVA 4PC8A 1W3IA 3TC6A 2Y70A 3PVFA 4MKNA 4LVGA 3UPWA 4HPJA 3T40A 3JS3A 3O07A 3W7GA 1SSGA 2JK2A 3TQ0A 3DAQA 1OFQA 4UMBA 3K30A 4LVBA 3MHFA 4UTLA 3M1ZA 1H51A 4O1CA 1KA9F 3GYEA 2ZTJA 3RF9A 5EA9A 2J27A 1AL8A 2FJKA 4NU7A 4JYFA 4XTDA 4MVAA 1PHWA 3NQCA 5CZJA 4JTSA 2DP3A 1ZJIA 1QFEA 3M6YA 4RKAA 3SFKA 3KXQA 3W76A 1YADA 1OX6A 2VOMA 5F1VA 3PUOA 5LHFA 2ZCGA 1SW7A 3P62A 3S1XA 1LTDA 2Y7DA 1SFJA 3W7LA 3DHDA 3W1PA 2QCGA 3TFXA 5FEPA 4JYEA 4NNAA 3P61A 4YCOA 3ZFHA 3L0GA 3L67A 1XBYA
chains in the Genus database with same CATH superfamily
1RUSA 1VPYA 1SR9A 4GVIA 3C6CA 3O0KA 2R1MA 3MB9A 1J11A 1I60A 4V28A 3HGJA 3P0XA 2AQOA 3MW7A 1XLFA 1OK4A 1XP3A 6ALDA 1KLZA 2HSAA 1Q63A 3ISIX 1LOQA 4WY0F 1CTNA 1ICSA 2EF9A 4WJ8A 5AYBA 4MFEA 4NXKA 4UQBA 2E3ZA 1XHGA 4PMOA 1CECA 3RLHA 2R8WA 2VENA 3VIHA 1BXNA 5CZSA 1QPKA 1DJXA 3Q67A 1P7TB 4QSFA 2D3LA 1A5MC 3RCNA 3NL3A 3IUIA 1ISZA 1EGZA 8CGTA 2WSPA 3VGEA 4NILA 1DYSA 3PZNA 4J3XA 3FCPA 3M0KA 2AQWA 1MZHA 3CB8A 3ERPA 2XVGA 3WK3A 3CH9A 3W6MA 4AD2A 2FGZA 3R0DA 3W38A 4WEVX 1S2TA 4H19A 3OA5A 2V8ZA 1OCQA 2Z0IA 1G6CA 1KXHA 4GCXA 4B5SA 3WF3A 2Y5JA 4MUZA 1GOMA 5AYXA 5AC5A 2I1OA 1PKMA 5HUOA 5AC8A 1PHQA 3QTPA 1AQHA 4DJDA 4P7QA 3I3BA 3ZVHB 2PDJA 1LWHA 3QTGA 2QCEA 5DLCA 5CGMA 3H2AA 1J0KA 1C9DA 3PZGA 3OB8A 4CU7A 1QU4A 4IFKB 1I1XA 5D02A 1SFSA 2FHFA 4GX9A 3O8AA 3PJUA 2NV1A 2PTDA 5K2ZA 2QCMA 3G77A 1UKTA 2FHBA 5C71A 3LPPA 1CENA 4LS0A 5CC5A 5C7VA 1OB0A 3O15A 1CCWB 1D7KA 1AL7A 2DZPA 3IIPA 4DPQA 3CV7A 3Q58A 5I7GA 4DM2A 5K4ZA 4W93A 1XFBA 3EX1A 3T7VA 2HE5A 5EFFA 3WJXA 3WF0A 2PBGA 2CERA 4UQEA 4DBEA 5KZDA 4WY0A 2VT0A 3AZTA 4HQVA 1V08A 3H70A 3S9YA 4D8AA 2XH0A 1YDVA 2X7VA 3TE9A 2B31A 1KR0A 4QQ3A 3WK2A 3GLCA 4JX5A 1Y0EA 3M16A 2ZA3A 4JTHA 1A5AA 1LQ0A 3PS7A 3P80A 3B9OA 1MVYA 3M0IA 2OOFA 5HOSA 2CU0A 2P1FA 4OOUA 4YN5A 4OT7A 4N02A 4XZLX 3H54A 1TVNA 2HMCA 4QIUA 9RUBA 3B04A 5FL0A 4C5ZA 3PFRA 3BLEA 4MGGA 3S2MA 4C1NB 4Q4MA 4RE3A 3KUMA 1VZWA 1YW1A 1JXJA 1OZQA 5BNKA 4WX2A 2WB5A 3WNMA 2VEPA 3E2VA 5DF0A 1Y5XA 4X9SA 3TC3A 3MHUA 2J24A 2TAAA 3GE7A 4KEUA 1PB0A 1QCWA 2FZ9A 4FNSA 3D6NA 1A5BA 2OELA 2QAFA 1QI5A 3UD6A 1FA2A 1QAPA 4OU1A 3SCUA 2ZUSA 2C18A 1WBJA 2YBUA 4YVPA 1GVFA 2QYGA 3ANYA 1G69A 1TIWA 3CTLA 1RCOB 3NZRA 5IBXA 1UWRA 4CD7A 3LGEA 4FP1A 2PRLA 3K13A 4LBSA 1ECEA 2VEKA 4INFA 1XRTA 4JZ5A 1KQYA 3VKKA 2J8TA 2YPIA 1M7JA 3W7PA 2OTDA 4IFOA 3AU6A 2QS8A 2PFHA 2VCBA 3STEA 3SAZA 1YYAA 3G1DA 3PM6A 3WJZA 1LLWA 2I56A 1EPVA 3LOTA 2Y89A 4UTTA 3OGVA 1EJUC 3TJ4A 2BOGX 3CTTA 3M64A 1E15A 3RYSA 2CLEA 3VPLA 3UA4A 2W9MA 3TV8A 2G0WA 4GC4A 4PL2A 5E93A 1JJKA 4P61A 4D8ZA 3NURA 3ZT7A 1UASA 2RDWA 2VXNA 3S4TA 4DZIA 3WFZA 2PA6A 4H6KA 1GVOA 4R7OA 3H53A 1XCWA 4L56A 4BJHA 3V0TA 4L7ZA 4ZBCA 4M6VA 4JTJA 2E6FA 2Q02A 1S3TC 3W88A 1JD9A 3KZSA 3VK5A 2ZA1A 2OVLA 1BYBA 3ABOA 4E38A 3PPCA 2RDTA 1OF8A 1DXFA 4XUGA 4UR8A 2J7FA 1WZAA 3EYPA 4B90A 1TMHA 4LUTB 1V02E 2J78A 2INEA 4WHBA 4H7VA 4M1RA 3O16A 4H9ZA 2B81A 3EWBX 4MDPA 1LZOA 1HZYA 2CLLA 4BI5A 3L65A 4GUFA 1HQTA 1NIUA 3GQYA 4HZ8A 4BQ2A 4GH3A 4Y9AA 3VU2A 4GUGA 1VBRA 4DI8A 4M7TA 4W4QA 4E5TA 1P6BA 1AQ0A 4IMCA 3CPUA 2GFTA 3VIPA 4KBXA 3THQA 5G1TA 3UETA 1GOXA 1ISXA 4PMUA 4RR4A 1TPUA 3AHYA 1V0NA 1QNVA 2B7OA 4N0RA 1M5WA 3TFCA 4X3ZA 1WBHA 1GVIA 2Y7EA 3A4AA 1RLCL 2H8XA 4U10A 3W37A 1H49A 3IJIA 3L68A 1PZ1A 4CNTA 3URNA 2CWNA 5EMYA 1CX9A 3NO3A 3AMDA 2HK1A 1FWDC 1CBGA 2J88A 4UIOA 2DORA 4A8LA 4URIA 4PRTA 3OHIA 1W3NA 2YCLA 2ZZ4A 1AVAA 1VRDA 1AA1B 4B9ZA 1UP2A 1E1CA 1WOAA 3TUUA 4MYAA 3G1RA 4C6DA 2YDRA 4L4LA 1RCQA 4GUJA 3SM0A 2E0PA 4RE4A 3D47A 3TK7A 1AFSA 4KFPA 1ME9A 2VJXA 1W2VA 2ZWZA 1KRMA 3CHVA 3WQPA 1OG6A 2ACUA 3L23A 1H60A 3M47A 5REQB 1KLYA 4OV9A 2Z1BA 2HJPA 3EOSA 1TTQA 1AH0A 1LL6A 1HJUA 3WELA 4D6GA 2Y5SA 3EMZA 3E5BA 1B1YA 5K4XA 1I2QA 2YCEA 3B9EA 2CLIA 1SMDA 3MMWA 1V0LA 4Y8FA 3PB0A 1TIMA 1EUAA 1PWLA 4H4IA 1XJBA 4P7NA 3RRAA 4S38A 3SBFA 4HPHA 3UY8A 4TMCA 2E68A 2IKHA 2OO0A 3CMFA 3T09A 1KW1A 2BOFX 1ZJAA 3K5XA 4LS1A 1S2WA 4HP5A 3G8RA 1M41A 5DBUA 3VIJA 2OKTA 3QLDA 1A80A 1V7YA 2PDFA 2DQWA 3EPNA 2WYSA 5CZTA 1ZENA 5D2TA 3USBA 1J2BA 5D09A 3I6RA 5AOUA 3REQB 5K9XA 4RNIA 3WL0A 5C5YA 5DN1A 1ZCCA 1GOKA 4B5NA 1KWKA 2UWFA 3WMLA 5C70A 4AISA 3G6LA 4K6AA 4MB5A 2NQ5A 3WQFA 1VYRA 2QUVA 1NAL1 1PCKA 2A3LA 4UCGA 2FQIA 3DZ1A 2OR2A 3M07A 5HWNA 4DJFC 4Q4PA 3UWVA 7CGTA 3H2CA 3C2FA 1HKMA 2EO7A 2XN0A 4WZHA 3S5YA 3PJWA 1H7OA 3BSHA 1Z48A 2GSJA 1B9BA 5JH1A 3S5OA 3L9CA 4NVTA 5E0CA 3W01A 2D22A 4LB4A 2ZX7A 1EKOA 4QS6A 3G0UA 3FEMA 2D3NA 1POJA 4S23A 2VCCA 3FKRA 4S3EA 2VFEA 1UKSA 5I3GA 2ZRXA 3W7EA 3M7WA 3EBVA 2PEVA 2QR6A 3H4XA 4WQ6A 3LTPA 5DBTA 2DH2A 1W1ZA 4JCLA 2BV9A 4V1YA 1XLMA 5EKYA 4XISA 3KOFA 5FAGA 3H7RA 4PCSA 3OG2A 3BZJA 3UCQA 1HO4A 3RCYA 2ONEA 5C2GA 3MMTA 3E0FA 2V3FA 5BYWA 5LSMA 5E5CA 3CAVA 4AZGA 4ECLA 5DQPA 2Z26A 1ITCA 4IXXA 3SCRA 3AYTA 5DCBA 3GK0A 3LXBA 2ACRA 4IFRA 2WC7A 3TTSA 2JQXA 3BZGA 1W1IE 2ICSA 1OZMA 2NVDA 4AH7A 1ZP4A 1L9WA 1VJIA 1BLIA 5FAJA 1QWKA 1SU5A 2QJGA 2QF8A 1V4YA 5BRBA 1J0HA 3LHZA 4C1NA 1V6UA 1EX5A 3U7BA 3W7RA 1YXCA 4GQRA 3NSMA 3SECA 3W07A 2FFIA 1KM2A 4D71A 3G6MA 1ECQA 3EPOA 4MWAD 1Q4NX 1ZP3A 2WZHA 3DH7A 2J6XA 2DSVA 4YHEA 1TWWA 1XSKA 4RXFA 3SR7A 4C6MA 4IJBA 1LG2A 1YDYA 4ZOCA 3T0TA 3SCWA 3EWZA 1TB3A 3Q45A 4E6MA 1DPMA 2FTYA 1WA3A 3O6DA 1NOUA 4AWUA 3B06A 2GJNA 3UJSA 1UUMA 3CHDA 1E6SM 4HMCA 1LLZA 1DWGM 2X7WA 1A4MA 4JQ3A 2CPUA 4ZOAA 3LI1A 4CQCA 1JZ8A 2YBVA 5DMMA 4TU1A 1V0MA 2Z29A 4KPLA 1YIXA 2C91A 3SUVA 4ACYA 1WXJA 5G2WA 1MQRA 3RJXA 4F4RA 3BAJA 5FCZA 4KEVA 1DL3A 4HU8A 1HP4A 3ABZA 2WQDA 2YCLB 2ZBTA 3UBPC 3VIFA 5CG0A 4H8UA 2PWHA 3UR2A 2G3IA 3F5JA 2QJNA 4AHPA 2PZNA 3MU7A 3MUIA 1UC4A 2A7PA 3PJTA 1QPRA 1FKWA 3C0JA 2D23A 5KZ6A 3KLLA 4EXQA 1Z69A 3KBVA 4UOZA 3E3HA 1E6QM 3VCCA 4MNKA 5HA7A 4PFMA 3LX9A 1KGUA 2V3EA 3C3NA 1DWHM 3L7RA 4NY2A 1AH4A 4WGXA 4Z42C 3PUGA 1MNZA 1PYFA 1E6RA 1UZDA 3C8NA 3AALA 1I8JA 4UTKA 4XAYA 5HNNA 1R85A 3IV3A 2REQA 2CKRA 2QVNA 4K8HA 3GTHA 3EDFA 2PDLA 3VABA 2BFGA 3KWXA 3W86A 1QBBA 4HNTA 3IAQA 4XAFA 5GNYA 2UZ9A 2E9MA 1UR0A 5EGRA 2X05A 2Y1HA 5CAHA 3ZT6A 3IAPA 2WO5A 3N29A 2Y62A 2QCFA 4M7SA 1BTCA 2GLKA 2OYKA 4ZL1A 3WEZA 3KHJA 2WJDA 2W67A 2PURA 4J7RA 1B3VA 2WAGA 2RDUA 1GTEA 5AC7A 4GOAA 5IHSA 4U28A 4Q6JA 3RPDA 4AYSA 3VNIA 1TV4A 1ALDA 1VFTA 2CZEA 3UWYA 3ZJKA 2BSLA 4TVUA 4L1XA 1Z41A 5CPOA 3TN3A 4E2OA 4NZ1A 2VR4A 4TX6A 3U2ZA 1FWNA 3WH6A 3W72A 3TA6A 4ATLA 3N4AA 5AFDA 2VEMA 3BAWA 3S46A 3W7NA 1UWTA 3GFYA 3BWWA 3ABXA 4Q8PA 1MEHA 3WD2A 1XKJA 3B8VA 3P84A 1BKSA 5E09A 4EXAA 1FX6A 5A5WA 3S2CA 3ITLA 5I6SA 4M29A 3VNYA 2OFJA 4FOKA 1B57A 3UVAA 4JKMA 4ZVJA 1C8VA 1I9CB 3N34A 3BAXA 4K37A 1R86A 4A22A 1M7PA 1LBMA 4ALDA 1GZJA 1MUWA 5BU9A 1GVSA 2A2IA 1LQAA 4EPBC 2DDXA 4DO6A 1O6IA 3TXZA 3GH5A 4F3HA 3VD9A 1ITXA 2F7FA 3P67A 3BG3A 3GBDA 4H1ZA 4Q4SA 3VUSA 1GEQA 3GVVA 2ZQ0A 5JUVA 3UWUA 4IT1A 5DEZA 1H09A 3L4VA 1HKWA 2ZDRA 2DIEA 1TVLA 2PWUA 4LU0A 1R2TA 2NSOA 5CPSA 1GUVA 1IHIA 1EFZA 4TXEA 2D73A 1EIXA 1Z32X 3RNDA 1H63A 4W84A 4DYEA 2RGMA 3GBEA 2NUWA 3CAWA 3OVQA 3AWOA 5FF0A 4UWMA 1DIEA 1W5PA 1UR1A 2INFA 2VM8A 5A6KA 3NQMA 1PCWA 1JRBA 4C5YA 2WVVA 3UXLA 3LMZA 4GNJA 5BRQA 5A6BA 3N3TA 4Q3MA 2DZSA 3U5UA 1UQYA 3P0WA 3JZUA 1IIGA 2XIQA 3G0SA 4N4QA 2P53A 1XGEA 3UEQA 3KVLA 1WV2A 4S3FA 1WDQA 3PF3A 3VGGA 3N17A 3K1GA 1QUMA 4U4MA 1HVQA 2NVAA 3IJ8A 4H8HA 2PGRA 4WSHA 3UZZA 3VOJA 4AIOA 6XIAA 1PJ9A 4X9YA 3WNNA 1BG4A 1TCDA 1JYVA 3SGUA 3T6CA 1NOWA 4PB4A 5B80A 4DXXA 1TUXA 2R14A 4O0KA 2CBUA 1IWBA 3GKFA 1Z89A 4MB3A 2PI6A 1QK2A 5T91A 2WNZA 3R89A 4Z2JA 3GXDA 3URAA 1J9YA 4NUWA 3WLKX 1MW0A 3W1LA 3DC0A 4XIMA 3LCGA 2V82A 3CQJA 2ZRUA 3GU1A 4B5TA 4O18A 3BLFA 1E70M 4GNVA 1MMFA 2VWSA 4NX0A 2XSBA 3I4EA 3AXKA 4Z1DA 2QUUA 1A3XA 5AC4A 1DIDA 4IFKA 1QW9A 1PIFA 2FB3A 2UY3A 3BCDA 3C2VA 4LY4A 4PN2A 2VZVA 1P7TA 1HKIA 1PZ3A 4JQ2A 2B4GA 4PULA 4G1NA 2OZ3A 3O0FA 4G7FA 1JCLA 3H4WA 1J5SA 3GFXA 3N2TA 4HJWA 1KTNA 1KO0A 2V5JA 2P0IA 3TVAA 4FIQA 1G4PA 3AFBA 3FYOA 1M3UA 1TTIA 4O1FA 3TNBA 4IL0A 4JIIX 1MW3A 1H7WA 1UZ4A 4H9MA 1TKKA 2V5CA 1X1ZA 3S5SA 2FVMA 1FWJC 3NPXA 1UKQA 2GZXA 1AMKA 3TU9A 3W6LA 3UNTA 2I9UA 2YL8A 2GGJA 4PUDA 2EPKX 2PZ0A 4NAEB 4MY1A 1LL4A 3GG0A 1M04A 3LLDA 3L2MA 3IUDA 3CZ8A 3S1GA 2H9AB 2XFWA 3PZIA 4MAZA 1UPMB 4HB7A 3PBYA 4ZR8A 4F2TA 2X1UA 3M0HA 3LYEA 3E96A 5DCDA 3V1HA 2Z7GA 2A3EA 1Q65A 2PDXA 2QEZA 3KW3A 1RBAA 2OGJA 5D9OA 3ZJ8A 5DMLA 3LLFA 4WOQA 3TQPA 1XYBA 3SJNA 4JD4A 2R6OA 5BOOA 3WSUA 1W9UA 4QAIA 1BSIA 3DHUA 1ZGDA 3RLUA 1JAKA 3LSCA 4ZO7A 3UG5A 1WDPA 3KTSA 4RW5A 4GXPA 3RM9A 1CDGA 3L4XA 1W1TA 4ZCWA 6XIMA 4HA3A 2XIJA 5C7HA 4AHQA 3NQDA 2WC4A 3VE7A 1TZ7A 1UPPA 3AS2A 4G6CA 3NM3A 2BVTA 5U7SA 4W5UA 4NKCA 4DJDD 2VDHA 5B7YA 2XVKA 1CGTA 4RCXA 2Y8VA 4O57A 3OLIA 3B03A 3WCZA 3HV9A 4GYJA 4EVZA 2HXUA 1K7EA 1DXIA 2HS6A 1VLIA 1C92A 3VD5A 1I2PA 1VHCA 2PCEA 4R34A 1OC7A 4MKVA 2KAUC 1VCGA 4XUYA 1SMAA 3LBCA 1OFBA 1HF6A 4O54A 3PN8A 1HUVA 1KFKA 2F61A 2WQPA 3M0JA 3RAOA 3WLLA 1FCUA 4GQQA 4B91A 1KRAC 2V30A 4OIFA 4Z0SA 3V5OA 4EWJA 3PZ9A 3KS6A 1F61A 1EZ2A 3QMRA 3UWQA 2CEQA 8XIAA 1EJRC 4QGCA 3MUXA 3UU0A 1ZJBA 1G0CA 3WLIA 3DFPA 3VC5A 4D6DA 4KT2A 4O0QA 1P0KA 1PEZA 1EB3A 2EXOA 3GVQA 4TX9A 5CGQA 3B3DA 3EA2A 4DXKA 1EHNA 4LY8A 4FOUA 4NI3A 5IOBA 1VCFA 4GJJA 3UJEA 2VRJA 2YL6A 2VX6A 3LMYA 4HHPA 4IMDA 1XLJA 4IG2B 4KEZA 1CXHA 5HNUA 3SB0A 1AQFA 3GG1A 4XKYA 3OIHA 3IWPA 5EMMA 4AZ5A 4BQ5A 1X6NA 2PP3A 4DN1A 5LNSA 2DW6A 1FFQA 4CN4A 4L1WA 1MO0A 1UZHA 4UNLA 3GXPA 4NAFA 2W92A 3WJYA 4TTGA 3O63A 2DZWA 4IPJA 1WE5A 4UFIA 4GVGA 2PP0A 1UW9A 4PEKA 1JDDA 4ERGA 1A47A 3TA9A 4JIRA 3KVJA 4RPPA 3VZYA 1GJWA 4NQ1A 3HG5A 4DUXA 2VFGA 2OSYA 1XICA 3VZZA 1D7FA 1ELSA 1AZ2A 3VTRA 4B9YA 1MEIA 3BW2A 2ISWA 1TPEA 1WB0A 3W81A 1V6YA 1WO2A 4LJ3A 2WVUA 3QFWA 3NNTA 2BGSA 1G94A 3HF3A 2BTMA 3QW4B 5AHFA 3O6AA 3FVMA 2V2DA 1E3ZA 3NIYA 1NDWA 3LPGA 1BVNP 3WZ0E 1QBAA 3A23A 1UP0A 4DBSA 2O9OA 4N9CA 3QY7A 1S2AA 3CHCA 1A49A 1HJXA 4G56A 4RX0A 1YTEA 5LYRA 3WDIA 3U2EA 4L9YA 2HISA 1DIOA 4DQWA 1DVJA 3CO4A 5K7JA 6REQA 1B31A 4YXGA 2VELA 7TIMA 1UR4A 3GNXA 4X2PA 4EF9A 4A8IA 1N7KA 2Z7KA 1EUNA 4XSMA 3IPWA 3VDHA 4FXRA 5FIPA 3N6JA 3CUHA 1XLGA 2NV2A 4LYRA 2ACQA 2NQHA 2FPYA 4GD0A 4WD0A 3R2GA 2HV5A 4NX5A 2E6DA 4JFVA 4JKLA 1TJPA 1TJRA 4HHHA 2X2GA 3NO5A 4IQJA 3PANA 1L8PA 1FWTA 1XRSA 3MYPA 1M03A 4LWWA 3AIVA 4Q8TA 3CLMA 2OYLA 4C91A 4PL1A 5JMUA 3AIBA 4JHZA 1ICQA 2WZMA 2YX0A 3GYCA 3TYUA 3HB9A 5CXPA 1KRCC 3A13A 5DT7A 2XWDA 1TO3A 4KRTA 2OSXA 2A7RA 1XLKA 1MW2A 1CXEA 3EGJA 5GQBA 4CD4A 4MWAA 1W37A 4DY1A 3W83A 4ZZ9A 3REQA 3FNDA 3FJ6A 4LEFA 4IGHA 1W1VA 2CFFA 1WYIA 1HG3A 1W3TA 2ZOXA 3O3RA 4Z1YA 3UXAA 1M1BA 1IXQA 1KBIA 3S1UA 3BLOA 1D2KA 1LRNA 4K7VA 3H26A 3GDRA 3VI2A 5DMNA 4W8AA 2DT1A 1LG1A 1XLAA 3UPBA 1VYSX 3WD4A 3TNOA 2A79A 4RZ5A 1FWIC 1I2NA 3P3BA 1XR2A 4Q6XA 4HOXA 3UP8A 1X98A 4FLRA 2QCLA 5H2ZA 1W5MA 3F1QA 1CLXA 3W26A 1WP6A 2R91A 1WKEA 4YVVA 3AI0A 3EX4A 3SI9A 3FIGA 4MMWA 1IGWA 5G1MA 3BVJA 4ATWA 3DOPA 4PC8A 3N6QA 2NVCA 2G3NA 2Y70A 3QV9A 3PVFA 1UHVA 1ISWA 3RPMA 4JAWA 4JQ4A 3PHAA 2QW5A 1SSGA 1MFVA 3VVGA 3MSRA 2JIWA 3WLSA 1H51A 2IMRA 1GEHA 1KA9F 2ZTJA 3TJIA 3RF9A 1AL8A 5LA2A 3CH0A 4P7OA 4XTDA 1PHWA 1DJYA 4WKAA 2HPIA 3E2SA 2Y4SA 3WDPP 3W4RA 1EH9A 2DVXA 3W7LA 3DHDA 3W1PA 1Q6GA 3TFXA 2RJGA 4BY3A 4US5A 3P61A 4YCOA 3TLQA 2NT1A 3NQBA 1XBYA 3M0XA 3S2NA 2C0HA 1WAUA 3WUFA 2FZMA 3W3OA 5AHLA 4PMZA 1D9EA 1ZZMA 4GO8A 4DRSA 1V7AA 4CCDA 1QR7A 2IKGA 1DWJM 4FIRA 4TQTA 3MJMA 4IOTA 3WFLA 2ZZ5A 5I06A 1W6TA 3GTNA 4FLSA 3ICJA 1UR9A 3URQA 3DN5A 2VFIA 5A1AA 1R3RA 3N2CA 3QVQA 2BHYA 3HFTA 4UOQA 3W7HA 5I00A 2HS8A 3CUFA 3WH9A 2CNCA 5CGTA 1OHLA 2CYGA 1O4UA 3DG3A 3OTRA 3QOKA 5CBBA 2YR1A 2ZFAA 4O16A 3UPMA 2HVNA 4XD5A 1CZ1A 3HQNA 2HE8A 3KDNA 2V6AA 4GIAA 3TONA 1TTPA 4GNKB 3OBEA 3QQ1A 1UWAA 2C1IA 1GTHA 2CHNA 5A8GA 4YIWA 7ENLA 3E6EA 4HJFA 3JRKA 3W2MA 1DQUA 3O05A 5HPOA 4A3RA 4DNHA 4L6HA 2VX7A 3UYIA 4LOCA 4LANA 1XYMA 4MZ1A 1S5NA 4XAGA 1NTHA 3OVPA 2HK0A 2POZA 3VNDA 4UFLA 4ZODA 4B4FA 3VX1A 2VD9A 2XH4A 3ONCA 1QNSA 3FJNA 3VNJA 3E0VA 1VH7A 4O52A 5JXQA 2QF7A 3ME3A 1Q85A 1KTCA 1UC5A 3AXMA 3BXWA 5HXMA 4HCDA 4I9TA 4C6IA 1RJRA 4GIEA 3S6DA 2VZOA 4A6GA 4HKPA 3M5YA 2DGAA 4RUBA 1D3GA 1M53A 1TWZA 2YXOA 5AKQA 4ERIA 4U2ZA 4FNTA 3GKAA 3SW6A 1JCMP 4G1KA 4MM1A 4GX8A 3UG4A 3GG8A 4O4VA 4NZCA 2XYLA 2WCSA 3WQEA 1KCXA 3NQ6A 1QMLA 4HMDA 3C2YA 1ZAHA 2X8RA 3P74A 1SZRA 4Q4OA 3WMCA 4G9PA 4NAFB 4MLJA 2Y7FA 3AMGA 1ME8A 1BKHA 1ZS2A 1Q66A 1Q13A 1W1PA 3GS6A 2EHHA 5A3HA 2H3DA 4J3SA 1DEDA 4XZNX 3U57A 3DX5A 4BCEA 3AIWA 2WSQA 1F7BA 2D69A 3OA3A 3FSUA 1KBJA 4EPDC 3WLOA 2VUNA 1ONXA 2EBNA 2OLSA 1VHNA 1QOQA 3GFZA 4DAFA 2XU2A 3FK4A 4KEMA 2HVOA 1HTIA 1J6PA 5AN7A 4UQ9A 3OPSA 1Q5MA 4H9UA 1MXGA 3PTDA 1NF7A 5CC3A 3TYCA 4PODA 2P8CA 4Y9OA 9CGTA 5E6ZA 1IR2A 1P4CA 4HNUA 3IARA 1W1A1 3MUCA 1BGGA 2X16A 4ZEPA 1IT0A 3AZSA 3E12A 2HPMA 4CEUC 4PTVA 3L2LA 1PTAA 1BFNA 2BXVA 3GXMA 4CVUA 3H2FA 1JFHA 1BYAA 1LCOA 1ZBWA 3A5VA 1HW6A 4R7JA 4K39A 4DELA 4AEEA 2CBIA 4F0MA 2JF7A 1BSLA 3FN9A 4HSHA 1B30A 2J7DA 4J27A 1J0JA 5FSDC 2FH8A 2XH2A 2WZTA 1JCXA 5G2IA 1EWEA 3CQHA 1QI0A 2AMXA 4LC8A 1XUUA 4W5ZA 5E6YA 3FGCA 2DZXA 1I0DA 2HRWA 4FX6M 3R6IA 1QO5A 3GTIA 3OO2A 3JR2A 4B5XA 3RPTA 4A05A 4IMAA 3P82A 4WF7A 4Z2LA 2BX7A 1I2OA 3VOCA 1T40A 4UTWC 3ZWSA 1ZAJA 1RQHA 3HIJA 2EQDA 1J10A 1K1DA 1V3MA 2OT0A 3WNKA 5T9BG 1NQKA 2P0OA 3W2LA 1M01A 3DECA 4EAYA 3WUEA 1VKFA 1C91A 3WQGA 4LUJA 1GCYA 1F9CA 1DJQA 2EPOA 8TIMA 1C90A 1YPIA 1OEPA 1ZBCA 2CESA 1N8IA 3ZSTA 2PD5A 4MJZA 3SEPA 4Z2KA 2XDFA 4GBUA 3OGSA 1J79A 1SO4A 3G1HA 4PRWA 3OEXA 4MPQA 4ASTA 1FOBA 5I24A 4PBFA 3SQSA 1PV8A 3KOXA 4FHAA 4Q33A 4DJED 3BOXA 1Q6EA 3EEZA 3GD6A 2WMIA 3M0YA 3QQ0A 1BEUA 2VEFA 2QCCA 3RJYA 5HINA 3MUY1 4V33A 3B05A 4QJ5B 2YCJA 1OWQA 3BCJA 1H1ZA 3HGOA 3GAKA 2QMJA 4AD5A 3QMSA 3OYXA 3WF4A 6CGTA 1Z3NA 1V3LA 2PWEA 1ZB5A 4Q7IA 5CLWA 3B0PA 3PPFA 3PBVA 5JBFA 1ZJHA 3RO8A 3LXAA 3VC6A 3VUPA 2GDQA 3ZWTA 1ME7A 2VRKA 2QNEA 2QV4A 3P8JA 3NFUA 4RV8A 1WCGA 3AUJA 5F2IA 1V93A 2VQUA 4M24A 3ABRA 4CLMA 3E1F1 2AGKA 2JGQA 2YCKX 3A22A 1WDDA 3UR8A 3QJAA 2WOQA 1UR8A 1SJDA 4C6FA 4IP7A 3DBPA 1IEXA 4L1GA 1GVEA 1A0DA 3UGRA 3IVTA 2FDMA 5DMYA 1JF5A 3G5EA 1SVDA 4KCUA 5AYIA 4ATDA 1H0GA 3OLDA 3KRUA 3DUGA 3WLNA 1F6YA 3NGFA 1PX3A 2WNQA 2XIOA 2WZEA 5A6JA 5C54A 1KM0A 1TELA 1UIPA 4JNZA 4RK8A 3B4UA 1J0YA 1M68A 1ZFJA 4KRUA 1SZNA 2JBMA 2A3BA 2I7GA 4AZ7A 1DJNA 4FMVA 2NUXA 1J5TA 1B5TA 2Y85A 3KOWA 1LOLA 2P8BA 1CPUA 5DFAA 2A7NA 4P8VA 2A3HA 1Q6LA 3CQIA 4S3JA 4DB7A 1JI2A 4QRNA 1QVBA 1JZ4A 1YXYA 3VD7A 3W7OA 2PDPA 2SFPA 3TYAA 3CLWA 1XIDA 2Z2AA 4D2JA 4JTUA 1ZTVA 2OU4A 3M6DA 3RK8A 3I3EA 4B15A 2O0TA 3L21A 1D8CA 1L2UA 3RM8A 4EP8C 1Q6QA 2GK1A 1VFSA 1CXFA 3QC3A 2CZDA 2BB0A 3D0CA 3E2QA 3V7PA 3W7KA 5HQLA 4ZOBA 3PAOA 2G8ZA 5JVLA 3GTFA 3VDBA 4UR7A 2GDUA 4GBDA 2QPXA 1I75A 1DJWA 2IQDA 5GJNA 4B5VA 4WR3A 1X8FA 3H2OA 1A0CA 3ES8A 4KF1A 2XSAA 4FNUA 1SSDA 2WXDM 4FOJA 3WDHA 5LGZA 4PMDA 2NT0A 1VD6A 4GA8A 4ACZB 1RVGA 3VIGA 3TTOA 3M0MA 3WQWA 5HUPA 2PDUA 4IP4A 4FF5A 5FKYA 5DY2A 3MKVA 2J77A 2R1NA 5CSYA 4O4WA 2W0UA 3PULA 3GR7A 4O8AA 1EC7A 4TV6A 4EKJA 5FL1A 5BXRA 1AW2A 1XV8A 4IGNA 4YU1A 1N82A 4LAZA 5A2AA 2TSYA 4TO8A 5KINA 2DEPA 4JN6A 3T0AA 1G7VA 4V2XA 1LRTA 3EA3A 2PE4A 1US3A 1A5NC 2QJMA 4U5KA 4C6OA 4R85A 1ML1A 1F4HA 3W84A 2NQJA 2ISDA 4J2MA 1KTBA 2ESCA 3H6OA 1XGDA 3ITOA 3HM7A 1NQ6A 1WKFA 3W71A 1LORA 2DZUA 1QATA 1E9ZB 2ANUA 1WUEA 4RDZA 4ZFCA 1P5BA 4JTEA 4O10A 3BPWA 4QISA 5IDZA 2J7HA 2WHLA 1X38A 4ZO9A 4H3DA 2Z27A 3EOOA 1BXBA 1EYEA 2OOGA 1CI1A 3B8TA 2VP8A 4XZ9A 4HSOA 3S6OA 1Y5WA 3T44A 4BF9A 2GK1B 4LB3A 3FY1A 5ABGA 2FZNA 1I45A 2O92A 1CNVA 5BMWA 1F8MA 1OFAA 3QSTA 1DHKA 4F79A 4NT0A 3VKBA 1TFVA 2J66A 3IGHX 1VS1A 5D2YA 5CJ5A 2X1IA 3NQAA 2WSKA 4ZO6A 3TLLA 4DZ5A 1G9HA 4ACZA 4RPQA 4JTRA 1OBAA 3FJLA 5EMLA 1QASA 4D6CA 2G4FA 1FP8A 3SRKA 5G5IA 3KE0A 1EX1A 5FD0A 3CIXA 5MF5A 1JL8A 2O9RA 2J9YA 1H7NA 1HX0A 4GABA 3FKKA 1UP3A 5DANA 1XIBA 3CPRA 2NWRA 4I5XA 1GKQA 2ZE0A 5JIPA 1QXLA 3R5EA 3BLPX 3TIMA 4PYSA 1T7LA 4WKHA 4YS1A 1Z6KA 1BYDA 3ARRA 3R1ZA 3KDOA 3RM4A 3TCEA 2VC6A 3NVDA 1TCMA 3LLXA 2C79A 4QSHA 4UTJA 4FB7A 5D9NA 3F03K 3OZOA 1FP9A 3RMEA 3VIIA 4R33A 4DWSD 3M44A 1V51A 2C14A 3EPMA 3NZGA 2Q3RA 1U2YA 4EWND 3CL8A 1JF6A 1KXTA 2A6LA 5I23A 3GH7A 1HNYA 1RY0A 2FYMA 1RD5A 4A21A 5DRIA 2E40A 2DUZA 4PH6A 3T8QA 1L6SA 5D8ZA 1MI3A 1TV8A 1K03A 1A0EA 1SM9A 3TX9A 2E77A 2BGQA 5D2WA 2BY1A 4RDVA 3W7JA 3AXIA 2C13A 3L0KA 4MDOA 5E1QA 2Q8LA 4L9ZA 3MCNA 2MANA 4GIRA 5G1YA 1KBKA 3V36A 1EA9C 2V68A 4CU6A 3AYRA 1PIGA 4HIBA 2ASHA 4FI4A 4ADSA 4N42A 4C1LA 3MKKA 3T0DA 1C8XA 1OSEA 3R12A 4K8GA 3AHZA 3AHVA 1THFD 2VZTA 3HBLA 3MWCA 5CEWA 5LIYX 3Q37A 1VENA 3EXSA 3MDWA 2G97A 4C7FA 3NZPA 4ZA0A 4N4PA 3W70A 2P50A 1SUXA 4BF5A 5LIUX 3BICA 1PAMA 2AGTA 3LZ5A 3WNOA 1KD0A 3F2DA 3BGJA 4G7EB 1EJWC 7TAAA 2X0HA 4HA1A 4M82A 1YXDA 3CV1A 1EOKA 4LV4A 3WQ4A 1WAWA 1ZU8A 1MXDA 2WNNA 1AD4A 3HMJG 2INZA 1R3QA 4RE0A 1RVKA 1YKWA 4GHRA 2YIHA 4LSBA 1OF6A 1CYGA 1KFJA 3GVRA 5ECUA 1TZ9A 1E72M 5J5DA 5C8BB 4QCEA 3A6OA 3QPYA 3UCDA 2WMIB 4GCAA 4FEZA 2WVTA 4I7UA 1JUEA 1IEVA 2E5BA 2WV8A 5H91A 3EX3A 4N9BA 2YSWA 2OEKA 4QJ4B 1V77A 2WKLA 1DWIM 5D33A 1VEOA 3LRLA 3M5XA 3AAMA 4C6NA 4XG1A 3ZLFA 4DBDA 2VC5A 4FNRA 1KFWA 4AB4A 1FHVA 2WSYA 4EPEC 1F76A 2PDKA 1YTKA 4OHQA 5J04A 4B3KA 4WKFA 3HA1A 1NJJA 3P60A 3HMCA 3EKGA 3SCQA 1GQNA 3I7QA 4LYPA 3N2XA 2ZZ2A 4I7VA 4I5UA 3HQ1A 1K9FA 3PWAA 4I9AA 3PUDA 4KKXA 3BH4A 1UIOA 5GVJA 1GJUA 1BAGA 3LGGA 1UH2A 4NRSA 4HMEA 2O4QA 3H21A 4OFCA 3WLRA 4XBKA 5FJTA 2DW7A 3C3UA 4PA8A 3VDCA 3FYYA 1W5OA 3TYBA 4AD0A 3I65A 3VM5A 3WQCA 5I0DA 2YXGA 2J7CA 2VWTA 2C7FA 3GNNA 1FHDA 1ZY9A 3UT0A 1W31A 3ANUA 1J0IA 3IGUA 4OUEA 4AC1X 2OMAA 1B9ZA 3ARSA 1F3WA 2PF0A 3L5AA 2Z25A 4UQCA 4I8YA 2YYUA 3IEBA 4WDUA 1PWMA 3EB2A 1V79A 2WHMA 3E0LA 4JX4A 4XZMX 3BAIA 3BLKA 1MQPA 4IGSA 1HJVA 1V6WA 1PS9A 3B8IA 4RJEA 4JTLA 1LP6A 2J8GA 4R53A 2EEXA 2PGEA 3NSNA 1OYBA 3W7MA 4GG9A 2Q09A 2CLKA 1RP8A 2NXHA 2P3EA 1XCXA 3KL3A 4MY9A 3RLGA 1G4EA 2PUZA 4E2VA 1GWJA 4U3AA 2ZIDA 3DYOA 3TN6A 4AD1A 4L65A 2QV5A 2BY0A 3QGAC 2GVYA 4TIMA 2J7GA 4XQ6A 3N9KA 1E6NA 1EQCA 4M81A 4E3TA 3W0KA 1ONEA 2FMOA 3CL7A 1ZLPA 3F7JA 3QM3A 2JALA 2F6KA 4HU4A 1KM1A 3OOQA 3SQLA 3F2CA 1TPFA 5D4YA 3VFLA 3TQKA 3EKLA 3KHDA 1H2JA 4Y7EA 4QNWA 3AS0A 2Y7GA 1BTMA 4KCVA 4Q8QA 2ZKMX 2GOKA 2QQ6A 3U48A 4S3KA 1ISYA 2OJPA 1G67A 3BGAA 2OWWA 4MOZA 1F3XA 3ZYZA 4ZB2A 1Y5VA 1OCBA 2VO5A 4WCJA 1EA0A 2Y6ZA 1K4HA 3LEPA 4XKMA 4DEFA 1XYLA 1GJPA 2ZDSA 4YNGA 5CPLA 3SFWA 2PTWA 4JTAA 3U4AA 4W86A 2PDIA 2QCHA 3T2OA 3GHRA 5CPTA 4REQA 5C2CA 3OYZA 3T2QA 4AX7A 1P43A 4D6FA 7REQB 4ZE5A 3T4CA 7PTDA 1GNXA 3BLIA 5EMKA 1U33A 4GY7A 2TMDA 4OE7A 2Z2UA 1CIUA 4PFHA 1W8SA 1I1WA 5AHNA 2HBXA 2ZRWA 4HVXA 3RITA 3NDYA 3WK1A 1REQA 3QKEA 3VOGA 3LTYA 2P76A 3I6EA 7REQA 4J3VA 4A8RA 1L6YA 1NH6A 4H9VA 5C9RA 4PTMA 4AWTA 4ZQRA 1XDMA 2E1DA 2WMGA 4DZHA 4GJ1A 4PB5A 2VC9A 3WQVA 1FQ0A 1O7AA 3QY8A 1IQ8A 4KWVA 1M9HA 1K9DA 3DI1A 1VEMA 3TDFA 5I78A 1Y65A 4BR1A 2E1WA 1E0XA 4MZYA 1CGYA 5MKGA 2QZRA 2Z00A 3TWBA 3MI2A 5BOEA 4IM4A 3W1UA 3INPA 4A4AA 1RJPA 4HSNA 4DUOA 3WD0A 4H41A 1NDYA 3M41A 3MC5A 1BHGA 1FWWA 1QI4A 4XIAA 2C6QA 5ECVA 2NZLA 2DZAA 3V18A 2J9ZA 4PCFA 4CQAA 4UTIA 1JYXA 3O2LA 5D32A 1H11A 1EBGA 4C60A 3S1WA 4B5UA 1XIFA 4DWSB 3K1DA 2REQB 4UTUA 1O1ZA 1A50A 1JEZA 3GXTA 4NL1A 5F4SA 1HP5A 4IPPA 1UOZA 3FW6A 4ZFMA 4US5D 5I5RA 2B0MA 3KLKA 2J7EA 7A3HA 3VOFA 5AVNA 2GJXA 4MADA 4IICA 3AU2A 3VMNA 1UR3M 3P6LA 3EXTA 3LQLA 1XW8A 2VQTA 3S47A 1Z42A 3R0KA 1O60A 3DKJA 1W5NA 2G41A 4AVNA 5AZ0A 1JFXA 3PZUA 2BBFA 4ZQOA 1M6JA 3LERA 4M51A 4UMCA 4AU0A 3N9RA 2GGIA 1IEQA 3VKCA 4OTKA 3PR2A 4ZENA 5AVHA 4XD3A 2IPWA 3MSDA 5EB8A 1MWOA 3CASA 3LCFA 1H7PA 3QPZA 1GKRA 2GYIA 1PTDA 1O5RA 2VD8A 1XL9A 3LDVA 3E5PA 3UQNA 5DY3A 5FF4A 4JFSA 1ADDA 3G3DA 2WPGA 1MEWA 1NP0A 4GKTA 1UBSA 1V8EA 3MMDA 3LHYA 1OX4B 3P5ZA 1OFEA 3GR4A 4NJIA 2ZA2A 3FYPA 4D6EA 3E0WA 1UMLA 3BSMA 3BURA 5AYYA 4UXDA 4UR9A 3ZLHA 3O6CA 5KETA 3HFYA 2VOTA 3FX4A 1YBQB 2V38A 1Q6DA 1RA5A 3VIKA 2DIJA 1D3HA 2ZZ7A 3N11A 4PCTA 1XG3A 5CBIA 3PTKA 4XD4A 5CCZA 1UYQA 3F5LA 4M1BA 4LBUA 4D9PA 3G0XA 3TOYA 4BS0A 1J2WA 3WUGA 2OWXA 2TODA 1W91A 3L2IA 1QRQA 1OQFA 3NWRA 4LYQA 4RL3A 4JGDA 3PZOA 5H8UA 4Z1AA 1W56A 1H3GA 1UA7A 2VDGA 2GQAA 4LT9A 1YTDA 3M9YA 3OP2A 1OFOA 1S3HA 5HAOA 2QPSA 2V69A 4A3YA 3A4XA 3WBEA 2PLKA 4YHGA 1E0UA 1X8CA 2WKJA 4LAUA 3TH6A 1XDJA 4YPJA 1R8LA 2EPHA 2ZVIA 1P1MA 3VCRA 4P7RA 2F9RA 5TBOA 3KWSA 2OT1A 1JUKA 4FNQA 1XLCA 2V5KA 4LPCA 1FWCC 4F9JA 2J47A 2AKZA 4YVXA 4BF7A 2B7QA 3NO1A 1RLDA 3CUXA 2R1LA 4HK6A 5A6LA 4Q4KA 3R8RA 3N13A 3U6WA 4AEOA 4PMJA 4UFJA 3AWNA 3WMSA 3KAOA 2QHAA 1SFTA 3UESA 2EG8A 3LBOA 1XISA 5GNZA 3S0CA 4AD4A 2DSWA 1W17A 4XV0A 4OOZA 4Z1BA 1E1CB 1E43A 3K4WA 1DWAM 1W2PA 5TF0A 5HNTA 4AUBA 1WPCA 3T81A 1PKNA 1MYRA 4AZ6A 1HFBA 2Y2WA 3GHUA 2BOEX 5F2MA 2ALRA 2PWFA 3IGSA 3ZS4A 3PY2A 4BEUA 4MZ8A 3OZMA 2O4MA 2VGGA 3ZR5A 1WUFA 1NEYA 3UZYA 1JPKA 3LM3A 4UQAA 3ABQA 3GC5A 5TNVA 3WQ5A 2W27A 4EF8A 2G50A 1W0MA 3JZEA 4OBSA 4WLCA 1MXSA 5AB3A 5EPDA 1QK0A 1K7FA 1EJXC 3KOZA 3ZSSA 5HR6A 4DPPA 2QMKA 4F2BA 3HPXA 3S5NA 4C6EA 4AF0B 3RRXA 2W3ZA 2J13A 3B9AA 2XM2A 1XYZA 4L6OA 1V5XA 2J62A 3OZPA 1FTXA 5EY5A 3ZVIA 4S3CA 2Y8UA 1R46A 1XH1A 2XZ9A 4GI9A 1XG4A 3F4WA 2D0FA 3EX6A 2XN2A 1UG6A 3R58A 1GQKA 2DV0A 1IR1A 2BMBA 3ZVHA 1SZGA 3LRMA 2O7QA 4BWLC 1A3WA 3IIZA 2NX3A 3NVTA 4X60A 1Z8AA 3BW3A 4LW7A 1M65A 3NDZA 1QI3A 2I57A 3STPA 3GNRA 3NQ7A 1QWGA 4M0XA 4FX7A 1TV5A 4R9XA 2PWVA 4HNNA 1PXGA 1B4KA 1VBUA 1XSIA 2F2HA 5EL1A 1QNOA 4FK9A 2HBVA 3PTQA 3SCPA 5A2BA 3U7VA 2GWGA 4RZBA 3TC6A 2WCAA 4AG0A 4QTGA 3ARVA 4HPJA 5DO8A 4UB9A 2CC0A 2JK2A 3TQ0A 1XIMA 2DQXA 4LVBA 4UTLA 3M1ZA 3U4FA 4CQDA 3GYEA 3MV11 2EG7A 2PDYA 4QEEA 4E4PA 4MVAA 1VIWA 5CZJA 1TZZA 4XBJA 4RKAA 5G4HC 1S46A 3KXQA 4JTDA 3W76A 3VD4A 1W9DM 5DT5A 4KCTA 1SW7A 1LTDA 4Q8WA 1SFJA 2EJ1A 1OY0A 1RD6A 3LNMA 2R1PA 4GYKA 4NNAA 4L64A 3DBNA 3ZFHA 3L0GA 3WIJA 4PCNA 1KKRA 3L67A 1HJQA 4O53A 3NUKA 4PCPA 2PPGA 3W00A 4Y6GA 4IP5A 2O56A 4LX4A 3ZIZA 1R3TA 3S9ZA 1RZMA 3C86A 5LA0A 1BF6A 3LGDA 3HG4A 4AD3A 1PSCA 3KL0A 3TW7A 3VM7A 4A3HA 4O1EA 1SPQA 2XFRA 2J6VA 1FXPA 4NJJA 5BXPA 3DCPA 1XX1A 2X40A 5LNWA 3MYOA 3QSRA 1H4PA 3HQPA 1O94A 1H5VA 2D2GA 3KRBA 3N9SA 5IBXC 3GDMA 1SZFA 1ZBVA 2E28A 4NNCA 4PMNA 3DESA 3AHTA 4HHLA 4QLKA 1EP1A 2RKXA 2C8NA 4PTWA 3CWOX 3GG7A 1Q2SA 1M7XA 4IQLA 3SCNA 2ZXDA 1PBGA 4AVFA 1NU5A 3GC2A 4OBTA 3SADA 1EDQA 1R3YA 3UXKA 1G4SA 3A64A 1YE6A 4TVDA 1GK8A 2F8QA 2E8YA 3NR0A 4KESA 3QLLA 4OQVA 2DSZA 4FALA 2EGZA 3V1PA 1RP9A 2VKZG 1UD3A 3ZMRA 2PLJA 3SUWA 1GVQA 5JH2A 4EOUA 1NWUA 2PWDA 4IMGA 4WXYA 3PAJA 3F4VA 4W88A 1EBHA 5HK4A 3W7DA 2E5CA 3PSVA 3WNPA 2UV8G 4JX6A 3SURA 1XKYA 3B40A 1S1PA 3PG8A 3QHNA 4IUOA 3GHSA 4BI6A 3BLDA 3W28A 2IXVA 1LL7A 1K02A 1KFEA 3CMGA 3SCVA 2QAPA 1X7FA 2DSKA 1JCTA 2NX9A 3W2NA 2H90A 1U30A 4LF1A 4RDWA 1BG9A 4CNSA 2PRHA 3S2JA 1TA3B 4GUHA 3DEQA 4KFOA 1PIIA 1HGWA 1XPGA 1WXYA 4P5UA 2GVGA 2Z1KA 3MKCA 4KIRA 2BDQA 2JE8A 3AISA 1OYCA 3GH4A 3ALFA 2A21A 1EYWA 4GINA 6TAAA 2VGFA 1QHOA 1XFCA 1XLIA 2XIMA 2Q6ZA 3N4FA 4PMVA 4FZIA 2Z6JA 3GNPA 3QYSA 3QW3A 4JTGA 1OIMA 5T9CE 4WDTA 5TAOA 4GYPA 1HKJA 4DLMA 3ARTA 3S83A 2W91A 1GHRA 4XWUA 1TQXA 3W82A 4S3BA 2BY3A 3W25A 5TQLA 4MPKA 5D05A 3FA3A 1FFRA 8XIMA 4QAWA 2QKFA 1DKWA 2P3ZA 2PWGA 2EKGA 5LKYA 2QDGA 1TPC1 2Z28A 3RU6A 3BMWA 5FJJA 5E0KA 4G2DA 4W7WA 1KM4A 3QR0A 2Z6IA 4LRSA 4JFWA 1GYMA 3BAYA 3AHXA 1FRBA 4NP7A 2XVLA 3UW6A 3R79A 2E4TA 1W9PA 1VF8A 2PTYA 4CN6A 3L5MA 2ABAA 3UZJA 3RR4A 2ZYFA 1YHTA 2AAAA 4GVFA 1UWIA 3IV8A 4RZ6A 4CKQA 1D3CA 2EPLX 5KZEA 1E6XM 1E4NA 3FA5A 4AZBA 1YLVA 3GW3A 3TR2A 3BGGA 5A6AA 1DTNA 1GKPA 5ABHA 4HU0A 3CBWA 3GXFA 4M56A 3B9NA 1BD0A 1O5XA 2AL2A 3MY9A 1ISVA 3UFYA 1TPWA 2PODA 2ZRYA 3Q4DA 1ESWA 2IUZA 3EA1A 1IT7A 1OD0A 3PWIA 3CL6A 5FF3A 2R82A 1NM9A 5XINA 1FDZA 3F4NA 4MSSA 3NGJA 4KH2A 3TXVA 1UKPA 2D1ZA 5C9WA 2AQVA 1UBPC 3QPEA 4GO9A 1J93A 5KZMA 1KNWA 2GSHA 1ODZA 4HT3A 5C55A 2J9XA 4QE1A 2AMGA 1E1FA 1AJZA 3HO8A 1H1YA 3KZPA 5C9UA 1PKYA 1BRLB 1TPH1 2Q01A 3TJXA 1P0EA 3G1XA 3LCIA 3KBMA 4F66A 3W53A 2MUCA 4O1DA 3TSBA 1C7SA 4MKSA 4CU8A 1AH3A 3OVRA 4GXWA 3BG9A 1E5NA 2ZX6A 1JYWA 2A6NA 2BG5A 3KX6A 3BQ6A 1TTJA 4EACA 3BUVA 3MZ2A 1JPDX 4N9DA 1E1EA 4HGXA 1S2VA 2PF8A 3W1XA 4DWDA 2WBKA 4BA0A 2GVLA 2YL9A 5D04C 3HN3A 1VYPX 3EMQA 1K77A 2DU2A 3KM8A 3VZXA 1J18A 1MUMA 1XWYA 3VXGA 2FGBA 4US6A 1RALA 1XF0A 2RJHA 4O11A 3MVIA 1K8XA 1JPMA 3NCOA 4YCPA 4GLEA 1XUZA 5BWAA 5HJYA 3R10A 5DXXA 2C19A 9XIMA 3ARWA 4R9OA 1S38A 3BG5A 4TTUA 2PBOA 2YCIX 1H62A 3A21A 2C15A 2XG9A 4GFIA 2VFHA 2GGGA 1EXPA 5TD4A 2WLYA 3DYPA 3V4BA 3QKZA 1XBVA 1XYAA 3NDOA 4PB3A 1OIFA 3DENA 3JW7A 3H7VA 3PBWA 4UBPC 2R9RA 5H8MA 3WDJA 2F6UA 4GPNA 4NAEA 3STGA 1G5AA 3RIKA 4HYRA 3AYSA 3SJ3A 3EOUA 3UYCA 4GQBA 1Q3NA 4IL2A 4B92A 2QVHA 2GQ3A 2ZC8A 4ORMA 4PMRA 2B7PA 1XXXA 1JGIA 3O1NA 4RV3A 4CQ8A 4O8RA 3XISA 4BKNA 3MSGA 3FA4A 4K3ZA 2Z1WA 3N04A 2DJXA 1TPVA 3SY8A 2QCDB 4KGLA 5LHEA 1E0TA 1DBTA 5FSEC 1CXLA 3TOPA 1EDGA 3NOEA 3QFEA 2VI0A 3NZ1A 1US2A 1YPXA 3APGA 4WRHA 3S42A 1X96A 1HKKA 4HZMA 3CXOA 3G1VA 3IJ6A 4WIWA 2WHKA 3BCFA 3MP4A 3ORWA 4QITA 2VDIA 4NF7A 5AYZA 3VGDA 1H61A 2OZ8A 3WX7A 1N8WA 3XINA 4C6PA 4O15A 5AHIA 5EMJA 3APTA 3HGRA 2Y88A 2X42A 3ARYA 3C2EA 5G2HA 1QNRA 5A8PA 5BMXA 3ITXA 1EEPA 3KBWA 1LT8A 3URBA 4FNPA 1T6MA 3RXZA 2ATSA 4GMEA 1GW9A 4RNJA 3RUBL 4IH3A 3DC8A 3QR3A 1G01A 1XYCA 5ABFB 4DAIA 7XIMA 3ARUA 1JULA 4P8XA 4WJEA 3OBKA 3ZR6A 2YA0A 4DIAA 1FDYA 1VGAA 5FA5A 3GU2A 4PMYA 2RH9A 5I77A 4DXVA 4L5ZA 5CPMA 3UR5A 4OGZA 1I4NA 1J4EA 4JXCA 4PSPA 1HJSA 2W61A 5GJMA 3B0XA 5D37A 5LZLA 3OLEA 4S1FA 2C0AA 4KWWA 3KFTA 3FS2A 3VNMA 2EPMX 2DY3A 1Z44A 4F9DA 1U1HA 2PTXA 3WL1A 1RPXA 2MNRA 3OQEA 4LUYA 3WN6A 1V6TA 3CZKA 3IJ7A 3N1AA 2Z1SA 2OYMA 2Z24A 2OEJA 4QX4A 4ZXOA 1EC9A 2GVEA 4NIRA 4PUNA 1UB3A 1R47A 4PUEA 4EANA 5FJPA 1K70A 2BXZA 1N2VA 3UERA 1PX4A 2OQYA 2F84A 2GJRA 4LVDA 4AC7C 3LN3A 4MJ4A 2CZVA 4IWWA 4J9JA 4NZ4A 4TV5A 3RO6A 2XH7A 4LRTA 3CB3A 5F2GA 2YA2A 1RH9A 5KMYA 3ES7A 1TVPA 1WDSA 4NNBA 4QNEA 4C6BA 1K8CA 3EX2A 2ACSA 1SJBA 3IVSA 2QLYA 4ONVA 4RW3A 3DXIA 3TN5A 1JZ2A 4K7YA 5CKSA 3LCWA 4UTMA 5D9PA 4H7ZA 2H6RA 4LCQA 3PJXA 3TZFA 4PTXA 4LAOA 4NSBA 3PPGA 4R3UA 1VFMA 3N6HA 3A3HA 2W6RA 1OFRA 3CWNA 1XH0A 4BFAA 4PUJA 4KFNA 2QDEA 4JPGA 5IFTA 4EXBA 1P1XA 1J6OA 2PTZA 2I16A 2YL5A 1UJPA 1DJIA 1EWDA 1XIGA 3E02A 3EAUA 4HBKA 4GI6A 2D0HA 2ZUTA 3VD3A 4HZ7A 1V6VA 2DVTA 2BZNA 2YGYA 4ZTXA 1A4LA 2UY4A 1VIZA 5GPRA 4O12A 3II1A 1JZ5A 2Y61A 1IZCA 3QH2A 4DUVA 2NXGA 4XD6A 5DELA 2GVJA 3COTA 4QE4A 4PEEA 3LTSA 3N2OA 2TPSA 2X0SA 4DF2A 4KCWA 3W7QA 1LT7A 3ZXWA 1TJ1A 1QTWA 1KQZA 5K9DA 4LNCA 4CUCA 5XIMA 5I07A 2WKGA 4K8EA 4TR9A 5F1UA 4F8XA 9XIAA 2CLFA 2ATMA 4ZGYA 2FH6A 4I3GA 1R7AA 2JFEX 3T9PA 3IJ9A 2VEGA 4QR6A 5D30A 4PUMA 3CEPA 4NRRA 2CHOA 4J3UA 1IIHA 4ICNA 2JGYA 3V16A 2I5GA 2AL2B 3CUZA 4MYXA 1BXCA 4E8GA 1VJZA 4O28A 3DG6A 2EAWA 1DIKA 3TW6A 1BWKA 1UMYA 3LB0A 5I3DA 3RX2A 4FLQA 3W1MA 5EFDA 4CNOA 4DO7A 4JS3A 4HPXA 3B0YA 1XPYA 3DYMA 1E5JA 4IJCA 3TSDA 1TWDA 3TP4A 3FFSA 2PDGA 2GQ9A 3M4HA 1WNOA 2XPKA 4JY8A 4ZQPA 3WBXA 3FV9A 4CEXC 3R8HA 3WD3A 1U1UA 5I3JA 4DF1A 4U2YA 1BVWA 2QGYA 1LWIA 2VYOA 1JCYA 3PSWA 3K8MA 1RHCA 2UY5A 1T8QA 3O7UA 2ISFA 3MSYA 5KITA 3LENA 1E3XA 3GU9A 4LUTA 1KGWA 2PDBA 2FVLA 3N12A 2FIQA 2XSXA 4H01A 4IMEA 1MDLA 4DJEA 2PB1A 1VBGA 1E6PA 1OCNA 3SUSA 1OG0A 4BI7A 1TA3A 4O50A 3VNLA 1U5HA 4BWLA 2O7SA 3K4DA 1F74A 3W1QA 1RCXB 3PZQA 4WVXA 3UXDA 3G24A 4M6UA 1P0NA 4JNYA 1A5SA 1XC4A 1EP2A 3W27A 3QOMA 2VGIA 3SZ8A 2E67A