3NQ6A

Crystal structure of the mutant p180a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor 6-azaump
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
218
structure length
218
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISAGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase/lyase inhibitor
source organism Methanothermobacter thermautotrophicus
publication title Crystal structure of the mutant P180A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor 6-azaUMP
rcsb
total genus 83
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nq6A00
1JCYA 4JIQA 3DHDA 1PVNA 4W9TA 2VENA 4NJHA 4LY8A 3EX1A 5C2XA 2B0MA 4JX5A 1KM5A 2QCDA 3N3MA 2PRMA 3P60A 3S6DA 1M6JA 4AHOA 2CLHA 2CZFA 4ZZ9A 1THFD 3LI0A 1PL9A 3A23A 5F4SA 3NL2A 1H7PA 3QPZA 4TX9A 2PRLA 3STFA 4MZ1A 4AF0B 1SO4A 3DFPA 5G5IA 3O6DA 1OFAA 3EWZA 3OBKA 1TIMA 2ZTJA 5FEWA 4S2CA 4CNOA 1VYRA 1J4EA 1KBJA 2ZZ4A 4PFMA 3UQNA 1GZGA 4Z0JA 3PVFA 4NXKA 1OX4A 2JK2A 3NPXA 4OGZA 5G4EA 4Z1CA 5I3FA 5LGXA 3QH2A 5DY3A 1XC4A 5A5WA 1ME9A 3NDOA 3S9YA 4FNSA 2YZRA 3T55A 3HG4A 3CM4A 3EWYA 2BX7A 4NQ1A 5D04C 4PTNA 4Y8FA 5DCBA 4P2VA 4JTUA 4XKYB 3LGEA 2WSYA 3TQKA 1Z48A 2W6RA 4ZQMA 1RQHA 1ZAIA 1ADOA 3KVLA 3QSTA 4E0CA 1VYSX 1LBFA 2GPTA 4H6KA 1RV8A 4QJ1A 1M7OA 3NQAA 4FNRA 3P8IA 1QPNA 1SW0A 3E02A 3GDLA 6TIMA 3DBPA 5AHFA 3W1XA 4OE7A 3W1AA 4M6VA 3GZ3A 1NF0A 1H1ZA 2X1TA 4LOCA 4JTJA 5D02A 2EHHA 1HG3A 3TV8A 1H51A 3QF0A 4LVDA 2QR6A 1F05A 1PHWA 2HSAA 4KWVA 3LCLA 4JTFA 4UMAA 5LNUA 3KRUA 3CC1A 4GUIA 2RDTA 5DXYA 3W7CA 3NQ2A 3STEA 4GUHA 1VLWA 5AC6A 2J24A 1GVQA 2CFFA 3SY5A 3NA8A 3HPSA 3NL5A 5I3JA 3UWWA 1LOQA 1DQWA 5LHFA 1RD5A 4ZMGA 1KM4A 4X3ZA 1GWJA 3C6CA 1R2TA 3EKZA 1KBIA 3L68A 2VC6A 2H3BA 1A5CA 3SR7A 2BTMA 2ATMA 4A21A 3SJ3A 2FQIA 1SZGA 1Z44A 4Y9AA 3EX3A 3Q37A 1P0NA 5G4WA 1OABA 5FF0A 3LLFA 1QMLA 1AW2A 2QUTA 4JTKA 1OG0A 1YTEA 1AL7A 5I3IA 3LCXA 1X1ZA 3B05A 3E9AA 6ALDA 3W22A 2J9XA 1DJQA 3RMJA 3OIXA 2OT1A 3DU0A 4TO8A 1SO5A 3IIXA 4HHPA 4IMGA 4JTIA 1Q6OA 4IGHA 3FYPA 3LCIA 5DLCA 1K7FA 3SIZA 5D2XA 1ZENA 3M1ZA 1TPVA 5AFDA 3TU9A 3M43A 3ATYA 1NF7A 3PSWA 2A7NA 3UPWA 4UFLA 3JRKA 3GKAA 3W7RA 1OFDA 2C0AA 3ZWSA 3NQ7A 4MUZA 2VFIA 1JULA 3GDTA 3G22A 1MEIA 4O15A 4HSOA 4CNPA 4YXGA 4R53A 3TW6A 2E6FA 3H53A 4GC4A 1KV8A 4K38A 1TPWA 1UUMA 3PUOA 1SSDA 4R7JA 3BLEA 1AW5A 3I7RA 1WAUA 2A5HA 1OX4B 5D2YA 2FB2A 2CU0A 3F4NA 4AHPA 2KZHA 1NSJA 1DOSA 5DBUA 1O95A 2V81A 4GE8A 4IJBA 3GDKA 1N7KA 2OZ0A 4PA8A 3TUUA 1RZMA 2JBMA 3W7EA 2VFHA 3F03K 2JKAA 3G24A 4ZQOA 3AJXA 3C61A 3O8AA 1O60A 4O1BA 2DJXA 3W83A 3TR2A 2XN2A 2E1DA 3B03A 3W1QA 1KFLA 3UZJA 2I14A 4NJIA 1LZOA 3E49A 3EWWA 2P0OA 2Y85A 3LRMA 1TO3A 1LBLA 3LTYA 1TQJA 4O14A 3W1RA 1DKWA 2CW6A 3C3NA 1UBSA 3IGUA 3MMTA 3W2LA 2V8ZA 4LS0A 5K4XA 5C54A 5FEPA 1SU5A 3DGRA 4GJ1A 3PM6A 4IX2A 3L0NA 1BKSA 4FHAA 4LRSA 2QCLA 4QSHA 2ZA1A 2OT0A 1GJPA 1FBAA 2WNQA 5DCEA 1R2RA 4AB4A 3TE9A 1EA0A 5D32A 1WBHA 3HB9A 3LHTA 5AYXA 3GDRA 1FXQA 3WK0A 4IPJA 3LTSA 3HGRA 5TIMA 3C56A 3SGUA 2J88A 3O06A 3N2XA 4UTJA 3RFAA 4UCGA 3UY8A 4O18A 5DBTA 1H62A 4OBTA 2E77A 1DV7A 4LRTA 2ALDA 3O63A 1LLWA 3QEZA 1F76A 2J6XA 2C13A 1A53A 3W2NA 5BRBA 1XM3A 3R2GA 4QM1A 4U4MA 1VH7A 1K3UA 1K8XA 2DZVA 2WQPA 4ADSA 3W1TA 3LHYA 3TMQA 5AN7A 3IGXA 2VEPA 4CCCA 3K30A 1YTDA 5BW6A 1MSSA 2GUUA 5T26A 1ZHAA 3EX4A 2DZPA 2R14A 2WO5A 2E6YA 5HMSA 1F7BA 2ZA3A 4QISA 3U2OA 3NM1A 3H54A 4UFJA 2QDHA 1SW7A 4UMCA 2B7PA 3IVTA 4K39A 3I68A 1RQEA 4OQVA 4XUGA 4K8EA 2DZTA 5G1YA 3FJLA 3TA6A 3NYZA 4N6FA 4IOTA 1O5XA 1LOLA 4JIPA 1L2UA 3HOJA 4O12A 1AW1A 4AWUA 3ZFHA 3LLDA 4UTHA 2GJNA 2H3DA 1SZFA 2QCGA 4X2RA 4EVZA 3L2IA 4NZJA 4RKAA 1EP2A 2QCDB 4BF9A 4UNLA 4M5PA 4WY0B 5KINA 2YFNA 5KITA 4UMBA 4TU1A 5LSMA 1FWWA 4E2DA 4UXDA 1LRQA 1ML1A 4XTDA 4S2BA 4YMZA 4MY1A 1EP1A 1H7NA 3LBMA 2YXGA 3O6YX 4IX0A 5FEZA 3WJXA 1G4TA 3D0CA 3DENA 3R8RA 1VCGA 3P81A 2CZDA 4HN4A 1JCXA 3JR2A 1BWKA 1QFEA 1YLVA 3P67A 4N4PA 3A22A 3IVSA 1XFBA 2DZXA 3VKJA 2NWSA 1LM1A 3HQ1A 3HG5A 1G4PA 3GB6A 2NX3A 1SPQA 3P5YA 4MY9A 3M47A 1Z41A 1PIIA 4MVAA 4DELA 5C55A 2NUYA 4HNVA 2Q8ZA 3QMTA 5KZDA 4YL2A 4RZ4A 1VPXA 4O28A 1FDYA 3PUDA 5F4XA 1C8VA 3G3MA 4UNKA 3MI3A 1R2SA 3VCRA 2X1UA 2FTPA 2QAPA 2GJLA 3U6WA 2DZWA 1QPOA 4A3UA 1JRBA 1O4UA 4M19A 5HWMA 3HPZA 1B9BA 5K7JA 1JCMP 1QO2A 4LS1A 3LI1A 1FDZA 2Z0IA 3W1PA 4M6QA 3FS2A 1JJKA 1XBVA 3LDVA 3OVQA 2ZDRA 5A8GA 1YYAA 3EWXA 2X1SA 3B06A 4X22A 3MW7A 5SWUA 1WQ5A 2PURA 4O16A 3TFXA 4LT9A 3BGGA 4MKNA 2WJZA 4JEQA 3M5ZA 1OF6A 4ZL1A 4IMFA 1ICPA 5F2LA 4FF7A 1IGSA 5KZEA 5HULA 4XBKA 2DORA 4WX2A 3BW4A 1Q45A 1S5VA 3LCGA 5LKYA 3TCEA 3P8JA 2O7SA 1ZAHA 2V0TA 3W7GA 2H8XA 1S5WA 3L66A 3DZ1A 2NXHA 3UXDA 2ZCGA 4L4MA 1GPWA 1ZCOA 3DFTA 3L0KA 1KM3A 1XUZA 1DVJA 1L6SA 1I2OA 4QITA 5K9XA 1H7XA 1VCFA 2X30A 1EUAA 4HNUA 1W56A 1BEUA 2ZRVA 3W7MA 1TB3A 3HPXA 2CLLA 3NR0A 3PC0A 2EGZA 3F4WA 2OMAA 1KM1A 3G0XA 1XBZA 2RDWA 4A2SA 1XXXA 1F2JA 1GT8A 4LVGA 4YWIA 1KLYA 4WJEA 3PSVA 3TXVA 2TSYA 3R89A 3GKFA 1WXJA 1MZHA 3PBUA 1WX0A 5FF2A 3LB0A 1ALDA 1QWGA 3NQMA 3BGJA 1G4SA 1UB3A 4QAIA 4MFDA 2ZQ0A 2TRSA 1PCWA 5FI8A 4EWND 3MHFA 3O15A 4IPIA 1KV5A 5E0KA 3LXCA 1GEQA 3B4UA 1HTIA 4BR1A 2Q3OA 4WOQA 5EYWA 1K03A 2TMDA 2V2DA 4YLWA 3C2VA 4CCDA 2ZRYA 5E93A 4Z08A 3T7VA 5C6MA 4UR8A 3NZRA 1B57A 4BWLC 3G1XA 4GRSA 4AF0A 1F5ZA 3NXFA 3I65A 1GQNA 1TPH1 5U7SA 4EF9A 3S1WA 2BXVA 4JYEA 3KRZA 4UIOA 1KM6A 1DHPA 1VQTA 2GVJA 4KFPA 4CCEA 4PEKA 5LHEA 3I7SA 3TK7A 3C8FA 1W54A 2YYTA 1Q6LA 4Y6GA 3M44A 3RU6A 3BK0A 1QNVA 5D09A 4HPJA 4DF2A 3Q2DA 3O07A 1VJIA 2YDAA 3ZR4A 1OYBA 3T78A 3IEBA 5D03A 2QCNA 1GTEA 3GAKA 3FEMA 3W76A 1A5BA 2VFEA 3NG3A 3WK2A 1GTHA 1P4CA 3STGA 1WYIA 4O13A 3W07A 3W6YA 3CB8A 3UWQA 5AC8A 3VI2A 1I2NA 2CLIA 1W1ZA 3PB0A 3PBYA 3NEVA 2ZYFA 2XN0A 4NJKA 2A7PA 1DL3A 4FX6M 1W31A 4D2JA 3G0SA 2F84A 4ICNA 5CPMA 4NZFA 3W7HA 3MI2A 1M7PA 1ZFJA 3IRDA 3TMLA 4WY0F 3SSJA 4EF8A 1LLZA 4MLRA 3R5EA 5AC7A 2VFDA 4Q4KA 4JY9A 3DHFA 1FY6A 2E5BA 3IV3A 4XBSA 5D30A 4WY0A 5G2IA 3UWYA 4CNNA 4UFHA 3TC6A 4IMCA 1YADA 3N9SA 4JYFA 4NU7A 3W7NA 3QQ1A 4NX0A 2DJLA 5LZLA 4AMAA 2NXIA 1LDCA 1FWTA 2WNNA 3GX9A 3M9YA 5L9FA 3GXTA 4BK9A 3MUXA 3LRKA 3MO7A 4XQ6A 3EWBX 3SGZA 3QYQA 5F2MA 4FXRA 2P1FA 1XI3A 4NJGA 5CSSA 5CZSA 1B4EA 4E38A 3WJSA 5IM51 3FLUA 1TRDA 1YPFA 3QW4B 5HNRA 3KHJA 4O0KA 3WFAA 2FFCA 3EEGA 4BI5A 3W2KA 1KM0A 5AHIA 2RKXA 4TR9A 1QDSA 4XZ9A 1UASA 4IMEA 3M5YA 1QR7A 3QMSA 1W5QA 3TX9A 1YDNA 4WXYA 1VYPX 3G0UA 3BV4A 3VE9A 1XBYA 3HO8A 4DQWA 4KWWA 1SFLA 3WK1A 4AEOA 1DQXA 4OV9A 1ONRA 2NV2A 4GWEA 3EX2A 2WV8A 4RXFA 4UFIA 2FB3A 1UUOA 3BVJA 3W7OA 2AGKA 1N8FA 3FYOA 4K7YA 3GXNA 5BMWA 4YCPA 2CLEA 1TTQA 3HGSA 1PE1A 3KRSA 3PULA 4FEZA 1YDVA 4MZ8A 3P62A 3UXAA 2B7QA 4Y90A 2VELA 1CX9A 3W23A 1TV7A 2NZLA 1VS1A 5AHEA 3CTLA 1I8JA 2WKJA 3RF9A 3W86A 3G1HA 1H7RA 5AHNA 3WK3A 1JQVA 3DI0A 3NO5A 3THQA 1TSIA 3F1QA 3W7DA 4C1LA 4AH7A 1LRNA 4MYXA 1QPRA 3CU2A 3O6CA 2QCMA 4FNTA 1FCBA 1ICSA 1TJPA 4FO4A 1G67A 3LHVA 3DI1A 2NX1A 1CW2A 3MBFA 1JUEA 3R12A 2FPTA 3NPWA 2DU2A 3C2EA 3G1YA 4O1AA 4WOZA 1YPIA 1T8XA 3QM3A 2G5WA 3MI6A 4ORMA 3M16A 5AOUA 4FX8A 3BW3A 3W85A 3S1XA 2QF7A 2CLKA 1GG1A 3CQ0A 4GUGA 5G2WA 3HBLA 1QOPA 1SR9A 1YXYA 3LV6A 2C14A 5EA9A 3W84A 3N2MA 2G95A 4PC8A 5EBUA 4FNQA 2FLIA 2LLEA 3MWAA 4NUWA 5F4WA 3W7IA 5I3KA 5L6UA 1V7YA 4A2RA 1D3GA 3W7JA 4DBDA 5BMXA 2Y61A 2YR1A 4QNWA 5EY5A 3ELFA 5K9CA 4CQAA 3DXIA 3O16A 5J5RA 4RLIA 4OV4A 3PBWA 2QJHA 3T4CA 2YSWA 1MEHA 3M7WA 5EL1A 4LWWA 3ZS4A 5BOOA 3RNDA 3OA3A 5CGQA 5KSWA 4O53A 3EKLA 3PBVA 1JQXA 4LVAA 1SO3A 2VKZG 2R94A 3S5NA 4JTGA 2GVLA 5CZTA 3N73A 3PG8A 1Y0EA 1VHNA 1V5XA 4MOZA 1ME7A 3RLUA 3CWOX 3TDFA 4HNNA 2ZBTA 3QPYA 4JR5A 3V75A 3L5MA 1ZJIA 1TPEA 4JICA 4RV8A 3B0PA 1F6KA 2Z6JA 3LHWA 2V5LA 3CEUA 4GXMA 4FIRA 2AQWA 3TKFA 4N9BA 1MEWA 1TQXA 2PE4A 4JNMA 3BG5A 3KXQA 1KFBA 3GVGA 2NV1A 3DFQA 2EPHA 1W5NA 2ISSA 5D2VA 3GLCA 2CLMA 4BI7A 1I2QA 4JTLA 1D3HA 4CQ8A 3BG3A 3PWAA 2YFOA 3ZWTA 3S5OA 3NNTA 3W7KA 3GK0A 1TPB1 1JCNA 4MLJA 2YX0A 2QEZA 1F74A 3NQDA 3NAVA 3FA5A 1FX6A 4GNJA 1ZY9A 3W1UA 2QUUA 3QW3A 1IF2A 2TPSA 3CHVA 2GOUA 1P5BA 2G96A 1I2RA 1OFOA 1H50A 7TIMA 1EEPA 1KFEA 4GUFA 1GYNA 5KZMA 1NFBA 3DKJA 3MBDA 1X6UA 4L4LA 1WOBA 4JTEA 1ZNNA 4BWLA 2J9ZA 1XKYA 3BPWA 2ZZ2A 3G18A 1KW1A 4ML9A 2Y89A 2FPYA 1OFPA 5LNRA 1TPDA 1QCWA 4OHQA 2RDUA 3G1SA 1RQBA 5MHBA 2C6QA 3DFOA 4AVFA 3A24A 4OT7A 4QIUA 2ZZ5A 1QOQA 1L6WA 1TPFA 2J27A 3TNOA 1FDJA 1HUVA 3HJZA 3CIWA 4Y96A 3LHZA 4JX4A 4ADUA 1T99A 3FJ6A 3KAOA 4N2YA 2UV8G 4O54A 1RPXA 2A2IA 4RXGA 4YCOA 3MP5A 4JTHA 1OJXA 3LXBA 5TQLA 4E2BA 3PUEA 1TTJA 1B4KA 2E6DA 1W3TA 3NM3A 2V9DA 4PH6A 2WPBA 4RZ6A 3L21A 1VCVA 1LRTA 3A5FA 3W7LA 2BWGA 3NQEA 1A5SA 1QAPA 3BO9A 2DZSA 5FF7A 5G1TA 1UCWA 1W5PA 2A6NA 1I2PA 3DKLA 4UUIA 1LP6A 1WDWA 3DFSA 1AK5A 1GG0A 1NAL1 3BLIA 2NLIA 4DF1A 4PL2A 1YDOA 1KTNA 1IXPA 4LUJA 3P80A 4O52A 4UTLA 3PF3A 2A6LA 1BWLA 1W5MA 4H3DA 4RX0A 2QDGA 5D33A 1FUYA 3PG9A 1KFKA 1WBJA 3GYEA 2I1OA 5TBOA 3MYOA 1QO5A 4LTSA 1Q6QA 3G1VA 3S0CA 1HO1A 1X8FA 5AHLA 3NL3A 1VZWA 3MP4A 4DO5A 1LBMA 3IIPA 1PV8A 4LC6A 1C29A 4HSNA 5U4NA 5HWNA 4NVTA 3QQ0A 3SZ8A 4IXXA 3BG9A 1VLIA 4LW7A 2WOQA 3LOTA 1JRCA 1YTKA 4WD0A 5ABTA 1ZAJA 1EWEA 1AL8A 4BI6A 3WJZA 1OVDA 3LX9A 3NGJA 3HG2A 3GNNA 4TMBA 2CLFA 2E5DA 3NQCA 4DEFA 1FWRA 2QCEA 2YW4A 3OVPA 1PCKA 3TH6A 2VEMA 5LNSA 4R34A 3MHUA 5HUPA 3WJWA 1K7EA 3RLVA 3NQVA 3E0IA 1KTCA 1WA3A 2PCQA 3ABOA 4NX5A 1G4EA 4ONVA 4HKPA 1H7OA 3G8EA 3ANYA 1Q3NA 2Z6IA 1SQ7A 3O05A 3E12A 5D38A 3C2RA 3CWNA 3SI9A 2NUWA 4KFNA 2EAWA 2DZUA 3UYCA 3MP3A 2QUVA 5DELA 4ZVJA 1LCOA 4Z1DA 1Q6RA 1FWSA 3W75A 3R13A 1TRIA 4IUOA 2C15A 3NQFA 2YGYA 1QPQA 1KLZA 2CWNA 3TXZA 1EIXA 2YYUA 4M7SA 4N6EA 5D05A 2C19A 2A21A 4UTWA 3TAKA 1EX5A 4UFMA 1MO0A 1K7XA 2QKFA 1E51A 4ALDA 4QQ3A 1KFCA 3N9RA 2QCHA 1YXDA 1SZEA 3W1NA 2A1YA 3LM7A 2A4AA 4DPQA 2JGQA 3W7QA 1IXNA 4JTTA 3TJLA 3NQ8A 4MFEA 3DH7A 1O5KA 3DAQA 1EUNA 3S1VA 2ISVA 5CG7A 2BLEA 4LS2A 3C0JA 1FXPA 4P61A 1K02A 2RHGA 2CZEA 4EIVA 3P5ZA 2YCEA 3HMJG 3S8HA 1G69A 5K3VA 2R8WA 4UTIA 3W7PA 2NXGA 8TIMA 5FF3A 1EP3A 4LV9A 5E1QA 2HS6A 2HS8A 2B4GA 2WSRA 4JYDA 1LORA 2C18A 1ME8A 4JXCA 2JKPA 2V2CA 3C4UA 4N02A 1IIHA 4JD4A 4LUIA 1JUKA 4FXSA 1UJPA 2C1HA 1GVRA 5H91A 3T44A 5BNKA 5CPLA 4CLMA 4XTIA 1OF8A 3VNDA 4B5NA 2B7OA 2Y7GA 3BARA 2W79A 2J9YA 1W3IA 5AYYA 3THAA 4NNBA 4BFAA 4IWWA 3G3DA 3INPA 3G1FA 2Y70A 5HJLA 3W87A 2E6AA 3FFSA 4ADTA 4FIQA 5D37A 4RCXA 1T96A 4O8RA 3L67A 3HIJA 4GFSA 3TJXA 4O19A 1GVSA 1OHLA 1TJRA 5F1VA 1D9EA 2OJPA 4NNAA 3S5ZA 5HINA 3TIMA 2QJIA 4RR4A 2VXNA 1NEYA 1R46A 1J5TA 1H60A 1R47A 3ABQA 4Z1AA 1VGAA 3IGSA 3GDMA 3IIOA 2JKEA 3S1UA 2H90A 4HPXA 3TSMA 3OVRA 3SECA 1I4NA 3QMRA 4UTUA 4K6AA 5KTLA 4JTSA 4X9SA 1JCLA 1FCQA 1L6YA 3C52A 1EWDA 2VFFA 1K8YA 1XCFA 2VOMA 3I7QA 1WV2A 3P84A 3YPIA 3NOEA 4G1KA 3NZ1A 4DO6A 2FIQA 3W71A 2X1RA 5I3HA 3LCFA 4ZQNA 4DO4A 4IMDA 3NQ6A 4MIMA 4Q33A 4OU1A 1K8ZA 1W8SA 3C2OA 3OHIA 4UFKA 4M6PA 5KMYA 1O94A 1KFJA 1TYGA 3KFTA 2YW3A 4JY8A 1TMHA 3VFLA 1CI1A 4K36A 4N9DA 4JDYA 1RR2A 3LV5A 2TYSA 1R30A 2WNZA 2NX9A 1OX5A 4TIMA 1GOXA 4O1CA 4NNCA 1F73A 1GVOA 1FCVA 4UTTA 4H4IA 3RK8A 3W88A 4FNPA 3N34A 4QNEA 4DPPA 2QCCA 3PS7A 3UWUA 3LHUA 3S42A 4O4VA 1OFRA 4HNTA 2VEKA 4NJJA 2YPIA 3B0UX 4U28A 3NQGA 3KVJA 4XWUA 1TPUA 2ZZ3A 3UY7A 3GR8A 1W37A 4N9CA 1DORA 1SFJA 4ZQRA 5IBXC 4AWSA 1IIGA 5DY2A 1PHQA 1OK4A 5FF4A 1I45A 1X7FA 2VFGA 3PAJA 3NPVA 1H63A 4JX6A 2FJKA 1X1OA 5D2WA 4FX7A 1XDLA 2GVGA 1SW3A 3P74A 3L5LA 4O10A 4CQ9A 3LTPA 4UC5A 1U5JA 2Y63A 2ZRXA 5CPNA 2ZRWA 2DP3A 5LNVA 3O1NA 4O4WA 2D73A 2ZFAA 2EKCA 1P0KA 2NUXA 4N9EA 1TTPA 1PS9A 4O57A 1H1YA 1GYLA 3B04A 3IIZA 1OFQA 3MHGA 4I7UA 3QSRA 1G7VA 2Q8LA 3W3OA 1BTMA 2HTMA 2PC4A 2IQTA 4ZQCA 2GQAA 5K4ZA 4DXVA 2X16A 3OEXA 2ATSA 4PODA 3VE7A 3Q94A 3W73A 3UWZA 3V1PA 3UZ5A 4JDBA 4GBUA 3OG3A 3QFEA 3TROA 1LROA 1MXSA 1YXCA 5FEXA 5AYZA 1HFBA 4ZQPA 3CEPA 3W9ZA 3L9CA 3TQVA 3A21A 4R33A 1HO4A 4MJMA 3TAOA 1A50A 3EB2A 3Q58A 5FESA 4IQLA 1TV8A 3GR7A 3FKKA 4N4QA 2VEIA 3H55A 1SSGA 3B8DA 3S5YA 1L9WA 3NL6A 5HQEA 3M41A 1VR6A 1EPXA 2V30A 1AG1O 3CLMA 5CKSA 2QAFA 4MY8A 1KM2A 4AAJA 3T40A 2G97A 2XFWA 1W0MA 2X2GA 1N55A 1DJNA 1XDMA 4UR7A 3A9IA 1XL9A 5F1UA 5CPOA 4UTKA 1P1XA 2E68A 2V82A 4MPQA 1OX6A 3USBA 3B0VC 4DF0A 3EWUA 3W2UA 1HL2A 1JVNA 3LXAA 3FOKA 3EXSA 4IXHA 5F2GA 2A85A 1F6PA 2I9EA 2ZZ1A 2Y7FA 5HUOA 4EOUA 3UWVA 5DXXA 1TTIA 3QZEA 3LCHA 5K2ZA 5LGZA 4WXZA 1KTBA 3EXTA 5AHMA 4UTMA 4S1FA 3P61A 2A0NA 1NVMA 1SUXA 3QRHA 3LERA 3NVTA 4DBEA 1OFBA 4AWTA 2BZNA 4KKXA 2Y6ZA 2R91A 3EX6A 1U83A 2GQ8A 1H7WA 2OCZA 4M7TA 1KA9F 4ORIA 2FDSA 2Y7EA 4J9JA 3U8GA 3TSDA 1XUUA 1SO6A 5DN1A 2B7NA 5CSRA 3FIGA 4POCA 1GVFA 1B3OA 3UD6A 3QJAA 2Y88A 1TV5A 5HR6A 3W1LA 2HMCA 4UTWC 2W0UA 3A5VA 4NT0A 3W2JA 4LC8A 1FCUA 4FB7A 1W5OA 5C5YA 5EMUA 1LYXA 4WQ6A 2ZA2A 3M6YA 2QCFA 4HIBA 5AB3A 2Z1BA 4HT3A 2Y7DA 5LNWA 4K7VA 5DCDA 3G8RA 4RJEA 4RZ5A 1OYCA 2CLOA 3P7YA 3MJYA 2XN1A 1A5AA 2ZRUA 3LCWA 3N14A 1M5WA 2RH9A 1DBTA 3P82A 2EF9A 1JCJA 4WZHA 3W70A 1WOAA 2F7FA 2Z2UA 4K37A 2WSQA 4Q32A 1T0OA 2JGYA 3NPUA 1H5YA 5GVJA 1TPC1 3FKRA 3SW6A 4LVFA 3TFCA 2OX1A 4I9AA 3GIYA 3BLFA 3M0ZA 5K9DA 3CPRA 4AXKA 5J5DA 1OYAA 5I3GA 1JR1A 3QC3A 1G7UA 4JS3A 3ABSA 4MJZA 2C16A 3M5XA 2GQ9A 3G1AA 1S3HA 3KVKA 4OWGA 4O0ZA 4O50A 3LBCA 4LV4A 3TC7A 2E5CA 1LOSA 3TSBA 2V5BA 3L0GA 3AO0A 2ZRZA 5EPDA 2Q3RA 2QJGA 4I7WA 1LTDA 2RFGA 1C9DA 2ZZ6A 3IVUA 3PR2A 1JUBA 4K8HA 1TREA 1FQ0A 5CZ0A 2A7RA 1J2WA 4LNYA 3CT7A 4RK8A 3SFKA 5D2TA 4XKYA 3IIVA 2ZTKA 4O11A 3DFNA 4A22A 1SZNA 4AHQA 3M5VA 1H61A 3KX6A 3KVMA 3WJYA 3W74A 5F2IA 2C3ZA 1FWNA 1IXOA 2H6RA 1ZALA 1AMKA 3ABRA 3TW7A 5H2ZA 4LU0A 4FNUA 2ABAA 4LVBA 2ISWA 3BW2A 3G1DA 1RVGA 3STCA 1EB3A 3L65A 5HR7A 4TMCA 2Y62A 5G2HA 4O17A 3GNDA 3GXPA 3MYPA 3EXRA 3GAYA 2ZZ7A 3LRLA 1XBXA 1VHCA 1VRDA 3W72A 3E96A 4Z1BA 4Z0SA 2H8ZA 2E09A 3UNDA 3W2MA 1ICQA 2ABBA 3L5AA 1Z42A 4WUIA 2O7QA 1IXQA 3N19B 4O1DA 4JGDA 4I7VA 2NWRA 1G6CA 3C2FA 3HF3A 1VC4A 5CZJA 4UTTC 2PRHA 2P10A 3ATZA 5IBXA 4A29A 3HG3A 3CIXA 3UPBA 3KOFA 2AAMA 1OFEA 3JS3A 1TCDA 5EKYA 3TQ0A 2BSLA 3I6RA 4KFOA 4GUJA 1S5TA 4PL1A 4JN6A 3HGJA 3PB2A 2CZ5A 3W1MA 1W3NA 4MYAA 4PCFA 4MZYA 3HGOA 4C1KA 1OK6A 3PY2A 5HWJA 4NXSA 2FPVA 2V2HA
chains in the Genus database with same CATH superfamily
4MWAA 1PVNA 2VENA 3EX1A 4MJ4A 1LG2A 2FTWA 2CZFA 1THFD 1AJZA 4ZXOA 1OB0A 3A23A 4AD1A 1H7PA 2G8ZA 3STFA 2BV9A 4JIRA 3M0YA 3DERA 3CZJA 5C7VA 4AF0B 1SO4A 2J8FA 2OWWA 1OFAA 1CCWB 5I6SA 2ZTJA 3AZSA 1KBJA 2ZZ4A 4PFMA 4JFSA 5FCZA 5FJPA 3N15A 1GZGA 3BICA 2JK2A 1NWUA 3NPXA 4JBRA 5LGXA 4HJFA 1M68A 4H7CA 4IGMA 3B9DA 1ME9A 3NDOA 4HSHA 4UWMA 2BX7A 2O4MA 2XGIA 1D7FA 4C6LA 4GCAA 3S1GA 1XPGA 3T08A 2WSYA 3TQKA 4Y9PA 2O9PA 4C6IA 4PUWA 1M7OA 3NQAA 2AKMA 3U4FA 3GDLA 2CBIA 6TIMA 3WZ0E 5C71A 2FHBA 3VD7A 3R94A 3A4WA 3EWCA 4J3SA 4RUBA 2F6KA 5FSEC 4LVDA 3OLEA 4UMAA 5CAKA 5BU9A 5I23A 2PODA 2VRQA 5BWAA 3NQ2A 3E1F1 4GUHA 3EMZA 2GJPA 3D3AA 1W1B1 4WDUA 3SY5A 3NA8A 3HPSA 2VZOA 3UWWA 3T4WA 1KM4A 4X3ZA 2EJ1A 3VNIA 1GWJA 1KCKA 1R2TA 2FHCA 1KBIA 3L68A 2ACSA 2VC6A 2H3BA 3SR7A 2X0SA 2CXGA 3ZLHA 3SJ3A 1P0EA 4GINA 3EDEA 3E2RA 1MW0A 2G0WA 1XRTA 4HCDA 1OABA 3WD1A 4ZBCA 4HYVA 4JTKA 1X1ZA 4N0RA 2TAAA 4EE9A 1R3RA 3RMJA 3VGEA 3WN6A 3EB4A 4TO8A 2HBVA 1UW9A 5H1WA 4JTIA 2PDIA 2WHMA 5DLCA 5D2XA 1KR1A 1ZENA 1TPVA 4UQAA 3CZGA 4W8LA 1NF7A 4I9JA 4UFLA 3U4AA 4QG6A 4P8VA 1OT1A 3ZWSA 1RCOB 3NQ7A 1G0CA 4MUZA 5BOEA 2BGQA 3G22A 4HSOA 3E5PA 2OOGA 2Y2WA 2V67A 1KCLA 1SFTA 1MW3A 3RDKA 1AW5A 5M2FX 1W9XA 2A5HA 4MB3A 4S3JA 2Q09A 5D2YA 4IL2A 4AHPA 3CHCA 4PYSA 5J04A 1W91A 1DOSA 4AWEA 4MG4A 1NELA 4IJBA 3GDKA 5FIPA 3LU2A 4PA8A 3TUUA 2VFHA 5DT5A 1F61A 1M01A 4KMQA 2EKGA 3MPGA 3VIPA 3ZJ7A 3B03A 4C6CA 1DP0A 4IP4A 1B1YA 1KFLA 3GC4A 2VC7A 5CG0A 2A3HA 1LBLA 2GLKA 1J96A 4DO7A 5HQMA 3W1RA 4L4OA 4GG9A 2BVTA 5G4HC 3ENLA 1NOFA 3AZTA 3EMQA 4C90A 1A80A 3AYSA 1MRQA 4LS0A 4MADA 1MNZA 1V3JA 1KCZA 3DGRA 1V3MA 5HDRA 1JCTA 3NCOA 3L0NA 2XJ7A 5E9AA 2VL4A 3SADA 4B16A 1J0KA 3TTOA 3HQNA 3C0SA 2WNQA 5DCEA 1EA0A 2XGBA 1HJWA 2IKGA 4KWSA 3NOYA 4MWAD 4KS0A 3ARRA 3C86A 3SGUA 3RFAA 2ZXDA 1UWAA 5HNTA 4LRTA 4IIHA 4C6EA 4LCQA 2J6XA 1H1NA 3ARSA 1A53A 1UPPA 2O92A 1QU4A 4QM1A 2OQYA 3WBWA 1K8XA 2WQPA 3WLRA 3TMQA 3W81A 4EK7A 1EGVA 4A6GA 3K4AA 3IGXA 1MQRA 1LUCA 1TIWA 4DJDD 1MSSA 3WELA 3HURA 1EBHA 1ZHAA 3T9PA 2J6VA 1I0BA 3RU8X 2ZXAA 2DZPA 2YCJA 1FOBA 1J0ZA 2QVHA 4H8UA 3ZLGA 4AZCB 4GD0A 1EXBA 2Z1KA 4TXEA 4UMCA 2B7PA 2V3GA 4K39A 4XUGA 4Q4PA 2DZTA 4GXPA 1LOLA 4JIPA 4YTQA 4ROQA 1L2UA 3LLDA 4QBXA 2H3DA 1SZFA 4X2RA 4EVZA 4NZJA 4RKAA 1EP2A 2QCDB 4BF9A 4UNLA 4M5PA 4ERAA 5KINA 2WQDA 3KBSA 2Z24A 5LSMA 5I79A 1LRQA 5M1TA 4XTDA 3TOYA 1OT2A 4HPNA 1DTNA 1REQA 3LBMA 4GIYA 4ATWA 1XYFA 2CZDA 1U5VA 5BWFA 1B9ZA 3UFYA 1V6UA 3IVSA 3LGGA 3AHTA 3B9EA 3CHEA 2NX3A 1SPQA 4MY9A 1A5NC 1XSKA 5C55A 4HNVA 1XIGA 2XFRA 2F6XA 4ZOBA 1VPXA 2PI6A 1HGWA 3UJSA 3G3MA 2HWGA 2G3FA 1O4UA 3VZXA 4M19A 4D6CA 3BLLA 1FDZA 1QATA 3W1PA 1KWGA 3UR8A 4QFUA 3FS2A 1JJKA 3WX7A 4D6HA 5A8GA 3EWXA 4X22A 3LN3A 5I09A 3NXLA 3E5BA 1WQ5A 2AQVA 1E0WA 4O16A 2WYSA 3VCCA 3AC0A 3DN5A 2WJZA 4JEQA 1K4HA 4A3YA 4ZL1A 4ZCWA 1F07A 4I5RA 4RNJA 1FHVA 4WX2A 4ZTXA 3BW4A 2XIIA 1Q45A 3G1RA 3TCEA 3P8JA 4WIWA 4ZO7A 4FOKA 2O7SA 2P3ZA 2V0TA 2J7HA 3W7GA 4UB9A 3VDGA 3WUFA 1US3A 3KE0A 1GPWA 3G77A 4QITA 5K9XA 3FXGA 3KBMA 4MKSA 4FXFA 4HNUA 3HPAA 1XIIA 2VURA 1TB3A 4Q3MA 3HPXA 3EGJA 4JTDA 4FP1A 3T2PA 1NQKA 5EFDA 4F0MA 2VCBA 4LF1A 4YWIA 3T81A 3QY8A 3ANUA 4WJEA 2PCEA 2TODA 2HE5A 3R89A 1WXJA 1WX0A 1GOOA 4URIA 3NQMA 3TA9A 4QLLA 1UB3A 1JYXA 2BP1A 3UXKA 1PCWA 2MNRA 3SY1A 2QS8A 1C90A 1NP0A 3SCUA 3OP2A 1GEQA 1TUXA 2Q3OA 3QR1A 4INFA 1BYCA 4ICCX 1XG3A 4Z08A 4ZGYA 4IQJA 4BWLC 3G1XA 2YA0A 2AQOA 1F5ZA 1BQCA 1EC7A 3NXFA 1GQNA 2BXVA 3MSGA 2GVJA 2RUSA 4HJWA 1W54A 3M44A 3BK0A 3MC5A 4HPJA 3ITOA 1BF6A 3DHUA 4H9YA 2Z28A 3RCYA 1GTEA 4DN1A 3RO6A 3W76A 2VFEA 3STGA 2C7FA 3QTGA 2I56A 4WLCA 4NAEB 1EJXC 4JKMA 3SCNA 2VRJA 4W7VA 3FAXA 3UWQA 2ASHA 5AC8A 3VI2A 4LAKA 2V6AA 4A8IA 2OYKA 1DWAM 1W1ZA 2WVVB 3LENA 3TLLA 4AUBA 4O1EA 3PBYA 4QLKA 3GZAA 2A7PA 2OLSA 4D2JA 2HNEA 3MVIA 3TMLA 5AC7A 1LLZA 4MLRA 3IUDA 4E8DA 1K70A 4JY9A 1UWTA 1HJVA 3TC6A 4CVUA 3TR9A 1YADA 3BANA 2FZBA 1PZ0A 1LDCA 5E70A 3M9YA 4L1GA 4DWSB 4MGGA 3EWBX 2PDUA 2CITA 1W1PA 3QYQA 3C0LA 2AMXA 5F2MA 4FXRA 4NJGA 1B4EA 2QHAA 5IM51 2XDFA 5HNRA 4O0KA 2J25A 1KM0A 2RKXA 4RZBA 4F0LA 3PJXA 1NDZA 1VFSA 4IMEA 3CUGA 3M5YA 1QR7A 3CZEA 2REQB 3WEMA 3QMSA 3WH8A 4D72A 1QW7A 1LG1A 4BF7A 2QMKA 3G0UA 3JVAA 3OPSA 4DQWA 4KWWA 3VC6A 2R24A 4W8AA 3EX2A 2MANA 2WV8A 4RXFA 2FB3A 3BVJA 1NDWA 4K7YA 5BMWA 1PE1A 3PULA 3P62A 4R88A 3U0HA 3UXAA 2YLAA 5EMJA 1G9HA 1UMYA 2AKZA 5JIWA 3MQTA 3G1HA 2BDQA 1JQVA 3NO5A 3NQBA 1TSIA 4DUXA 3W7DA 4PCNA 4C1LA 4RE2A 3QKZA 3ABXA 3PPCA 3STPA 4MJ2A 4FNTA 2BOFX 1TJPA 3KZPA 3DI1A 2D2HA 3ZJKA 2B31A 5A6KA 1Q2SA 3S83A 5C2GA 2DU2A 5CEWA 3QV8A 4Q8PA 1YPIA 3QM3A 4Q8MA 3MI6A 4R5EA 4ORMA 2XG9A 2FGZA 3BW3A 3K2GA 5DMYA 3QZ6A 4S3FA 2QF7A 3MMDA 1ZTVA 1RJQA 1GG1A 4QQUA 3HBLA 2Y8KA 4DVOA 1UR3M 4RDZA 4KCUA 3PZGA 3B8TA 3NWRA 3N2MA 2DGAA 1KXTA 2G95A 4NRRA 4EPKA 4MPKA 4G1NA 5E0CA 3D5HA 3QR3A 1FWEC 1I9CB 4IICA 3QXBA 4W8BA 4JEJA 4MNKA 2J47A 1KRAC 4H41A 3GVVA 3WNPA 4UOZA 3W7JA 3EOOA 3VABA 4QNWA 4PE8A 5K9CA 2ZE3A 4R7WA 1T40A 3DXIA 3O16A 2QYGA 4RLIA 3J7HA 3LUTA 1WKDA 4X60A 3T4CA 3IGHX 1MEHA 1WKEA 3M7WA 1JZ8A 1R7AA 2CLPA 3PZMA 1UZHA 3EKLA 1IR1A 3KCLA 1SO3A 1FRBA 3S5NA 1OSEA 2V68A 2WMJA 3VD5A 1UC5A 3SQLA 1Y0EA 1V5XA 1QI2A 1SR0A 3BOFA 2WVTA 2PDFA 2X0HA 4JICA 5FL1A 3H2CA 2Z6JA 1AFSA 4H7ZA 3D6NA 3WNNA 4FIRA 1Z7AA 4N9BA 3DHPA 2W63A 1MEWA 4RDVA 2PE4A 1KFBA 3ECQA 3R0DA 3TTYA 4PSRA 4Q4QA 4O1FA 3UVAA 4EWJA 5D2VA 3GLCA 5CC6A 1V03A 5EBAA 4BI7A 5LXEA 3NGFA 4HNLA 1D3HA 3BG3A 3NEHA 1JXJA 2PB1A 3HJEA 1TPB1 1JCNA 3B8SA 3H23A 1R85A 2QEZA 1F74A 3H2FA 4US5D 3W26A 1IF2A 2G96A 1I2RA 1B30A 1GYNA 5KZMA 3MBDA 4JTRA 2POTA 4JTEA 1ZNNA 2J9ZA 1CXHA 4HBKA 1UA7A 4YHGA 2Y89A 1V4YA 1OFPA 3N29A 4J27A 3UCDA 3VM7A 4D1IA 2A79A 5M5DA 2XWDA 3V5FA 4W86A 2C6QA 2BHUA 3A24A 3ZYZA 2PDNA 3G6LA 4FLOA 3ZSTA 2J27A 3FDGA 1HUVA 3CO8A 2XYLA 3HJZA 4OUIA 3BSGA 7XIMA 3FJ6A 4YYFA 4N2YA 5EFFA 4Q7NA 3PFRA 2INEA 5HANA 4RXGA 4YCOA 1OJXA 3LXBA 5TQLA 4B5SA 3PUEA 1BAGA 2E6DA 2J8GA 3WF2A 1W3TA 1IEQA 3UYIA 1IHIA 3AHXA 3GTHA 3CMGA 4W85A 5G1TA 1UCWA 2KX9A 5FD0A 1NOUA 2OU4A 4HZMA 3BDKA 1BG9A 2VCAA 3IRSA 1K6AA 4CN4A 1Q6EA 4DYKA 1LP6A 1NAL1 3BLIA 1KTNA 4LUJA 3P80A 2J7BA 3T8LA 3KHDA 1BWLA 1W5MA 4L4PA 3WQWA 2V3EA 5D33A 3FXYA 4NF7A 3TYUA 4GQGA 1KFKA 3GYEA 3MYOA 1QO5A 1EJWC 1E43A 1HO1A 3LYEA 1Q85A 5HOSA 3WQOA 2GDUA 4DO5A 1TV4A 1EHNA 4HSNA 3MCOA 3S4TA 3W29A 5GQBA 4IHCA 2G3JA 3KS5A 5I5RA 3W4RA 4LYKA 1JRCA 4WD0A 2Y5EA 4FLQA 3WJZA 4LH8A 3NGJA 3UT0A 4CD5A 4TMBA 2CLFA 5TAOA 4DEFA 2YW4A 3TH6A 5D8ZA 2VEMA 5HA7A 3RLVA 1Q13A 1KTCA 3COTA 2OXNA 2PCQA 3ABOA 4MNJA 4ONVA 1DIKA 4HKPA 3II1A 1W1A1 4ZE4A 1MUMA 1H7OA 4C1NB 2FYMA 3OHMB 3CWNA 4KFNA 5HPOA 5CLWA 4BS0A 3OG2A 2EPOA 2QUVA 1JPKA 5DELA 1XFCA 3KM8A 2CHOA 4U3CA 3LZ5A 3CO4A 1XD0A 1YNYA 1C3FA 3IJQA 1TRIA 3ARPA 3WQEA 4IUOA 4L6DA 1PZ2A 1QPKA 1FHUA 2YYUA 4M7SA 5D05A 3AALA 1VBUA 1PAMA 4P7LA 4UTWA 3T0DA 2ZIDA 2QXWA 5C70A 1EX5A 1K7XA 3WBEA 2GGJA 3WDQA 4IFOA 4LAMA 4Y7EA 2QCHA 1SZEA 3LM7A 4U10A 1KGXA 3RPMA 1UP2A 2JGQA 4JTTA 2QJMA 2PWEA 1QUMA 2DSUA 1EUNA 3S1VA 3L4VA 5CG7A 3VIJA 5T9CE 4HMCA 3ZVHB 3DECA 5CBIA 2YCEA 3WUBA 1TKKA 3S8HA 4YN5A 3ZJ6A 1G69A 4MB5A 1R86A 2E8YA 2DY3A 4JXCA 2YB1A 3P3BA 3LQGA 3XISA 2VZSA 4LJ3A 4GVIA 1J0IA 4LUIA 4ACYA 4AD5A 3M0MA 1HL8A 4HP5A 4D1JA 1GVRA 2XM2A 4KW2A 3AXKA 2F6UA 2PDJA 3AZRA 3WF1A 3B9NA 1AZ2A 4OECA 1P7TA 1Q6GA 2J9YA 1ZBCA 1W3IA 3NJ3A 3GSMA 1GOMA 3THAA 4BFAA 4NZ4A 4C6MA 1K4GA 3INPA 1J93A 1DWJM 2Y70A 5HJLA 2Q6ZA 2A3CA 1DWHM 4FIQA 1JZ4A 2AGTA 4RCXA 3E0WA 4AY7A 1WPCA 4FA3A 1UKPA 3HIJA 3RJXA 1TJRA 5F1VA 2VOTA 1D9EA 2CERA 4G7FA 4NNAA 1R38A 1O6IA 4L5ZA 5HINA 2AAAA 1BVWA 2ZX9A 1E1CB 1HJUA 3TJ4A 1GEHA 1WO2A 3NYDA 3GDMA 3IIOA 5AYIA 3VGBA 3S1UA 3TSMA 4IFRA 3A9BA 3UCCA 3QMRA 4K6AA 5KTLA 1JZ7A 1CYGA 2PGFA 2WAGA 2X1IA 3TZFA 1ADDA 1EWDA 2VFFA 3IANA 3P14A 3AU6A 3I7QA 3WBAA 2VO5A 3A13A 5I3HA 3LCFA 4ZQNA 3NQ6A 4MIMA 4C91A 4W4QA 1W8SA 2OKTA 2DQXA 3KL5A 4DI9A 1V3KA 3TLQA 4DWDA 1TYGA 3MDUA 4U33A 4LSBA 1LL6A 1TMHA 1VD6A 1CI1A 4K36A 2OB3A 2NX9A 3HPFA 1GOXA 3OTRA 1GVOA 1IWAA 4UTTA 3RK8A 3C3UA 3S5SA 4WGHA 4QNEA 1ZSXA 1UBPC 3LHUA 4AIEA 4O4VA 4U28A 1CGXA 3KVJA 2EEXA 3K8KA 3SUSA 3UY7A 4XSLA 3GR8A 1L2QA 4AWSA 4AVNA 5DY2A 1OCBA 1OK4A 3N2CA 2FJKA 3FHQA 5D2WA 3D47A 4ZOAA 3EOSA 2YXOA 1C9WA 1GHSA 3NTYA 1DXIA 3LTPA 1P6BA 1XIEA 2ZRXA 4R85A 1EPVA 4XD4A 1TR1A 1HW6A 2BY2A 4EPDC 1TCMA 3AXXA 1VRXA 3M0XA 2NUXA 4ZO6A 2XINA 1TTPA 5A69A 1PS9A 2I17A 1XC6A 1GYLA 3IIZA 1Z8AA 3SQSA 5DQPA 3SRFA 1G7VA 3W3OA 4NHVA 2IKJA 2PC4A 5AZ0A 3GC2A 3Q94A 3W73A 3IUHA 1Q66A 3AMDA 4GBUA 3TROA 1U1JA 2HCVA 4GQ0A 4ZQPA 2O4QA 3CEPA 3QHOA 3RCNA 3L9CA 3OBEA 3NSNA 3A21A 1PYFA 4R33A 3EB2A 4IQLA 5LA2A 4UQ9A 3B8DA 3S5YA 3UZWA 5HQEA 3VD3A 1MDLA 1AG1O 4IIDA 4B4HA 5TF0A 5ECUA 1S2CA 1YEYA 3VOHA 5CPOA 4DM1A 1V8EA 1EIBA 5IRPA 4MPQA 5ABHA 4DF0A 1Q8AA 3N6HA 1F8IA 3EWUA 3GW3A 1E4MM 3W2UA 1HL2A 3MWCA 1E3XA 1JVNA 3LXAA 4RW3A 1XCWA 4V1YA 3EXSA 2EQDA 5F2GA 1F6PA 4GZJA 1JZ3A 2Y7FA 1KQZA 1BRLB 4RPQA 4GQBA 3ME3A 4U3AA 2EG6A 3LCHA 2XWEA 5A8NA 3ZXWA 4LFYA 4DYEA 2PSNA 1NVMA 2CWXA 4KCVA 1XLBA 4F4RA 1HZYA 5A6BA 3OGVA 4LUSA 4AWTA 4EPEC 2OVLA 2X0YA 5BU6A 2Z00A 4LBRA 3EX6A 3BJTA 4LXFA 3WF0A 4M7TA 1TVNA 1KA9F 1LF1A 2XZ7A 4A35A 3TSDA 1SO6A 1P0BA 2FH6A 4POCA 1JYVA 4PZVA 2X2YA 1E1CA 4X2PA 5D8WA 1UHVA 2HMCA 2W0UA 3S6OA 1GORA 1EBGA 3KTSA 1FCUA 1X7IA 1W5OA 5EMUA 1H49A 4KGLA 3MT1A 2IMRA 4KT2A 3M07A 1J0YA 5LNWA 4JIIX 3H2NA 3TN4A 2Z27A 5DCDA 1D3CA 2ZADA 1OYCA 1X98A 1F8MA 3LCWA 1NP2A 4GOAA 4D6IA 1DBTA 1JEZA 3P82A 1X39A 1JCJA 3REQB 3BLPX 6A3HA 3VIHA 2Z2UA 4GIRA 5C9WA 2RAGA 1YNPA 4JCLA 4KPLA 2ZUTA 3POCA 3GIYA 4FOJA 3BLFA 1XIJA 2J62A 3WENA 5K9DA 1B5TA 5I3GA 2OELA 3ABSA 4MJZA 2C16A 1E6XM 3ZR6A 3G1AA 1S3HA 1J9YA 2HEJA 3TC7A 2E5CA 3AHZA 1J18A 4YPJA 3RYSA 2HXUA 2ZZ6A 3IVUA 3PR2A 1TREA 4F2TA 5CZ0A 1E0UA 1J2WA 3IV8A 2YA2A 4Q8WA 1X1NA 2WSKA 4RK8A 1M7JA 1QK0A 3WY1A 2O56A 3DFNA 3VILA 1MW1A 5F2IA 2QW5A 3WQCA 4JTCA 1TE1A 4DJFD 2WC7A 4V2XA 1K77A 2AL2A 4XKMA 4IMAA 3WNKA 2J74A 3PZOA 1QHOA 4LVBA 2I16A 4XVEA 1J5SA 1D8CA 3VD4A 2BGNE 1XLAA 3STCA 1NIUA 1B0IA 1EB3A 1RJPA 2OGYA 1GKQA 4LUTA 3VZZA 5CC7A 2BXYA 1FFRA 2ZZ7A 4CVWA 1UD6A 5T8GA 1AQ0A 3BAXA 4BY3A 1VRDA 3E96A 5A6BD 3IJLA 3W2MA 1ICQA 5HBFA 4KQNA 3BQ6A 1Z42A 1DIOA 3N19B 3LQLA 1R3VA 4IGNA 2NWRA 4I7VA 5IBXA 3HG3A 1KBBA 5I77A 1OFEA 3JS3A 3F4CA 3DGBA 1PX4A 1JF5A 3ZO9A 3I6RA 4GUJA 1S5TA 3BQ5A 2BOEX 3HGJA 3OODA 3W1MA 3U2ZA 4MYAA 4G6CA 4C1KA 2PF0A 5HWJA 3CB3A 2FPVA 5I24A 2DT0A 4JIQA 1B31A 4A8RA 4LY8A 3A12A 5C2XA 4G9PA 4K2SA 4GX9A 1N2VA 3ALFA 3S6DA 2W67A 4KRTA 4OOUA 4AHOA 1HP4A 4X63A 3QV9A 2GJXB 2PRLA 1UQYA 2Y5JA 3DFPA 1CDGA 1KKRA 3O6DA 2INFA 3EWZA 5FEWA 3OJGA 3P6LA 4ZODA 1E9YB 1VYRA 4C6JA 4Z0JA 1YBQB 4IG2A 1U1UA 4ZR8A 1OX4A 2AL2B 4GIAA 1ISVA 4Z1CA 3I10A 1NH6A 3CK5A 3QH2A 1S1RA 3FVDA 4YJ5A 5D04C 4Q8NA 4FLSA 5DCBA 3RLHA 4JTUA 3RITA 3LGEA 2W6RA 1ZAIA 4YVXA 1ADOA 3QSTA 1VYSX 1LBFA 2GPTA 4H6KA 5HMDA 1RV8A 4QJ1A 1P43A 4LY4A 4FNRA 4W87A 4A05A 1FWBC 3GVQA 4X0VA 3HN3A 3DBPA 5GPRA 3W1XA 1S1PA 3C2YA 1I75A 2YCLB 4OE7A 3SN1A 4M6VA 1QBBA 2QF8A 2JFEX 1J10A 1E9LA 1JI1A 1HG3A 2EHHA 3M46A 1H51A 1D7KA 1E5NA 4FZIA 4IIBA 2HSAA 4ZO9A 4JQ2A 2E3ZA 3CV2A 3CC1A 4IUGA 3W7CA 3QHNA 4E3TA 1ELSA 1GVQA 2CFFA 2PDLA 3CV7A 3K1DA 3NL5A 2WWDA 3HZ3A 5I3JA 1LOQA 4CQDA 5LHFA 1RD5A 1UZ4A 4ZMGA 4KWOA 1VAHA 3S46A 1NOWA 3OLGA 3EKZA 2ATMA 4G7EA 5HXMA 1SZGA 2Q71A 2BOGX 4Y9AA 1DWFM 4W7UA 4LBUA 4S3KA 4S39A 3CPGA 1OG0A 1AL7A 2GGEA 1ZS2A 3B05A 3VGGA 3QVQA 2WHKA 4IQDA 6ALDA 1W9VA 3V5CA 4XZWA 3LM3A 4IMGA 4HHPA 3R0UA 1K7FA 3BV7A 3RX2A 4D8ZA 3TU9A 3CLWA 4DB7A 2D2JA 3CIVA 3W7RA 2C0AA 1Z9AA 3AAMA 2VFIA 1JULA 5JBDA 2Z1WA 3C5QA 1PKNA 2E6FA 3H53A 1MFUA 2C71A 4R7JA 3WLJA 1M53A 4B3LA 3KBNA 2FB2A 4AD2A 2WMHA 3T0AA 2J13A 4LB3A 3DBNA 3GM8A 5DBUA 1V6YA 1RSCA 2V81A 4GE8A 1IT7A 1N7KA 5H8PA 1HGYA 2XU2A 2IW0A 2YBUA 3MUCA 1RZMA 2JBMA 3M0VA 2PGRA 1V6TA 4W93A 3OYXA 1O60A 3VDCA 3TR2A 1JAKA 4Q8TA 4Y9NA 9CGTA 3W1QA 7REQB 2XM1A 3E49A 3EWWA 2Y85A 3FV9A 2EXOA 1TQJA 3VCNA 1DKWA 4E3VA 3TNBA 3ZIZA 3VO0A 1VFFA 4H2HA 1OCQA 3WH6A 5FEPA 2R1NA 1RA0A 6REQA 3CJPA 4GJ1A 1HKIA 5B80A 1DTUA 1S2WA 1ODUA 3ITLA 4PCSA 4FHAA 4LRSA 4PEEA 4QSHA 4OUEA 1R2RA 4S3BA 1XIBA 1WBHA 3HB9A 3LHTA 3LBOA 5AYXA 3VYLA 3CUFA 3GNPA 4W88A 1FXQA 2YOCA 2XHYA 4QEHA 2GK1B 2YCLA 1UG6A 2VX7A 3O06A 4UTJA 4UCGA 1MMFA 5A2AA 4WSJA 5JXQA 4O18A 1NM9A 1C93A 4OBTA 2E77A 1DV7A 1JIBA 2ALDA 1XD1A 4LCRA 3WYZA 1F76A 2ODOA 2C13A 4TTGA 4NG3A 1XM3A 3R2GA 3KDOA 3MSDA 4NILA 4U4MA 4ADSA 3QR0A 1AH4A 4B4FA 3L23A 4ZO8A 2ZX5A 4PTDA 5T26A 2RJHA 4AEEA 1TJ2A 1GUVA 2R14A 2WO5A 3KBVA 2E6YA 5HMSA 2ZA3A 5I7GA 3VU2A 3U2OA 5A6JA 1ESWA 4K68A 4DJFA 2NV9A 1UD5A 3BLDA 4XAZA 1SW7A 3GG7A 1IEVA 1HVQA 3IVTA 1XRSA 1CENA 2I7GA 4BEUA 3R43A 2OZTA 1RQEA 2VEGA 4K8EA 1CT5A 4AZIA 3SGGA 2YL6A 3A3XA 5RUBA 2OSYA 2QJJA 3B0YA 3GHTA 2C8NA 3HOJA 4AWUA 3ZFHA 4RE3A 3L2IA 3URBA 2JE8A 4WY0B 7A3HA 3OW1A 3HV8A 1XLMA 4UMBA 2XH0A 1LT8A 4UXDA 1FWGC 5EU9A 3KWXA 4GLEA 1ML1A 3B8UA 4S2BA 2XVPA 4YMZA 3TYEA 4DUVA 3HFYA 2YXGA 3O6YX 2P0IA 3NFUA 3DENA 3NO3A 4HN4A 2CBJA 1XH0A 2J79A 3IJ6A 3VMNA 3U7VA 4S3AA 1UKSA 1T5AA 2DFAA 1UP0A 4IFKA 2DZXA 4CEUC 3VKJA 1NDVA 2NWSA 1LM1A 1ZBWA 4B91A 1XS2A 1G4PA 1RD6A 1R5YA 1XIFA 3M47A 5I3DA 1Z41A 4M56A 1PIIA 4MVAA 2ZVRA 1HL9A 2F9RA 3PZIA 4O28A 3P0XA 3DC0A 1HNYA 3KW3A 3IK2A 1R3TA 4MDPA 1R2SA 3VCRA 2BVWA 2DZWA 4A3UA 4GQRA 1JRBA 4H8NA 3HPZA 1B9BA 5GJMA 4MTVA 4AC7C 2IXVA 4JQ1A 3VOJA 4MNMA 2EPKX 4M6QA 4US5A 1XBVA 3BURA 3VD9A 2HVMA 7CGTA 1FFQA 1Z89A 2HBXA 4RDYA 3VZYA 3TFXA 1PWLA 4MKNA 3VNKA 3TZNA 5JIPA 1RY8A 4IMFA 2GGIA 1ICPA 4M51A 3FEQA 2DORA 4GY7A 4UZSA 1ZGDA 3LCGA 5LKYA 3USZA 1BXCA 7ENLA 2H8XA 4J5NA 1QI3A 4M0XA 2NXHA 2ZCGA 4KWUA 4GIEA 4L4MA 3L0KA 3DFTA 1KM3A 2PBGA 1ISYA 1I2OA 4JIEA 3LMYA 1FHLA 2CNCA 5F7UA 3RLGA 1WDSA 3S9IA 1W56A 3GW0A 3F2BA 2ZRVA 1QNSA 3I3DA 2CLLA 2NT0A 4QG9A 3F4WA 4KBXA 2RDWA 5HK4A 4PRWA 1FWCC 5BRPA 3VNZA 4FS9A 3PSVA 3TXVA 4B5WA 3WQ8A 2TSYA 3GKFA 1MZHA 3CZLA 1QNRA 4XD5A 2SFPA 3LB0A 1Q65A 3BE7A 1EC9A 1FWHC 3GHUA 1H4PA 3H24A 5FI8A 4IPIA 5FJIA 1HTIA 1EOKA 1Y8BA 3FCPA 3VIKA 1VKFA 4YLWA 5E93A 2XTKA 2HVNA 2ZRYA 4JAWA 3NZRA 1B57A 4HA4A 3GU1A 4AF0A 3QKEA 3URAA 4FALA 3I65A 5U7SA 4EF9A 1LJYA 2WHJA 4UIOA 1UA3A 2J66A 1PTGA 1HJSA 3EPMA 4PEKA 1A4MA 3C8FA 4YIWA 3SY8A 1Q6LA 1R0MA 3PZNA 4XISA 4GYJA 1EO7A 3FVMA 3O07A 1VJIA 2UY2A 2YDAA 4UTFA 1OYBA 2JEPA 1V0NA 4L9ZA 3GAKA 4C6BA 1HKJA 3CUZA 2OLHA 3O9NA 3TJIA 1XF0A 1WYIA 2Z26A 1ISXA 4O13A 4X9YA 1WZMA 3RUBL 5DRCA 1UKOA 3GVRA 3U5YA 1V3LA 3B9OA 2Z1SA 4LEFA 2XN0A 4FX6M 4C5YA 3G0SA 5CPMA 3APYA 3GS6A 3M7SA 5PTDA 1ZFJA 3WLTA 1IEWA 4BQ4A 3GG1A 3VC5A 3IV3A 3WH9A 3ARVA 5D30A 3G6MA 4CNNA 2PEVA 3GQYA 1ZJAA 2YKKA 4NU7A 4JYFA 1RALA 4NX0A 5CQ1A 3GBDA 4GGBA 3LGDA 3LRKA 3MO7A 4XQ6A 4CQCA 1XI3A 3N1AA 2PFHA 4E38A 4TV5A 3IAQA 2O0TA 2IKHA 4C6FA 1V7AA 2CESA 1BLIA 3UZXA 1OBAA 2XH4A 2I5GA 6ENLA 3FLUA 4IP7A 1Q7ZA 1EF3A 1YPFA 4F9DA 1WB0A 5MKGB 3WFAA 3EEGA 4BI5A 4H1ZA 3W2KA 3MUY1 4IH3A 2RDXA 2WMKA 2XIBA 2FGBA 3ZT5A 1DYSA 3TX9A 4WXYA 1BGGA 3VDBA 1OCJA 2BVDA 1EJSC 2IPGA 1XLLA 1SFLA 3R6IA 3GXDA 1DQXA 4OV9A 1LUCB 1ONRA 2NV2A 4GWEA 2QUMA 3QC0A 1UUOA 3W7OA 3FYOA 2YIHA 5A6AA 1CECA 1YDVA 3RPTA 2ISDA 1E4IA 3UVIA 4Y90A 1CX9A 4XZIA 1VS1A 5AHEA 3CTLA 2FHFA 2WKJA 4ZOEA 3RF9A 2W92A 3EDJA 3W6LA 1H7RA 3DI0A 3F1QA 3GFYA 4KEUA 3MSYA 3N04A 2IPFA 4CU8A 4CD8A 3O6CA 1XR2A 2QCMA 5AC5A 3S3GA 5JBEA 2JF6A 4IJCA 3KUMA 2NX1A 3MBFA 1JUEA 2HJPA 2FPTA 4B5TA 3NPWA 1UP3A 3G1YA 1A3XA 4Z17A 5EMMA 5I0DA 4WOZA 1T8XA 5EB8A 4E8CA 2G5WA 3M16A 4FX8A 3A4AA 4Z2IA 3I4KA 1D8WA 3CQ0A 4Z42C 4GY1A 4PMQA 1QOPA 4K8GA 3H22A 3PTMA 1SR9A 1JDFA 3F5JA 1YXYA 2Y8VA 4F2BA 3C0QA 4I9MA 2CBUA 2VUYA 4PC8A 4Y2WA 1W8GA 2D23A 2LLEA 1EEXA 4EX4A 1HKMA 3CAWA 3ERPA 4NUWA 1VJSA 1E6SM 5I3KA 4J7RA 3ID7A 3ELFA 1EYWA 4B5UA 3PJTA 1KO0A 3IACA 1X6LA 3R10A 3I3EA 3CHDA 2VWTA 3O6AA 1X38A 4HOXA 3G2GA 5BOOA 1ENUA 2BMBA 2XIQA 3RNDA 1UD3A 4C6NA 2WBGA 3SCTA 1JQXA 1NFPA 3K5XA 2CIPA 4JTGA 5CZTA 3SN0A 1XLKA 3CWOX 3TDFA 4XAFA 1OIMA 4HU4A 3QBUA 3L5MA 1U33A 3N18A 1ZJIA 3CMJA 1MDRA 3MZ2A 4LAOA 4HQVA 3T0TA 4D6EA 3LY0A 3LHWA 2NQZA 2V5LA 3CEUA 4GXMA 3K13A 2WVUA 1VBJA 1T8QA 4JNMA 5B7YA 1UMLA 3KXQA 3GVGA 2ZX6A 1VBHA 2EPHA 4H7VA 4DBSA 3U2CA 3VIGA 2CLMA 1OGSA 4KEVA 1I2QA 4W84A 4JTLA 1AJ2A 3PWAA 2YFOA 5JMUA 4C65A 4H04A 3ES8A 1WZAA 3WLNA 3ZWTA 1V3IA 3RPDA 3W7KA 3GK0A 5EMLA 1FVPA 4ILSA 3NQDA 2YLLA 3B8WA 3LSCA 3WH5A 2VI0A 1E6PA 2QUUA 4G8TA 2GOUA 7TIMA 3B9AA 4GUFA 1NFBA 4GJIA 1WOBA 2R82A 3BPWA 1AODA 3XIMA 4ML9A 2FPYA 1J0HA 1TPDA 3GG8A 3A3WA 3G1SA 1RQBA 3RGTA 1OD8A 3MSRA 4AVFA 3WEZA 3F4VA 2ZOXA 3CV1A 3PWGA 4JX4A 4GI9A 4ADUA 1T99A 1CZ1A 1KBKA 3WLSA 3KAOA 1P1MA 2UV8G 3GH7A 1RPXA 2VD8A 3N2BA 4JTHA 1RAKA 3HQPA 3UNTA 1B4KA 2EG8A 3APGA 1VENA 4CGTA 4QG8A 4RZ6A 4DYJA 1LRTA 4RL3A 2V69A 3A5FA 5IXEA 2BVYA 2UY4A 3QFWA 3PN8A 3WD4A 1FH7A 3ZSSA 1QAPA 5FF7A 2DZSA 1V0LA 3U9IA 4TX8A 4PRTA 1I2PA 4Z1YA 2C79A 2VGGA 4PMRA 4B9ZA 3DFSA 4EKJA 1GG0A 1W9DM 2NLIA 4PL2A 4DUOA 4P7RA 4UTLA 2A6LA 1HVXA 3H2OA 2QDGA 3PG9A 3UA3A 1WBJA 4KCWA 5TBOA 4LTSA 4MKVA 1A0DA 3MP4A 3IIPA 4PR4A 1C29A 5A95A 4JNZA 4HHMA 5U4NA 5HWNA 3EA2A 3SZ8A 2QT3A 4DXKA 1EWEA 1AL8A 4BI6A 1OVDA 3LX9A 2E5DA 1FWRA 2XIOA 3I3BA 3OZMA 1PCKA 4R34A 1RCQA 2CKSA 1JZ6A 4GH1A 1YMYA 4NX5A 2QJNA 5REQA 1XWYA 3E12A 3VX1A 1IV8A 3C2RA 5D38A 4F0RA 1H11A 3SI9A 3RXZA 1QNQA 3VKDA 3W24A 3UYCA 3MP3A 4HA0A 3AS1A 4M1RA 2DUXA 1FWSA 3GFZA 1Q7QA 3W75A 3WH7A 1PO9A 2OWCA 2WHLA 3NQFA 1KLZA 1CNVA 2WCAA 2XUCA 1H3GA 4N6EA 2OG9A 2C19A 2A21A 3OZPA 1KRBC 1GONA 1MO0A 2QKFA 4CU6A 3UZYA 3N9RA 1LL7A 4PN2A 3W1NA 3VFCA 2A1YA 3WQ5A 4NRSA 1NWTA 1IXNA 2C1IA 2OODA 3KTCA 1FH9A 4P8XA 4HK5A 3DAQA 2ISVA 3ZJ8A 3M4HA 3BLOA 1KKOA 2E7FA 4FR6A 4ENLA 5LA0A 3V0UA 2CZEA 3FA3A 3IJ9A 3L4WA 4NIRA 3HMJG 3W0KA 1R9XA 4RE4A 1ODZA 4PCTA 4Z2KA 3TTEA 3W7PA 8TIMA 1QK2A 5E1QA 1LORA 3GXMA 4HA1A 4MM1A 1B90A 2C91A 2HRWA 2V2CA 3O0KA 3C4UA 3SRHA 4N02A 3V36A 2FKPA 4JD4A 1CTNA 4IPPA 1JUKA 4V15A 1UJPA 2C1HA 2D2OA 2FMNA 2QDEA 3T44A 4JOMA 5BNKA 1L8NA 2YXXA 4MWAE 5CPLA 4CNTA 3VNDA 4IJRA 3VIOA 3T1GA 3BARA 3GTNA 1I6NA 4PFHA 3AMLA 4NNBA 4WHBA 3G3DA 1BSLA 2F38A 1U1HA 3W87A 4XVDA 4F48A 4J3TA 5D37A 3ARQA 2GWNA 3L67A 3VGFA 1M03A 4H8VA 3TJXA 2HQAA 4O19A 3VINA 3KTXA 3S2NA 2ON3A 4OBRA 3CAQA 2QJIA 1B3YA 2VXNA 1FP9A 2FGLA 1F9CA 1R46A 1H60A 4BQ5A 5BCAA 4Z1AA 4D8LA 3N13A 4YTRA 1JZ2A 5H8MA 2GUYA 4HPXA 1I4NA 3GHRA 4UTUA 1MW2A 3CH9A 3WUGA 4JTSA 4AIUA 5C0QA 3D3FA 4QSFA 4R27A 2VOMA 4HU8A 7ODCA 1F6YA 3OU8A 3VMPA 3WQFA 3NOEA 4G1KA 3NZ1A 4Q22A 2DSWA 1GVYA 5CSUA 3N2TA 3DESA 4JPGA 1JFXA 2WC4A 1XQKA 3LA4A 4ROPA 4IFKB 2J7EA 5C8BB 1E0XA 3M0JA 3C2OA 5AECA 3NSXA 4PUJA 4UFKA 1BG4A 1EQCA 4M6PA 5DEZA 1O94A 3ZT6A 1KFJA 3KFTA 4BQ2A 1F3XA 3ONBA 2YW3A 2GJRA 3KOWA 3QGVA 3TEVA 3OGRA 1BXNA 1RR2A 2VTFA 4F40A 4J4KA 2TYSA 1R30A 2WNZA 5D9MA 1OX5A 2FZMA 4NNCA 1F73A 1FCVA 4JNYA 3W88A 1IGWA 4FNPA 1XG4A 2V5JA 4LYRA 2WM1A 4DPPA 3PS7A 3WCZA 5MKGA 1PDZA 4NJJA 2YPIA 4R3UA 4RDWA 3NQGA 3MUIA 1JF6A 1TPUA 5IHSA 3GIPA 5B7ZA 1SFJA 4ZQRA 5IBXC 1KNWA 2NSXA 2PWFA 1GNXA 4OZOA 1I45A 1R87A 2X42A 3IAPA 3S2JA 3L5LA 2R6OA 4MWAC 1VF8A 1W9BM 4GI4A 5KETA 4UC5A 2Y63A 2ZRWA 2H9AB 3L2LA 3EOEA 3TN5A 2GZXA 1XGZA 4LYPA 2QIWA 4N9EA 3WDJA 4DWSA 3VNLA 2H9AA 4B2DA 2QDDA 1DJXA 3F5KA 1C8YA 4O57A 1IE7C 1OFQA 3QSRA 3V5OA 4OVXA 2Z25A 4QXIA 2GQAA 3M0KA 3L4UA 3OEXA 3EA1A 3VE7A 2OX4A 4H2CA 2PTDA 2VC9A 1ZZMA 1UIPA 3S47A 1LL4A 2ZKMX 1LROA 1GQIA 1HFBA 4M8UA 3W9ZA 3MV11 5FESA 1UWRA 1HIZA 3GR7A 1A5UA 4B90A 3H55A 3N3TA 2XFYA 1ZL1A 4NI3A 3NL6A 3M41A 1VR6A 1EPXA 2YCKX 2WBKA 3BAYA 3WFLA 3WD2A 4E8GA 2WXDM 2XVKA 4AAJA 4L61A 3T40A 3ZR5A 3C8NA 3S2MA 3ZQ9A 1N55A 1CXLA 1WZLA 1E5JA 2GFTA 4GVHA 4WGXA 2BY1A 4UTKA 1P1XA 3DG7A 4EPBC 1QHZA 2V82A 3KDNA 3SUTA 3THCA 1POJA 2CPUA 4EOUA 4GO8A 2HNHA 1UR4A 3QZEA 5LGZA 5T9BG 2WKGA 3EXTA 1HX0A 1HJQA 3SAZA 2NVAA 1SUXA 4NAEA 3NSMA 1P6CA 3E0FA 4G56A 1W9PA 3CQKA 1ZCCA 3UJ2A 1OC7A 4AIOA 4XG1A 3WD0A 2FDSA 3VNYA 2Y7EA 1GKRA 4J9JA 2CETA 1QT1A 2B7NA 4F66A 3FIGA 1GVFA 1B3OA 3BAKA 4I6VA 4AY8A 5DMLA 3REQA 3QJAA 3WD3A 1TV5A 2IXUA 5HR6A 3W1LA 4UTWC 1JZ5A 3A5VA 3ITVA 1NFGA 3EB3A 5C5YA 4ZEPA 1LYXA 4KEMA 2CHRA 3EDKA 2PUZA 2WKLA 4HIBA 3QGKC 2Z1BA 2P3EA 2Y7DA 3SUVA 4MAZA 3KEHA 3BOLA 2E0PA 3PTKA 4FMVA 3WDIA 1EA9C 3G8RA 3WBXA 5CH9A 3DFYA 1YX1A 2CLOA 3A64A 3ZOAA 2DSKA 3EBVA 3H4GA 3BZGA 1PB0A 5AVHA 2EF9A 4AU0A 1UR9A 5CJMA 3WBYA 2BHZA 4AEFA 1WOAA 2F7FA 2R1LA 4K37A 2D2GA 4Q32A 3NPUA 1H5YA 4NKCA 1TPC1 1RXOB 1ZB5A 2PDBA 2OX1A 1S3TC 3M0ZA 1PTAA 5J5DA 3AIVA 3WUEA 3EPOA 4U2YA 3RJYA 1G7UA 4JS3A 1B3ZA 1DJWA 2INZA 3M5XA 1TZ9A 1JG9A 3VOIA 4TUFA 3UG5A 2OO6A 3BMWA 4OWGA 3CTTA 3CBWA 4O50A 4YVVA 2XH2A 3TSBA 1A4LA 2I57A 2ADAA 2WZMA 2NQ5A 2ZRZA 5EPDA 4I7WA 1TZ7A 1QI5A 1N8WA 5LYRA 4K8HA 4HTYA 1OQFA 4LNYA 3KBWA 4UBPC 4KCTA 4FXJA 1E15A 3IIVA 2V3FA 4A22A 4GCXA 3KVMA 2DVTA 3B8IA 4W5ZA 2DUAA 5CZKA 4FI4A 5H2ZA 3DC8A 5KEZA 1YBQA 2RJGA 2ABAA 3PK7A 3G1DA 4DBUA 3FAWA 4F79A 5HR7A 1IEIA 2O9TA 1K9FA 3GNDA 1PKMA 2D24A 1RCXB 5A8MA 1QRQA 3GDBA 3AHYA 2VJXA 4Z0SA 4GGHA 1JPHA 1UR1A 3MTWA 2E09A 4Q4SA 2ABBA 4IIFA 1GOWA 4PMJA 1JPDX 1DJYA 3ITTA 3HF3A 1R8LA 2PRHA 3ATZA 3KOYA 5FAGA 3E0LA 5A3HA 1JDDA 2WM0A 1TCDA 3GRIA 3EOLA 3RO8A 3W38A 4KFOA 2YDSA 2J77A 4BKNA 5HNUA 4QR6A 3PY2A 3PZVA 4NXSA 4L9YA 2JKPA 3DHDA 4KH2A 4W9TA 4PTWA 4JX5A 2QCDA 5ABEA 3I6TA 3AROA 2CLHA 3GR4A 3LI0A 3EYPA 5F4SA 4B5VA 1PZ1A 3RAOA 1JPMA 4TX9A 4MZ1A 4AIBA 4AW7A 3OBKA 2DW6A 4CNUA 4KESA 1J4EA 5JVLA 3UQNA 3PVFA 3TONA 1T7LA 4AX6A 5ENLA 1Q6DA 5A2BA 5I3FA 2YDQA 5CGMA 1V6WA 5DY3A 6REQB 1VEPA 3S9YA 3AICA 2YZRA 4OKDA 4I5UA 3T55A 3CM4A 4NQ1A 1MI3A 3AIRA 3N4AA 4PTNA 3TWAA 4P2VA 2ZX7A 1JNDA 4XKYB 4DAFA 5D9PA 5CPQA 1IWPA 1Z48A 3AXHA 4ZQMA 1RQHA 4YTSA 3KVLA 4XD3A 4YYCA 2P5NA 2FVLA 3D46A 4P7OA 3DCPA 3E02A 4AMCA 1O1HA 4NYYA 4C7DA 1E3ZA 3GZ3A 4HYWA 1NF0A 3ZM8A 1H1ZA 2OEKA 4JZ5A 4HU3A 2X1TA 4LOCA 3SEPA 3H7RA 3TV8A 3QF0A 5A8PA 2QR6A 1F05A 4KWVA 3LCLA 3UJEA 4PUMA 4ZFCA 2RDTA 5DXYA 1VEOA 2W4XA 4LF2A 1KCXA 2EPNA 4XSMA 2NLYA 3W00A 3H21A 3AMCA 3K46A 1A5MC 1LT7A 1W1TA 5HPCA 1DQWA 2ONEA 2UY5A 4Q7BA 5JU6A 1VFHA 1MVYA 3IWPA 2OEMA 2IS7A 1S2UA 4DI8A 1Q4NX 1XIHA 4XAGA 2PDXA 3SFWA 3N25A 4ML4A 3F4DA 2W3ZA 4PTXA 4A21A 1NWSA 3UG3A 1EJVC 1Z44A 3IUIA 3RILA 2ZUSA 3Q37A 5GNXA 2J7FA 2QUTA 1MYRA 5E6ZA 1YTEA 5CSYA 3E9AA 1KC7A 3W22A 1DJQA 1TVLA 3K8LA 2BFGA 3IIXA 4S3EA 2YCIX 3WF4A 3T8QA 1Q6OA 3ARXA 3GFXA 4JFWA 1UH3A 3LSBA 3M1ZA 3TYCA 2PU0A 2W61A 3PSWA 4QROA 4M1BA 4Y8EA 4HCHA 3LG3A 1OFDA 1HKWA 1A0EA 1MEIA 4O15A 1W1VA 4CNPA 4YXGA 3TCSA 4GC4A 1KV8A 1XYZA 4K38A 1UUMA 3SN4A 4H9VA 3I7RA 4DJDA 5J8LA 1SJAA 2ZICA 1E72M 2KZHA 1NSJA 3GTFA 2DH3A 4JN8A 1UH2A 3UU0A 1UR2A 3N9KA 1RHCA 1ZBKA 2GGHA 2OZ0A 2VP8A 1SJCA 4ERGA 4M3PA 3F03K 2OZ3A 4KIEA 2JKAA 2L5HA 1FTXA 4XZBA 3O2LA 4ZQOA 3C61A 3W83A 2DJXA 4ZA0A 1KR0A 2XN2A 2E1DA 3UG4A 3UZJA 1LZOA 2P0OA 3LRMA 2PWGA 1TO3A 3LTYA 1V0KA 4G5DA 1XYMA 2D0GA 3C3NA 3BTNA 1UBSA 3WLIA 2CXEA 3IGUA 1QWKA 3MMTA 3W2LA 3RIKA 4F0KA 5K4XA 3UETA 1SU5A 3AIBA 1YKWA 2W91A 1UD4A 3E38A 1M3UA 1YE6A 3FGCA 4Q7IA 2I9UA 4H9XA 1RLCL 2OT0A 1FBAA 3CS2A 3A6OA 4MHBA 2X7VA 3KCOA 3ZVIA 2VDIA 2CHNA 1K9TA 1S38A 3VVGA 4IPJA 3LTSA 3I6EA 1EF2A 2P8CA 2J88A 1WDRA 3T2OA 5DBTA 1PXGA 3CAVA 2F8QA 1H62A 1LLWA 3QEZA 1DJHA 4PBGA 3ARZA 5BRBA 5FOOA 1VH7A 2DZVA 2DSZA 5BXPA 3W1TA 3LHYA 5AN7A 1M9HA 3WO8A 2VEPA 3SCRA 4CCCA 3H7VA 1CGUA 3EPNA 4TVUA 1U5HA 3K30A 1YTDA 2C0HA 2VQUA 1HJXA 1G5AA 3V4BA 3MU7A 4QISA 1RJRA 4H8HA 3NM1A 3FDKA 3MO4A 4IT1A 2YL9A 4QX4A 4UFJA 2QDHA 1CBGA 4NAFB 4ZB0A 3R4IA 1XW8A 3I68A 5G1YA 2WLZA 1WDQA 3BOXA 3TA6A 3NYZA 4N6FA 4IOTA 2QV5A 1DWIM 4Q8OA 5KZ6A 4ATLA 2D0HA 1AW1A 3LEPA 4UTHA 2PD5A 2QCGA 3SIMA 2YFNA 4HD5A 4V28A 3WQ6A 5KITA 1FWWA 4E2DA 3MB9A 5I07A 3F7JA 1EP1A 1H7NA 1JGMA 4XBJA 3SRKA 4IX0A 3TOPA 1S2VA 3D0CA 3R8RA 1US2A 1JCXA 2XVGA 1BWKA 3P67A 1YW1A 1XFBA 4JHZA 4WKFA 4MF4A 3M0IA 3WDRA 3P5YA 4KETA 3H7UA 3GD6A 4DELA 2CC0A 1O7AA 2Q8ZA 3VKCA 4HZ6A 4PUEA 3RMEA 3VDHA 4RZ4A 1YDYA 1V3HA 5F4XA 4UNKA 4LAZA 2ZUNA 2G37A 2X1UA 3U6WA 1Q4WA 1J8VA 4QDWA 1QPOA 1E6QM 3NURA 5FKYA 2QQ6A 4AD3A 5HWMA 1QO2A 4DWSC 3LI1A 2Z0IA 1X97A 2FFIA 2PLKA 3WNMA 3OVQA 2ZDRA 1UWIA 4A8LA 3B06A 4XO6A 1NARA 1IEXA 5SWUA 3R8HA 2CKRA 4PMUA 2PURA 3UWEA 4AZBA 4E4UA 4LT9A 3BGGA 2VX6A 3M5ZA 1PEZA 1UOZA 4FF7A 1IGSA 5HULA 3NIYA 3VK5A 1CGVA 1S5VA 2ISFA 2YB4A 1ZAHA 1SMAA 4WK9A 4J3UA 1AQFA 3AIWA 3VOCA 1S5WA 3UXDA 2ESCA 3BC9A 1UKTA 3OLDA 3FHAA 1NU5A 1L6FA 3WFZA 3WLMA 1H7XA 2X30A 1EUAA 4JFTA 5HQLA 1XYBA 1J01A 1ZJBA 1V02E 3OIHA 2D0FA 4I8YA 3OZYA 4QAWA 1HKVA 1HP5A 1PTDA 3NR0A 4D9PA 3QTPA 2EGZA 1CXEA 3GNXA 1UC4A 4Q6JA 2YJQA 5LIYX 1GQJA 1F2JA 1GT8A 4LVGA 2GWGA 3U48A 4OFCA 3G5EA 3PBUA 5FF2A 4IISA 1ALDA 1QWGA 3MS8A 4QAIA 5DANA 4MFDA 1BRLA 5DX7A 1XH1A 4HHHA 3AYTA 4TV6A 4WKHA 4EWND 3SCOA 1KV5A 2ACUA 5E0KA 3LXCA 3B4UA 4F9JA 4QDMA 4GZ7A 1O1ZA 5MF5A 5EYWA 1K03A 2TMDA 3B0XA 1NDYA 2V2DA 3MANA 3C2VA 5C6MA 2VR2A 1DQUA 4X0NA 2DIKA 1TUFA 1KB3A 5CC3A 4I90A 1BWVA 4JYEA 3KRZA 1KM6A 2C1GA 1P6WA 4KFPA 4J2MA 3I7SA 4Y6GA 3RU6A 5D09A 3VNJA 4YTUA 3GH5A 4DF2A 3Q2DA 1XYLA 3ZR4A 1S39A 5D03A 2V5KA 2DW7A 4GYFA 3QHMA 3FEMA 3WK2A 3U57A 1V51A 4Q4OA 1GHRA 4LUSB 4J28A 4PMDA 4G2DA 3W6YA 3CB8A 3CYVA 2NQHA 4AZCA 1CLVA 2XIJA 1I2NA 1GJWA 1X8CA 5C9RA 3PB0A 1OADA 1E55A 4F2UA 1EJRC 1DL3A 1W31A 1WZKA 4ICNA 3R25A 4NZFA 2X09A 3LZ3A 3MI2A 3MJMA 1A0CA 3GC5A 3SSJA 3R5EA 4D6DA 1IT8A 1A49A 4GX8A 4XUYA 4WY0A 3PZTA 3RN6A 1ITXA 4UFHA 1REQB 4IMCA 3N9SA 4CN1A 5LZLA 1TFVA 2NXIA 3CUIA 2WNNA 1QW9A 3GXTA 3SGZA 4AY1A 4DAIA 3L7RA 2P1FA 5CZSA 4AZ5A 4I9TA 4GKLA 2BS9A 3WJSA 3BMVA 1TRDA 2WZIA 4AZ6A 3KHJA 3VMOA 2FFCA 4E4PA 2DDXA 4TR9A 1QDSA 1XLFA 1DIEA 1F4AA 4YU1A 2HE8A 2VNCA 2GQ3A 1W5QA 3H4WA 1TMLA 3BV4A 3VE9A 1FWAC 1XBYA 1WDPA 4AEOA 4ZB2A 3AWOA 3BSMA 1W3LA 4UFIA 2AGKA 3AJ7A 4LCSA 3VX0A 7REQA 2JIEA 4YCPA 2CLEA 4H00A 4FEZA 1JGIA 2B7QA 4PCPA 3W53A 2GK1A 1BKHA 1ZQ5A 3GTXA 1TV7A 2NZLA 1E6ZA 1I8JA 1XV8A 3P2VA 5AHNA 1DPMA 4HK6A 3THQA 3ITCA 4K3ZA 4AH7A 1CWYA 4MB4A 1DE6A 1TJ1A 1LRNA 4A8NA 3SJNA 3PZQA 2XISA 3CU2A 4HPGA 2GOKA 1ICSA 4QJ4B 2ZVIA 1A3WA 5AKQA 1R6WA 4DZ5A 1TMQA 1MRAA 3LHVA 3R12A 3F2DA 4PTMA 3C2EA 3KLKA 4PUUA 5FJJA 1QTWA 5AOUA 1UH4A 3UZZA 2CLKA 5G2WA 1CGTA 4O0QA 3Q45A 2WVSA 3LV6A 3PPFA 3H26A 2C14A 1EQPA 2NQJA 1RK6A 4FNQA 3BJSA 3OOQA 1ZRQA 4M24A 3MWAA 3GWQA 2EBNA 3W7IA 3GTIA 5L6UA 3DUGA 2PD9A 1V7YA 4GKTA 4A2RA 4DBDA 2Y61A 2YR1A 5DT7A 2WJEA 2VYOA 3AS3A 4QTGA 3CT2A 5J5RA 1TWWA 4G7EB 3PBWA 1V6XA 3HQOA 4WJ8A 1K8CA 1XYCA 4XIMA 3B3DA 8XIMA 3H6OA 2KAUC 4B3KA 3ANVA 1V08A 3MVTA 3OLIA 4BF5A 5CGQA 4O53A 3CUJA 3MY9A 3HM7A 5A8QA 4L7ZA 3PBVA 1M04A 4D6JA 4PULA 3W25A 1TVPA 1TWDA 4LVAA 2GGGA 2VKZG 2GVLA 3PG8A 4MOZA 1ME7A 1GJUA 5AZ1A 3DIPA 4JR5A 1KFWA 2OSWA 1AQHA 2GUBA 1TPEA 6XIMA 1ITCA 4RV8A 2HK1A 3ABZA