3NQ8A

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r4 8/5a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
247
structure length
246
Chain Sequence
LKASSLRALKLMHLATSANDDTDENVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADYIVTSTGKVAVGATPESARIMMEVIRDMGVENTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASGSLLASLLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 99
structure length 246
sequence length 247
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nq8A00
3TNOA 2BX7A 3QQ0A 4OE7A 5LGXA 3QF0A 1OK4A 4FNRA 2Y7GA 3L9CA 1HL2A 4JTTA 4PFMA 4IWWA 3QPZA 4ORMA 5T26A 4Z0JA 1I2OA 1OFDA 2JGQA 2GQ9A 4UMBA 2NWRA 4UNKA 2QCNA 1AG1O 1JCLA 3NQDA 4G1KA 5C2XA 3FJ6A 4YWIA 5E0KA 1TB3A 3QC3A 4H6KA 3KRUA 5LNSA 3P7YA 2A1YA 3TKFA 2B7PA 1W8SA 4C1KA 3PUEA 1ICSA 3GNNA 4O16A 2D73A 5DELA 3PUOA 6TIMA 2VFIA 3P74A 3N2XA 4RV8A 3NL6A 1P5BA 3TW7A 2TSYA 4O52A 3PR2A 3NL3A 5EMUA 5D03A 2B4GA 3PVFA 2DZPA 2NXGA 4Z08A 1OX6A 4E2BA 1Q6RA 3R89A 2CFFA 3LCFA 3RF9A 1DL3A 3W88A 3S1UA 3HPZA 3TJLA 1GQNA 1J2WA 3I7SA 3STEA 3G1YA 1W56A 1B3OA 4HN4A 3NZRA 4K38A 2VOMA 3A5VA 3ATYA 3UPBA 3IGXA 4JDYA 4LVBA 5EKYA 1UUMA 5AC8A 5BNKA 2VKZG 4LVGA 1GOXA 4BWLA 3T7VA 4DPPA 4BWLC 5TBOA 3C2OA 1TYGA 4OGZA 3P82A 4MZ1A 2E5BA 4I7VA 6ALDA 1ALDA 4HHPA 4K6AA 5AHMA 1W5NA 3HJZA 3O6YX 1JULA 3W2MA 2A6NA 1W1ZA 3G18A 5LNRA 4HT3A 1HG3A 4AVFA 2WNZA 1SZEA 4Q33A 1RV8A 1WAUA 1LRNA 1FCBA 4P2VA 3C0JA 1WA3A 3CHVA 2YXGA 4MJZA 4QNWA 1R2RA 1ZAIA 1QAPA 1VHCA 1DQWA 1VCGA 4LTSA 1D3GA 3W2LA 3B03A 3UWVA 4U28A 2ZRYA 3FYOA 4DF1A 5CZ0A 2I1OA 1LLWA 4MVAA 2X30A 3V1PA 3LV6A 3RU6A 3OEXA 3IVUA 1GEQA 3DI1A 2Q3RA 1ZAJA 3IIVA 4LV4A 4K36A 1XXXA 2X1SA 4PC8A 5K4ZA 1LROA 2YGYA 3NM3A 3GK0A 2ZCGA 2NV2A 3OVPA 3B4UA 2X1RA 2C16A 4Z1DA 1TPEA 2RDTA 1FWWA 3N9SA 4JTLA 4A29A 3TAKA 1JUBA 3W2NA 1QPRA 1KFCA 1NF7A 3R8RA 4HNTA 5KZMA 4FNPA 2GPTA 2GUUA 3W70A 3NEVA 3TSMA 2CLEA 3A22A 1DORA 3P84A 2TPSA 2V9DA 3L0KA 4EF9A 2VEMA 3GKFA 2OJPA 3IIOA 2G96A 2QCDA 3LTYA 3UWZA 3EX2A 1I2RA 3G1VA 2V82A 3HBLA 3NQEA 4YCOA 3W75A 5LZLA 5FF7A 3ZFHA 1VYRA 2CZDA 1KV8A 1OFEA 4E38A 3EX6A 2EPHA 4JX5A 4MZYA 3CM4A 4O1BA 3LRLA 2WV8A 2CLMA 3SI9A 1YDVA 5DBUA 5F4WA 2DZVA 4JIPA 2A0NA 1W54A 4JTSA 4GUJA 1M6JA 4UTMA 2DORA 1KLYA 1ZCOA 3CC1A 5KZEA 1K7EA 1SFLA 1CW2A 3R2GA 2JBMA 3H54A 1LP6A 2WO5A 2E5CA 2YFOA 2RDWA 3O05A 3WJXA 3TQ0A 3HG2A 3NGJA 2WKJA 3TX9A 2Q8LA 3E12A 5EL1A 3PBUA 2CZEA 1LRTA 5D05A 1EUNA 4MZ8A 2EAWA 5CSRA 1ADOA 4FO4A 1O94A 1OX4A 3DXIA 3A24A 4S1FA 3QEZA 1KM3A 3AJXA 3QJAA 2DZSA 3T44A 3W7LA 1W0MA 4M7TA 4I7UA 4ADUA 2FJKA 2OT0A 2O7QA 3W7IA 4LV9A 3T55A 1XL9A 1Q6QA 3THAA 5MHBA 3HO8A 4UTKA 3SGZA 4NX0A 2R14A 3W71A 1RQEA 4GFSA 3P81A 2E1DA 2WQPA 1QPNA 2V81A 3W7MA 1NF0A 2WPBA 5I3GA 3FIGA 3QSRA 4O28A 4JTKA 2X1TA 1PL9A 1H1YA 1P0KA 3RMJA 4DO6A 3N2MA 4UFIA 5CPLA 5FF0A 1SUXA 1RZMA 4POCA 3YPIA 5U4NA 4O1AA 3BGGA 1AL8A 1O95A 3IEBA 4AEOA 4E0CA 3DI0A 2ZZ7A 1IXQA 3EX3A 4IJBA 4OV9A 3TFXA 3LI0A 4UFMA 3MMTA 3DFOA 3CT7A 1QOPA 3TK7A 1KBJA 4JIQA 4LU0A 2G5WA 1WOBA 3I65A 2GVGA 4TIMA 1ME7A 1WQ5A 4O1DA 4E2DA 3S1WA 3T40A 4UTLA 3W83A 5BMWA 2C1HA 2NV1A 2PC4A 2PRMA 4LRTA 2Y63A 3QMSA 3H53A 4UUIA 4UFKA 1Q6LA 1SSGA 3G0XA 4BK9A 4GUFA 3E96A 3P8IA 3Q58A 3QSTA 3EWUA 3TUUA 1QDSA 3Q94A 3GAKA 1RQBA 1THFD 1XFBA 2RDUA 1EB3A 2J9XA 4UTTA 2CZ5A 1OYAA 1Z48A 2C6QA 2QCDB 2HS6A 1UUOA 1H5YA 2F84A 4XTIA 2Q8ZA 3LOTA 1DV7A 1GVFA 4RZ5A 3N73A 2LLEA 2ZRXA 4UTIA 5I3JA 3A5FA 4IMCA 3W7DA 1OK6A 2B7QA 3AO0A 1SW0A 5I3IA 3KRZA 2A85A 4FB7A 3M16A 3W1TA 1JCMP 3W1UA 4XKYA 2NXIA 2BWGA 4X22A 3O6DA 3L67A 1LLZA 1H7NA 4HKPA 1BTMA 1GTEA 4K8HA 4QSHA 1TO3A 3P5YA 1TPFA 1L6WA 4LW7A 1EIXA 5HWMA 3O6CA 3GVGA 5IM51 4J9JA 1HFBA 1OX5A 3T4CA 2V2CA 5FESA 4GC4A 1V5XA 3S0CA 3RLUA 3IV3A 2OMAA 2BSLA 4JTIA 3LHYA 3W7HA 3TMQA 3DFTA 3BK0A 1VQTA 4M5PA 3W1MA 1M7PA 4ZVJA 4A22A 2Z6IA 4M19A 5CKSA 1VPXA 3DBPA 3GX9A 2QCMA 4NJIA 2B0MA 5F2IA 3O16A 1T0OA 1ZENA 3G1DA 1T8XA 2G97A 1WOAA 1OX4B 2QDHA 3LHVA 3M43A 5HR6A 5K2ZA 1TIMA 2X1UA 2Y61A 2NXHA 4R33A 2YSWA 3QW4B 1FY6A 1KA9F 3IGUA 1IF2A 4JY8A 3WK3A 2H3BA 5AC7A 2FPVA 4GXMA 4S2BA 3STGA 1KTBA 1DVJA 2O7SA 1LOLA 4WOZA 1PS9A 4M6PA 1S3HA 4KWVA 3NA8A 3VI2A 5CZTA 3O8AA 4GBUA 3UWQA 3LRKA 3W23A 5LNUA 1V7YA 4LUJA 1LRQA 4JTFA 1TTPA 1TV8A 3QZEA 1EP3A 3F1QA 4WOQA 3WJSA 1BWKA 2GOUA 3LCIA 1GZGA 2PCQA 2ZBTA 2ABAA 3DZ1A 5FEZA 4YLWA 3IVSA 5LSMA 3E9AA 3PUDA 1FWTA 1GVQA 1VGAA 5F2GA 5DCEA 1M5WA 1KFBA 5H2ZA 1G4EA 3W22A 3FA5A 2VEPA 4MYXA 4NNBA 2FTPA 1YDNA 3PS7A 1R47A 3EWZA 3OVQA 3LHTA 5D38A 2C15A 3C8FA 1RVGA 4FXSA 1K3UA 3EWYA 4WQ6A 3W9ZA 3DGRA 3BLIA 1OFPA 1WYIA 3LCHA 1S5VA 1UBSA 3LB0A 4JYFA 5DY2A 3WJWA 3W1AA 5F2MA 3G8RA 3S6DA 4EIVA 1K8YA 3W86A 3BLEA 4RXGA 2J6XA 5AOUA 3WK0A 3HPXA 4XKYB 3GDKA 3QYQA 1VS1A 3MBFA 4LVAA 3EB2A 2H90A 1DBTA 1IXNA 3WK1A 2VFDA 1IXPA 3GZ3A 2QCFA 3G24A 4RX0A 2QUVA 2A2IA 3DFPA 4XTDA 1N7KA 4BI6A 3LBCA 4ZQMA 3GXNA 3R13A 1TV7A 4AB4A 1TMHA 2XN1A 4O17A 2R94A 4GUHA 4N9DA 1AK5A 3I7QA 5D32A 3P60A 3QW3A 3NQGA 1QFEA 2X16A 1MEHA 4AMAA 2JKAA 4N2YA 2ZRUA 3E0IA 3MYPA 5AYXA 1GVOA 1QMLA 3BG5A 4PTNA 4DO4A 4TMCA 1XDMA 3NYZA 4IMGA 4PH6A 5FI8A 2FB2A 3LGEA 4Z1AA 1R30A 1LM1A 4O13A 3TC7A 1FWSA 2EHHA 1LBMA 4RZ4A 2C19A 3CU2A 1GYLA 2OX1A 1OF8A 4QJ1A 4UTWA 5HQEA 2VFFA 3BG3A 2FQIA 2NZLA 3NQ6A 3M44A 1H51A 3IIZA 1OFAA 4IX0A 3USBA 1FCUA 8TIMA 3DU0A 3N34A 3I6RA 4Q4KA 3GXTA 3ABQA 3KHJA 5KZDA 3L65A 1S5TA 2E6YA 4AWUA 3W7KA 1SW3A 1EEPA 1B4KA 2PRLA 1WBJA 5HWJA 3W74A 1R2TA 5LNWA 4MLJA 1ME9A 4UFLA 2J27A 3CB8A 3BW3A 3PY2A 3KAOA 5CZJA 1YLVA 4XWUA 1HO4A 3P80A 1LTDA 3L2IA 3LX9A 4JS3A 3UNDA 1W31A 2A6LA 2ZYFA 3KOFA 4X3ZA 3D0CA 2ZZ5A 5HR7A 3KVLA 3SECA 1VCFA 4Y6GA 1W5MA 3QRHA 3JR2A 1SQ7A 3VFLA 2H3DA 4AF0A 1JJKA 4HNUA 3CLMA 1O5XA 4A21A 2QUTA 2ZA3A 4MFDA 1HTIA 1J4EA 1HUVA 4JYEA 4ZZ9A 2V30A 2PRHA 3QMTA 4IPIA 1P0NA 1X1ZA 2XN0A 4UCGA 5BW6A 3LCLA 3CWOX 3QH2A 2Y7EA 1LBLA 1S5WA 3PSVA 3LCWA 3W85A 3O15A 4W9TA 5EY5A 5IBXA 2C0AA 2Y62A 1KFJA 2WJZA 4UFHA 1KFEA 4OWGA 3HG4A 3R12A 3MP4A 4HNNA 2CZFA 4IX2A 1MSSA 5TQLA 2QCGA 5DCBA 3NPUA 3W7QA 1B57A 4NVTA 3PSWA 4GNJA 4UMCA 4JGDA 4WXYA 4MLRA 1WBHA 4PEKA 1VCVA 1YXYA 4IUOA 1G4TA 2QAPA 2H8XA 5GVJA 2E77A 4QNEA 3W3OA 4JTHA 1G69A 3C3NA 5K9CA 1OYBA 1ML1A 3EXRA 2B7NA 2JKPA 3CWNA 3M5ZA 1CI1A 2QCEA 3QQ1A 3OBKA 3C2RA 3BLFA 3IGSA 4N4QA 1NSJA 2NUXA 5D2VA 3GDRA 3CTLA 3HGJA 1T99A 3NL2A 3HIJA 3LCGA 3G1FA 3I68A 2A7NA 1EP2A 2UV8G 1FX6A 4WJEA 3NQAA 3TIMA 3BG9A 4O0ZA 4CLMA 3ABRA 1SR9A 2QCCA 2YYUA 3FOKA 3C56A 2C3ZA 3STCA 1TJPA 3QPYA 2B7OA 3N3MA 3W1QA 4JICA 3N19B 3LHWA 4DF2A 1QO2A 1YPIA 3LLDA 1OFQA 1EA0A 3KX6A 2RH9A 1KBIA 3PAJA 2ZA1A 4MIMA 2FFCA 2DZTA 2BLEA 5D02A 2QDGA 1W37A 2H6RA 1O5KA 2HTMA 4NNAA 1P4CA 1H7XA 1MO0A 2C14A 2J9YA 2V8ZA 3NPVA 4GUGA 3DHDA 2V5LA 1FCQA 4OT7A 4AH7A 1VLIA 1KLZA 3B0PA 5HINA 1QO5A 5G2IA 3ANYA 2KZHA 1D9EA 4JY9A 2NX9A 2WSQA 1O60A 3O63A 2VELA 3K30A 1SZNA 4R53A 5AHNA 5DN1A 3LERA 2GJLA 1H63A 4UR8A 2Z2UA 2CW6A 4Q32A 3EEGA 1TPVA 4K7YA 3RFAA 4AF0B 5BMXA 4LNYA 3MUXA 3NR0A 4AWSA 2Y85A 3P61A 2NLIA 3G3MA 1JCJA 5DLCA 4UR7A 2NUWA 1LOSA 5L9FA 4PL2A 4O50A 1GJPA 1TREA 4QITA 1IXOA 1FCVA 3MI2A 4O54A 1BWLA 3NAVA 2QJGA 1TCDA 1YTEA 4FX7A 3TDFA 2GQ8A 3OVRA 4ICNA 1DHPA 2GJNA 1K02A 3ELFA 3RNDA 3NPWA 1A5CA 2ZZ3A 1B4EA 1KFKA 1XBXA 4LT9A 2WSRA 5G1TA 2EF9A 2V0TA 3DFNA 1YADA 3T78A 3LXAA 1KW1A 2DJLA 3TFCA 2ZFAA 4XBKA 3N9RA 1G4PA 1N8FA 2ZTKA 3SY5A 2ATSA 5D30A 3OG3A 1I45A 4CNOA 3PBVA 3ZWTA 3TH6A 4AWTA 1Q6OA 1TV5A 1ICQA 1JQVA 2BTMA 4GRSA 3VE7A 3MO7A 4MUZA 4AHPA 3LCXA 3SIZA 2QUUA 3DAQA 3OIXA 4L4LA 3G0UA 4JNMA 4EWND 2VEKA 1BKSA 3UWYA 4FX6M 1NEYA 3L0NA 3UPWA 3THQA 4XUGA 4N4PA 1E51A 1Y0EA 3KVMA 4O11A 4FNUA 4UTTC 4Y9AA 3U2OA 2DZWA 5AYYA 3TQVA 1QNVA 3NQ8A 1F2JA 3B05A 4BI5A 3W7GA 2CLFA 3EWWA 2YYTA 1PVNA 4IMDA 3INPA 3TAOA 1AL7A 1SO5A 1OFBA 2ZZ2A 4FNQA 3W1XA 4JX6A 3G0SA 3SSJA 1FWRA 2J24A 2NWSA 4H3DA 4LOCA 1AW5A 4N9EA 3W7CA 3L5AA 5A8GA 2QJIA 3ABSA 3HMJG 3O07A 5AFDA 4ONVA 5K7JA 4KWWA 3TMLA 2A7RA 3ATZA 2FPYA 3G22A 3GDTA 1SZGA 2ZZ1A 1G67A 4CCEA 3GYEA 3W7JA 3L68A 1H60A 2Y89A 5CZSA 1F7BA 4UNLA 3P5ZA 3PBYA 3HQ1A 3U8GA 1F6PA 3C4UA 1FUYA 1KM5A 3S5YA 3HPSA 3C61A 3VKJA 4OHQA 1OFRA 3ABOA 3JS3A 3LLFA 3IRDA 4EOUA 4JR5A 4K39A 2ABBA 4IPJA 4CQAA 4QM1A 2QEZA 3W73A 4DF0A 3QFEA 3L66A 5EBUA 1AW2A 5E1QA 4NJHA 1EUAA 4ALDA 3C6CA 3BW2A 4WX2A 4Y96A 2E6DA 1TQJA 2QF7A 1XUUA 4NJJA 3UY8A 1WX0A 3BPWA 1DJQA 2NX3A 4LS0A 5AHLA 3TE9A 3CEPA 3NPXA 5D2YA 3CEUA 2F7FA 3TXVA 1I2QA 3VE9A 2E68A 3KRSA 1TJRA 5F1UA 3L0GA 3W07A 5G5IA 3PM6A 1EPXA 2I9EA 4ZQRA 5HWNA 3H55A 1FXPA 4JXCA 5G1YA 1CX9A 3R5EA 1K03A 3NQVA 1TTJA 3KVJA 1ICPA 1Z42A 5AB3A 5KITA 3MYOA 4RZ6A 1L9WA 3S5ZA 1G6CA 4ZL1A 3FKRA 3NQCA 4IMEA 1LORA 5CSSA 1KM1A 3NM1A 4ML9A 4ADSA 2EKCA 1R46A 1TQXA 4BI7A 1TPUA 3S5NA 1SU5A 5C54A 1SO6A 1ZJIA 5EYWA 1OYCA 4TO8A 3B0VC 1WDWA 3NQFA 2DJXA 5TIMA 3S9YA 2E6AA 4LS1A 2W79A 4FNTA 4LC8A 3P67A 1GPWA 4Y8FA 3LM7A 7TIMA 3LHUA 4WZHA 3W2JA 5L6UA 4QIUA 1QPOA 1FDYA 5FF3A 1TPB1 5D04C 3UY7A 3BARA 1JR1A 2ZRWA 1TSIA 1K8ZA 4ZQOA 1XC4A 5F4XA 3M5XA 5F2LA 4JX4A 3ZR4A 3LTPA 4AHOA 1IIHA 2H8ZA 1UASA 3M9YA 5HMSA 1EX5A 3MI3A 2VC6A 2P0OA 1KM0A 5G2WA 3PBWA 4K7VA 4LY8A 4X9SA 3KVKA 3UXAA 1BEUA 3MP3A 1GWJA 4A3UA 5CPOA 3B06A 1JVNA 5K9XA 2E6FA 3SR7A 3O1NA 3RLVA 4FF7A 5D2TA 1EWEA 3Q2DA 3OHIA 3MHUA 3UYCA 1W3NA 1SPQA 4UMAA 4PL1A 3PG9A 1OFOA 1UCWA 1L6SA 3UXDA 1LYXA 2V2DA 1Q3NA 1TPDA 4LVDA 4O57A 1GTHA 4QQ3A 4IXHA 1A53A 3UWUA 3L21A 1XBVA 1F74A 5FF2A 4CNNA 1KM2A 4YMZA 2EGZA 2YW4A 1OG0A 1LOQA 3LXBA 3BV4A 4CQ8A 2BZNA 3JRKA 1PV8A 1NVMA 3DKJA 3QM3A 2DU2A 5D2WA 1W5QA 3TJXA 1YYAA 4KFOA 4DELA 3W72A 5FF4A 1NAL1 4MY8A 3STFA 5LGZA 1FXQA 3MW7A 1VYSX 1X1OA 5C6MA 3GR8A 4NX5A 4CCDA 4JTJA 4LVFA 4GJ1A 5C5YA 4UTWC 1TTIA 4O1CA 4U4MA 1XBZA 1EWDA 2PURA 1LCOA 4FNSA 3F4WA 3NQ2A 3NZ1A 3C52A 1KM6A 1TRIA 1JCNA 1SO4A 3TSDA 3W2KA 1QOQA 2ZRVA 3M6YA 2JKEA 3M47A 5CGQA 4UC5A 4X2RA 2DZXA 1F6KA 2YX0A 2OT1A 1QPQA 3W7RA 4DO5A 3WJZA 3UD6A 1H61A 4WXZA 2ALDA 3EWXA 1SZFA 5DBTA 1GVRA 5G4EA 1PHQA 5HULA 2YZRA 1GT8A 5AC6A 4K8EA 1B9BA 5FEXA 1NFBA 4JDBA 4JD4A 3CIWA 2QR6A 3TR2A 4AXKA 2Y7FA 2A5HA 3P8JA 1IIGA 1KTCA 1PCKA 2Y6ZA 1KFLA 2ISWA 4RCXA 2RKXA 3TQKA 3IIPA 3G1XA 4KFPA 4ZQNA 3SZ8A 2A21A 1F73A 1WXJA 3LHZA 4YXGA 1UB3A 4C1LA 2TMDA 1SFJA 3LTSA 2AAMA 4AAJA 2ZA2A 1Z41A 3LBMA 4RR4A 2XFWA 4WD0A 2YW3A 3NG3A 1ZALA 1Q45A 5K9DA 3W7EA 2WSYA 5C55A 1MXSA 1A5SA 5CPNA 1DKWA 2Y70A 4O12A 3TROA 3MI6A 2CLOA 1H62A 4N9CA 1DOSA 1ME8A 3WK2A 1Z44A 1VH7A 1YTKA 5IBXC 2Y88A 3DFSA 3S8HA 1K8XA 2DZUA 3NQ7A 3G8EA 3G1HA 1VZWA 4WY0A 3GAYA 2AGKA 5DCDA 1VLWA 1J5TA 1RD5A 1XKYA 3FS2A 1H7OA 4HPJA 3EX4A 3S1VA 1JCYA 4JN6A 5G2HA 2WNNA 2VENA 4XBSA 3GNDA 3FLUA 3W1NA 4S2CA 2J88A 1QR7A 4NZJA 4KKXA 4TX9A 4RK8A 3VCRA 2NUYA 4Y90A 1H50A 1YXCA 2ZZ4A 1SW7A 4B5NA 4HNVA 5AN7A 1VR6A 4MY9A 4XZ9A 5EPDA 3P62A 5HUPA 3B8DA 5KSWA 4IMFA 3E02A 5DY3A 5I3HA 3C2FA 4H4IA 4UXDA 2C13A 1C29A 3IIXA 1GG1A 2VFEA 3UWWA 1JUEA 5AHFA 3W87A 4TU1A 3U6WA 3NL5A 2IQTA 1XI3A 3HGRA 5U7SA 1EP1A 2X2GA 1A50A 2CU0A 4JTGA 1DQXA 4IOTA 2VEIA 4IQLA 4OBTA 3A21A 2FPTA 2QKFA 2FDSA 4OV4A 3B04A 5F4SA 1TPC1 1WV2A 5KMYA 2JK2A 2YFNA 4OQVA 1U83A 1XUZA 2OZ0A 2DP3A 3SW6A 1XBYA 3G3DA 5HNRA 5CPMA 2Z0IA 3M5YA 3FFSA 4UIOA 1H1ZA 3WFAA 1PIIA 1T96A 2Q3OA 1QCWA 4PODA 1ZFJA 1MZHA 4PCFA 4Z0SA 3DENA 3GDMA 3MHFA 2E5DA 4JTEA 2FIQA 2J9ZA 3HB9A 2ISSA 3PG8A 2OCZA 1I8JA 4NT0A 3S1XA 4WUIA 4M7SA 5F1VA 4A2RA 1XCFA 3GB6A 3Q37A 4O4WA 4CNPA 1R2SA 1W3TA 2ZTJA 4O0KA 3UZJA 1OHLA 5D09A 4FIRA 3O06A 3S5OA 1TRDA 3F4NA 5BRBA 3KFTA 1K7XA 3A23A 1VRDA 1X8FA 5KTLA 4CQ9A 2YDAA 5EA9A 3TCEA 1SSDA 3GDLA 3CIXA 3I7RA 1ZNNA 1VHNA 1ZAHA 4HIBA 4DPQA 5SWUA 3M41A 5HUOA 2QAFA 3M1ZA 3FJLA 1ZY9A 2R91A 3L5MA 5LHEA 2CLIA 2FB3A 4LC6A 2TRSA 3NDOA 3VNDA 4XQ6A 2C18A 2TYSA 4D2JA 2FLIA 1UJPA 2HSAA 2BXVA 4O19A 2YR1A 1G7UA 4ZQPA 3W7NA 2VXNA 3LV5A 4A2SA 2QCHA 4FIQA 1H7RA 4EF8A 2I14A 1OJXA 4EVZA 1KV5A 1X6UA 4WY0B 4M6QA 4NXSA 4UTJA 4BFAA 5I3FA 4TMBA 1L6YA 5AYZA 4LS2A 4MJMA 1LBFA 2VFGA 4BF9A 3C2VA 1O4UA 5AHIA 4MPQA 3FYPA 1SO3A 3PF3A 3DKLA 2R8WA 4Z1BA 2A4AA 1F5ZA 3A9IA 3GIYA 4FEZA 3W2UA 3GR7A 2E09A 3W76A 1HO1A 1I4NA 4IGHA 4DBEA 4DEFA 4JTUA 2RHGA 1JRCA 1FQ0A 1TPWA 1K7FA 1N55A 3LXCA 3MJYA 3ZS4A 4YCPA 3HGOA 5FEPA 3WJYA 1AW1A 1A5BA 2WOQA 4O14A 2CWNA 3DHFA 4IXXA 3NNTA 3L5LA 2YPIA 2Y7DA 1A5AA 4HSOA 1YPFA 1JCXA 3UZ5A 1LDCA 1ONRA 3W7OA 4O8RA 1QWGA 3UQNA 3GXPA 1TPH1 4M6VA 1OVDA 2JGYA 3SJ3A 4DXVA 1TTQA 2AQWA 1LZOA 1KTNA 4O10A 1OABA 4O18A 2ZDRA 4NJKA 4DQWA 2V5BA 4UFJA 5LKYA 4ZMGA 1GYNA 1VYPX 3EWBX 4N02A 5H91A 3CQ0A 1C8VA 5LNVA 1W5PA 2GVJA 3MWAA 1RPXA 2PE4A 4N6EA 4MY1A 1L2UA 2ZRZA 3EKZA 4RKAA 3M7WA 1H7WA 4P61A 5D33A 2G95A 2A7PA 3NVTA 4FX8A 3W6YA 1VJIA 1IGSA 3OA3A 1DJNA 2W0UA 3MP5A 5FEWA 4UTUA 4O4VA 1PCWA 4Z1CA 4GWEA 1G7VA 4RXFA 4GUIA 3DH7A 3W84A 3NXFA 3ZWSA 1PHWA 4N9BA 3SGUA 3PWAA 5K4XA 5G4WA 3HG5A 2W6RA 2GQAA 2ISVA 5J5DA 1W3IA 3HGSA 3MBDA 1RR2A 3NO5A 1YXDA 4ADTA 1I2NA 1ZHAA 3LDVA 3F03K 4O15A 5ABTA 3HOJA 4R7JA 4JYDA 2CLHA 4GE8A 1F05A 3MHGA 3W1RA 2P1FA 3NOEA 4N6FA 4LWWA 3PB0A 5HJLA 1X7FA 4HPXA 4JEQA 4K37A 4AHQA 2ATMA 3RK8A 1GG0A 3PULA 3GLCA 3N14A 5DXYA 3BVJA 3FEMA 2RFGA 4NJGA 3TU9A 4L4MA 4HSNA 4DBDA 3IVTA 3TW6A 1YTDA 1MEWA 1PE1A 3G1AA 1P1XA 3GKAA 1U5JA 4YL2A 5AHEA 3LRMA 1MEIA 2QJHA 2CLLA 5LHFA 3TV8A 1AMKA 1KM4A 4LUIA 3E49A 3TC6A 3M5VA 4LRSA 5D2XA 3V75A 1XM3A 3QMRA 1RQHA 2VFHA 5DXXA 4ZQCA 2XN2A 1I2PA 4MKNA 2WNQA 3CPRA 3LI1A 1M7OA 1FDZA 4NQ1A 2ZZ6A 4I7WA 5K3VA 4I9AA 1W5OA 5I3KA 1G4SA 2NX1A 4QAIA 4TR9A 4BR1A 1VC4A 4O53A 3KXQA 4KFNA 5CG7A 1H7PA 4UTHA 4OU1A 1F76A 3TSBA 1YDOA 3BW4A 3DFQA 3HF3A 3NQMA 2HMCA 4NU7A 2Z6JA 3EXSA 3BGJA 4RJEA 4MYAA 3HG3A 2QCLA 3EXTA 2P10A 4WY0F 1FWNA 2ZQ0A 1XDLA 4RLIA 4NZFA 2HS8A 1JQXA 1FDJA 4CCCA 1GVSA 4NNCA 5BOOA 1C9DA 4MOZA 1FBAA 2CLKA 2GVLA 3W1LA 4PA8A 3C2EA 3W1PA 3B0UX 4NXKA 3EKLA 4ORIA 1JRBA 5E93A 2YCEA 3G1SA 1OF6A 3PB2A 3TA6A 4NUWA 1JUKA 3S42A 4FHAA 3PC0A 1D3HA 4R34A 4FXRA 3FKKA 5A5WA 5D37A 3TXZA 5J5RA 3SFKA 3BO9A 3W7PA 4QISA 5KINA 2V2HA 2Z1BA 4MFEA 3M0ZA 3EX1A
chains in the Genus database with same CATH superfamily
4CU7A 3ZO9A 3TNOA 5LGXA 3QF0A 1OK4A 3L9CA 1HL2A 4JTTA 1KKRA 4QRNA 4Z0JA 1KWGA 1OFDA 1JL8A 2JGQA 2NT1A 2CBVA 2NWRA 3NQDA 4E6MA 4G1KA 5C2XA 4YWIA 1XLBA 1PWMA 3K2GA 3WQGA 2PD5A 2WBKA 5E0KA 1TB3A 3VIJA 4Q8OA 1W8SA 4CCZA 1SJBA 3PUEA 4O16A 2GOKA 4YNGA 4H7ZA 2ASHA 1RK5A 1XR2A 2VFIA 2TAAA 4RV8A 3AWOA 3TW7A 2VRJA 4EE9A 3GXDA 2DZPA 2NXGA 4B5SA 3R89A 3S1UA 1MMFA 2D69A 1JPIA 1W56A 4HN4A 3NZRA 4P7RA 3VIFA 3KCJA 3UPBA 4J28A 3URBA 4TXEA 3APTA 1XIBA 4LVBA 5EKYA 1UUMA 5AC8A 3TYDA 1UPMB 4L4OA 3VIMA 4DPPA 5A94A 4JFSA 3S6TA 4OGZA 1BSIA 4M0XA 1GW1A 1P1MA 4I7VA 6ALDA 8CGTA 3W2MA 1W1ZA 3PNZA 4B5XA 4AVFA 3ITVA 4YS1A 1FCBA 4URIA 3C0JA 4HU3A 4MJZA 3NDZA 2QNEA 2YXGA 2Y5EA 3JUGA 3TYCA 1XLJA 1VHCA 2BGNE 3AHZA 2OODA 3FNDA 1GEHA 1BLIA 1U5VA 1KBLA 1YBQB 1TZ9A 3VIGA 1GEQA 1P48A 1RJRA 4HK6A 2PU0A 4YVVA 5CC3A 3IRSA 1DWAM 4J7RA 3AAMA 1RBLA 1W3KA 3AU6A 5I03A 3CHCA 5BXRA 5J04A 3NM3A 3VIPA 5T9BG 2X1RA 5FIPA 1TPEA 3TAKA 2XM1A 2Z1XA 1GQLA 2PDLA 3R8HA 3GTFA 2VZUA 4HNTA 5KZMA 2ZUSA 3E6EA 4FNPA 5M17A 4LQ1A 3W70A 3NEVA 3TSMA 3P84A 4EF9A 1ISXA 3RPMA 2GL5A 2YL9A 4GGBA 1BGGA 1RJPA 3IIOA 3DESA 3EA2A 2CKSA 3LTYA 1I2RA 2YA2A 4QLKA 3HBLA 3NQEA 2OLAA 1HKKA 4EXQA 5LZLA 1VPQA 1J0JA 1XD0A 2W27A 3VNJA 3BICA 3BURA 3IK2A 1KV8A 4B2DD 1OFEA 4J27A 4E38A 1FWIC 3K1DA 4MZYA 3VMNA 2O9PA 2WV8A 2CLMA 4UQEA 3SI9A 1V79A 3WF3A 2WMFA 4Q6XA 2I5GA 5DBUA 1W54A 2YCIX 2ZXAA 3H2MA 2BNJA 4BEQA 3PTKA 3WNOA 1NDZA 4U5KA 1K7EA 1CW2A 3IAPA 4C6FA 3O05A 2X1IA 3WJXA 1XIFA 1MZRA 2PDXA 4Q4OA 3F4CA 3CV6A 1E3XA 4Z2KA 3ME3A 3TX9A 2JIEA 2A3AA 2GSJA 2NT0A 5D05A 2YB4A 2J7HA 4LGXA 2EAWA 2O0TA 5CSRA 1EJUC 3W38A 1Q63A 4S1FA 3QEZA 1Q6FA 3QJAA 5A6MA 2R82A 1ECEA 2ZUMA 1BYBA 3CK5A 2OT0A 2O7QA 1XFCA 1WUFA 5MHBA 2QZRA 2DIKA 1TV2A 1EHAA 3UJ2A 1RQEA 2BDQA 4O8AA 2WQPA 3W7MA 1SMDA 2WPBA 4JTCA 4M51A 2X1TA 4C5ZA 4ML4A 1P0KA 4UFIA 5CPLA 1SUXA 1RZMA 4NIRA 5BZAA 3WLLA 3T08A 4ZCWA 1KD0A 1ONXA 1PKNA 3N18A 4LEFA 4O1AA 3NOYA 4WKHA 1E0UA 1RVKA 3BSGA 4AIBA 4B92A 1WB0A 5CCZA 3BMVA 2ZZ7A 3F4VA 3DERA 1IXQA 4NZ1A 3TZFA 3EX3A 4IJBA 1UYQA 2BXZA 4ZB0A 3TWBA 3A3WA 4LB3A 2ESCA 3MC5A 2XUCA 1AJ0A 1Y5VA 2G5WA 2VEGA 3C86A 3CIVA 2O4QA 2GVGA 3I65A 5C0QA 4O1DA 4UTLA 4C65A 2C1HA 2NV1A 2PRMA 3K4DA 1JZ3A 4LRTA 4F9DA 3CL8A 4DJFC 4UUIA 4UFKA 3UG8A 3GD6A 4H83A 4BK9A 3P8IA 4XAGA 4I6VA 3TTSA 1C7SA 1SJDA 1THFD 3B40A 1EB3A 2BGQA 2J9XA 5BOFA 4OOZA 2VOTA 2HS6A 1X7IA 3UZWA 3UESA 1LQ2A 3OU8A 5BU9A 3ZR5A 2J4GA 3N73A 5B80A 5TAOA 2ZRXA 4UTIA 4DNHA 1V6WA 4DWSD 3A5FA 4L4PA 2PDHA 5I0DA 2A85A 2DY3A 4JTDA 5CGMA 4XKYA 2NXIA 2BWGA 4X22A 4HKPA 4AD0A 4K8HA 2FHCA 4LY4A 2R1NA 4H04A 3GVGA 4L6HA 4HHLA 4IF2A 1OX5A 1XSKA 3T4CA 3UXKA 4GC4A 4D6CA 3B9OA 2VZOA 3RLUA 2BSLA 2CEQA 1VQTA 3W1MA 1M7PA 4ZVJA 3H7RA 5CKSA 3TN5A 3B8UA 3UYIA 3U2CA 2GDUA 4NY2A 4JIEA 2G97A 1POKA 3SURA 4YTQA 3GVVA 2Y61A 5JMUA 2POTA 3DG7A 3ZT7A 1EEXA 2J7CA 3PZIA 3VM7A 4GVHA 3SN0A 1FY6A 1IF2A 1FRBA 3WL0A 2ZVIA 5I24A 3SCQA 1HT6A 4XB3A 1MQRA 4GXMA 4KEVA 3STGA 1KTBA 4AZ6A 2VP8A 4YTRA 4M6PA 4KWVA 3LLXA 3M0HA 4GBUA 3LRKA 3W23A 3NQBA 1GVEA 3EA1A 4WOQA 1UWIA 3WJSA 3ZJ6A 4HJWA 4PEEA 1H09A 1DJGA 2PCQA 3GXIA 3TC3A 4DN1A 4GKLA 3WF1A 3IVSA 1S1PA 4LCRA 4MMWA 3SFWA 4GY1A 4V2XA 3E9AA 5E6YA 3SUWA 3NIYA 1PKYA 3FA5A 1QI4A 4NNBA 4GVIA 3E0FA 4ZSTA 1LT8A 1YDNA 5A8QA 3MA8A 1XH0A 3PS7A 1A5MC 3EOSA 1JD7A 1WKFA 2HJPA 3N4FA 4AEEA 3LHTA 2C15A 2QUNA 1K3UA 3W9ZA 3GY1A 3BLIA 1PDYA 3KDNA 1WYIA 1R5YA 3LCHA 1EXBA 1S5VA 2VGIA 4XZNX 2Q8XA 1QNOA 1US3A 3B8TA 3W86A 4BY3A 1K77A 4IIDA 3GHUA 3HPXA 4XKYB 1RUSA 3SCSA 3RRXA 4W86A 3MMWA 2PA6A 4REQA 1IXNA 3WK1A 1UROA 4HNOA 1IXPA 3FX4A 1BG9A 3S83A 2A2IA 1QASA 3BCFA 3LBCA 2QULA 1SVDA 2XN1A 4GUHA 1AK5A 4ZOBA 1EJVC 1E56A 3GC5A 1R3TA 2FFIA 1NTHA 2ZRUA 4QX4A 3VD3A 2G3IA 3E0IA 3H2NA 3MYPA 1GVOA 1QMLA 2WM0A 4JFTA 1M3UA 4LBRA 3NYZA 4IMGA 1R30A 1M7XA 1LM1A 4XD5A 1EPVA 1RSCA 3TC7A 1FWSA 4PCTA 1J6PA 3CU2A 1GYLA 4MUPA 3W02A 4TV5A 1JPMA 2DT2A 2VFFA 1QATA 3FDGA 3L12A 3LUTA 1WE5A 3B3DA 3Q65A 4ZR8A 3N34A 2C0HA 3CPGA 1UA3A 3BTNA 1KCXA 2J66A 3BAXA 3H22A 4LPCA 1S5TA 4AWUA 1EEPA 3W74A 1R2TA 1ME9A 3RYSA 3NVDA 2J27A 3AHVA 1E0WA 4CU6A 1H3GA 2OKTA 3BW3A 3WD0A 2BY2A 5CZJA 4DY1A 3P80A 3L2IA 3LX9A 1W31A 2ZYFA 3KOFA 1I1WA 3L2LA 4L1XA 2PGFA 4QCEA 1K6AA 3A13A 1VCFA 3MU7A 3VFLA 2Z27A 3IJ6A 4MFDA 4S3CA 4PTDA 1W3LA 4JYEA 3P0WA 4ZZ9A 2V30A 4Z1YA 1X1ZA 4DWDA 2PGWA 3WDRA 4LUYA 2WM1A 3GFYA 3MY9A 1IYXA 2CXGA 4BF5A 4HK7A 4GI4A 5TQLA 1JG9A 1EQPA 6ENLA 4REQB 5DCBA 1B57A 2W5FA 3DEQA 4JGDA 4MLRA 5LA2A 1VCVA 4LSBA 4HMDA 3UEQA 3DC0A 5GVJA 2NVCA 4FR6A 1E0TA 2FVKA 1KC7A 2R9RA 1OYBA 3EXRA 1YKWA 2B7NA 1YX1A 3ABXA 3OYZA 1NSJA 2WVSA 3HGJA 1Q6EA 2ZC1A 3NL2A 4GVGA 2VHLA 3G1FA 3PP7A 1AJZA 4WDWA 4GG9A 4AD5A 4AVNA 4A3YA 3R4IA 1IZJA 2WSPA 3ABRA 5HATA 2YYUA 3FOKA 1US2A 4KCVA 4OECA 2TODA 4FALA 2PTXA 3QY7A 1SZRA 1YPIA 1JZ6A 4JKLA 1ZP4A 2RH9A 2OOGA 1H0IA 3PAJA 2ZA1A 3OZPA 2O9OA 3MQTA 4WSJA 4JKMA 4PMZA 5HJXA 4Y9NA 3ZJ8A 2H6RA 5D9PA 1P4CA 2C14A 2VEFA 4HVXA 3NPVA 4OT7A 1FCQA 2V63A 1VLIA 2V3EA 3TTOA 4DHGA 3B0PA 4WDXA 5HINA 3ANYA 5FACA 3O63A 4R53A 1HVXA 2PGEA 4UR8A 3ARUA 1W9XA 4IH3A 1Y65A 4AWSA 1XRVA 2NLIA 5DLCA 3SCTA 3Q67A 4UR7A 2NUWA 1QUMA 2PDWA 5L9FA 3VPLA 3LD5A 3F7JA 2VX4A 1BWLA 1TCDA 1FKXA 1YTEA 2E1WA 2GQ8A 2VZTA 4IGMA 3T42A 4ICNA 3ELFA 4OVXA 2REQA 2OQYA 1UWQA 2WSRA 2V0TA 4MPKA 5HQMA 3EEZA 1N8FA 5EMMA 1QNQA 4S38A 1RCXB 1E40A 4CNOA 1ESWA 1R3SA 3ES8A 3ZWTA 3FCPA 4KCTA 5AYIA 2BTMA 4GRSA 1F3EA 4MUZA 1OC7A 4AHPA 5A6TC 3LCXA 4M1RA 3V18A 1IT8A 1F4AA 4L4LA 1PZ3A 3G0UA 3WF2A 4S3JA 2J7DA 1BKSA 2E7FA 5FL1A 1NEYA 3BAJA 4BHYA 1G9HA 4D9PA 3HMCA 3RMEA 3SO7A 3PN8A 1Y0EA 3KVMA 2V3DA 3ENLA 5AYYA 1HJUA 4PULA 1AQMA 1V3JA 2GJRA 3KOYA 8XIAA 1F2JA 3AOFA 3W7GA 3NTYA 5A8OA 2YYTA 1PVNA 3ZLHA 2OSXA 2XIQA 4UB9A 3SCPA 3W1XA 3EZ4A 1QNSA 2NWSA 4N9EA 1FHLA 1TUXA 3W7CA 2F9RA 3APGA 1C91A 3ABSA 1XIDA 4ONVA 2VRKA 1RAKA 1X38A 5D9NA 1GKRA 3VD7A 2FPYA 2HK1A 4Q8MA 4AX6A 4BJHA 1H60A 2FZNA 2IUZA 3PZNA 3HQ1A 1FUYA 3CUFA 5LIUX 3W82A 3CZLA 1XWYA 4A3QA 4K39A 3V5CA 4C1NA 2ABBA 4CQAA 3PAOA 2VNCA 2XPKA 3TOPA 4DF0A 2ONEA 3QFEA 3FXGA 1EO7A 3PZUA 5EBUA 5C71A 4NJHA 4ALDA 3BW2A 3H70A 2E6DA 2QF7A 3SN4A 3MPGA 5C7VA 5AHLA 3CEPA 1HKVA 1I0DA 1UMLA 3NPXA 4C6PA 4OZOA 5EB8A 4B9ZA 2V5JA 4IISA 2BODX 3VE9A 4YWSA 4XVDA 3GSMA 4ZOEA 2X42A 5HWNA 3H55A 4MTVA 5G1YA 3WQWA 2CIPA 3R5EA 2REQB 1EBGA 3F2BA 3UWEA 3KVJA 3DYOA 3AFBA 1Z42A 3MYOA 1L9WA 1IR2A 2ANUA 3NQCA 2XVNA 5CSSA 3RM4A 1KM1A 2VC5A 5KEZA 4ML9A 4UOZA 1TQXA 4BI7A 1MYRA 1SU5A 4PZVA 5C54A 2PLCA 1SO6A 3QLDA 1OYCA 1NP2A 4EACA 1NOFA 1U1HA 3NQFA 1HP5A 4FSAA 2GUBA 2QV4A 2DJXA 3HQOA 4J4KA 4YU1A 4LS1A 1K9FA 3EDFA 4HP5A 3M0IA 7TIMA 4Q8WA 1XRFA 5L6UA 4QIUA 1QPOA 4WJ8A 4R7OA 3S4TA 1FDYA 2HBVA 2VVSA 5FF3A 4QFUA 5D04C 1JEZA 3EB3A 3UY7A 2R1MA 3O2LA 2ZRWA 3WDJA 3W24A 4ZE4A 4ZQOA 1XC4A 5F2LA 3ZR4A 3LTPA 3H21A 2W9MA 5GJMA 1IIHA 1UA7A 3PPFA 2VC6A 2UZ9A 5G2WA 3T81A 4ENLA 4K7VA 4LY8A 2GYIA 4X9SA 4HD5A 2J74A 1BEUA 1K9DA 2JEQA 4XZHA 1HJVA 3B06A 3OLDA 2PDKA 1NJJA 1KCLA 1LWIA 5K9XA 3BJTA 3KL5A 2KAUC 3VGDA 4MB4A 4FF7A 3Q2DA 3R43A 1XYMA 1SPQA 4UMAA 1E9LA 1O5QA 2Y5SA 4UQ9A 3A3XA 3L4ZA 1L6SA 4PBEA 4FLOA 3RCYA 4C1NB 5FF2A 2VX5A 3VILA 2YW4A 4I6KA 1C7TA 2XIIA 1EJRC 3HM7A 3CMGA 1NVMA 3DKJA 4GHRA 4CVUA 3ICJA 1W91A 5AECA 4DELA 2BHYA 3TNBA 3STFA 3MW7A 3GE7A 1VYSX 1X1OA 4CCDA 5FJRA 3KUMA 4LVFA 3NCOA 1TTIA 3U4FA 2NSXA 3PZMA 2DQXA 4FNSA 1QI2A 1OCJA 1FOBA 1XICA 4JTQA 2JKEA 1L8PA 1SFTA 3BAYA 2OZTA 2WW5A 2OT1A 3MVTA 2NW0A 3W7RA 3BOLA 1H61A 1XRSA 1EHNA 5FOOA 1RLDA 5HULA 1AH4A 2YZRA 1GT8A 5AC6A 1MFUA 1UD4A 2F6XA 3I6EA 4OFCA 3BCJA 4AXKA 3QHNA 4L6DA 3P8JA 1IIGA 1KTCA 2ISWA 2GUYA 2G4JA 1PIFA 3QY6A 3G1XA 2XZ7A 3IJ9A 4KFPA 3Q4DA 1XIMA 4GC3A 1KGXA 3LGDA 5AY7A 1NQKA 3KWXA 3E2RA 4AAJA 4RR4A 3VVGA 3VMOA 2UWFA 1Q45A 4F8XA 3ZSSA 3CV2A 2BHZA 5C55A 2G50A 3M0VA 1Z8AA 1DKWA 2YXOA 3J7HA 3MI6A 3O6AA 2QT3A 4GZEA 1TZZA 4GIEA 1Q7ZA 1ME8A 4PUKA 3W26A 5IBXC 2ON3A 5C2CA 4Y8EA 5HAOA 2DDXA 3GAYA 4UQDA 2WVVA 4H8VA 1TFVA 1M9HA 3VNYA 4XV0A 3BAIA 1JCYA 3TYEA 1UW9A 2G4FA 3IPWA 5IDIA 3GHTA 3TTQA 4TX9A 3LBOA 4RK8A 2NUYA 2Y1HA 3EB4A 2ZZ4A 3G6LA 4LAUA 2YL6A 2HZGA 1FHUA 4KCUA 2HVOA 1JYNA 5HUPA 3B8DA 3RGTA 3NGFA 4IMFA 4WSKA 5DX7A 2OSWA 3C2FA 3WQPA 1P0BA 1WZMA 4MAZA 1B3YA 4UXDA 3NZPA 2VFEA 3UWWA 3E38A 3T2QA 3W87A 3CS2A 3UJEA 4LXFA 3VABA 4JTGA 2CU0A 4IOTA 4D6EA 4IQLA 2FPTA 2BASA 2QKFA 4HGXA 1QI5A 4B5UA 5HNRA 3N2TA 1XSIA 1YNPA 3HJEA 1PIIA 1ISVA 3BH4A 2ZIDA 1QCWA 4J3TA 2ZX7A 4PCFA 2GLKA 3DENA 3T9PA 2E5DA 4C60A 2FIQA 2ISSA 3QKEA 4PGLA 2GSHA 1I8JA 3S2LA 1DHKA 3NSNA 1XCFA 1ZCCA 5F1VA 1ZJAA 2QGHA 1FWJC 1EQCA 1R2SA 3N6QA 1K70A 1V3MA 4GYJA 5D09A 3O06A 3ZIZA 5TD4A 3A23A 1X8FA 4DZAA 5KTLA 1J0KA 3TCEA 3AS1A 1SSDA 2WKLA 2XIOA 1ZNNA 2YOCA 1ZAHA 4A8LA 3ZOAA 4HIBA 3BOFA 2VDHA 3M1ZA 1K1DA 1ZY9A 3DN5A 3AXHA 1GGOA 4B91A 4H9ZA 5IOBA 2FLIA 1HKIA 3DOPA 2HSAA 3URNA 4O19A 4C6JA 1G7UA 1JXJA 2J7GA 5FSDC 2DT3A 1Q6GA 3WLKX 4FIQA 3LS9A 4J35A 1UKSA 4D6GA 1SFSA 1KV5A 4NXSA 3OVGA 1B5TA 2W91A 2WVVB 3SQSA 4TVDA 2QPSA 4MJMA 1ZJHA 3GTHA 2VMFA 4LS2A 4AIOA 2VFGA 3FYPA 3CQKA 2R8WA 2CPUA 1CLKA 3VOHA 3G77A 4D71A 3W2UA 2E09A 2VGFA 3W76A 1I4NA 5EMLA 1LWJA 3P2VA 2EJAA 2ZADA 1Q85A 4EK7A 1QRQA 2A79A 1K7FA 2G0WA 2YZ5A 2OGYA 5FEPA 3ALFA 2PDJA 2WOQA 4LB4A 3IJIA 1VFOA 4CKQA 1DIDA 3L5LA 5A6JA 4GQQA 3IGHX 3AMKA 1D8WA 1MUMA 1A5AA 4O1FA 1JCXA 1ONRA 3W7OA 1O1ZA 1QWGA 3MANA 3AICA 3GXPA 2E8YA 3SRDA 2W92A 5JBFA 3GIPA 1GUVA 4DJFA 4L1WA 3PFMA 4V33A 1UD3A 2ZDRA 2A3CA 4NJKA 1PKLA 3W0KA 1EJWC 2V5BA 3TR9A 4GX8A 1C8VA 4YVPA 2GVJA 3MWAA 3L2MA 2PE4A 1S3TC 4MY1A 1L2UA 1MDRA 4ICCX 3WLJA 4RL3A 3EKZA 3WF4A 3M7WA 2HE8A 4M1BA 4P61A 1I0BA 1ZL1A 3BGAA 4H6RA 4FX8A 3W6YA 4XISA 2EO7A 3MP5A 3H8AA 1PCWA 1J0YA 5C9WA 4Z1CA 4JNYA 3PZ9A 3M0XA 3O3RA 4JBRA 4RXFA 4CEUC 4LBSA 2ZE3A 1J0IA 4PMRA 3LN3A 3PWAA 5K4XA 4XG1A 2ISVA 1T7LA 3HGSA 3UPMA 1XYZA 4O15A 5ABTA 4C7DA 1EF3A 4JYDA 3VD5A 3TN4A 4EPBC 3AMLA 2NQJA 1JCTA 1R7AA 3MHGA 8A3HA 3BDKA 4D1IA 3RUBL 2ZX9A 3KLLA 1GORA 4XVEA 3PZTA 2OTDA 1JDFA 3MDWA 4RPQA 5HJLA 3L7RA 1T6MA 4AHQA 1BF2A 2MANA 2ATMA 4HJFA 1O68A 4GPNA 3RK8A 1QTWA 3GLCA 4X9YA 2RFGA 4NJGA 2WJDA 4L4MA 4DBDA 3RHGA 3EMZA 1EIBA 4W8LA 1P1XA 4C6QA 4ZEPA 1PB0A 4DJEC 1OIMA 3KS5A 3KTSA 4RNHA 1E6XM 1AMKA 1F3WA 4LUIA 3E49A 3MMUA 1MVYA 3RPDA 3VYLA 5I6SA 4D72A 3PZVA 3M5VA 3KDOA 2RUSA 3V75A 1XM3A 4DUOA 3NDYA 1TELA 5CH9A 1RALA 3P0XA 5A6SA 2DUAA 1VFUA 1QK0A 3LI1A 1VJZA 4MNLA 4HYRA 4I7WA 4ATLA 1LUCA 1TA3A 2OSYA 2DGAA 4HPHA 2NX1A 4QAIA 4NRRA 1J11A 1VC4A 1XC6A 4O53A 2BVYA 1OC6A 5CG7A 4UTHA 1ZJBA 1F76A 3PJXA 4S3DA 4YTSA 3NQMA 4P7NA 4NU7A 2Z6JA 4DAFA 4RJEA 1UPPA 5E70A 4EKJA 3CXOA 4F0LA 2P10A 1RXOB 2C8NA 3CUHA 1US0A 2SFPA 1FWDC 4XAFA 1U30A 3O9NA 4LAKA 1ITXA 1JQXA 1FDJA 4KGJA 3KHDA 2GZXA 5DRCA 1C9DA 1FBAA 1BYDA 2CLKA 1EC8A 1KXVA 3W1LA 3W1PA 3WQ4A 4NF7A 1DJIA 4DJDC 4J3VA 2QDEA 3GQYA 3TOYA 1OF6A 1R0MA 2Z29A 1O5RA 3IUDA 1XP3A 4E8GA 1ITQA 4M6UA 2PWVA 3EOEA 3CZGA 4AY7A 3AIWA 2C7FA 4UQAA 4NILA 1EBHA 3BO9A 5CSYA 4TVUA 3W7PA 5AZ1A 4MFEA 1UWAA 2XYLA 1UWSA 2HISA 2BX7A 3QQ0A 2J7BA 3EBVA 2PP3A 1V3IA 4IWWA 2CBUA 5T26A 1GQKA 1I2OA 1RA5A 3WELA 2DFAA 2WVUA 1XRTA 2GQ9A 3QV7A 5M1TA 4UQCA 5JXQA 5GQBA 3FJ6A 4W7UA 2Q71A 1NQ6A 4LYPA 2CC0A 3N1AA 1ONWA 4H6KA 3KRUA 4WDTA 5LNSA 1XLAA 5AYBA 3TKFA 1M01A 4C1KA 1AFSA 1EJXC 3NXLA 5DELA 6TIMA 3P74A 2J8FA 4JIIX 4B3LA 1UR2A 2TSYA 3PR2A 2WCSA 2FKPA 4Z08A 1OX6A 3LNPA 1HQTA 1EGZA 2DUZA 2J7EA 3ECQA 5TNVA 3RM8A 3TJLA 5DQPA 1V0KA 3UFYA 3FXYA 2DZAA 1P6WA 2VOMA 4PYSA 1LG1A 3ATYA 4Y9PA 3ZJKA 1LUCB 1HIZA 1TA3B 5BNKA 2DH3A 4K1GA 3C2OA 3P82A 1JPKA 2E5BA 1AVAA 4HHPA 2EPNA 1J79A 3B9AA 5AHMA 3HJZA 3O6YX 4G6CA 1HGYA 4W4QA 3G18A 4HT3A 2VZVA 4RDVA 1RV8A 1WAUA 3ITOA 3I3DA 3SUVA 3CHVA 3WLRA 1DQWA 3W2LA 2YLAA 1GOIA 2ZRYA 1TJ1A 1JF6A 1O1HA 2I1OA 1LLWA 1VFTA 4C6LA 3E5PA 3LV6A 3IVUA 3DI1A 3H23A 3VD9A 4LV4A 3MSYA 5FAJA 4K36A 1U5HA 3T2PA 2WCGA 2X1SA 1LROA 5B7YA 1BHGA 1F3TA 1HP4A 3RCNA 3KEHA 4L64A 4A3RA 1WDSA 1FWWA 1TWSA 4NKCA 1JUBA 3W2NA 3F2DA 1Q8AA 2VUYA 1KFCA 2AKMA 3EPNA 2INEA 1TG7A 4QSFA 4YIWA 2GUUA 3V5OA 1JDDA 4WJXA 1VBJA 2E28A 1DORA 3L0KA 1C9WA 1SR0A 1QPKA 2G96A 1Q4NX 1V0NA 4DLFA 3EX2A 3G1VA 4JEJA 4F0RA 1HJSA 2WMGA 4YCOA 2AOSA 1XCXA 1VYRA 5A8PA 2F6KA 4XIMA 3PPGA 3EX6A 4JX5A 3WIJA 4G8TA 2OWXA 3LRLA 3CUZA 2J25A 4I5UA 3LZ5A 4CD6A 3VTRA 4GUJA 4UTMA 2DORA 4AISA 3V0TA 5MF5A 5LIWX 2V6AA 3TTYA 3R2GA 4S3KA 1A5KC 3MO4A 3VIOA 3CO4A 2YFOA 2RDWA 3DYPA 2Q02A 1XYBA 1C8XA 3WH8A 2WKJA 1CGVA 1UJQA 2Q8LA 4ZO8A 5CQ1A 3S5SA 1LL6A 3KM8A 1LRTA 1EUNA 3EAUA 1OD0A 2OPJA 4GYKA 1UP3A 1ADOA 4FO4A 4U3CA 1KM3A 2DZSA 3W7LA 1W0MA 1DE6A 4I7UA 4G2DA 3OLEA 2FJKA 3GNPA 4I5RA 5I79A 3THAA 2HNHA 4NX0A 3W71A 4GFSA 3P81A 5DT5A 2E1DA 1WKDA 1XQKA 1FWGC 4IPPA 3QSRA 1DQUA 4JTKA 4H9XA 2FH6A 5FF0A 3W25A 1LG2A 5U4NA 1EC9A 1RA0A 1CXKA 3BGGA 4KBXA 5HQLA 2D2JA 4E0CA 1DWHM 3DGBA 4R85A 3VGHA 3TFXA 9RUBA 4IIGA 3MMTA 3DFOA 1VBRA 1KBJA 1S2TA 4LU0A 5FJJA 2CBIA 3FVMA 2ZX5A 4TIMA 4A8IA 3GFXA 3OGRA 1F8MA 2Y63A 3DBNA 1Q6LA 5I7GA 1SSGA 3G0XA 1A0EA 3Q58A 1NARA 1XDJA 5HA7A 3VNKA 2WC3A 1QDSA 3Q94A 3GAKA 1XJBA 2CZ5A 4NZCA 3T0TA 2QLYA 2F84A 1GOOA 4AZBA 4YJ5A 1TVNA 4QE5A 4I9TA 3GDBA 4LYRA 2Y24A 1A3XA 3M64A 1HKWA 4PUWA 5GNYA 4RZ5A 3GIQA 1JZ5A 3WDQA 5I3JA 1PIGA 3UP8A 1RY0A 4HZMA 2CZVA 3AO0A 2VQTA 5I3IA 3KRZA 4WKAA 4FB7A 3QY8A 1DE5A 5M2FX 3M6DA 1BTMA 4QSHA 1UZHA 2UY5A 5HWMA 3C3UA 3O6CA 2ZWZA 3C2YA 3AALA 4AU0A 1HFBA 2YDRA 1JXKA 1UQZA 3AQUA 4FMVA 3A4AA 1W9PA 3IJ7A 5FESA 2JQXA 4FR1A 2OMAA 3E2VA 2P8CA 4JTIA 2Z24A 3W7HA 3DFTA 3FA4A 3MUY1 5CEWA 1XLEA 4W8BA 4M5PA 1CIUA 1FWAC 2C1IA 4A22A 1XYLA 1BSLA 2JEPA 2BY1A 4NJIA 5EMYA 5F2IA 4S39A 2GGIA 4GQGA 2Y5JA 3MJMA 3P3BA 1T8XA 1OSEA 5A6KA 4GQ0A 3M43A 5K2ZA 1TIMA 1I75A 2X1UA 3WLHA 3QLLA 2PDBA 3ZVHA 4WR3A 3POHA 4R33A 3QW4B 1OT1A 3IGUA 3EOUA 1E4IA 4JY8A 3WG6A 5FCZA 3WLMA 4E4UA 2FPVA 4EANA 3VA8A 4DB7A 1UR0A 4KH2A 3BV7A 1S3HA 3FK4A 3TLLA 1ODZA 5GNXA 1PPIA 3W01A 2OXNA 1S2UA 3VI2A 3O8AA 5LNUA 3URQA 2I56A 2NSOA 2AAAA 3W81A 1V6XA 4JTFA 1TTPA 3B0XA 4QGCA 4LEQA 1BWKA 4LF2A 4M29A 3LCIA 2VYOA 3DZ1A 1TMLA 1QWKA 4QR6A 2BOFX 1U1JA 2DEPA 5LSMA 4QG8A 3DIPA 4XZMX 3PUDA 2WMKA 1GVQA 5F2GA 2EPMX 1NELA 4ZSUA 1KFBA 4G56A 2PDQA 3PTMA 1DJHA 2FYMA 4RUBA 1NDWA 2Z1KA 3MV01 1NOUA 2FTPA 3OODA 2C79A 5IRPA 3GTIA 3EWZA 4WF7A 2X05A 5D38A 3C8FA 3ZT5A 1RVGA 3DGRA 3BQ5A 3ZJ7A 1OFPA 5EBAA 5LIKX 5DY2A 2UBPC 2FGLA 3KP0A 2XINA 3W1AA 5F2MA 2F8QA 4YHEA 3BLEA 2PTYA 2J6XA 5I23A 4DZHA 3NJ3A 2YJQA 4L9ZA 3QHMA 3ANUA 3QYQA 5HOSA 1GVIA 3AHYA 1LL7A 4A35A 4HMEA 4FF5A 4GI6A 4BI6A 1J0ZA 3R13A 1GQIA 1TMHA 4O17A 2F2KA 4AVOA 3QW3A 4FOUA 1M65A 3E3HA 4A6GA 4MDOA 2VR4A 4IPNB 2JKAA 5CC7A 4KESA 1W1B1 3VUPA 1GJUA 4IP5A 1UC4A 3BG5A 2B81A 1W1A1 1XDMA 1GNXA 3S9IA 2FB2A 1CT5A 5D9OA 5CBIA 3ZVHB 1YPXA 3TJ4A 3KLKA 1H51A 2I57A 1K9EA 2HRWA 4IX0A 1NFGA 4CNSA 4IP4A 2E40A 1A4LA 1VFMA 3GXTA 3ABQA 3KHJA 2QDDA 3PJTA 1XGDA 3BLOA 3WQOA 3W29A 2WHMA 4WK9A 3CB8A 3A64A 1XF0A 3D46A 1Z9AA 2ODOA 4YPJA 3BXWA 3WBAA 2IKJA 4JS3A 1VBHA 3UNDA 4HTBA 1V6VA 2VCAA 3MSGA 4XZIA 1EYEA 3SECA 2J75A 1W5MA 3QRHA 3JR2A 1VIWA 4P8UA 1POJA 3WLQA 3UVAA 2XH7A 1HTIA 1J4EA 3KBJA 5DMYA 3H12A 3QMTA 1Q7QA 1TR9A 3WEZA 3B8SA 4UCGA 2XN0A 1RH9A 4AXNA 3QH2A 1S5WA 1LBLA 1E4LA 3PSVA 3UVIA 3IWPA 3O15A 4W9TA 5IBXA 4E5TA 4LALA 2Y62A 1N8IA 3T0AA 1KFJA 1X96A 1CZ1A 1JFXA 4OWGA 3HG4A 1DTUA 4EPKA 3N2CA 5CJ5A 4HNNA 2XGBA 2FDMA 3PJUA 3WNLA 2X40A 1OWQA 3WUFA 1MSSA 1FH7A 3T8LA 1B9ZA 2CHRA 2WCAA 4N42A 4J2PA 3AIBA 3CZ8A 4MADA 3SCUA 3GZAA 3PSWA 3MVIA 4UMCA 3GG7A 1P0DA 3UBPC 2QAPA 2H8XA 4B3ZA 4BS0A 1ECQA 4QNEA 4UOQA 4DZ5A 3DYMA 4JTHA 1TJ0A 1G69A 3G6MA 5G4HC 5K9CA 3V5FA 4MGGA 1K8CA 1ML1A 2Z25A 4UBPC 4DYJA 3M5ZA 2QCEA 3IGSA 4PTWA 5D2VA 3W28A 3WLPA 1Q65A 4KQNA 3WQVA 1T99A 5FA5A 1CGUA 1RCQA 4WGHA 3HIJA 3LK6A 1Y8BA 2A7NA 4Z2HA 4HHMA 1W3HA 1FX6A 3OO2A 2D0GA 4AQLA 4H2HA 3TIMA 2HXTA 2YBUA 3VINA 4CLMA 2VURA 1FKWA 1SR9A 4KIRA 3WF0A 4YVXA 1TJPA 3RAOA 2B7OA 2R6OA 4QTGA 3W1QA 3QZAA 3N19B 1WDPA 2PODA 1EA0A 1EGMA 4AZ5A 3VC5A 2FFCA 4QDWA 5D02A 3C8NA 3HN3A 1W37A 1Q13A 1R86A 1X1NA 2HTMA 2V3FA 4AC7C 4QLLA 1MO0A 3VDAA 4QG9A 4PCSA 3DHDA 4AH7A 3RDKA 2QMKA 4KS0A 4LYQA 1QO5A 5G2IA 2X09A 3S46A 4JY9A 1UH2A 2WSQA 3IJ8A 4PMNA 2VELA 3WMBA 5AHNA 5DN1A 3OLIA 3LERA 1RBAA 4JTAA 1D3CA 3NO1A 4Q32A 5HPOA 2PSNA 3EEGA 3RFAA 3MUXA 3NR0A 5HK4A 3G3MA 4LH8A 3KL0A 4BA0A 5DEZA 4C90A 3TLQA 3SIMA 2W4XA 3BUVA 1R3RA 3O7UA 1NWSA 3TDFA 2OEJA 4TOQA 1MWOA 3UG4A 5CBJA 4ERAA 1DHPA 3WLSA 1HNYA 1K02A 3S1GA 3RNDA 4JCMA 5DMNA 1B4EA 2ZZ3A 4D8AA 4LT9A 3DFNA 4X61A 3LXAA 1KW1A 2DJLA 2ZFAA 3NSXA 1CYGA 3V36A 1XIEA 3F4DA 3SY5A 1JDEA 2ATSA 4HYVA 4CN4A 5D30A 1I45A 3PBVA 3TH6A 1CXIA 4W5UA 2D3NA 1TV5A 4CQBA 1ICQA 1JQVA 2DSVA 1UZ1A 4JQ1A 4ZTYA 2GSEA 3GNRA 4XAZA 5REQA 3H2OA 1A5LC 1NWRA 2VEKA 4BF7A 3I4EA 2XGZA 2DW6A 1KQYA 4IFKA 1XSJA 4PUMA 5HMEA 2PDFA 1E51A 2RAGA 4LAMA 4O11A 4O0QA 3BQ6A 4Y9AA 3FSUA 3U2OA 2DZWA 4U3AA 3MKKA 1PJ9A 3TQVA 1QNVA 2ACSA 3B05A 2O55A 1B54A 3EWWA 1AL7A 3ARWA 2ZZ2A 3LQLA 3BMWA 3N04A 1FFQA 4JX6A 4C6EA 4J3ZA 4GO9A 4C6MA 3NUKA 2JALA 3O07A 5K7JA 4NSBA 3TMLA 3VO0A 1VPYA 3PHAA 3CV7A 4ZB5A 1H1NA 3GYEA 3L68A 2Y89A 1MXDA 1F7BA 5IFPA 2HDJA 1XX1A 1F6PA 3S5YA 3C61A 1C93A 1E6RA 4OHQA 3VDCA 3ABOA 3KCLA 4EOUA 1FWBC 3WBEA 3GH7A 3W73A 3WO8A 5JBDA 4GY7A 1YHTA 3L66A 3VDBA 1EUAA 4WX2A 1FWFC 1XUUA 3HTWA 3BPWA 4XSMA 2DW7A 4LS0A 5HNUA 3TE9A 3GO2A 5FJIA 2DPEA 3AMGA 3WQEA 3CUXA 2BHUA 2C1GA 2E68A 1EPXA 3ZMRA 4JXCA 1CX9A 2VX6A 3O0FA 3EYPA 4NAEA 3XISA 3AS0A 3IUIA 3A3HA 3NQVA 3UGRA 1KB3A 1TTJA 3RG6A 1ICPA 3MB9A 4ZL1A 4IMEA 3BL3A 3A4JA 4QS6A 3NM1A 4YHGA 4H7CA 4XZBA 2EKCA 4DJEA 4S3BA 4YTTA 1TPUA 3TYBA 4M8UA 3ARPA 2Z1VA 4TO8A 3B0VC 1UKOA 4GLEA 4RPPA 2FZBA 1V77A 5REQB 3W00A 5A1AA 1XINA 4QBXA 3GHRA 4FNTA 3P67A 3LM7A 3LHUA 4IFKB 2FH8A 3W2JA 4G5DA 5E9XA 1TPB1 1MRAA 1TSIA 1W2VA 4JX4A 1WXYA 2IXVA 2YLLA 3AZRA 4JHMA 1JZ2A 2P0OA 3ZXWA 4U5IA 4GINA 4NP7A 4YN5A 3KVKA 3UXAA 3FW6A 1Q7MA 5CPOA 3V4BA 2BOGX 4UZSA 4K68A 4AZHA 2E6FA 3UNTA 3WSUA 1BRLA 1OB0A 4C7GA 3UYCA 5CJMA 3AC0A 4PL1A 4DJDA 1OFOA 3VZXA 2W67A 2Z2BA 1L2QA 4D6JA 1LYXA 2V2DA 1MNSA 2HROA 3TYZA 3A4WA 4IXHA 1BXCA 1PYMA 3UWUA 1NM9A 1E1FA 5AVHA 2EGZA 3VIHA 2V67A 3LXBA 1OG6A 3JRKA 1PV8A 2HK0A 1QJWA 2E8ZA 3CUJA 2DU2A 3ZLGA 4QJ3B 3AIUA 2FZMA 4Y9OA 4LFYA 5FF4A 3W72A 3OBEA 4XD6A 1Q2SA 1NAL1 2WWDA 4MY8A 2XGIA 1GHRA 3I6TA 4F0KA 4NX5A 2AGTA 4UTWC 4O1CA 4U4MA 3STPA 3VU2A 4EXBA 4PB4A 1EWDA 1ZZMA 3NEHA 3F4WA 2ZICA 1KM6A 1JCNA 1SO4A 3TSDA 3W2KA 1XLFA 4NAEB 3M6YA 1ZPTA 3M47A 1DXFA 4UC5A 1CGTA 4RNJA 4GK8A 1F6KA 2YX0A 2WVTA 4AG0A 4S3EA 2B31A 5D8ZA 3FN9A 1SZFA 5DBTA 3VCCA 4OIFA 4Q8NA 1NU5A 1B9BA 1NFBA 4JDBA 3CGTA 3CIWA 3E0VA 4IZGA 3UA4A 3TR2A 4PMXA 3EDJA 2A5HA 4Q22A 3ARRA 1B3VA 4RCXA 1UWUA 2OELA 3IIPA 1BFNA 1HN1A 2ZDSA 1MFVA 1FVPA 3SZ8A 4WGXA 1F73A 3KOWA 3NO3A 3VGGA 4QLJA 4H9MA 3WKZA 4Q7IA 2TMDA 1C90A 1SFJA 2OG9A 4UZUA 2ZA2A 1Z41A 4WD0A 5CC6A 1U1UA 4N0RA 2J6VA 3CQHA 5K9DA 1YEYA 2WSYA 5H1WA 1ADDA 4FAMA 3OB8A 4D8ZA 1W17A 4A3HA 4BQ3A 3WK2A 2L5HA 1VH7A 1YTKA 2PP1A 1AODA 3DFSA 3APYA 1C3FA 5FJOA 4GJJA 2DZUA 4HU8A 4IGNA 3G1HA 3ORWA 1TIWA 3OYXA 4LX4A 2EBNA 4CQCA 2W61A 4P8XA 1XKYA 2OR2A 1Z32X 3VDHA 1H7OA 3CHFA 1JAKA 3O0KA 4CEXC 2NQ9A 2PLMA 1UD8A 4ZB2A 1BRLB 4NZJA 5CPTA 1KWKA 5GJPA 4Y90A 1DIKA 2YL8A 3U48A 4B5NA 5JH1A 1E0XA 4HOZA 1T8QA 4MY9A 1J18A 1MQQA 4XZ9A 3RCMA 3ITXA 3P62A 1EDGA 3CQIA 1UKQA 1W1YA 2WB5A 4CD5A 4H4IA 3JW7A 1TE6A 2XISA 2AL1A 2IQTA 1XI3A 3HGRA 3R1ZA 1EP1A 1A50A 1A3HA 3UJSA 1Y7VA 4DXKA 2E9MA 1WV2A 5KMYA 2BOEX 2YFNA 3OZOA 4OQVA 1U83A 3U4AA 2DP3A 4B90A 4DO7A 3T8QA 2EEXA 3DECA 4GJIA 3M5YA 4UIOA 1XLLA 3SY8A 4PODA 5I00A 5FSEC 2DSWA 3KZSA 4ICMA 1QHPA 3MHFA 1JI1A 2P5NA 3XIMA 2XSBA 3WN6A 4NT0A 2ZUUA 4WUIA 3S1XA 4CNPA 1W3TA 3AUJA 2ZX8A 3UZJA 1OHLA 4Q3MA 3LSBA 1TRDA 3KFTA 5I2UA 2VTFA 3HPAA 1VRDA 4JFUA 3GVQA 3CIXA 4DPQA 3U5YA 2QAFA 2PFHA 1YDYA 3L5MA 4U33A 1M41A 2FB3A 2D23A 2TRSA 2TYSA 3EMQA 1UJPA 2GGGA 2YR1A 1ITCA 3H2CA 2FGBA 3LV5A 4A2SA 3S3GA 2QCHA 3VOIA 1H7RA 1OJXA 4EVZA 2PD9A 4M6QA 3KOZA 1TX2A 4PMOA 1CEOA 4BFAA 5I3FA 4JTRA 1L6YA 5KETA 3ZQ9A 3DUGA 1LBFA 4BF9A 1EZ2A 1O4UA 3D3AA 4TQTA 4HOWA 3PF3A 3DKLA 4Z1BA 3HV9A 3OZMA 3A9IA 5JQ9A 3C0QA 1VBUA 3BWWA 3TW9A 4F79A 4RNIA 4RDWA 5A69A 1FQ0A 3V1HA 1TPWA 4KEZA 3LXCA 4LJ3A 2G8ZA 2QIWA 3MJYA 4JHZA 3ZS4A 1GCYA 3HGOA 1Z69A 2G37A 2CWNA 3TQPA 4JNZA 1FWHC 2G3FA 3WD2A 2GJXA 2QPUA 4H7VA 4RV3A 3UZ5A 5HDRA 3BLDA 3UQNA 1E9YB 4M6VA 1TPH1 3BJFA 1OVDA 1PZ1A 2DUXA 2WLYA 3SJ3A 4DXVA 1TTQA 2AQWA 1LZOA 4UTFA 2BP1A 3AMDA 5CC5A 1KTNA 1OABA 4O18A 1OGGA 1KRMA 4DQWA 3SCOA 2DT0A 3GTXA 2E0PA 4UFJA 5LKYA 1FP8A 1VYPX 3EWBX 1B2YA 5LNVA 1W5PA 2QXWA 4RE3A 4B2DA 2DSKA 4JKKA 1GHSA 3KBVA 5GNZA 4PB5A 3GYCA 3RJYA 3S2NA 1H7WA 5D33A 2WQDA 4GD0A 2A7PA 4J3SA 1VJIA 2VRQA 3UR2A 2X8RA 1QVBA 3CAQA 1DXEA 4GH1A 1UR4A 4ACZA 1FH8A 1WAWA 4GWEA 3SUUA 2F38A 1J93A 4W87A 4GUIA 4R3UA 3ZWSA 1HZYA 4N9BA 3N3TA 1K4HA 4KETA 3SGUA 4XZWA 1W3IA 4IQJA 5C7HA 5BXSA 2H9AA 3FDKA 5HNNA 1Z3NA 1ZHAA 3AZSA 3F03K 3HOJA 3EWCA 3KBWA 2XTKA 3L4WA 3WNNA 4Z2JA 2IW0A 5C8BB 2P1FA 1HJQA 2IKHA 1CPUA 1X7FA 4PMYA 4HPXA 4KIEA 2FGZA 5DXYA 3EMCA 4AZIA 3GU1A 3TU9A 4HSNA 4F2TA 1YTDA 4D6IA 1MEWA 3GFZA 1U5JA 3LPPA 4YL2A 4AY1A 3IJLA 3WQ8A 1BVZA 1MEIA 4KWUA 3TV8A 3L4UA 2EKGA 1RJQA 1QU4A 2P50A 2QMJA 1CENA 1CXHA 3R6IA 4MWAD 1PTAA 4JIHA 2X0YA 2RGLA 4BCEA 1L6FA 2XN2A 4HOXA 5ABEA 4MKNA 3CPRA 3VOGA 1YNQA 3TN6A 2GJXB 4I9AA 1A49A 1C8YA 3GW0A 4V15A 1W5OA 1W9UA 4CGTA 2VR5A 2FHFA 4IIBA 3EDKA 4GH3A 3CTTA 1B90A 3KXQA 4NAFA 1WZAA 1H7PA 4BQ4A 1V7AA 2I9UA 3TSBA 4B5VA 3REQA 3PPCA 3LPOA 1QW8A 3WBYA 4DWSA 4AMCA 2Y8KA 2QCLA 3EXTA 2WYSA 1FWNA 1OY0A 1R6WA 3E74A 5CZKA 2VC9A 4HA4A 3SRKA 5XIAA 2HS8A 4CCCA 1GVSA 4JFWA 4GXPA 2QQ6A 4US5A 1T40A 3C2EA 4Z42C 1DIOA 3WNMA 3EKLA 1JRBA 5E93A 3QKZA 2YCEA 1M68A 5TF0A 3TA6A 4NUWA 5PTDA 4ACZB 2XVGA 1WP6A 4WSHA 4GOAA 4FXRA 2XFYA 1PWLA 1PZ0A 5CJNA 5A5WA 2P88A 3T0CA 5J5RA 4HB7A 4W7WA 3N9KA 2CERA 2WPGA 5LYRA 1M03A 2PB1A 3M0ZA 4WHBA 3QR3A 3E2QA 2H9AB 4CN1A 1GONA 4OE7A 1UMYA 2PTDA 1EA9C 2Y7GA 5LXEA 1DJZA 4PFMA 3AISA 3B8VA 3QPZA 2NQ5A 2VGBA 2XFRA 1JD9A 1UKPA 4GYPC 3WD4A 4X60A 4UMBA 3GUWA 2QCNA 1JCLA 1NY1A 3H6OA 3OP2A 3H2EA 5ABGA 3B9DA 2D2HA 3SCNA 3H7UA 3QC3A 2PC8A 1IEWA 2XU2A 2A1YA 1UD2A 3S6OA 1H0GA 3GRIA 1ICSA 4DZIA 2OOFA 3FGCA 4R7WA 3PUOA 1RLCL 4ZO6A 3SBFA 1WDQA 2D24A 3NL6A 4QDPA 2E67A 4O52A 4E3TA 2WC4A 3BSHA 4C6BA 4NL1A 1RBOB 5D03A 2B4GA 2PWFA 1RPKA 2DH2A 1Q6RA 3CYJA 1JGIA 1DL3A 5FD0A 2PWEA 3W88A 4DX3A 3HPZA 3SCVA 4FZIA 3STEA 1TJ2A 1B3OA 3CMFA 4GY0A 1F4HA 5T91A 4K38A 4KPLA 3CHDA 3ARVA 3LY0A 1UWTA 1SGJA 1OBAA 4LVGA 1GOXA 4P7OA 4BWLA 2BBFA 3AXIA 4NAFB 3ANVA 4GYFA 4MZ1A 2O9RA 1ALDA 3UG3A 4K6AA 3REQB 1JPDX 5BWFA 1W5NA 5H8PA 2A6NA 1WO2A 3RX3A 5LNRA 3USZA 3CAWA 4P2VA 1EKOA 1WA3A 1R2RA 1ZSXA 3VNLA 1VEOA 4ZXLA 1VCGA 1KBBA 4LTSA 1D3GA 5GJNA 4ZTXA 3B03A 3UWVA 4U28A 3FYOA 3R79A 2GVYA 1E6PA 3VGFA 4WIWA 5CZ0A 1O12A 1JF5A 3AYTA 4MVAA 3V35A 3QOMA 3VZYA 1IEQA 2X30A 1JDCA 3RU6A 3OEXA 4XKMA 4TX8A 2Q3RA 4PR4A 2PP0A 3IIVA 3CT2A 2G3NA 2FHBA 2ALRA 2PS2A 4C5YA 2CCRA 1B3ZA 3RPTA 5AC4A 3GH4A 3AIRA 3GK0A 2NV2A 3B4UA 4QROA 2C16A 1EJTC 5JIPA 4KCWA 4LCSA 2WZMA 4QEEA 3R8RA 3CUIA 2GPTA 2CLEA 3A22A 2QVNA 4DIAA 2VEMA 1BKHA 3GKFA 4AYGA 4E4PA 4QE4A 3N4EA 1V02E 3RXZA 2QCDA 3NZGA 3UWZA 3MCOA 2HE5A 1S38A 3N12A 1ZLPA 3GXFA 1FH9A 5FF7A 3ZFHA 4HU4A 2CZDA 1EOMA 2ZOXA 4M3PA 7REQA 3T1GA 4KT2A 2PAJA 3FGCB 1R9XA 1J0HA 4TV6A 4O1BA 1YDVA 4UNIA 1Y5XA 5F4WA 2DZVA 4JIPA 4ROPA 4X63A 4JTSA 1H2JA 3KWSA 1ZCOA 1HJXA 3CC1A 3XINA 3NZQA 1ZB5A 1SFLA 3P6LA 2ZUWA 4B3KA 3H54A 4MHBA 1LP6A 1V0LA 2DVXA 3HG2A 2VD8A 3TQ0A 1FWEC 4PRRA 4KEMA 3E12A 4DUVA 5EL1A 3WNKA 3NWRA 2VUNA 4H1ZA 4W85A 2CZEA 2WZIA 3T4WA 2OVLA 3DXIA 3A24A 3AJXA 4M7TA 2PDPA 1QOXA 4HCHA 4RDYA 4X0NA 4PBGA 4LV9A 3T55A 1Q6QA 1W9VA 3HO8A 5HANA 5FAGA 1EL3A 3NFUA 2R14A 2I7GA 5HJYA 4G7FA 4Y9MA 3VM5A 4CVWA 5IXEA 1JPHA 3RO8A 2E9BA 4O28A 1PL9A 3AMCA 1OQFA 1CB7B 1FWCC 3RMJA 3VDGA 3N2MA 3WQDA 2O92A 4POCA 1IE7C 3YPIA 5FJPA 4MJ2A 1V8EA 5EFFA 1AL8A 4CD7A 3QN3A 1O95A 3IEBA 4JOMA 4JQ4A 1V3HA 3D47A 2O9TA 1Z6KA 3LPFA 1HXJA 1M04A 4OV9A 3VKBA 1EZWA 4UFMA 4E3VA 4QJ5B 2FMOA 4WDUA 4XZLX 3MDUA 3GM8A 2YDSA 4JIQA 4MNMA 4Z2LA 2AQOA 3W6MA 1ME7A 4ZODA 1WQ5A 2E3ZA 3WMCA 3T40A 3W83A 3K8MA 2PC4A 5CSUA 5JH2A 4W7VA 2VWTA 3H53A 1OIFA 4TVCA 3KL3A 1JGMA 5CPSA 3QTPA 4GUFA 3QSTA 3EWUA 1RQBA 1XFBA 2IPGA 4ZA0A 3K46A 1ZGDA 1MW1A 1Z48A 5DO8A 2C6QA 2QCDB 2G3MA 2J47A 4GI8A 2OEMA 1DV7A 4D6HA 4X2PA 2ZUNA 1IWAA 4K3ZA 7REQB 1OK6A 1SW0A 3M16A 3W1TA 4IIEA 3W1UA 4J3UA 3L67A 3OLGA 4KRTA 2VDIA 1TO3A 3P5YA 1L6WA 4OBSA 2DV0A 2AKZA 1EIXA 1VEPA 3VKCA 1PTGA 3GG8A 1TR1A 5IM51 4J9JA 3U9IA 2V2CA 4INFA 2ZXDA 1V5XA 4FOJA 4M81A 9XIMA 3RLHA 3IV3A 3OGVA 3TMQA 1VP5A 1CGXA 3BK0A 3WFZA 3FAXA 1UD5A 3EDEA 3QFWA 1REQA 3GX9A 2QCMA 3SB0A 3O16A 2A3BA 1ZENA 1WOAA 2DVUA 2WZTA 1CXFA 3QVQA 3DDMA 1V4YA 4U31A 3D3FA 2YB1A 1CTNA 1R87A 1KA9F 2NV9A 3ITLA 3WK3A 3U3HA 5AC7A 1WCGA 4J5NA 1K4GA 2O7SA 1PS9A 2BB0A 1PX3A 3ARSA 3BLPX 3NA8A 4E4FA 1VJSA 1S1RA 1AZ1A 1UD6A 3UWQA 3MV11 3AZTA 1V7YA 4LUJA 1LRQA 3QZEA 2Z1WA 1E1EA 1EH9A 3F1QA 1S2WA 2QV5A 3VOJA 4BZYA 4WCJA 2HEJA 4C7FA 1KRAC 7ODCA 3QBUA 1R3QA 2IQDA 5DCEA 1XD1A 1B1YA 1G4EA 1Y5WA 3GVWA 3W22A 1UHVA 2VEPA 1EGVA 1JDAA 3F5KA 4FLQA 3QHOA 4IL2A 3E2SA 2XIMA 2Z4GA 2EQDA 1O6IA 1V51A 1R47A 3ONBA 3RX4A 4FXSA 1GKQA 1E55A 3EWYA 1UBSA 3LB0A 1LJYA 4JYFA 2PDMA 3WJWA 1LQ0A 1BQCA 4GQRA 2HBXA 4RXGA 5AOUA 3WK0A 1NWTA 3H7VA 1G01A 3GDKA 3AXXA 3WQCA 3MBFA 4LVAA 1AQHA 2HCVA 2PWGA 4EAMA 2VFDA 3DHPA 1B31A 2QCFA 3G24A 1UC5A 1MQPA 3I10A 2QHAA 1CCWB 3GXNA 1TV7A 4AB4A 2R94A 1MXGA 5D32A 4GMEA 4PSPA 1OM0A 3NQGA 1J12A 4NYUA 4Q8TA 4N2YA 3DG3A 3IV8A 1BD0A 1REQB 5AYXA 2DQWA 1HJWA 1DJWA 5RUBA 4PH6A 2EPKX 4PUJA 4I8DA 2J8GA 4JCLA 2GDQA 4O13A 1Q2RA 4LF1A 1YE6A 2EHHA 4RZ4A 3LNMA 4US6A 2OX1A 1OF8A 4ZO7A 4UOJA 4UTWA 3CPUA 3BG3A 2FQIA 3NQ6A 3RIKA 3M44A 5A8MA 6CGTA 5BROA 3IIZA 1OFAA 2BVDA 3ITGA 3THUA 1FCUA 3A9BA 4Q4KA 3W6LA 4QEHA 4RE2A 4HA0A 2E6YA 1SW3A 4PMQA 3VKKA 5HWJA 4MLJA 4UFLA 4GBDA 4WKFA 2ZVRA 3L4TA 3PY2A 5CG0A 3KAOA 1HO4A 1DWGM 1LTDA 2A6LA 4HYWA 1W1IE 4B5WA 2WHLA 1PDZA 3RO6A 2WZHA 1E1CA 3QC0A 1B3XA 1R9ZA 3EPOA 4OKDA 3PJWA 2H3DA 1M53A 1DWFM 2PDUA 1O5XA 4A21A 2QUTA 4H2CA 3IJQA 1HUVA 4I9MA 2PRHA 2Q01A 4PB3A 1P0NA 2E4TA 1ITUA 2I5QA 3SEPA 4FP1A 2Y7EA 3W85A 1XLIA 4R9XA 5EY5A 4GNVA 2PBGA 3SY1A 2WJZA 4UFHA 3ZSTA 4K8GA 4GACA 4B16A 3WLIA 3MP4A 2CZFA 1UQYA 3FEQA 1HGWA 5IHRA 1CB2A 4F0MA 4IHCA 1FA2A 2QCGA 2UY2A 4IQDA 3RR1A 4NVTA 4GNJA 2QJJA 4WXYA 1WBHA 2ICSA 3N15A 5LA1A 1LT7A 1J01A 2INZA 3KBNA 4MKVA 2E77A 4D1JA 3UF9A 5CAHA 1KGWA 3GNXA 2J78A 3JVAA 3HV8A 2W66A 2JKPA 3GUGA 3CWNA 2YA0A 3SRFA 1CI1A 3LM3A 3OBKA 3C2RA 3S2MA 4N4QA 2NUXA 2JE8A 3W37A 4FOKA 4DI9A 5JUVA 1YQ2A 1AH0A 3OGSA 1GOKA 4WJEA 4LBUA 4KMQA 3NQAA 5JU6A 3BG9A 4ATDA 3WD1A