The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
83
|
sequence length |
218
|
structure length |
218
|
Chain Sequence |
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISAGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the mutant P180A of orotidine 5'-monophosphate
decarboxylase from Methanobacterium thermoautotrophicum complexed with
inhibitor 6-azaUMP
rcsb |
| molecule keywords |
Orotidine 5'-phosphate decarboxylase
|
| source organism |
Methanothermobacter thermautotrophicus
|
| molecule tags |
Lyase/lyase inhibitor
|
| total genus |
83
|
| structure length |
218
|
| sequence length |
218
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
4.1.1.23: Orotidine-5'-phosphate decarboxylase. |
| pdb deposition date | 2010-06-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00215 | OMPdecase | Orotidine 5'-phosphate decarboxylase / HUMPS family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |
