3NQ8A

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r4 8/5a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
247
structure length
246
Chain Sequence
LKASSLRALKLMHLATSANDDTDENVIALCHQAKTPVGTTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADGVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLSVIIETGELKDEALIRKASEISIKAGADYIVTSTGKVAVGATPESARIMMEVIRDMGVENTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASGSLLASLLKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
total genus 99
structure length 246
sequence length 247
ec nomenclature
pdb deposition date 2010-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nq8A00
3SGZA 4UFHA 5DN1A 1WOAA 2J9YA 3BLEA 3ZR4A 3RMJA 3H54A 1OX5A 3QMTA 3W74A 3GDLA 1OG0A 4K37A 3O1NA 3L21A 3PUDA 3BGGA 4GFSA 3G1DA 3RFAA 1K8YA 2WOQA 3B4UA 3MHFA 5LNWA 3P61A 1THFD 4NX5A 1A5AA 4RR4A 2V2DA 3EXSA 4X22A 3MBFA 3Q94A 1O4UA 3FYOA 2CLHA 4UFKA 1WYIA 4O18A 1QPOA 5A5WA 3S5OA 3N9RA 5EY5A 2YXGA 4C1KA 2YZRA 1S3HA 4XUGA 3HG4A 2FPYA 4BI6A 4FNUA 2F84A 1KV8A 1PCKA 2NX9A 1QFEA 1A5BA 3F03K 1FQ0A 2WSYA 1PVNA 2UV8G 1OYCA 1XBYA 1PIIA 2ABAA 5LHFA 5I3JA 3PM6A 2WNQA 1XDMA 3PG8A 3HGOA 2H90A 5DCDA 2H3BA 4XBKA 3KVLA 1QCWA 3TIMA 3W83A 2WQPA 5D2VA 3CIXA 1D3HA 3YPIA 2NV2A 2J88A 3UWYA 4NQ1A 3NG3A 1BKSA 5DBUA 3HQ1A 4FNTA 4QISA 5BOOA 5D05A 5DCEA 4UNLA 1GJPA 5AOUA 3W2NA 3HPXA 3NPVA 4QNWA 3KX6A 2CLOA 1JQXA 1A50A 2BSLA 1SQ7A 4A22A 3C2EA 4UFLA 3TUUA 1GVFA 4OBTA 3DI1A 4JTIA 4Q4KA 2VFDA 4FO4A 1OX4B 2Y85A 4RLIA 3NQ7A 5J5RA 1V7YA 5D03A 1F7BA 3B05A 2H3DA 1FXPA 2CU0A 4O50A 4JTSA 2BZNA 3PBYA 1LOQA 3KRZA 4YWIA 3NNTA 3F4WA 2Y61A 4H4IA 4JTEA 2XN1A 1OJXA 1H60A 3STEA 1NSJA 4LRTA 1MO0A 4JICA 5HWNA 3FYPA 4KWVA 3CM4A 5EL1A 4UCGA 2D73A 3G18A 1JRBA 3TU9A 3BLIA 1VPXA 2F7FA 3K30A 4EIVA 4UTUA 1JCLA 2DP3A 5G2WA 5TBOA 3VNDA 2WKJA 1DORA 1K02A 3QSRA 5EMUA 1P1XA 4N02A 1SR9A 5DXXA 3S8HA 3BLFA 1X1OA 4AEOA 4HHPA 4AVFA 3W73A 5BW6A 2C16A 1FCUA 1TV5A 2X16A 3S9YA 2HS8A 4FB7A 3PVFA 2Z6JA 4MKNA 4QNEA 1S5VA 1FCBA 1KFLA 3WJXA 1XXXA 3TROA 1Q3NA 1K8XA 3DU0A 3EWWA 5CZTA 3LDVA 1QDSA 5AN7A 4FNPA 1M7OA 1NEYA 4EVZA 3A23A 4OV9A 1OFAA 1TRIA 4NZJA 4TX9A 3RF9A 4N2YA 3HGJA 1MEHA 2VELA 3TMQA 1Q6OA 2I9EA 3VI2A 2WPBA 1Q6QA 1G7VA 1K03A 1XI3A 1G4PA 4AHQA 4LVGA 1GYLA 2B0MA 2VFGA 3G3DA 3VE9A 2TSYA 4PA8A 4UTWA 4O1DA 2FIQA 4ZQMA 1LOSA 3O6YX 4K7YA 5D2YA 2XFWA 3W84A 5FF7A 1TREA 3ANYA 4AWTA 5F1UA 1EX5A 1XM3A 4GNJA 3V1PA 4XQ6A 3PBUA 3TH6A 3EKZA 4IMCA 2B7PA 1WXJA 1UBSA 1KFBA 3MBDA 1T8XA 5FEPA 1NFBA 4ML9A 1MZHA 3BW2A 3IGUA 4XKYA 3NR0A 3HPSA 3BG9A 3IIXA 1EPXA 3W85A 3QRHA 2E6AA 3B03A 2O7SA 3EEGA 3HIJA 4DXVA 2BLEA 4HSOA 3A24A 1X8FA 4PCFA 5AC8A 1W54A 4O11A 4J9JA 3NO5A 3TA6A 1FY6A 2J9XA 1O94A 1PV8A 1XUZA 3P62A 3F1QA 3S1WA 3GDMA 1PL9A 3W1MA 3STFA 3DZ1A 3W22A 4LRSA 1VZWA 2QJIA 4HN4A 3ZWSA 1FWNA 2ZCGA 2QKFA 1WAUA 4O1CA 5HR6A 1YYAA 4IXHA 4CCDA 4E2BA 4DBEA 1LRNA 4GUHA 1X1ZA 2QCCA 3LCLA 2ALDA 4KFPA 1GT8A 5FF2A 3GDKA 1VCFA 3QQ1A 1R47A 1V5XA 1Y0EA 3LERA 3HG2A 1TPC1 4M6QA 2BWGA 4TU1A 4RX0A 2ZDRA 3GZ3A 3UWZA 3M5ZA 1L9WA 2ZBTA 3W88A 4O8RA 3TXVA 2FB2A 2AQWA 3W1LA 3P81A 5EBUA 1KBIA 1TJPA 2NX1A 1M7PA 3MI2A 3EX3A 4WY0A 1OFEA 6TIMA 3MWAA 4IX2A 1VGAA 3N2MA 3BG3A 3CEPA 2J24A 1LBMA 4N9DA 2TPSA 2QCGA 1F5ZA 4MFDA 3KOFA 1GEQA 4ZQPA 3L5MA 4E38A 1TJRA 3P74A 3QC3A 2CLMA 3C6CA 1VJIA 5F2IA 4RCXA 1LDCA 1SSDA 3L2IA 3P8JA 4O53A 3D0CA 1IIHA 3IVSA 3PC0A 2A7RA 1LZOA 4PFMA 5AYXA 3FJLA 4BK9A 2TYSA 5D2XA 3OVQA 4DO5A 3C61A 5HJLA 1ME7A 2ZRUA 3FS2A 2QJHA 5LZLA 1XFBA 5HNRA 2V5BA 3NQAA 3C4UA 4GUGA 5I3IA 2QDHA 1GTHA 2ISVA 5LNVA 4WXZA 5U4NA 2A0NA 3A22A 5E93A 1ML1A 2H8XA 3W72A 2E6DA 4IXXA 3UY8A 3N14A 3QFEA 3CB8A 3QW4B 3TQKA 3MI6A 3VFLA 4PODA 3B0VC 2C6QA 4PC8A 1FWRA 4K7VA 2ATMA 5KTLA 5F4WA 4AMAA 3KVJA 3HGRA 1XKYA 3S42A 1ZAJA 1W5OA 3T40A 2Y6ZA 5AYZA 3TW6A 4UMAA 1DKWA 5FEZA 3I65A 1KM0A 4Y9AA 1KFKA 4N4PA 1H51A 4JD4A 5EPDA 2WJZA 5HUPA 3PB2A 5FF4A 5CGQA 3UNDA 4L4LA 2LLEA 3CIWA 1PHQA 3CEUA 3EXTA 1DOSA 1LLZA 2A6LA 1OF6A 1ZNNA 1W1ZA 1H1YA 5GVJA 1VLWA 4QIUA 5D02A 3TQ0A 2BXVA 1KFJA 3L66A 3TR2A 1RQBA 3EB2A 1ZAHA 1FDJA 1OFDA 3LTSA 2VFEA 4IMGA 3G1VA 2R94A 1YPFA 3WJSA 4DO4A 1L6YA 1G4EA 1WBHA 1LLWA 1ADOA 2ISWA 1HTIA 2YFOA 4K8EA 2E5DA 3W86A 5CPLA 4ZL1A 1LM1A 3C2FA 2ZQ0A 3G1FA 3SZ8A 2FFCA 4S2BA 4GWEA 1OFQA 3B06A 1SPQA 3GDRA 5KITA 2A7PA 1ZY9A 1C9DA 5G1YA 3W7HA 3I7QA 3A5FA 2NX3A 3S1VA 2QCFA 4N9BA 3NPXA 4JIPA 3M7WA 3THQA 5F4XA 2ZA3A 1GOXA 1LCOA 1NVMA 2ZTKA 3T4CA 3QH2A 3NEVA 3W70A 4IWWA 4OQVA 3G3MA 3NYZA 1QPNA 1UB3A 3R12A 4IMFA 1T96A 5DELA 1D9EA 2DZSA 3CC1A 1OFRA 3O6DA 3MO7A 4LC6A 4OHQA 4UXDA 2C15A 4Z1CA 4IMDA 3LBMA 4NX0A 3NDOA 3H53A 4O1AA 4ZMGA 5C2XA 1L6SA 2G96A 3W1RA 2DZXA 1LROA 3GNNA 3OVRA 3F4NA 3LBCA 1DV7A 3JS3A 2QUVA 1RV8A 4YL2A 5DCBA 3TSMA 1SO3A 5CPOA 4X9SA 2RHGA 3BARA 1ME8A 4CQ8A 5LNSA 1ME9A 2V82A 1Q6LA 2Z6IA 2OT1A 3P67A 1ALDA 2QCHA 1M5WA 3LGEA 4QITA 4JXCA 6ALDA 4O16A 3T55A 4M7SA 3NQMA 5BRBA 3C2VA 1X6UA 1LORA 1OYAA 4K36A 2Q8ZA 4ADUA 1IIGA 4HNTA 3L68A 1Z48A 3PWAA 3W2MA 3QF0A 1JCNA 3GNDA 3PSWA 3UPWA 4DF1A 4UFIA 1P0NA 2PURA 1YTEA 1CX9A 3TSDA 3LRMA 1G67A 1B9BA 4UTWC 3LV6A 4RXGA 3L0GA 1QPRA 3O15A 3NL5A 4XBSA 3UYCA 4NU7A 1KTNA 1YTKA 1K7FA 3TAOA 1P5BA 2DORA 3G0UA 1JCMP 4JTHA 3CHVA 2X1SA 3P8IA 3GR8A 1IXNA 2GQ8A 3O63A 4PL1A 4AH7A 3TFXA 1VH7A 1F76A 4E0CA 4NJJA 4K8HA 4M7TA 2NWSA 3E02A 4AF0B 1H7XA 4UNKA 1GVQA 4NT0A 3L5LA 4LUIA 4WZHA 4JX6A 3HJZA 2FTPA 2X1RA 3TQVA 1CW2A 3HG3A 5DLCA 3TC7A 3LRLA 3S5YA 1KTCA 1FWTA 3P82A 2CFFA 1R46A 2ZZ1A 1O60A 5FEXA 3RK8A 4O57A 3E49A 3TJXA 3TC6A 3ZS4A 1T0OA 1W3TA 1F6PA 3W2LA 4QM1A 3SSJA 5BNKA 1WDWA 2GJNA 3SW6A 3SIZA 3LLFA 3UY7A 5CSSA 4R34A 2ZZ2A 2W6RA 5D2WA 2E68A 4Y96A 1UUMA 3L0KA 3HPZA 3LXCA 4W9TA 4BWLC 4UUIA 3GDTA 3IIZA 4FX7A 3S6DA 1AL7A 5AB3A 2GVJA 2ZA2A 1B57A 1A5CA 3W7DA 1N8FA 3MHUA 2RKXA 3VKJA 3PULA 4FXRA 4FIQA 1ZJIA 4U4MA 2RH9A 1UUOA 3HGSA 1GVSA 5H2ZA 3NQEA 3KHJA 3W7QA 2TMDA 4IGHA 1NAL1 2VEMA 3DFOA 3SI9A 5DBTA 5A8GA 4EOUA 1TPDA 4YCOA 2OZ0A 4LV4A 4PL2A 4N9CA 3WK3A 1LP6A 3GLCA 3JR2A 2EGZA 1X7FA 3JRKA 1F74A 3KFTA 3OIXA 2QCEA 3HBLA 3UQNA 4UMCA 7TIMA 3G1SA 3Q58A 3U2OA 4ALDA 2V5LA 1H50A 4FNSA 2G97A 1TRDA 3DGRA 5D04C 4GUFA 4FNRA 4E2DA 4I7WA 3N3MA 1I2PA 4Y90A 2E1DA 3EWXA 4Z08A 3TSBA 3GXNA 3FKKA 3QW3A 4MZ8A 5F2LA 3M5VA 3LOTA 2NXIA 3HOJA 2C0AA 3FOKA 4O19A 4WQ6A 1DVJA 1VQTA 4POCA 3QM3A 1PE1A 1WBJA 2VFHA 2Y7EA 2Z1BA 4JGDA 1ZHAA 4QAIA 1FX6A 5U7SA 3TXZA 3FFSA 2X1TA 1DJQA 4N6EA 1W5NA 3T78A 3TK7A 3NVTA 3NZRA 2ZZ4A 5FF3A 2GUUA 2I14A 1O5XA 4LS1A 3TX9A 4QJ1A 5CG7A 4UTMA 3U6WA 3SECA 4GXMA 1KM4A 1RPXA 3FIGA 4WD0A 5G4EA 1OX6A 2EAWA 2QDGA 2NXHA 2OMAA 2Y70A 1TTQA 3G1HA 1H7RA 1TPH1 4P2VA 5KINA 1OF8A 4BF9A 1G69A 2V8ZA 3INPA 1IF2A 2RDUA 3O06A 3MMTA 4NJHA 4AWUA 4HNNA 4NXSA 2PC4A 2Y89A 2CWNA 2ZZ7A 1OK4A 1OX4A 2JKPA 3A9IA 2YCEA 1LYXA 4YMZA 4LS2A 3DHFA 4Y6GA 3PB0A 2QR6A 4O28A 3QPZA 3USBA 2VEIA 3W7LA 3P84A 1LBLA 3UPBA 4GBUA 1W0MA 1NF0A 3NPUA 4XTIA 3MUXA 4AAJA 3N9SA 5FEWA 5D09A 4WY0F 1EWEA 1HUVA 3NAVA 3W07A 3PBVA 4WJEA 1W5PA 2VXNA 5EYWA 3RNDA 2CZ5A 3NM1A 2P10A 2QJGA 4JYFA 5D32A 2EF9A 1QR7A 1SO6A 3LTPA 3GB6A 3KXQA 3STCA 4Z0SA 3G0SA 1I2NA 1RVGA 1SFJA 2C1HA 2HS6A 3W1NA 1QAPA 5DY3A 4OU1A 5K7JA 5AHLA 3TDFA 3W7RA 2A21A 4LNYA 1SSGA 2DZTA 5LGZA 1R30A 2NV1A 3UXAA 4DEFA 4DF0A 3W7CA 1BWLA 3B8DA 3NQGA 3BVJA 4JEQA 3NPWA 3IV3A 2ZRWA 1KW1A 2Z0IA 3QMRA 1EUNA 1JJKA 3BGJA 3LV5A 3I68A 3DXIA 3OVPA 3CWOX 4MZ1A 4RXFA 3PSVA 4RV8A 3NQ2A 3IGSA 5FF0A 2ZYFA 1Z41A 2PRMA 5MHBA 4UTTC 2OX1A 2CLLA 1J4EA 5L6UA 2A7NA 4MY9A 1KV5A 4MYXA 4EWND 3I7RA 4ORMA 1L2UA 2ZZ3A 1HO4A 1OFOA 5HINA 3GKFA 4MY8A 3NQ8A 4O13A 2G5WA 3LHWA 1W3IA 1TSIA 4IX0A 5AHEA 3ABQA 4A2SA 4DPPA 4WX2A 1K7EA 1FWSA 2QUTA 5LKYA 3I6RA 2YYTA 4IUOA 1FXQA 1ZENA 2Q3RA 3P60A 4GRSA 3W7PA 3Q2DA 4ORIA 3W7GA 4LS0A 1JUKA 4IMEA 3W1AA 1W8SA 3B0PA 4CCEA 4Y8FA 4XKYB 4K38A 4AHOA 3C2RA 2YX0A 1BTMA 1I2QA 1LOLA 1W56A 5G4WA 1WX0A 2Q3OA 3PF3A 1EP3A 4O52A 4JTGA 2J9ZA 3GAKA 3BW4A 1VYPX 1SW7A 3IIOA 2WSQA 1I45A 4O12A 2YW4A 3CQ0A 5HQEA 1DHPA 2DZVA 3C56A 4LT9A 1DQXA 4MZYA 4CNOA 1H62A 2DJXA 4O1BA 4LOCA 2WSRA 4K6AA 1ZAIA 4Z1DA 5HWJA 1SZGA 4MLRA 2YGYA 2CLEA 3LLDA 1JVNA 3M16A 4HPXA 4JTFA 1M6JA 2PRHA 3Q37A 5K4ZA 3UWUA 1I8JA 5LGXA 2NLIA 4DO6A 3NL2A 4Q32A 1B4EA 3A21A 2FLIA 4N9EA 4JR5A 3CLMA 5AC6A 3IRDA 2CLIA 4NJKA 1JULA 2OCZA 4FX8A 4GJ1A 1HO1A 2GQAA 5E1QA 4JTJA 1AW1A 3BG5A 4JN6A 3MW7A 2WO5A 3OHIA 3GXPA 1BWKA 4UTHA 4O0ZA 4O15A 2Y62A 3HB9A 2B7OA 2OJPA 3KAOA 3QYQA 5K9XA 1WOBA 4IJBA 2EPHA 3LCWA 4I9AA 2JGQA 4MY1A 1B4KA 1RR2A 3LCXA 5AHNA 3QJAA 1KLZA 5F2GA 4IPIA 3WFAA 5ABTA 4R33A 5K4XA 2VEKA 3KVMA 2BTMA 2C14A 8TIMA 1LTDA 5KZEA 1S5WA 1TQJA 4NXKA 5CZ0A 5E0KA 3TCEA 4LC8A 2DU2A 1JR1A 3OEXA 3MP3A 4UFMA 4LVBA 5C5YA 3AJXA 4A2RA 4JTKA 3DBPA 3MHGA 1AW2A 5CZJA 3LHUA 3SJ3A 1EIXA 4HNUA 5AC7A 4AB4A 2JGYA 3CU2A 1LRTA 1RQHA 3LCIA 2GOUA 3DFTA 3NA8A 1R2SA 2FJKA 2QCMA 3W1QA 4JTUA 4P61A 1AG1O 4U28A 5KMYA 3M5YA 2V0TA 2VOMA 3TE9A 2XN2A 2DZWA 3TNOA 1OABA 1GG1A 3EWYA 3MP4A 3P5YA 4S2CA 1EEPA 4M19A 5CPNA 3QSTA 5EKYA 2WNZA 3EWBX 3NL3A 4ZQCA 1A5SA 4LWWA 1AL8A 3TKFA 1QNVA 1TPUA 3M9YA 3N34A 1KTBA 1R2RA 1TCDA 3L5AA 4NJIA 4RZ4A 5G2IA 2EKCA 4ADSA 2X2GA 1U83A 4YCPA 4CLMA 3N2XA 3ABSA 1WV2A 4IPJA 2CLFA 3DAQA 2Z2UA 2BX7A 2ZZ5A 3G8RA 3MYPA 2B4GA 1IXOA 2A4AA 2YYUA 4BI5A 3G1YA 3O16A 1SU5A 2FPVA 4ADTA 4LVFA 1G7UA 3B0UX 1Z44A 3NQCA 4JIQA 1EWDA 1ICQA 3DFPA 1YDNA 3TAKA 1YDVA 3QZEA 2ZRYA 2C13A 4JY9A 2VFFA 3LCGA 1SO5A 1ZALA 5I3KA 1XBXA 1UASA 1TPVA 2VFIA 3KVKA 1SZFA 4TMBA 1H7PA 1TPFA 1I2RA 1KM5A 5D38A 1H7OA 3U8GA 4TMCA 4WXYA 3GR7A 3NL6A 3FA5A 1QO2A 2YW3A 3LCFA 1GTEA 1XBZA 1L6WA 4ICNA 1GG0A 4LW7A 2XN0A 1G6CA 1GWJA 1TB3A 3HO8A 1TTIA 5AFDA 5D33A 1DQWA 1SW0A 4X3ZA 1JCJA 2ATSA 3ATZA 3EX6A 5I3GA 3GAYA 1KM2A 3N19B 3OBKA 4Z1BA 2TRSA 1VS1A 3MP5A 2QAPA 4RK8A 4K39A 3LM7A 4I7UA 2PE4A 1F6KA 3M5XA 3L9CA 1IXQA 1A53A 5BMWA 3LX9A 3EWUA 4FHAA 5KZMA 3W2UA 3UWVA 2O7QA 4OV4A 1TTPA 5AHIA 4MIMA 1VYSX 1OHLA 2CZEA 2ZRXA 4OE7A 3VCRA 3IEBA 3ZFHA 2AGKA 2QUUA 1KLYA 4NVTA 3L65A 2V2CA 3STGA 1BEUA 2E6FA 3M41A 4FIRA 2QF7A 3W7EA 1H1ZA 4NJGA 1I2OA 3S1XA 2VKZG 1SZNA 1P4CA 1VRDA 4JS3A 1Q45A 1QWGA 2X30A 3GX9A 3W1PA 5KZDA 2ZFAA 4AWSA 1FWWA 4JTTA 3QMSA 1W31A 3CT7A 3R13A 1IXPA 3S1UA 1PHWA 4YLWA 3G22A 1TV7A 5K3VA 4PEKA 4N4QA 3R8RA 1TTJA 3EXRA 1MXSA 4AF0A 5TIMA 1W5MA 2ZA1A 1FDZA 3OG3A 2R91A 2HTMA 2H6RA 2GVLA 2V81A 2ZZ6A 4JDYA 2FQIA 5F2MA 2JKEA 3H55A 2ABBA 2JBMA 4UMBA 4RKAA 1F2JA 4PH6A 4MJZA 5HULA 4JX5A 4FEZA 4WY0B 2P1FA 3DH7A 4O4VA 1KBJA 1VR6A 1G4TA 3DFQA 3MJYA 3W7IA 4WOQA 3PBWA 3RLUA 3W75A 5K9CA 2R8WA 1KFCA 4UIOA 2DZPA 4R53A 2YSWA 3C52A 2V2HA 1OYBA 2NUYA 4O54A 4ZQNA 3P5ZA 4YXGA 1J2WA 3M1ZA 1TPB1 3I7SA 4GUJA 4NZFA 3CTLA 4M6PA 4LVAA 4WUIA 4JY8A 4IOTA 4MPQA 4DF2A 5FESA 3SR7A 4UTKA 5D30A 1KM1A 5AHFA 3DKJA 4UR8A 1U5JA 5G1TA 5SWUA 3PUOA 1SZEA 5I3FA 3LHTA 1N7KA 2VEPA 4MYAA 3TJLA 3W7KA 3C0JA 3BPWA 1KM6A 4M5PA 2CW6A 3T44A 1OFBA 3PY2A 2NZLA 3CPRA 3RLVA 3HF3A 1H5YA 1EUAA 2W79A 1GVOA 3GIYA 5KSWA 2AAMA 4R7JA 1EP2A 2CZFA 2Q8LA 1Q6RA 2YFNA 3L67A 4H3DA 2A1YA 3O07A 3MYOA 1J5TA 3IGXA 4WOZA 4UTIA 3WJZA 1CI1A 2QEZA 4A3UA 3ZWTA 5IM51 2DJLA 2GJLA 1TO3A 3DKLA 4O4WA 1O5KA 2ZTJA 3E9AA 1I4NA 1SO4A 4CQ9A 3C8FA 1JQVA 2C3ZA 4H6KA 1O95A 1RZMA 1S5TA 3NQDA 5C6MA 1TPWA 3NQVA 4X2RA 4S1FA 1GPWA 3W7MA 5CSRA 5D2TA 3SFKA 5C54A 1H7WA 1XCFA 3LI1A 1F73A 1VLIA 3GK0A 1Z42A 4OT7A 2B7NA 3W76A 1E51A 5H91A 4NUWA 1WQ5A 1JRCA 4EF9A 1HFBA 3M47A 3FKRA 2Y88A 4FF7A 1F05A 4IQLA 3UWWA 4CNPA 3IVUA 3W23A 2RDWA 2X1UA 3RU6A 1GZGA 2E09A 4FXSA 1YXDA 4MUZA 3GKAA 3TV8A 4ONVA 5HWMA 5DY2A 1XDLA 3EX4A 2VC6A 3UZJA 1B3OA 1QOPA 4G1KA 4BI7A 3BW3A 2V30A 1RQEA 4EF8A 3NQFA 3O6CA 4GC4A 5J5DA 3LXBA 4RZ5A 3E12A 1XBVA 3ABOA 4TO8A 3QQ0A 2R14A 1QOQA 1KA9F 3NZ1A 1ZFJA 4LVDA 2RFGA 4A29A 2GVGA 3N73A 3M0ZA 1DL3A 4HNVA 5K2ZA 2FDSA 4CNNA 4HSNA 1QO5A 2QAFA 5D37A 3W2JA 3PAJA 3W7OA 1YLVA 3IIPA 3W7NA 3FJ6A 3G8EA 2ZRZA 3TW7A 3DI0A 3PG9A 4DQWA 4TIMA 3LCHA 1FCVA 2CLKA 4JDBA 2OT0A 1WA3A 4KKXA 3MI3A 1GYNA 4QSHA 3G1XA 4KFNA 4O10A 4D2JA 1JUEA 4Z0JA 1LBFA 1VCVA 1PCWA 3EX1A 3T7VA 3DHDA 3PR2A 4AHPA 2I1OA 1UJPA 2FPTA 5EA9A 3VE7A 3M6YA 1XC4A 1HG3A 1DBTA 3EKLA 3R89A 4B5NA 2W0UA 1EA0A 1G4SA 1FCQA 4XTDA 1OFPA 4MVAA 1KFEA 5CPMA 2IQTA 1YPIA 3PS7A 1TV8A 1ZCOA 4KFOA 3TFCA 3TMLA 2E5CA 3W2KA 4HIBA 2J27A 2C18A 3NXFA 1W3NA 4JYDA 3GVGA 3C3NA 3UD6A 3LHZA 2PRLA 4UC5A 3DFNA 3FEMA 3NGJA 1VYRA 4ZQRA 3W6YA 5TQLA 1MSSA 5IBXC 4RZ6A 5HUOA 1YADA 4KWWA 4UR7A 1ICSA 4AXKA 4DPQA 4LV9A 3W3OA 1GVRA 3C2OA 1NF7A 2RDTA 2E5BA 1W37A 2A6NA 4ZZ9A 1PS9A 1VHCA 4LU0A 4N6FA 1FDYA 2YR1A 2NWRA 5DXYA 1C29A 2KZHA 3LTYA 3P80A 4LY8A 5HR7A 5G5IA 1LRQA 2NXGA 3W87A 3LRKA 4JNMA 2E77A 3R5EA 5HMSA 3KRSA 2Y63A 4XWUA 1QMLA 1TQXA 1KM3A 4UTTA 1YXCA 3NOEA 2CZDA 2PCQA 5AYYA 3W1TA 3QEZA 1TYGA 4DBDA 3LB0A 2ZRVA 2JK2A 1H61A 3M43A 2GQ9A 3GYEA 1OVDA 4A21A 3R2GA 1ONRA 2C19A 4ZVJA 2B7QA 2WNNA 3O05A 1VC4A 4CQAA 2J6XA 5BMXA 1OK6A 3O8AA 2NUWA 1K3UA 4Q33A 1JUBA 1SFLA 4OGZA 3EX2A 5LSMA 3W1XA 1JCXA 4HPJA 3G0XA 3QPYA 1T99A 5CZSA 2DZUA 2GPTA 1TPEA 2HSAA 1SUXA 4PTNA 3LXAA 4XZ9A 2Y7DA 5G2HA 3CWNA 2HMCA 1EB3A 4FNQA 3ABRA 1RD5A 4TR9A 4BR1A 2FB3A 5CKSA 4BWLA 4UTJA 4OWGA 5C55A 1HL2A 3P7YA 3DENA 3GXTA 5T26A 1FUYA 3LHYA 3WK0A 3S0CA 3EWZA 3ATYA 3HMJG 4JTLA 3LHVA 3FLUA 4FX6M 1P0KA 4MFEA 1FBAA 1YXYA 4HKPA 1XUUA 3NM3A 3WJYA 1AW5A 1C8VA 5F1VA 2ISSA 3ELFA 1GQNA 1ICPA 5K9DA 2A2IA 4M6VA 3WK1A 5LNRA 5AHMA 4NNBA 2QCDA 3W71A 1TMHA 1H63A 3UZ5A 4JX4A 5IBXA 1MEIA 3SY5A 3E0IA 2WV8A 1D3GA 1MEWA 3HG5A 4MJMA 4GUIA 1N55A 1VHNA 3G24A 4ZQOA 1AK5A 1W5QA 1AMKA 3W7JA 4O14A 2P0OA 4JYEA 3WK2A 4QQ3A 5I3HA 3SGUA 3B04A 1IGSA 2H8ZA 4RJEA 3S5ZA 3W1UA 4GE8A 2Y7GA 2Y7FA 2JKAA 3L0NA 3THAA 4LUJA 4O17A 4MOZA 1K8ZA 4I7VA 2YDAA 3A5VA 2A85A 4LTSA 1DJNA 5LHEA 5FI8A 1XL9A 3W9ZA 2A5HA 3BK0A 4DELA 1H7NA 3PUEA 5L9FA 5LNUA 2V9DA 1YDOA 3AO0A 3IVTA 4UFJA 2YPIA 1VCGA 3WJWA 3KRUA 4MLJA 2G95A 1YTDA 3S5NA 4NNCA 4C1LA 2QCLA 4UTLA 4Z1AA 3BO9A 1TIMA 3E96A 5F4SA 2QCDB 3UXDA 2VENA 2NUXA 2E6YA 1EP1A 4L4MA 3IIVA 1QPQA 1JCYA 3OA3A 1R2TA 3V75A 2EHHA 2QCNA 4CCCA 3UWQA 1K7XA 1UCWA 3LI0A 4O0KA 3DFSA 4HT3A 3M44A 3G1AA 3BV4A 1SW3A 4NNAA 3NQ6A 4BFAA
chains in the Genus database with same CATH superfamily
4INFA 3BUVA 4YS1A 4UFHA 3S9ZA 4JFSA 5HNUA 4URIA 3WDJA 3L2LA 3MWCA 4RE0A 1BRLB 3CLWA 3MA8A 3ZVHB 1OX5A 1WZLA 3W74A 5JIWA 3O1NA 2D69A 3L21A 3GM8A 3PUDA 3P6LA 1K6WA 3G1DA 3ICJA 4IQDA 3TLQA 1UD8A 3MHFA 1REQA 2GSHA 3ANVA 2Y0FA 1QNPA 1EJXC 1E43A 3SADA 2NVAA 3EXSA 3GRIA 3QV8A 1CGVA 3H2FA 1UIPA 5G4HC 1Y5VA 2CYGA 3MBFA 3Q94A 3KBVA 1XYFA 4KWSA 4O18A 1QPOA 3S5OA 4PUKA 4Q7IA 3BDKA 1S3HA 4J1OA 1AD1A 4GOAA 3WNNA 1BD0A 2FPYA 4HZMA 5AY7A 1PCKA 4ZB5A 1VEPA 1A5BA 2FTWA 3F03K 4IIEA 1PVNA 1M3UA 1PIIA 1JZ4A 2ALRA 4Q8VA 1W9VA 3HGOA 3WQPA 4PMQA 4FLQA 3KVLA 3WQWA 4LEFA 3TIMA 3H7RA 1IR1A 3YPIA 1V93A 2J88A 3HQ1A 3WQVA 1R87A 4FNTA 3UG5A 2VUYA 4HU4A 1UD2A 5D05A 1Q8JA 4UNLA 1GJPA 4H8UA 3LSBA 1PX4A 1GJWA 5HA7A 2QPUA 2CLOA 1GVFA 3AQUA 3UVAA 3DI1A 3CO4A 2WLZA 3B40A 3LY0A 3EMZA 3VGFA 1F7BA 3B05A 1CZ1A 5E9AA 2CU0A 4O50A 1XLDA 4JTSA 1ZS2A 2XVPA 1V79A 1MUMA 4H4IA 4WCJA 5HWNA 3FW6A 3CM4A 3N9KA 5EL1A 4UCGA 5IDZA 1CYGA 4MG4A 1JRBA 3DHPA 3C0QA 3RIKA 1LWHA 2QS8A 1KO0A 2GOKA 4GZ7A 3CGTA 5CCZA 1PBGA 3B9EA 3GTNA 1KXTA 3PNUA 2WMKA 3AMGA 2WKJA 3VM5A 2X0YA 5DXXA 3VDGA 2XJ7A 1UWQA 2ASHA 4P7LA 1CXKA 2DSKA 3W73A 1A5LC 2Y5EA 1FCUA 1TV5A 1E6PA 2BODX 1BLIA 2HS8A 3PVFA 1ISYA 1S38A 4QJ4B 4DUVA 3ZXWA 3E5BA 1K8XA 4LB3A 4FNPA 4AZCA 3ES8A 3ECQA 1XLKA 4Z2LA 4H8NA 3LQGA 3LA4A 1ENUA 1TRIA 1MEHA 2W92A 4PCPA 1Q6OA 2VGFA 1BYAA 1GK8A 1K03A 1XI3A 4AHQA 5DFAA 1PKMA 3MSGA 3SCVA 1QK2A 2E8YA 1ZGDA 3G3DA 4D8LA 4O1DA 4ZQMA 4QTGA 3AU6A 1CTNA 5F1UA 2BBFA 2VGGA 2GYIA 4XQ6A 3VX1A 3TH6A 3EKZA 4PMOA 4LX4A 2CXEA 4HVXA 7TAAA 4UNIA 5FSDC 1XSJA 3LENA 2GDQA 1U1HA 4M81A 4NI3A 4GD0A 4Q8NA 1E56A 1EPXA 3PTDA 3UERA 2A3BA 3QRHA 3AZRA 3ZVHA 4DJFD 2BLEA 4HSOA 4DLFA 1OY0A 1CXHA 2RAGA 4QROA 5DX7A 4IPPA 1X8FA 3WDHA 5AC8A 1NU5A 2R1KA 3BJFA 3OLGA 3WLSA 4F0LA 5EMJA 1TUXA 1R5YA 3GDMA 3STFA 1PKNA 3DZ1A 1VZWA 4HN4A 4Q6XA 4JBRA 3ARZA 1FWNA 2WWCA 1BQCA 1YYAA 4IJCA 4XZNX 4IXHA 4EPEC 2XG9A 4GX9A 1BG9A 4KFPA 1DIDA 3UJRA 2WM1A 2X2YA 3UZYA 4GNVA 1V5XA 3AS3A 4W4QA 4QE5A 2FH6A 4Q4QA 3K8LA 5FJPA 5JH1A 3EWCA 3PZVA 3W88A 4R27A 2W61A 3MDUA 3TXVA 4KH2A 1SJCA 3P81A 1KBIA 2QULA 4IX2A 3CEPA 2J78A 1VENA 1LBMA 3RPDA 4N9DA 1DEDA 2VZTA 4JTCA 4W87A 4MFDA 1DXIA 3PZNA 3P74A 3QC3A 1I0DA 3CUHA 4B9YA 1KWGA 5I03A 2XVGA 3QY8A 1JG9A 1I6NA 2VC5A 3D0CA 3UR7A 1IIHA 4PFMA 5D2XA 5HJLA 4PMYA 2OOGA 2ZX6A 3FS2A 2QJHA 5LZLA 2V5BA 2BDQA 3ZLFA 3C4UA 4GUGA 2QYGA 1J01A 5EMMA 4WXZA 1MWOA 2A0NA 3A22A 4I3GA 3UPMA 2IKGA 3UY8A 1PWMA 1P7TB 2O56A 5REQA 3QFEA 2FZNA 1BKHA 3QW4B 4H9UA 1XKJA 4OECA 5HQMA 3VZYA 5KEZA 1FWRA 1JPDX 3QTPA 1D8CA 2YA0A 3HGRA 2DUXA 3MZ2A 1ZAJA 1W5OA 2JALA 1DKWA 1MVYA 4ZOAA 1XSIA 5EPDA 4CGTA 1IEXA 4QXIA 1E0WA 1LT8A 4L4LA 1GHSA 3EXTA 1EXBA 1W1ZA 1VLWA 4QIUA 1Z6KA 1UZDA 1NDVA 3T2QA 4QS5A 1OZQA 1BXBA 4H01A 4PTDA 1OFDA 3LTSA 2R94A 4X63A 3KBWA 2F2KA 3QC0A 1FWDC 4H6RA 1YIXA 1UWSA 3GH5A 3LLXA 4MM1A 1HTIA 1GOKA 5CPLA 4ZL1A 4AISA 4WK9A 5H6HA 3G1FA 3SZ8A 4QEHA 3VKCA 3B06A 5KITA 2A7PA 3AISA 1OCBA 1ZY9A 1WDDA 2GL5A 1F9CA 2IPFA 3PAOA 4A05A 3S2CA 3A5FA 1JZ2A 3DG7A 4AU0A 2PWVA 1GKQA 3NPXA 3TWBA 1R8LA 4JIPA 3M7WA 5ECUA 4R7OA 1J0HA 2CWXA 3ABZA 3WMSA 1C9WA 3QH2A 2DIJA 3V4BA 5I23A 1Q6FA 3G3MA 1QASA 3MKCA 3REQA 3G1RA 3NZQA 3U9IA 2DZSA 5D9PA 4UXDA 1R6WA 4Z1CA 5I78A 4MNKA 2YBTA 1W17A 4D8ZA 1BGGA 1L6SA 4MWAB 3W1RA 1QHPA 3OVRA 5H8MA 3LBCA 1DV7A 4QBXA 2QUVA 2I5GA 4MMWA 1SO3A 3VUPA 2V82A 2Z6IA 2OT1A 1M5WA 2WVSA 1AQMA 4QITA 4UQEA 4JXCA 3V5CA 1FKWA 3BAXA 3UXLA 5EU9A 4XAYA 4EP8C 3HQOA 1JCNA 3UPWA 4UFIA 3SURA 4LJ3A 1G67A 1B9BA 1JPKA 3UT0A 4RXGA 3O15A 4XBSA 3UYCA 3WBYA 1NH6A 2DORA 4GACA 3G0UA 2RJGA 5FKYA 7REQA 2GK1A 4PL1A 3O63A 2WVVB 4IJRA 1F76A 2O9PA 4M7TA 8XIAA 2NWSA 4PTXA 4AF0B 1H7XA 4C1NB 3L5LA 5LIXX 4PFHA 4ZB2A 3I4EA 4YTRA 3GVQA 4V28A 2EEXA 1EDQA 3TQVA 1CW2A 3REQB 3N17A 2VRKA 1FWTA 2CFFA 1R46A 2ZZ1A 3RK8A 1F07A 4UZSA 3TC6A 3AHTA 3ZZ1A 1W3TA 4PBGA 3W2LA 1EHAA 4QM1A 2WPGA 2GJNA 3VNIA 3LLFA 3SCOA 4F0RA 4R34A 3S46A 5D2WA 2E68A 1UUMA 4JHZA 5AC5A 3LXCA 4KCTA 4UUIA 3R25A 3IIZA 4FX7A 4C6FA 1RD6A 3POCA 2ZA2A 2Q02A 3TYDA 1DJZA 3RG6A 2F8QA 2PLMA 1WKEA 1KFWA 1UUOA 3V35A 3GYCA 4C7GA 3II1A 4B2DA 4FOKA 1BG4A 4H6QA 1E9IA 2PDNA 2VEMA 2J7FA 4L1XA 4TOQA 5DBTA 5JBFA 4BF5A 2E8ZA 2Z1SA 3GLCA 3JRKA 3CJPA 4RNJA 5FA5A 3EB4A 5DO8A 4UMCA 4AUBA 3G1SA 7TIMA 3U2OA 2PFHA 4PMDA 4FOUA 3DDMA 4O1FA 3DGRA 4GUFA 4FNRA 1NDYA 1SR0A 4I7WA 2QGYA 3EWXA 4D6EA 3F5LA 3FKKA 4ES4A 4ZO7A 3LOTA 2R1NA 1TWWA 3BAWA 3L4XA 1F3XA 3N11A 3QY6A 4XAGA 2ODOA 1DVJA 1VD6A 2VGBA 3AIRA 3MKKA 3QM3A 1KNWA 1PE1A 3GU1A 3UU0A 3BAKA 2Y7EA 3THCA 1LL7A 5U7SA 3TXZA 3VD7A 3T78A 2VL4A 1L6GA 1JI2A 2FHFA 2V3GA 4UTMA 4K3ZA 1QNRA 1KM4A 4WD0A 3VOJA 1ISWA 1OX6A 2EAWA 4LB4A 2Y70A 1H7RA 5KINA 1KBLA 4YTTA 4GKTA 2RDUA 5EBAA 1WB0A 2Q8XA 4AWUA 4NXSA 3B9OA 1JD7A 3MVIA 4PRWA 4WSJA 3JUGA 3GNPA 1XD1A 4Q8OA 5A6MA 3VNLA 1M53A 1OK4A 1UC4A 1GOQA 2JKPA 3A9IA 3EMQA 2YCEA 3MY9A 3VUSA 1I1XA 3TYBA 1CDGA 3RM8A 1U30A 2GGHA 4Y6GA 4NSBA 1B54A 4IH3A 1GGOA 2Y5JA 4ZENA 1AQ0A 1E6ZA 3CH9A 3RAOA 5ABEA 1S39A 4D6DA 3S1GA 4RZBA 2DH3A 1W0MA 2I16A 4CCZA 4AAJA 3AHZA 1UROA 2DSWA 2D2GA 4DJDA 1EWEA 1LWJA 3NEHA 3W07A 1QK0A 2CHOA 2CZ5A 3LPPA 3VZXA 1P0EA 1QR7A 3LTPA 1JXKA 2V3EA 4DWDA 2FGLA 4ZGYA 3RU8X 1FWCC 1EYEA 4QSFA 2HS6A 1XLHA 2C1HA 4PMNA 3QV6A 1XGEA 4OU1A 2CPUA 3W29A 5E9XA 3U2ZA 1F3WA 5D9MA 1MRQA 1EFZA 4FR1A 3M0IA 4HD5A 4HHHA 4L80A 4DF0A 3WLTA 2RJHA 3SDOA 1BWLA 4QLKA 3BVJA 4JEQA 3NPWA 1CEOA 3IV3A 5M2FX 1MNZA 3PJWA 3WH9A 3QV9A 2D2JA 4F2TA 1MQQA 3EDKA 3I68A 3DXIA 3OVPA 2JF7A 3CWOX 4RXFA 5C0QA 4RV8A 4F79A 2ZYFA 4W85A 1B31A 4Z2JA 2PRMA 5MHBA 4UTTC 4AZ5A 1VP5A 3DCPA 2VR2A 5L6UA 2GUYA 2VM8A 2ISFA 2ZZ3A 2ZXAA 5HINA 1QI3A 3PJUA 4LANA 4GKLA 4HJWA 1TSIA 4IX0A 3ENLA 5AHEA 3ABQA 3KTSA 4A2SA 3EOOA 1HP4A 4LUTB 1GORA 4WX2A 1XINA 3QHOA 4R85A 3WNOA 4V1YA 3I6RA 5FL0A 4DYKA 5ABFB 1FXQA 3T07A 2I57A 4AZBA 3P60A 4ORIA 1JUKA 1FH9A 3O2LA 4S39A 3W1AA 1W8SA 3A6OA 1EJWC 3OODA 4HA0A 4B5WA 1XPGA 2YX0A 2Q3OA 3WLHA 5A1AA 1YNPA 4CNTA 5CC5A 1DHPA 2DZVA 4LT9A 1PSCA 4CNOA 3P3BA 5FJJA 1QVBA 2WSRA 3R94A 3DX5A 4JHOA 1JVNA 3M16A 4JTFA 1M6JA 2J7BA 2W5FA 2PRHA 3UWUA 4GCAA 4QLLA 4DO6A 3TEVA 2FLIA 3NGFA 3FVDA 3W38A 1DJYA 3B8SA 4CVUA 4PMVA 1CT5A 4FX8A 4GJ1A 1W9UA 4C90A 5E1QA 4I9TA 3GTIA 5IDIA 1H5VA 3UXKA 4JN6A 3MW7A 1C7TA 3OHIA 3GXPA 1BWKA 1ZJAA 4GIEA 5E6ZA 2PA6A 4ATWA 4IGNA 5EMKA 3M7SA 3KAOA 5JUVA 3QYQA 1VEMA 2D0FA 4O8AA 5I77A 1MUWA 1RR2A 4OIFA 1KLZA 3OIHA 3RMEA 4IPIA 4M24A 4X0NA 4US5D 3WMLA 2C14A 3B8UA 4GIRA 1UR0A 3ZT7A 3GIQA 4FLSA 3TCEA 2CKRA 2YCLB 1XICA 2DU2A 1JR1A 1IT0A 4LVBA 3GC4A 4Y9PA 4MGGA 1AW2A 4PUJA 3VIFA 1KBKA 4HNUA 1DJHA 3CU2A 4QHRA 3DFTA 3SY8A 3PZUA 3N04A 1R2SA 2FJKA 2BHUA 3SRKA 2HVOA 1EC8A 3M5YA 4DUOA 2V0TA 3TE9A 2DZWA 1PAMA 3EWYA 2P53A 3T09A 4S2CA 5FJUA 4GJJA 4GYPA 4GVFA 1JYVA 3QSTA 5EKYA 2WNZA 3EWBX 3NL3A 1E4IA 1E70M 2F38A 3TZFA 1HX0A 3EAUA 4LWWA 1AL8A 3TKFA 4QEEA 1MZRA 3U2EA 1R2RA 1TCDA 2F6KA 2EKCA 4XISA 3WQFA 4PB5A 6TAAA 3PP7A 4CLMA 1V02A 2BVDA 5AVHA 3B9DA 3N2XA 3ABSA 4HMNA 1V3JA 5CJMA 2OGYA 1WV2A 1YHTA 4F2BA 2Z2UA 2ZZ5A 3G8RA 2B4GA 3GTHA 2WKLA 4BI5A 5CEWA 3G1YA 3KTXA 2FPVA 1ONEA 3B0UX 3NQCA 3EZ4A 2VX6A 3T4WA 1EWDA 1ICQA 2MNRA 1TX2A 3KOWA 3V36A 1KCZA 2AGTA 1SO5A 1XBXA 5AZ0A 1UASA 1LUCA 1OC5A 1H7PA 1JL8A 1TPFA 5C9XA 5D38A 3WQ4A 3U8GA 3WH8A 3V5FA 3ABXA 1CXIA 3VGBA 4MADA 4HGXA 1GTEA 4QAWA 2REQA 1MQRA 1BSLA 2XIJA 4TTGA 1GG0A 3A13A 1QU4A 4LBRA 3AUOA 4G8TA 2ACSA 3AI0A 1TTIA 2UBPC 1OD0A 2ATSA 5I3GA 1KM2A 1VS1A 1LLOA 2QJJA 3LM7A 3OW1A 4I7UA 1A53A 1RJPA 5DQPA 3UWVA 2O7QA 3USZA 2G3NA 4OV4A 1GOWA 1TTPA 4DNHA 4MIMA 4MB1A 1A3HA 1EJ7L 4OE7A 1GQJA 3WKZA 3ZFHA 4NVTA 1JIBA 5A8OA 3GHRA 2WCAA 3L4ZA 3W27A 1TZ9A 1WUFA 1DJWA 3W7EA 4NJGA 1NDZA 2VKZG 1EEXA 1N8IA 2IMRA 5KZDA 1FWWA 3C86A 5I06A 3H2AA 1YE6A 3QOMA 4PULA 3CT7A 3S1UA 4YLWA 1J0YA 1B30A 1TV7A 4ZOBA 3WDPP 5K3VA 4PEKA 1PTGA 3FX4A 4XZLX 3SN1A 1HIZA 1HF6A 3N6JA 4AF0A 1W3LA 4ROQA 3R0DA 3H12A 1W5MA 1EO5A 4QCFA 3OG3A 3MV01 2PD5A 4C6PA 2HTMA 3NIYA 2ZZ6A 1UWIA 1RCQA 5HATA 2QDEA 2ZX8A 5BOEA 1EBGA 2ABBA 1UA7A 2PI6A 1TVPA 3S5SA 1F2JA 1MFVA 4XK2A 3BJTA 5FOOA 4MJZA 1QUMA 3TYUA 2XH4A 4O4VA 1KBJA 2FHBA 4LAUA 3W7IA 3PBWA 3W75A 1EKOA 4AD3A 3IJLA 5ABGA 1KFCA 4UIOA 2DZPA 2XUCA 1TWIA 3CL8A 3C52A 3BAYA 1OYBA 1QNOA 2OPJA 4YN5A 5T9CE 4NZ3A 3B8IA 1J2WA 4DJFA 4IUGA 1O5QA 2GDUA 1TPB1 3H70A 4NZFA 5H8UA 5GNZA 1U5VA 3ARQA 3F4DA 4JY8A 3SR7A 5D30A 3VU2A 1C3FA 2FTYA 2XPKA 1ZQ5A 1KM6A 5BOFA 2CW6A 2OYLA 1L8PA 1WDPA 3R58A 3OZOA 1EIBA 1EUAA 4REQB 1GVOA 1QT1A 5KSWA 2AAMA 2A3LA 2NVDA 3UESA 2A1YA 3O07A 3IGXA 4PTWA 4WOZA 3GH4A 2QEZA 2GJLA 4MAZA 4D72A 4GIYA 4AEFA 5HPCA 4DYJA 4NHVA 3I3BA 3C8FA 1VFMA 1RK5A 2CXGA 4H6KA 4BQ3A 1GQIA 1S5TA 3NQDA 3KUMA 1EL3A 3NQVA 1YW1A 4IP7A 3VOFA 3BZGA 8XIMA 5D2TA 3T42A 1F73A 3GTXA 1A49A 5I5RA 4S38A 3W76A 4B5UA 2FMOA 5H91A 3MCOA 5E70A 1VFLA 2PZ0A 1UMYA 1EYWA 3QHMA 4CQDA 4P7OA 3UWWA 1EZ2A 4UOZA 4ICCX 2RDWA 3NSMA 4MUZA 1R7OA 3E2VA 2VWSA 1E4LA 5DY2A 2OQLA 3EX4A 1QW7A 3UZJA 4G1KA 3VAVA 4EAMA 3BW3A 2V30A 3KCOA 3FHQA 1RQEA 3O6CA 4GC4A 1DTUA 1IR2A 1XFCA 4RZ5A 4AZ7A 3QQ0A 3GVVA 1DL3A 4HSNA 4ASTA 1TZ7A 3KLLA 1EGZA 3AYSA 1K8CA 3F4VA 1YLVA 3M0VA 1YE4A 3W7NA 4HNOA 3G8EA 4HB7A 2R24A 4PMUA 3DI0A 3CH0A 3ORWA 1DYSA 3LCHA 2ICSA 2ZX9A 3HPFA 4KERA 1AODA 1E3ZA 2W9MA 3G1XA 5PTDA 3OPSA 3RO8A 1VCVA 3EX1A 2EO7A 4AHPA 2AAAA 3WQ5A 2I1OA 1UJPA 2FPTA 3RJYA 5CBBA 1DBTA 4B5NA 2G4JA 2W0UA 1ITXA 1XIIA 5T91A 4XTDA 4OBSA 5CPMA 4EAYA 1I75A 3PS7A 2WKGA 1ZCOA 4KFOA 3TFCA 2E5CA 3KBNA 4HIBA 3SAZA 1DWGM 3WD0A 1REQB 3NXFA 2Q01A 4R9OA 3GVGA 3LHZA 2PRLA 4HCDA 2P76A 1EGMA 1TELA 3NO3A 5IBXC 4WDWA 4UR7A 4KWWA 1ICSA 1NJJA 3VYLA 4LV9A 1C91A 3W3OA 3GU9A 4C1NA 2EPNA 4AIOA 4HU8A 4ZZ9A 1DIEA 1PS9A 3P14A 2ISDA 2NWRA 3DBNA 4PB4A 5G5IA 3W87A 4LYQA 1GZ1A 4LPCA 2Y63A 3LEPA 3QYSA 3EPNA 3OLDA 3QGAC 4PRTA 3BJSA 1ESWA 3SQLA 1YXCA 3VGDA 1S2WA 2CZDA 2VP8A 4U3CA 2PCQA 3SM0A 5B80A 5C8BB 3M43A 3UYIA 2MUCA 4Q3MA 2PB1A 1OVDA 1C7SA 2B7QA 3FSTA 4GZJA 2E9LA 2E9BA 2J6XA 5BMXA 5ABFA 4D71A 1YMYA 4HZ8A 1MW1A 1JUBA 2W4XA 3EX2A 1AZ2A 1JCXA 3QPYA 4CD7A 1HGYA 4UOJA 2DZUA 3EYPA 3A64A 2HSAA 2DH2A 1SUXA 4ATDA 5G2HA 3CWNA 2HMCA 1EB3A 3WD3A 3ABRA 2P50A 2BOGX 2FB3A 1E6RA 4UTJA 1HJSA 5C55A 3VKKA 3DENA 3UZXA 1S1RA 2E1WA 1FUYA 4QCEA 4FR6A 3EWZA 4YTUA 3VKBA 3RDKA 4JTLA 3EMCA 1M41A 2Z1KA 2BY1A 4H7CA 3CUJA 2E9MA 3GHTA 1BYBA 3ELFA 1GQNA 1K70A 1EDTA 3L4TA 4D1IA 2DZBA 3FEQA 2QCDA 3D6NA 3U57A 2OLSA 2FZMA 2VCAA 3URAA 1V51A 1D3GA 4MJMA 4GUIA 1N55A 4C60A 4ZQOA 1PZ2A 4O14A 4RDVA 1P0BA 4TX6A 4IM4A 1IGSA 3S5ZA 5AYIA 4JNYA 4AC7C 1Q6GA 1UWRA 2PWFA 2YDRA 4GCXA 4MOZA 3OYZA 2PGWA 1K8ZA 2OSWA 4I7VA 3SSZA 3QV7A 5LHEA 4XZHA 5FI8A 1XL9A 1H49A 2A5HA 1H7NA 3PUEA 4DUXA 3UCDA 1YDOA 2X8RA 4HYVA 4B3ZA 1HW6A 4HZ7A 3SCNA 3IVTA 4UFJA 1M7XA 3R79A 2YPIA 2H9AB 2G95A 2QIWA 4MLJA 3MUZ1 3I6TA 4PUEA 2CEQA 3BO9A 1NOUA 1J93A 4UQDA 2PBOA 1EP1A 4C6KA 2DW6A 2XIIA 4CCCA 1VKFA 3NDYA 5DEZA 3RCYA 3ITLA 3GXFA 1ZBVA 4W8LA 3BV4A 4GK8A 1W3JA 3NQ6A 3DHUA 1ADDA 2J9YA 2VZOA 2NQJA 2OO6A 3GUWA 4G7FA 4UQAA 3EDEA 1RXOB 2J62A 4WDTA 2QT3A 3VVGA 3CV1A 5C9ZA 3GDLA 3IS4A 1OG0A 5HK4A 2DIKA 3FVMA 4U3AA 1W9DM 2P8BA 4FLRA 1K8YA 2BB0A 5LNWA 4ERGA 3TNBA 3U5UA 3BMWA 2PDJA 4KMQA 4JKMA 4NYUA 4X22A 3VNJA 3CHEA 1O4UA 3VCNA 1MDRA 3TWAA 1WYIA 5A5WA 1S5MA 2HBVA 4H6EA 4WSHA 2PUZA 3LPGA 2J7HA 2YXGA 1QI5A 4C1KA 2O55A 3HZ3A 2AKZA 1OGBA 2WYSA 2F84A 1QFEA 4EPBC 3RX4A 1N82A 1FQ0A 2WSYA 1EHNA 2UV8G 2BVTA 3GHUA 1OYCA 1POKA 5I3JA 1V6YA 1QI2A 3PM6A 1H3GA 3PG8A 4CU6A 1NQKA 2XH0A 5DCDA 2H3BA 4XBKA 1QCWA 2PDPA 1LL6A 1J6OA 2V63A 1MFUA 4RDYA 2VX5A 3UWYA 3ME3A 5HQLA 2OKOA 3H2OA 5BOOA 5DCEA 4KIEA 2QNEA 2PBGA 5AOUA 3NPVA 3QTGA 4P5UA 3WF1A 4QNWA 5AECA 3R11A 2XDFA 3K8KA 2BSLA 3CZKA 4H9TA 3C2EA 4UFLA 1XRSA 2QV5A 4FO4A 1OX4B 2X0SA 3NQ7A 1UIOA 1V7YA 2VC9A 3TLLA 4DWSD 3R8HA 1WXZA 2H3DA 5F7UA 3DOPA 1A5MC 4F0KA 1WDSA 3PBYA 4EX4A 4AYGA 4YWIA 1YNQA 3WD1A 3UR8A 3F4WA 2O4MA 2FZ8A 4EXAA 4JTEA 2XN1A 3LS9A 4GG9A 1NSJA 4JICA 3E2RA 3FYPA 3VGHA 2BGQA 3MCMA 2D73A 1UBPC 2ZXBA 3TU9A 1J5SA 1A80A 3BICA 3OO2A 1FRBA 2F7FA 1PDZA 3K30A 4PUMA 3CMJA 5TBOA 3H24A 3ZIZA 1K1DA 4N02A 1N8WA 2WWDA 4HZ6A 5IFTA 1X1OA 2A3EA 3KOZA 4XIAA 5BW6A 1P0DA 4PMRA 2X16A 4W5UA 1KRAC 1KXQA 9XIMA 3WJXA 3UJFA 3TROA 3DU0A 3LPFA 3LDVA 1QDSA 3A4JA 5AN7A 4NF7A 4E6MA 4OV9A 3R1ZA 4HYRA 5FL1A 1OFAA 2WHMA 2PU0A 1FHUA 4CEXC 4N2YA 3WLRA 2GGGA 4JQ2A 1DHKA 5C7HA 2I9EA 1G7VA 1G4PA 4AQLA 1TJ1A 4PTMA 2B0MA 2VFGA 3N2OA 3KWSA 4UTWA 1CB7B 2V3FA 8RUCA 3THDA 1V0NA 2XFWA 1XM3A 1JFXA 2NQ9A 3V1PA 3PTQA 4KCUA 3PBUA 2PGEA 4IMCA 1OIFA 1Z3NA 4GQBA 3MMWA 2B7PA 1WXJA 3VIOA 1UBSA 4A3HA 5FEPA 3MSDA 1NFBA 3GIPA 1MZHA 3IGUA 3CNYA 3NR0A 1TR1A 4DAFA 3HPSA 3BG9A 3IIXA 3W85A 2HNHA 3RUBL 1SGJA 5LA2A 4US5A 3P2VA 4F8XA 6XIMA 2G4FA 2EPKX 3G5EA 3NO5A 1BXNA 2J9XA 1V4YA 4R9XA 1O94A 4LF1A 2V5CA 2X09A 2PWUA 4AD4A 3W1MA 3PBMA 4NIRA 4D6CA 4LRSA 2XFRA 2ZCGA 2QKFA 5HR6A 3AHVA 5XINA 4CCDA 3AICA 4KEZA 2ALDA 2XIOA 1GT8A 4WHBA 3GDKA 3GU2A 4JL2A 3AIVA 4FF5A 1R47A 1FP9A 3HG2A 4KRUA 4M6QA 1G94A 2BWGA 4Q4SA 3BGAA 4RX0A 3AYVA 3UWZA 1L9WA 3ZSSA 3CV2A 2AQWA 2J79A 5BWAA 1M7PA 3MI2A 3EX3A 3N2MA 3PHAA 2V5JA 1GW9A 3BG3A 3D46A 4EWJA 5A6AA 2V5KA 2WM0A 2QCGA 4MNJA 3T8QA 3ARUA 3KOFA 5A8PA 1GEQA 4KW2A 1TJRA 2I5IA 2CLMA 3C6CA 4RCXA 5LIUX 1Q2SA 3L2IA 2R1PA 1NWRA 2A7RA 1LZOA 3E38A 5AYXA 2ZXDA 3C61A 1ME7A 5C2GA 4MNLA 2ZRUA 2WNWA 1IGWA 3KOYA 1SMAA 1DQUA 1OSEA 5HMDA 5CC6A 2QDHA 1GTHA 1OCQA 4BEUA 5U4NA 3O6AA 3W72A 4H19A 3AOFA 3PJXA 4IG2A 3TQKA 3MI6A 3DEQA 2PPGA 4PODA 4PC8A 4X0VA 2XIMA 1US0A 3WIJA 1XKYA 3S42A 4DUWA 1CWYA 1RCXB 3LBOA 3AU2A 3PZMA 5FEZA 4WF7A 1QXLA 4NASA 1UR8A 1KM0A 3APYA 4Y9AA 1KFKA 1PYFA 1O1HA 3U3HA 2YBVA 1JYXA 4PUDA 1E73M 3UNDA 3CIWA 1DOSA 1OF6A 1H1YA 1R9ZA 1E6NA 5D02A 3TQ0A 4A3QA 2BXVA 4NAEB 3APGA 2CC0A 1TJ0A 3L66A 4B4HA 3IAPA 4IMGA 4NG3A 4DO4A 1L6YA 1CGYA 2VRJA 1ADOA 4K8EA 1Z32X 3AS0A 2ZQ0A 3WO8A 3E0LA 1SPQA 1ZJHA 1RAKA 3GDRA 2DDXA 2JE8A 4H9MA 5G1YA 3W7HA 1XSKA 3TP4A 5IXEA 5CXPA 4N9BA 4YVPA 2PU1A 5F4XA 2ZA3A 3UCQA 1GOXA 2F9RA 2ZTKA 3MUIA 1UR3M 4HK5A 3W70A 5HMEA 4MKVA 1UB3A 4B4FA 4V1XA 2J66A 4N42A 1US2A 4LC6A 4DXKA 4YVVA 2HV5A 3NDOA 3DC0A 3IUDA 3H53A 4ZMGA 3EGJA 1S3TC 4JFUA 1RV8A 2QQ6A 5DCBA 3GVWA 4X9SA 1US3A 3E3HA 1ME9A 3EDDA 1OGGA 1Q6LA 3B9NA 4J3WA 1ALDA 4ZO9A 3JW7A 1G9HA 3CQKA 4DM1A 4O16A 3T55A 3UGVA 4QDWA 3NQMA 3ZM8A 4ERIA 5BRBA 1FVPA 2PLCA 3C2VA 1X6UA 3OGRA 4NL1A 4K36A 1F8MA 1RHCA 3CAVA 1IIGA 1W1TA 1W2VA 1Z48A 4QRNA 3PWAA 3QF0A 3IK2A 4JQ3A 1YTEA 3ARVA 3LRMA 1IE7C 3DYPA 1QPRA 2V6AA 5J8LA 2VVNA 3NL5A 1CLVA 1YTKA 1K7FA 5LXXA 1XIHA 4S3KA 3UJEA 2Y8VA 4AH7A 1R3TA 1HVXA 2NSXA 4BQ5A 3E02A 4UNKA 3N6HA 4PCNA 3VFCA 3H26A 5AVNA 3VA8A 2YBUA 3C0SA 3HJZA 1U1UA 1Q85A 2OXNA 3H22A 3Q67A 3S5YA 3H2EA 3P82A 3BCFA 3LG3A 1A47A 1XC6A 2E3ZA 2AMXA 1DPMA 2WHJA 1UKPA 3ZS4A 4JIHA 4GQRA 2W6RA 2RGMA 1PDYA 4Y96A 1VBUA 3RCMA 4L6DA 3ZR6A 4Z2GA 3GBDA 1N2VA 4BWLC 3GDTA 3M0HA 3PZGA 3S6DA 2GVJA 3E0FA 2CITA 1A5CA 3W7DA 3HURA 3RCNA 1N8FA 3TONA 1SJDA 2WMHA 3VKJA 2EJAA 1ZJIA 5I79A 3HGSA 2DT0A 1UC5A 3W7QA 3GNXA 1TPDA 3HV8A 1JDDA 4FALA 2OZ0A 3M46A 4LV4A 4PL2A 3UWEA 3WK3A 3AXIA 1XQLA 2EGZA 5A8MA 1X7FA 2IKHA 1F74A 4W5ZA 1E0TA 3HBLA 4J3XA 1T5AA 1TG7A 1H50A 4FNSA 3ITOA 3O3RA 5MKGB 1S2UA 2FVMA 1I2PA 3N3MA 2O9OA 4L9XA 4MZ8A 3A4WA 3IGHX 2W27A 3HOJA 4A4AA 2C0AA 3FOKA 5A2CA 3WLIA 5CLWA 4O19A 4WQ6A 2VFHA 4J3ZA 4ZXOA 4XV0A 1XLCA 3T81A 4S3AA 1VFHA 1EJSC 4QAIA 3AIEA 4N0RA 3UW6A 4PSPA 1C93A 3TK7A 1W5NA 3NVTA 4Q22A 2J4GA 4LS1A 5CG7A 3SECA 4GXMA 2PDYA 2J7CA 3FIGA 3LGGA 3PK7A 5G4EA 3KS5A 1NARA 4P2VA 4G5DA 5ABHA 4CD6A 1OF8A 1BF2A 4PR4A 1G69A 2QV4A 4LY4A 3O06A 1EBHA 1Z69A 2AL2B 3WH6A 7A3HA 3BC9A 2Y89A 4DVOA 3PZ9A 2ZZ7A 3ZQ9A 3PPCA 1OX4A 3GG1A 5FAJA 2VDHA 2YA2A 1LYXA 2J7EA 1UKQA 2VMFA 3DHFA 2QR6A 4O28A 3QPZA 3ITCA 2VEIA 3P84A 5A6TC 3UPBA 3SY1A 4AW7A 2Z4GA 4GBUA 4DLMA 2QHAA 1UMLA 1GQLA 4WY0F 5HOSA 3NAVA 1NFGA 5IRPA 1KBBA 2VXNA 5EYWA 2QJGA 1VPYA 4JYFA 5D32A 4NAEA 2WJEA 3KXQA 1UUQA 4Z0SA 1UA3A 9CGTA 3GFZA 2NT0A 1RVGA 1IEIA 3Q45A 2BY2A 4FP1A 3RRAA 2ADAA 2PC8A 5LGZA 1R30A 2NV1A 3UXAA 3B8DA 4ML4A 2ZRWA 2PWHA 1GCYA 3FY1A 4DZIA 1W6TA 3LV5A 4MZ1A 4V15A 1IT8A 1SJBA 1GNXA 2WCSA 5FJRA 3WH7A 5IHRA 1MW0A 1Z41A 2GWGA 5HJXA 3K5XA 2OX1A 3HV9A 1J4EA 2A7NA 4MY9A 3ID7A 3I7RA 5BZAA 1L2UA 1HQTA 1HO4A 2VQTA 4HA1A 2HBXA 2PDLA 4JFTA 4PN2A 3GKFA 4MY8A 4C6LA 3NQ8A 2VEFA 1MUCA 2Z24A 1MI3A 1M1BA 1W3IA 5D9NA 3A3HA 1K7EA 1U2YA 2YYTA 2GGEA 4HCHA 1E1FA 4IMEA 2WZHA 3PBGA 4UB9A 3KTCA 3B0PA 1B2YA 3C2RA 1I2QA 3OLEA 4O52A 3GAKA 1GKPA 5HQEA 3SEPA 4ZODA 4DB7A 3QKZA 4EPKA 4Z1DA 5M3WA 4MLRA 1UD4A 3CUGA 3T05A 1KGUA 2YGYA 3LLDA 5GNXA 1DTNA 1Y7VA 1I8JA 3CYJA 2NLIA 3NL2A 4Q32A 1W1PA 1B4EA 3CLMA 2PWEA 3WD2A 2WHLA 1UWAA 3OGVA 3CQJA 2GQAA 5I24A 2EQDA 1U33A 3ARSA 2WVVA 1AW1A 3BCDA 4DZ5A 3CMGA 2WO5A 3ERPA 2OEJA 5CZKA 4W7UA 1D2KA 4O15A 3CMFA 1B90A 5K9XA 4IJBA 2EPHA 1E1CB 3OZMA 2P88A 3WQOA 1UP3A 2JGQA 2YZ5A 3GTFA 1RP8A 1EC7A 4G6CA 4GVGA 2IPGA 4DBUA 3BCJA 4HYWA 3GE7A 5ABTA 3KVMA 2BTMA 2DPEA 1S5WA 1TQJA 1BQGA 3BMVA 1LJYA 4UFMA 1X8CA 4JTKA 3LHUA 5AC7A 1AFSA 3R0UA 3OQEA 3W1QA 4JTUA 1MRAA 5GNYA 4P61A 1AG1O 4U28A 3W02A 2HROA 2VOMA 3KDNA 3TNOA 1OABA 5I7GA 4J4KA 1F3TA 3MP4A 4AWEA 4M19A 5CPNA 1DP0A 6A3HA 4FA3A 2Y5SA 2BY3A 4OJYA 3SQSA 1W9PA 3VO0A 2V38A 4US6A 5FJOA 1QNVA 1TPUA 1Q63A 1FKXA 3PJTA 3L5AA 4NJIA 3PZOA 2X2GA 1XIJA 1U83A 1XV8A 1GUVA 4C6BA 4IPJA 2FKPA 3DN5A 4KT2A 4H9ZA 4RNIA 1ADSA 2PCEA 4LF2A 4H9YA 4XSLA 2YXXA 3QZ6A 4ADTA 3QGKC 3W6LA 3KL5A 1RA5A 4QP0A 1K9FA 3AZTA 1YDNA 1E0VA 1NDWA 2XSXA 1YDVA 3P0WA 4TVDA 3IJDA 3MMUA 2VFFA 2QXWA 1ZALA 5I3KA 3AMLA 2D2HA 1TPVA 4JQ1A 4TMBA 1I2RA 1KM5A 4S23A 4B5XA 1UD6A 4WXYA 3GR7A 3NL6A 2ZUVA 1FWHC 3FA5A 4ICMA 3WLLA 4GABA 2CZVA 4A8RA 4ICNA 4ZB0A 1GHRA 4Z2IA 1WKYA 4YHGA 1KC7A 4Q8PA 4LW7A 3K2GA 3MKVA 5AC4A 2XFFA 1W3HA 3Q4DA 5I00A 4HSHA 5AFDA 1SW0A 2DEPA 2XWEA 1V6VA 4A6GA 4B5VA 1JCJA 2Z2AA 3WLMA 3VMOA 4RE3A 4EANA 3WLOA 3B97A 3L9CA 1IXQA 5BRPA 1AQHA 3LX9A 5KZMA 1QJWA 3LZ3A 1YKWA 5H8PA 4S3EA 1UPMB 2REQB 4PB3A 3VCRA 5BU9A 4F40A 1XLAA 3KOXA 1W32A 2V2CA 3W37A 3H2MA 4HA3A 1BEUA 3GXDA 2E6FA 5JBEA 2PDQA 4PEEA 4FIRA 1HVQA 3FA3A 1H1ZA 3QFWA 1I2OA 3WNPA 1P4CA 4Q6JA 4W93A 2EPOA 3GX9A 2KAUC 3W1PA 1V8EA 3GNRA 3K13A 3R13A 3V0UA 4IFOA 3W0KA 4A3YA 4DI8A 3G22A 3XISA 3UF9A 1B3XA 1HXJA 1TTJA 5JH2A 1EOMA 3CZLA 2ZA1A 4IMAA 3I6EA 2X1IA 2R91A 2H6RA 1K77A 2V81A 3G6MA 5BXSA 1XHGA 1L2QA 4NZCA 1F6YA 1PB0A 1W3KA 2PGFA 2JKEA 5A69A 4EXQA 4C6JA 4OOUA 5H1WA 1EPVA 4UMBA 4RKAA 1E9YB 3WBEA 3U48A 4ACZA 4JX5A 4FEZA 3UP8A 3S9IA 1LL4A 1BVNP 1VR6A 1G4TA 3TJ4A 3MJYA 3RLUA 1W1YA 1J0KA 2R8WA 5DMLA 2YSWA 1GW1A 3LMYA 3S4TA 4XZIA 2V2HA 2NUYA 4LEQA 1ZBKA 4ZTXA 3GXIA 4O54A 4ZQNA 4YXGA 3VGEA 2VURA 4GUJA 4RNFA 4L64A 4I5XA 4MTVA 5CQ1A 3T2OA 4MJ2A 4M3PA 4XD4A 5FESA 3VIJA 1KM1A 2VD8A 1W9XA 4K1GA 7ODCA 4UR8A 5SWUA 3A4AA 1SZEA 1B3ZA 2R6OA 1N7KA 3ZJKA 2GWNA 4HP5A 3W7KA 3C0JA 4M5PA 3OZYA 1G1YA 1TUFA 3PY2A 4XIMA 2VR4A 3CPRA 1IEWA 2WXDM 4H00A 1IEVA 3RLVA 1WKFA 2W79A 3GIYA 3S3GA 3CQIA 3TJIA 4R7JA 1EP2A 1EC9A 4NP7A 2Y8KA 1GKRA 4AZ6A 1CI1A 3ZWTA 1TO3A 3DKLA 4O4WA 1F61A 5XIMA 2WVTA 3E9AA 3NVDA 1SO4A 1JQVA 4YTQA 4X61A 1H11A 3ITTA 1J96A 2WQDA 2BOEX 4X2RA 3SBFA 1GPWA 2OGJA 3W7MA 3NZPA 3SFKA 5C54A 1XCFA 4CN6A 2B7NA 4JZ5A 4C7FA 4BQ4A 4E3TA 3VD4A 4XD5A 5D9OA 4M56A 3ALGA 5TF0A 1HFBA 2Y88A 1F05A 3IVUA 3TTOA 1ZSXA 4I6KA 1GZGA 2E09A 3E0VA 1YXDA 1VIZA 3V0TA 3TV8A 5D4YA 3RILA 4M1BA 1KXVA 2VC6A 2VX4A 4MKSA 1JXJA 2C7FA 3VNMA 1B9ZA 5I6SA 4BI7A 2J47A 5HMFA 4DNMA 2AKMA 3NQFA 5J5DA 2ON3A 9XIAA 3E12A 2OSXA 3F4CA 3NZ1A 2WBKA 3EA1A 5A6SA 4A29A 3CYVA 2YDQA 3M0ZA 1DE6A 3NSNA 4M0XA 5K2ZA 3SUWA 3W7OA 3ZJ6A 2G8ZA 4MDPA 2ZRZA 5KZ6A 3VABA 3PG9A 3SRFA 2ZUTA 1KRCC 4HQVA 1OCJA 1VF8A 4A3RA 4QSHA 1UR9A 2WC3A 3QY7A 4KFNA 1WO2A 4DRSA 1P48A 4O10A 4WKFA 4NRSA 4XAPA 7CGTA 3FXYA 4Z0JA 4U33A 4YTSA 3T7VA 1PCWA 3H7VA 3M4HA 4B16A 2VT0A 4LBUA 5LYRA 5EA9A 5G1MA 3VE7A 4GI9A 2HWGA 3EKLA 1HG3A 3R89A 1CCWB 3H8AA 3K46A 1HJVA 1OFPA 1KFEA 4S3BA 2BOFX 4MVAA 3ONCA 1H2JA 2IQTA 1DWFM 4D6IA 5A2AA 3TMLA 2DY3A 2J27A 3T1GA 1Q7QA 1W3NA 1GZJA 4JYDA 3UD6A 3C3NA 2ZC1A 3CT2A 3DFNA 3FEMA 1W1VA 1VYRA 4QS6A 3W6YA 4CD5A 1U22A 1TR9A 4F66A 4DPQA 1GVRA 1NF7A 5FIPA 4PUUA 4X2PA 1RSCA 1V3HA 1CXFA 3FXGA 3GBEA 1VHCA 2B31A 4Y7EA 2YR1A 3IJQA 2Z00A 5DXYA 4J7RA 3LTYA 1I1WA 1GQKA 2J8TA 1GOOA 2WJDA 4N7QA 3AAMA 2NXGA 2Y24A 3CPGA 3LRKA 5REQB 2BY0A 2E77A 1XIFA 3R5EA 3LZ5A 4W8AA 2XM1A 2Y2WA 3SUTA 3ARRA 3SB0A 2A79A 4M29A 2DW7A 3FA4A 1TCMA 5LIWX 5AYYA 4W84A 3SUVA 3LB0A 3BWWA 1BVWA 2W67A 2OZTA 1H61A 1CBGA 5FSEC 4I9MA 1ZPTA 4EXBA 4A21A 1ONXA 3O05A 2GSJA 4GY7A 3O8AA 4GJIA 1CLKA 1V6XA 3RO6A 4CU7A 2AL2A 1RLDA 1J11A 3CWHA 4CQCA 4J3TA 1RH9A 1HJXA 1RJQA 1XYMA 5LSMA 3R43A 1XLFA 4LGXA 2G50A 4L4PA 4YPJA 1VEOA 3WYZA 4GZIA 1OC6A 4HHMA 3LXAA 1ITQA 3W81A 2Y7DA 3RR1A 3GSMA 3AYTA 1LQAA 5CKSA 4BWLA 3P7YA 4ZEPA 1TMQA 1TE6A 3S0CA 2GJXA 1DE5A 5GJPA 3PN8A 1C8YA 2ZUNA 1P0KA 4Q8WA 1Q65A 1XUUA 1ZLPA 2PLKA 3NM3A 4IZGA 3WJYA 1AW5A 2BP1A 5F1VA 1R7AA 1WKDA 5I0DA 3AUJA 5K9DA 2A2IA 3BE7A 4M6VA 4WSKA 4NNBA 3W71A 1KD0A 3BOFA 3E1F1 5IBXA 4E8DA 4PMXA 3E0IA 3M6DA 2FGBA 3QGVA 3AXKA 1VHNA 1V3IA 1CENA 3W7JA 1TVLA 4QQ3A 5I3HA 3VNKA 1AQFA 3N2TA 1VFUA 2WC4A 3E0WA 1UOZA 5LA0A 3T2PA 4Y2WA 3AIWA 4LUJA 4O17A 3RITA 3ARTA 2DT1A 4ZFCA 4L6HA 2RDXA 3A5VA 3KS6A 2WHKA 3KHDA 4HK6A 3GDBA 3VIIA 1DJNA 2JFEX 3AIUA 3FCPA 5L9FA 2V9DA 3B8WA 4HPHA 3S6TA 2BXYA 3LU2A 3OTRA 4Z2HA 1FWAC 2AMGA 5I02A 4C1LA 1B3YA 2QCLA 4UTLA 3JVAA 1TIMA 3KLKA 1PEZA 3UXDA 5LIKX 3VDHA 2VENA 2NUXA 5I07A 2E6YA 1PZ3A 4L4MA 4KEUA 3SJNA 3SO7A 5BCAA 2QCNA 2GDVA 1K7XA 4RUBA 3TQPA 2PDGA 3LQLA 4KCWA 1UQYA 4ZTYA 3G1AA 3C0LA 1SW3A 4NNAA 1XH1A 2HRWA 1TWDA 4BFAA 3SGZA 1WAWA 1H09A 1AA1B 2BS9A 2YB1A 1E6SM 2QVNA 1PXGA 5DN1A 4PGLA 1WOAA 2WK2A 4F48A 3BLEA 3ZR4A 3OLIA 3VMPA 1RPKA 2VVSA 3RMJA 3H54A 1IHIA 1X98A 3QMTA 5A3HA 3VOCA 3T0CA 3V1HA 3CTTA 4GFSA 1XLGA 4DZAA 2WOQA 3B4UA 3P61A 1THFD 2R1MA 3BANA 4RR4A 2V2DA 6REQA 3WUGA 2D20A 2CHRA 3WDIA 2F2HA 2GZXA 4FS9A 3CASA 2YLLA 2J25A 2Y8UA 3UZWA 1YRRA 1JEZA 2Z2BA 3FYOA 1ONWA 1EX1A 2CLHA 2DGAA 4UFKA 1Y5XA 4CN1A 3N9RA 5EY5A 2HXTA 4DX3A 3AZSA 3W4RA 2J75A 2ZE0A 2GQ3A 1B3WA 4LNCA 2ZVRA 4E8GA 2QMJA 2DZAA 7XIMA 1JYNA 1UQZA 1Q13A 2QVHA 1XBYA 1E4MM 2WNQA 1XDMA 2H90A 4L7ZA 1V03A 3W83A 2WQPA 2WMIB 5D2VA 3CIXA 3WQGA 4MWAA 3TTEA 3KL3A 3S2MA 4OUEA 3NG3A 1BKSA 4ZBCA 4OTKA 4JCLA 4QISA 3B8TA 4HMCA 1HGWA 1FWFC 2GVEA 1PTAA 3W2NA 2HE8A 1JDCA 1Y8BA 1NIUA 4MSSA 4M82A 3KX6A 4LUSA 4AMCA 1A50A 1OB0A 2DQXA 1T8QA 4OBTA 3KBMA 4CD4A 1BF6A 4FAMA 4Q4KA 2VFDA 4RLIA 1IEQA 3PPHA 2FZBA 4QG6A 4C6MA 4JNZA 3VINA 1QWKA 1WPCA 5A6JA 2TODA 1LOQA 2G3FA 3KRZA 1I60A 4XO6A 5AZ1A 2OVLA 3BOLA 3AHXA 4S3GA 1OJXA 3STEA 5CPSA 1MO0A 2CLPA 2PDBA 1IT7A 1V0MA 3EDJA 1IQ8A 3GHSA 3W28A 1B5TA 1DJIA 3TYCA 3NURA 3BLIA 1XRFA 2IKJA 3LD5A 1JCLA 2DP3A 2XISA 5G2WA 3CO8A 3VNDA 2XVLA 1W1IE 5TNVA 1DORA 1K02A 4IPNB 3QSRA 3QLLA 5EMUA 1P1XA 3S8HA 1SR9A 1JZ6A 3EOLA 4JQAA 1RLCL 4AVFA 3WFLA 2C16A 4HNCA 4PMZA 4HTYA 3S9YA 1QOXA 3HM7A 1VFSA 1S5VA 3AIQA 1KFLA 4H83A 3MTWA 4PTVA 2XWDA 1Q3NA 3EWWA 3B4YA 4PSRA 4CD8A 3C5QA 3MQTA 1NEYA 3A23A 1J12A 3TN4A 4A8NA 3J7HA 2C71A 1ZTVA 4NZJA 2FFIA 4TX9A 1J6PA 3HGJA 2DVTA 3TMQA 3ISIX 4LUSB 2CHNA 3VI2A 3B3DA 1Q7ZA 2WPBA 2IQ0A 4CUCA 3HFYA 4JEJA 3FJ4A 4YHEA 4K8GA 1GYLA 2OWCA 1XS2A 3VE9A 2TSYA 2IXUA 3ARYA 1BPLB 1ZBCA 2FIQA 4OFCA 3O6YX 3GZAA 3U5YA 3U4FA 3V5OA 5GQBA 3ANYA 4AWTA 1ECQA 3WQ6A 2VI0A 4GNJA 4FMVA 4Q8MA 2BHYA 3HA1A 4KS0A 4NYYA 4NAFB 1JD9A 4LAOA 3MBDA 3WUBA 3WLKX 1NFPA 5FD0A 1FWEC 4ML9A 3BW2A 3AWNA 1H4PA 3S2JA 4M51A 4IP4A 3CZJA 3SCUA 1BWVA 2E6AA 2QPSA 3B03A 3HIJA 1XPYA 4DXVA 4XVDA 4XBJA 3A24A 5CLTA 2ZC8A 2VRQA 2WBGA 2VOTA 5C71A 3WLNA 4O11A 1A5NC 5I2UA 1FY6A 4RDWA 3VX0A 3MVTA 1XG4A 3F1QA 3S1WA 2VEGA 3APTA 3H2CA 1TFVA 4Q7NA 2QJIA 4L6OA 3ZWSA 2AQVA 1WAUA 2INFA 4XAFA 3D47A 3PZIA 1YBQA 4ZO8A 2V69A 1X1ZA 2OEKA 1DWIM 2QCCA 2XGBA 4GHRA 2X0HA 3QQ1A 3RPTA 2V5DA 1Y0EA 1X1NA 3WEMA 4C7DA 5C7VA 4WVXA 1R3YA 2ZBTA 3WG6A 1QHOA 3WBWA 3DGBA 2BGNE 1TJPA 4CNSA 2NX1A 1OFEA 6TIMA 1VGAA 4IIDA 4WRHA 3NTYA 2UY3A 3D3AA 1PJ9A 3BLPX 3B0YA 3L5MA 4E38A 3CL7A 3BURA 1V77A 1LDCA 1SSDA 2GFTA 3KZSA 4O53A 4E2VA 2GJPA 3FJLA 1W9BM 2TYSA 5I09A 4DO5A 4OUIA 4P8WA 1DJXA 2FVKA 1TA3B 1XFBA 5HNRA 2PDXA 1EGVA 3IWPA 4ACZB 1YEYA 4J28A 3H2NA 3FDKA 3UXIA 5LNVA 8A3HA 5E93A 4K1WA 4IXXA 3PUGA 4PMJA 1T40A 5CAKA 1KR0A 3CB8A 4WKHA 4EE9A 1YX1A 2HPIA 2DQWA 5BWFA 1E15A 4C65A 2C6QA 4K7VA 2ATMA 5KTLA 5F4WA 3O0KA 5CPQA 1X39A 3KVJA 4AC1X 5HPOA 1XYAA 4ERAA 3T40A 2Y6ZA 3TW6A 4UMAA 3UEQA 4W8BA 5HXMA 1ZBWA 4N4PA 1H51A 4E4UA 1WZMA 4Q4PA 2WJZA 1J0ZA 4F0SA 5FF4A 2OLAA 2NQHA 2LLEA 1PHQA 3ARXA 3CEUA 1LLZA 2A6LA 1ITUA 4TUFA 5GVJA 3GC5A 5DMNA 2ZUUA 4GMEA 3FHAA 3AXXA 1V6TA 3TR2A 1ZAHA 1FDJA 2VFEA 3G1VA 1ITCA 3OYXA 1YPFA 4FXJA 3SFWA 1EJUC 4G2DA 2OWWA 4IIFA 2YFOA 4QFUA 1FWBC 2E5DA 1GONA 1TV2A 2GSEA 3C2FA 1TV4A 4MB3A 3RM9A 1X96A 4GWEA 3MCNA 1OFQA 3WLJA 3VDAA 1E0XA 4QG9A 1C9DA 2OYMA 2PDUA 2NX3A 3BL3A 4KWUA 3THQA 1CGXA 1CECA 2OX4A 1LCOA 1NVMA 3H23A 4Z2KA 1VFFA 3SCRA 5BXPA 3T4CA 1QNQA 3NEVA 4ZCWA 4Y8EA 2QMKA 4IMFA 1T96A 5DELA 1C8XA 2VDGA 3CC1A 3O6DA 2OR2A 2C15A 2PSNA 3LBMA 1AH0A 2CBJA 4O1AA 4AY8A 4H8VA 2O0TA 5C2XA 2P5NA 4C5ZA 2WANA 4GI6A 1LROA 3F4NA 3JS3A 3WUFA 4YL2A 4UQCA 3TSMA 3VKDA 1UR1A 2POZA 4L56A 2RHGA 3AROA 3BARA 4CQ8A 2PDIA 3P67A 3LGEA 1R38A 6ALDA 4TVCA 4M7SA 4P8UA 1LORA 4ADUA 5A2BA 4DJFC 4HNTA 3L68A 3CAWA 3GNDA 2E40A 2BFGA 1MW2A 2GVYA 4DF1A 1GVIA 5T8GA 1MNSA 3TSDA 1DJGA 3EOEA 3LV6A 3K4AA 4HOZA 5JXQA 1GOIA 4W88A 4FZIA 2PAJA 3FGCB 4NU7A 4HNLA 1P5BA 3KBJA 4JTHA 2J77A 1HJWA 3CHVA 4GO8A 2RGLA 1IXNA 3UJSA 3QPEA 2GQ8A 2C8NA 3CBWA 4E0CA 3DESA 4K8HA 3QBUA 1J0IA 6ENLA 1OD8A 1GVQA 4LUIA 3WX7A 1LG2A 3MANA 2PWGA 3N4EA 3RX3A 4OBRA 3E74A 2FTPA 3DYMA 2X1RA 4L4OA 4O1EA 1A3XA 1JZ3A 1EDGA 4JFWA 3HG3A 4U5KA 4Q8UA 3LRLA 1O60A 2XSBA 5FEXA 3E49A 3TJXA 1XIGA 2XZ9A 3WD4A 4D9PA 1T0OA 2EG7A 4A8IA 3SSJA 5BNKA 3CV7A 3NDZA 3B0XA 3UY7A 2ZZ2A 1S2VA 2YXOA 2V67A 3HPZA 1ODUA 4C91A 2INZA 1XH2A 1A3WA 3K1GA 2FGZA 4AY1A 5AB3A 1FHLA 1OWQA 4FI4A 1EA9C 2DUAA 4G1NA 3A4XA 3MHUA 1HKMA 4FIQA 1GVSA 5H2ZA 5C9WA 4IGHA 3NZGA 3DFOA 4EOUA 4HMDA 4YCOA 3G6LA 4L1WA 4N9CA 1LP6A 3JR2A 1I9CB 4LBSA 2HISA 4AYSA 3F7JA 2QCEA 3WF2A 2JF6A 3UQNA 3Q58A 4ALDA 1S1PA 3WENA 1AH4A 2FJUB 2XHYA 3PPGA 3BSGA 3E2SA 4E2DA 1AH3A 4Y90A 2D22A 3C2YA 4Z08A 3TSBA 3OGSA 3EA2A 3GXNA 5F2LA 2DT2A 1H0IA 2NXIA 2Z28A 1AUSL 2PD9A 4J5NA 1TX0A 1S46A 2YCJA 1VQTA 3OU8A 3PWGA 5E0FA 1S2CA 1J0JA 4MB4A 2Z1BA 4JGDA 1IZJA 4UR9A 1ZHAA 2W91A 3FFSA 1DJQA 4N6EA 1BXCA 3FDGA 2ZZ4A 5FF3A 1XX1A 5LA1A 3TX9A 4QJ1A 1IWPA 3AALA 2PF0A 3OVGA 3WF4A 2QDGA 2NXHA 2OMAA 2DT3A 1TTQA 2NT1A 3G1HA 1SZRA 1TPH1 4H1ZA 4H2HA 3CL6A 3INPA 1H41A 1IF2A 2QGHA 3MMTA 3RN6A 1G0CA 2X40A 2BXZA 2PC4A 4QQUA 3H21A 4ZE4A 1WP6A