3NQAA

Crystal structure of the mutant f100a of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
219
structure length
219
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGAPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase/lyase inhibitor
source organism Methanothermobacter thermautotrophicus
publication title Crystal structure of the mutant F100A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
rcsb
total genus 87
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqaA00
2Z6JA 1KFBA 1R47A 1SU5A 1M7PA 3I68A 1QFEA 3GK0A 3W7GA 1QOQA 2RHGA 3W2NA 4XKYA 2QKFA 4E38A 4JEQA 3ELFA 1KTBA 1TJPA 3PUOA 4DF2A 3UXAA 4GE8A 5C55A 3T44A 1DOSA 1IF2A 2DU2A 3W23A 3C61A 1K02A 4JX4A 4H3DA 1H7WA 3FIGA 5I3IA 3LCXA 4RZ5A 2A6LA 4LVFA 1ZNNA 3FKKA 3G1HA 4MKNA 4LOCA 4BFAA 1EIXA 3CQ0A 5FEXA 2RH9A 1YPFA 3W6YA 3HO8A 3NEVA 1ME8A 2NZLA 4ZQOA 3EKZA 4MJMA 2V2DA 2ZRZA 1B57A 1SQ7A 3MP3A 1OF8A 4CQ8A 1VYSX 1ME7A 3G22A 3SZ8A 1F74A 2DZUA 4R53A 4PFMA 1VRDA 3MJYA 3TXVA 4JR5A 2VEIA 1G67A 5DBTA 2EAWA 1KFJA 4PH6A 1HUVA 3FEMA 3G0UA 2FJKA 4A2RA 5KZEA 3LCGA 1S5VA 2JKPA 1QOPA 1DHPA 3P7YA 1CX9A 2G5WA 4YMZA 4KFNA 4UTTC 3W1XA 2A21A 2H90A 3A24A 5AHEA 1GG1A 2WSYA 5K7JA 3NQFA 1MO0A 1OF6A 1BWKA 3B0PA 4ZQMA 1LZOA 4IMFA 2QDHA 3PG9A 1OVDA 4C1KA 2XN1A 3ABSA 3PULA 4UFIA 4PL2A 2DZXA 3N34A 1F2JA 1LBFA 4OE7A 1A5AA 3LRMA 3W7KA 2J9ZA 5D38A 1F5ZA 4MYAA 1W54A 1RD5A 5BNKA 1ML1A 4X2RA 5SWUA 1O5XA 1KM4A 1EUAA 1EA0A 4CLMA 1WBJA 1VHCA 3HPXA 3F4WA 4FIQA 3G0XA 2EF9A 2NX1A 3O05A 2FPVA 1Z42A 3W7JA 2HSAA 2FQIA 1WV2A 5HJLA 3BLEA 2G97A 2WJZA 4MOZA 1VZWA 3WK0A 1RZMA 3EKLA 1SW0A 1AW5A 2VXNA 4A2SA 4XUGA 4XBSA 4LVDA 3GDLA 3U6WA 2YW4A 3BG3A 3L0KA 5FI8A 3W75A 2X1SA 4AHPA 2PC4A 4MZ8A 2QCEA 2GVLA 1G4SA 4QQ3A 1EP2A 3PUDA 3HG2A 4O53A 3NM1A 3MP4A 3C0JA 1WBHA 4NUWA 4BWLA 2RDUA 5GVJA 4HPXA 1PCWA 4I9AA 1SZEA 4O13A 4RJEA 1OG0A 3QC3A 1F6PA 2C16A 1TPVA 2V9DA 5F2LA 1XDMA 1L6SA 2O7SA 2E5DA 1NSJA 1FDJA 4R7JA 2P1FA 4MY9A 4N9CA 1GTEA 1OFEA 1T99A 1KA9F 1TPFA 1SW7A 3EB2A 4JN6A 3MBDA 3G0SA 4OWGA 1ZAJA 2CLIA 3W71A 1SFJA 3F03K 5J5DA 1KLYA 2ISWA 1H7NA 3W7HA 3PVFA 4TMCA 1N8FA 2QCDA 3RLUA 3SJ3A 4O28A 5D2TA 3NQ7A 2QR6A 5G4WA 3W1TA 4GNJA 1H1YA 1KFCA 4CNPA 4DBDA 4LU0A 1LROA 3BK0A 2YZRA 2BWGA 4JYDA 1UJPA 2PCQA 2V82A 4NJGA 3PS7A 2AQWA 4HPJA 4S2BA 4WY0B 1GVQA 4L4LA 2VFFA 1YADA 1LCOA 4QJ1A 2WKJA 1W1ZA 2Y88A 3W9ZA 2A85A 3TJLA 1QPQA 1NFBA 1VGAA 2J27A 5G2HA 2HMCA 3STEA 3TUUA 1GTHA 3L66A 1KFLA 3DZ1A 1W3IA 2V5LA 1D3GA 3M0ZA 4UTWA 5AHLA 1ZAIA 3Q37A 4MLJA 3G1FA 3Q2DA 4POCA 4O52A 2R91A 1Y0EA 5AOUA 5BMWA 3GKAA 5KZDA 3H55A 5D03A 4Y6GA 3L68A 3NZRA 2WNZA 3E49A 1VC4A 2VKZG 5FF0A 1SW3A 1YLVA 5IM51 1JULA 4NJIA 4JTFA 3O8AA 3HF3A 5LZLA 4WXZA 4LVBA 1EUNA 2FPTA 1WOAA 1G7UA 1YDOA 2PRHA 1H50A 2W6RA 2G95A 5D2VA 5AC7A 1GVFA 4NQ1A 4I7WA 3KOFA 2TYSA 3ZFHA 3CWOX 2XN2A 4NXKA 4JIPA 3U8GA 1OABA 3E96A 2ZQ0A 4LV9A 3WK2A 4LS1A 2WOQA 2QUVA 4N9EA 5HWMA 4UFMA 4LY8A 5K9XA 3G1SA 3U2OA 1T96A 4QM1A 4WZHA 1A5SA 5D2WA 4N9BA 1I2QA 2B7NA 4OHQA 4K7VA 3IIOA 1QDSA 2ZYFA 4Q4KA 4N6FA 4AVFA 2JGYA 1ZALA 1J5TA 4AF0B 4R33A 1DV7A 4O14A 4O4VA 3S5ZA 1TMHA 1SSDA 3HPZA 4RXGA 4QAIA 1M6JA 5FF2A 3TC6A 2VFIA 3DFQA 4JTIA 4QITA 5FF4A 2V8ZA 4TO8A 1VS1A 2DZWA 3KRUA 4IWWA 1I2PA 1LRNA 1GWJA 2ZZ5A 3T78A 1CW2A 2WQPA 1PE1A 1FY6A 1PV8A 1KTCA 3NQEA 3VCRA 4RXFA 3N2XA 3B04A 5DELA 4Z0SA 3DHDA 3SECA 3W1MA 2B0MA 3EX2A 5EL1A 2GQ8A 4Y9AA 4UC5A 4MYXA 3C4UA 3TV8A 1L2UA 2NXIA 5D2YA 2A5HA 1R2SA 3GXTA 5LHEA 3NAVA 3TKFA 2PE4A 1Q6QA 2QCMA 1S5WA 1YXDA 3FKRA 3ATZA 3TMLA 5D37A 1A5BA 3LCWA 3CTLA 3DENA 1GPWA 3W1QA 1R2RA 1VCFA 4IGHA 3MW7A 1IIGA 3NM3A 2OJPA 4FHAA 4O19A 5CG7A 5EA9A 5G1TA 3LXCA 1H51A 2CLOA 2E09A 5C54A 3PSVA 3JR2A 1EX5A 1YTKA 4NX0A 4O50A 3IVUA 4DO5A 1TREA 4WOQA 3TQKA 5J5RA 2A4AA 3NQMA 3O07A 4A22A 1FCVA 4GRSA 1D9EA 3LERA 3OEXA 4O15A 4MLRA 4AWUA 4HN4A 1LRQA 3W7OA 4AWTA 2X1RA 2CZ5A 5I3JA 2OZ0A 3FJLA 1FXPA 1SZFA 2Z1BA 1VLIA 4WY0A 3R2GA 3MYOA 2CZFA 3LLFA 3GDTA 5AFDA 2DORA 4ORIA 1S5TA 1GEQA 2GQAA 4UR7A 3STFA 3MBFA 3M9YA 3PC0A 1UBSA 3A23A 1KLZA 1VQTA 3HMJG 1EEPA 4ZL1A 2B7PA 3USBA 3UNDA 3NPWA 1JQVA 2CW6A 3SSJA 3C2RA 2BTMA 3LLDA 3E0IA 1SO4A 2BZNA 1C8VA 3ANYA 1YDVA 1KV5A 5A5WA 4K36A 1TRDA 4O17A 3L5LA 3N2MA 2DP3A 1QR7A 3IV3A 3FLUA 1Z44A 3KHJA 3KVLA 4AHQA 5AC6A 4AAJA 5DLCA 3L9CA 4NX5A 1FDYA 5K4XA 3LBMA 5LNWA 3DU0A 1FCBA 4HIBA 2CFFA 2Y63A 7TIMA 4M5PA 2ZZ2A 1FCQA 4N4QA 1IXPA 4PCFA 5E1QA 1J2WA 4IJBA 5FESA 3L5MA 2WPBA 2ZA2A 1UUMA 2CLKA 3NOEA 3TK7A 3NXFA 1NVMA 5KINA 3TCEA 1H62A 2GPTA 3AJXA 3I7QA 3LCLA 4HNUA 3BGGA 2W0UA 3QMSA 2YGYA 3W1LA 3BLFA 5D33A 2VC6A 5K9CA 1X6UA 3NQGA 4LVAA 3BG9A 4Z1DA 1F73A 2FIQA 4W9TA 2A6NA 1OFPA 4M6QA 3TSBA 1OX4B 3UZJA 4TIMA 1QO2A 1N7KA 3QMRA 1P0KA 3QJAA 3W2LA 4ZQRA 1XUZA 4JGDA 4Z1BA 4CCEA 4FNSA 1K8XA 1WQ5A 1KBJA 1KM0A 3ZR4A 1GZGA 4DF0A 3P74A 4K7YA 4ZQPA 3LHUA 2GOUA 2EGZA 4IXXA 2OT1A 3LTPA 4LC8A 1VHNA 4OGZA 4Y8FA 1U5JA 2E77A 1MEWA 2YCEA 1OFRA 2QCGA 3NL5A 4KWVA 2H6RA 2H8XA 4NNAA 1GQNA 1H7RA 2BLEA 2BXVA 2VELA 2V5BA 1H1ZA 1L6WA 3LHZA 3NGJA 1MEHA 3F1QA 3P61A 2Y7FA 3WJZA 2F84A 2V81A 3P5YA 1Z48A 2QCLA 3LOTA 1PL9A 2TMDA 4P2VA 1DL3A 3D0CA 1W5NA 1VCVA 4LRTA 1XBVA 5T26A 1W5PA 3P60A 5HINA 4UFKA 5KMYA 4LC6A 4LW7A 5LNRA 2CZDA 1AW1A 4HSOA 1F05A 1OYAA 4PC8A 4TX9A 5HUOA 3BV4A 1HTIA 3M16A 1RPXA 1Q6OA 1YTEA 2ZZ6A 4JS3A 3DKLA 3H53A 4IOTA 1L6YA 4LVGA 5D02A 3N9RA 4J9JA 1TYGA 5MHBA 3OVRA 3OIXA 4QNEA 4O1DA 3GX9A 3KVKA 5G2IA 4NNCA 3GYEA 3TA6A 2FTPA 3LXBA 2Y62A 1FX6A 2NUXA 5G1YA 1FWTA 3B03A 4CCCA 5LGXA 1KFEA 4NVTA 3N19B 1QPRA 5EY5A 3W70A 3EXSA 1OX5A 3MUXA 4UTIA 5A8GA 5CPNA 4JX5A 2D73A 1A53A 2QUTA 1S3HA 3EXTA 3SGUA 3TQ0A 5KZMA 3TMQA 1MZHA 1RQEA 1PHWA 1FWWA 1H5YA 3HIJA 3C56A 1O95A 3M5XA 3QH2A 2VOMA 1A50A 4BR1A 3O1NA 3P8JA 4CNOA 4LUJA 4O54A 3BW2A 4P61A 2DJXA 4LT9A 1W5QA 3TSDA 2ZFAA 3DI1A 1W5OA 3RF9A 1I2NA 5CZSA 5L6UA 3W87A 2ZRWA 1O4UA 2ZCGA 4K38A 2DJLA 2JKEA 4UFHA 4JXCA 3L0GA 3TR2A 3EX1A 4JX6A 1JCYA 5HR7A 3THAA 2C14A 1XKYA 4NU7A 1F76A 1TCDA 2PURA 3LV6A 1KTNA 1T0OA 1LDCA 1RVGA 3E12A 3T55A 3QSRA 3MHUA 3EXRA 1DQXA 2WNNA 3L21A 2VFGA 3NPUA 5D05A 3NL2A 2E68A 3PBVA 1PVNA 1GYNA 4AF0A 2X1UA 4WUIA 3GDMA 1KFKA 3DFSA 4XQ6A 3EWYA 3W76A 3P62A 3G1YA 5TIMA 3RMJA 3DFNA 1VH7A 1XBYA 1P0NA 2Y7DA 1X1OA 3BW4A 1GVSA 3G18A 3W7IA 4UIOA 4O1AA 2NLIA 2X16A 1B4KA 3VNDA 4CNNA 1TPEA 4D2JA 2GVGA 2C3ZA 3PBUA 4OU1A 2V0TA 1PS9A 3LBCA 1OFQA 3I6RA 1TIMA 2R14A 3LTYA 1W56A 4QISA 3GAKA 4M7TA 3SW6A 4ZMGA 4U28A 4NJHA 3A5FA 4O0ZA 2Q8LA 4AEOA 1LBMA 1EWDA 3KVMA 2LLEA 4MY8A 1LOLA 1H7XA 4RLIA 1E51A 2ABBA 3CC1A 5L9FA 1SZNA 3EX4A 4FX6M 3HG5A 2TPSA 1TTQA 1JUEA 3W1UA 4GUJA 5HUPA 2OMAA 4FNUA 3GR7A 5HNRA 3W72A 1H7PA 2NX9A 2QF7A 4FX7A 1XXXA 4WOZA 3LCHA 3W3OA 5AHIA 2NUYA 3M5ZA 2QAFA 1OFAA 4EF9A 1OHLA 1LTDA 4WD0A 5FEPA 1G69A 3STGA 5HWNA 3UYCA 2NUWA 3QMTA 1LYXA 3BVJA 3KRSA 3DI0A 3W1PA 4FNRA 1G4TA 2WSQA 3NR0A 2NXGA 3TFCA 5H2ZA 3R12A 4KWWA 1VJIA 3O6YX 4WQ6A 1TPC1 1LLWA 4RK8A 4XKYB 1EP1A 3W7NA 8TIMA 4FX8A 2QJIA 4JTLA 2RKXA 5AC8A 5F4XA 3SR7A 3NNTA 3HJZA 3A9IA 3QEZA 4ADUA 1BTMA 1TRIA 1TPUA 4AH7A 5KITA 3BGJA 1JRCA 3ZWSA 1C9DA 3DKJA 2VFHA 2WSRA 5HQEA 2YYUA 3C52A 1OYBA 3MMTA 2CLLA 2YR1A 3TW7A 4IXHA 2V2HA 2JK2A 4JTSA 3SI9A 3NG3A 4JYEA 2C6QA 3CLMA 2WNQA 1FDZA 4GBUA 5D09A 4LS0A 2CLEA 4M6PA 2YFNA 2B4GA 2VEMA 4RX0A 4H4IA 1ZJIA 2ZDRA 5LHFA 3GVGA 4HHPA 2OX1A 4JTJA 1MEIA 3HQ1A 1LRTA 2DZPA 1F7BA 4O4WA 3JS3A 3IGXA 2FB3A 3L0NA 3S8HA 2A7PA 3HPSA 1I45A 3N9SA 3S9YA 3NQDA 1Q3NA 3W2KA 3UZ5A 3B0VC 3RK8A 1WA3A 1TTPA 3CB8A 3HGJA 3MYPA 5H91A 1JJKA 5EBUA 1ZCOA 2PRLA 1OX4A 3G1XA 3CIWA 4LUIA 3GR8A 3SFKA 4GWEA 3DFTA 4ALDA 4OT7A 1JCNA 3UY7A 2QDGA 3OBKA 4O0KA 3TW6A 3DHFA 4NNBA 3QW3A 1GT8A 3WK3A 4IUOA 2QCDB 3B06A 1O60A 3YPIA 2Y89A 3G1AA 5CPOA 4BI5A 3C8FA 2GJLA 1SO3A 2KZHA 3N73A 2H3BA 2RDWA 3Q94A 4GUIA 3O16A 5CGQA 5ABTA 1FUYA 2J9XA 4JTHA 5C5YA 4EVZA 2YSWA 1NEYA 3PB2A 4UCGA 2Q8ZA 3CT7A 3IVSA 3T4CA 1A5CA 4ZZ9A 3P84A 4PA8A 4DO4A 4CQAA 1L9WA 1SFLA 3QQ0A 1H63A 1LORA 3IIVA 1VCGA 2CLHA 4FNTA 3C2FA 2ZRXA 1TV8A 3S1WA 3PUEA 3EX3A 4TMBA 4JTGA 1PHQA 3AO0A 1Q6RA 2HTMA 3UWVA 4FIRA 1ICQA 3L67A 1JUBA 3S0CA 1SZGA 1TTJA 4FB7A 1V7YA 1GG0A 3W1AA 4E2DA 3VE9A 1NF7A 1K7EA 3NDOA 3NQCA 4N4PA 5DY2A 5DXXA 2OCZA 2DZTA 3G8EA 2IQTA 1TO3A 1K3UA 3UWYA 1YTDA 4O11A 1VYRA 1I2OA 4JY9A 5DCEA 5FF3A 3RNDA 3S5NA 3H54A 1LOQA 3VE7A 4UTKA 3INPA 4HSNA 2VENA 3NA8A 2FPYA 2C18A 2VEPA 3UPBA 2R8WA 3G8RA 1WOBA 4S1FA 5LNVA 3I7RA 4C1LA 1BEUA 4GFSA 1W0MA 3FYOA 3C6CA 1TSIA 3W1NA 1TB3A 1G7VA 4M6VA 1OFOA 1PIIA 4I7UA 4JDBA 2ZTJA 3WJWA 1QNVA 5EPDA 1XDLA 3TDFA 3DBPA 3IIZA 2ZZ1A 2VEKA 3LI1A 2Y85A 3O6CA 3MO7A 4Q32A 5K4ZA 1LBLA 1THFD 3QZEA 4FEZA 4UMCA 4HNVA 2NWRA 3EEGA 3I65A 3TAKA 1TPWA 5CKSA 4UMBA 3M7WA 5I3HA 5F2IA 2QEZA 3GLCA 4OBTA 3DAQA 5CZTA 4WXYA 3MHGA 4IPIA 2HS6A 3LRKA 4YL2A 1P5BA 2TSYA 3IVTA 5BRBA 3G1DA 3TQVA 1HO4A 3WJXA 1TPH1 3NQVA 1XFBA 4NT0A 2C19A 3BO9A 4K8EA 3I7SA 3VFLA 1ICSA 3HG4A 3DGRA 2TRSA 4LNYA 1EWEA 4JY8A 2NXHA 4IMEA 3KX6A 1RR2A 3UY8A 4UXDA 4XZ9A 1K03A 1I2RA 2GVJA 5EKYA 4ADTA 2WV8A 4FXRA 5F4WA 5HWJA 3LI0A 4AXKA 5AB3A 1AMKA 5F4SA 1ADOA 2QCCA 3STCA 5F1VA 4ZVJA 3M43A 3WJYA 3TX9A 3P8IA 3EWUA 3BW3A 4JTUA 2A0NA 4KFPA 3DXIA 3O6DA 2QCNA 1FXQA 3O15A 3W88A 3TXZA 1VLWA 3LB0A 1B3OA 5AYXA 1OYCA 1ALDA 1FWRA 1ZAHA 3WFAA 2Y7GA 1TQXA 5DCBA 4DEFA 3TNOA 3HB9A 2VFEA 3TU9A 2P10A 1GOXA 3W74A 3RU6A 4CQ9A 1OFBA 3GDRA 1BWLA 3W73A 4GUGA 1WAUA 3UWUA 2ZZ4A 1XM3A 5LKYA 4JNMA 2X1TA 4ML9A 1GVRA 1V5XA 4NJJA 4UUIA 5KTLA 1AW2A 1HG3A 3UPWA 3NQ8A 1Q45A 2ZBTA 3KXQA 4L4MA 3OVQA 1NF0A 4RR4A 4UFJA 4MFDA 2ZZ7A 4AWSA 3KFTA 5HR6A 3W07A 1Z41A 4EIVA 2E1DA 4DQWA 3UWZA 3R5EA 1W37A 3B05A 1OK6A 4BI7A 1QMLA 2J9YA 5DN1A 4UTHA 4IQLA 4HNNA 2QCFA 3S5YA 4MVAA 4X9SA 4DELA 1M7OA 4IPJA 3DH7A 2E6YA 4JTTA 1JUKA 1KM1A 3A22A 5LGZA 1EB3A 3W7PA 1TPB1 1PCKA 3LRLA 4LWWA 3P82A 1U83A 2DZVA 1DQWA 2JBMA 4Y90A 1K8ZA 4XWUA 3W83A 3UWQA 3CPRA 2Q3OA 4X3ZA 3Q58A 4JYFA 3W2MA 4B5NA 2AGKA 2YYTA 3ZS4A 2A2IA 4WX2A 4NXSA 4UTJA 1KW1A 3PWAA 3QSTA 1TQJA 1UUOA 3HG3A 3QRHA 4A21A 3LCIA 1JCJA 4ZQCA 4GJ1A 4UFLA 2ZRVA 4TU1A 3C2OA 3MP5A 2E5BA 2E6FA 3ABRA 1SR9A 3BARA 1TV5A 5EMUA 1K7FA 5CZJA 3FA5A 1QCWA 3UWWA 3DFOA 4RV8A 3C3NA 1HFBA 1RQHA 3QF0A 2CWNA 2B7QA 3P67A 4O8RA 1DJNA 3CHVA 1XUUA 4MZ1A 5LSMA 4NJKA 3V1PA 3IIPA 2ATMA 4PODA 3PBWA 2QJHA 3BLIA 3NQ6A 4N02A 5F2MA 1QWGA 2NWSA 6ALDA 2ZA3A 1XBXA 4IX2A 2I14A 3KRZA 4OQVA 2NV2A 1B9BA 4YXGA 1IGSA 4WY0F 3IRDA 2WO5A 4GUHA 1QPOA 1T8XA 2XFWA 2Q3RA 1UASA 1I4NA 4FNPA 3NYZA 2ISSA 5CZ0A 1RV8A 4ADSA 1H7OA 2V2CA 1ZY9A 4HT3A 4OV4A 2V30A 3R89A 2H3DA 4BK9A 1LP6A 1SSGA 1YXYA 4LRSA 5AHMA 2BSLA 3OA3A 2Y6ZA 3BPWA 4O1BA 1SO5A 5AHNA 1GYLA 2X30A 5KSWA 3MI2A 5LNUA 2I9EA 3L65A 2AAMA 5I3GA 3DFPA 1YYAA 1SO6A 3QQ1A 2QJGA 4XTIA 1OK4A 3S1VA 3L5AA 4MZYA 1K7XA 1EPXA 5K2ZA 5C6MA 1FWSA 1ONRA 2G96A 2ZTKA 4E0CA 1KM3A 3W7LA 1JQXA 1X8FA 5AN7A 4JIQA 4ICNA 3PG8A 3PBYA 5DXYA 4K8HA 3OG3A 5BOOA 4RZ6A 3SY5A 1VPXA 4GXMA 3M41A 3FYPA 1DVJA 1CI1A 4FXSA 3P80A 1Q6LA 1KV8A 4JD4A 4FF7A 3W7MA 4DO6A 4MY1A 1H60A 3PF3A 3EX6A 4HKPA 1F6KA 3S1UA 2C15A 1AG1O 3A21A 3PY2A 3W2JA 2B7OA 4S2CA 3WJSA 5BW6A 5D32A 1KM5A 3T40A 2ATSA 2R94A 3HBLA 4LV4A 2ALDA 2A7NA 4RKAA 1OJXA 4FO4A 3GDKA 3PB0A 4OV9A 1TV7A 4Q33A 1K8YA 5U7SA 1JCMP 1JRBA 2CU0A 5LNSA 5HULA 3OVPA 2X2GA 3OHIA 4MJZA 2QUUA 2CLFA 3NPVA 4EWND 5CPMA 3W1RA 3QPYA 5IBXC 3TE9A 2ZRUA 1ZENA 3S1XA 2ABAA 3TAOA 3G24A 4YCPA 5G2WA 2JGQA 2CZEA 2NX3A 1YDNA 4ONVA 1ZHAA 4AB4A 4N2YA 3MHFA 2A1YA 3GNDA 3UQNA 4A29A 3GIYA 3BG5A 1G6CA 5D2XA 4KFOA 1O94A 1GJPA 3GAYA 1WDWA 1TJRA 4GUFA 2FDSA 4N9DA 5AYZA 1XBZA 1IIHA 2ZRYA 2EHHA 3QFEA 3CIXA 2O7QA 3ABQA 5DBUA 3E02A 2GJNA 4UR8A 1IXOA 2E5CA 1KM2A 4JICA 4RZ4A 3G3MA 3W22A 4U4MA 2H8ZA 3KAOA 2I1OA 3FFSA 3LHTA 4QNWA 3EWXA 2C1HA 3LXAA 1WYIA 4CCDA 2CLMA 3S42A 3VKJA 2EPHA 3ABOA 3TC7A 2Y70A 1FQ0A 3NO5A 3W7CA 4Z1AA 2E6DA 3KVJA 3MWAA 5IBXA 1X7FA 2YFOA 3ZWTA 1VYPX 4Z0JA 1DBTA 2J88A 4N6EA 3S6DA 3TIMA 3TROA 2C0AA 5E0KA 1JCLA 3SIZA 1O5KA 3IIXA 2GUUA 1XL9A 2YPIA 3N14A 3IGUA 2QAPA 3PR2A 3LHVA 5I3FA 4K39A 4M7SA 3O06A 3W86A 4BF9A 1W8SA 1IXQA 3IGSA 2UV8G 1I8JA 1X1ZA 3B0UX 1DJQA 1HO1A 1EP3A 3W2UA 4HNTA 2A7RA 3TJXA 2Z2UA 3F4NA 5CSSA 2FLIA 3N3MA 4NZJA 1XCFA 3HGOA 4DPPA 2E6AA 1QAPA 4LS2A 1AL8A 1M5WA 1C29A 3WK1A 4EOUA 2XN0A 3LCFA 2J24A 2Z6IA 3NPXA 2ISVA 1QO5A 3M1ZA 1IXNA 3CM4A 4UNKA 3GXNA 2JKAA 5D04C 2RFGA 4UTMA 1ICPA 1AL7A 4IX0A 1YXCA 1WX0A 5G5IA 5I3KA 3MI6A 3SGZA 4QSHA 3TH6A 4O12A 4QIUA 5E93A 3HGSA 1ME9A 4Y96A 4YLWA 4O57A 3UXDA 1N55A 2PRMA 3NQ2A 2ZA1A 2HS8A 2J6XA 3W7EA 5K3VA 3UD6A 3T7VA 3GXPA 1YPIA 4UTUA 4PEKA 3PSWA 1HL2A 2YX0A 3NVTA 2DZSA 1LOSA 1BKSA 4GC4A 5CPLA 2YDAA 1D3HA 5D30A 3TFXA 1W5MA 2YW3A 2RDTA 4UMAA 3TSMA 3GNNA 2BX7A 5FF7A 1R2TA 1OX6A 3EWWA 6TIMA 4JTKA 3LTSA 3THQA 1TTIA 5G4EA 2NV1A 2YXGA 2Y61A 3R13A 3VI2A 4Z08A 4UNLA 1OFDA 4O1CA 1SPQA 4E2BA 4PTNA 3GKFA 1VR6A 1R46A 4LTSA 4KKXA 4O10A 5F2GA 4K6AA 3NQAA 1KM6A 3A5VA 3GZ3A 3M47A 1W3NA 1JCXA 3LHWA 3RFAA 4DF1A 1R30A 3HGRA 2P0OA 4AMAA 3RLVA 2ZZ3A 3FOKA 3P81A 3LX9A 3QYQA 3G3DA 1UB3A 5U4NA 3GB6A 1JVNA 4MUZA 1DORA 5F1UA 1LLZA 3M44A 3LHYA 5CSRA 4H6KA 3W84A 1QPNA 4X22A 3NL3A 1XI3A 4IMGA 5AYYA 3FS2A 3C2EA 3K30A 5C2XA 1MSSA 3NZ1A 4A3UA 3QW4B 4YCOA 5FEWA 2F7FA 4XTDA 3JRKA 3M5YA 3MI3A 1J4EA 3W7DA 4BWLC 4K37A 4UTTA 2OT0A 3LM7A 1B4EA 4O18A 2VFDA 2Y7EA 4R34A 1FBAA 3O63A 5AHFA 4IMDA 1W3TA 3IEBA 3NL6A 1WXJA 3LDVA 3R8RA 3L2IA 4MPQA 5DY3A 4ORMA 4UTWC 1FWNA 1P4CA 4UTLA 4DPQA 1ZFJA 3LGEA 1MXSA 4ZQNA 2GQ9A 2Z0IA 1XC4A 4M19A 4EF8A 3QM3A 4TR9A 5TBOA 4G1KA 1RQBA 3W7RA 3QPZA 4YWIA 4DXVA 2EKCA 4JTEA 5FEZA 3PAJA 1SUXA 3C2VA 3M6YA 1GVOA 3V75A 3P5ZA 4RCXA 2W79A 5HMSA 3S5OA 3W85A 3CWNA 3FJ6A 2QCHA 4DBEA 2FFCA 3G1VA 1H61A 4WJEA 4AHOA 5BMXA 1P1XA 1JR1A 1G4PA 5TQLA 1G4EA 1FCUA 3LV5A 4BI6A 1NAL1 4I7VA 4MFEA 3E9AA 3B8DA 4NZFA 1KBIA 4XBKA 1DKWA 3EWZA 4JDYA 4MIMA 3ATYA 1TPDA 4PL1A 3M5VA 1W31A 3B4UA 4IMCA 4Z1CA 3HOJA 2C13A 3CEUA 5DCDA 3CEPA 3PM6A 5EYWA 4FNQA 3W7QA 1UCWA 3CU2A 3EWBX 4O16A 1LM1A 2FB2A 5K9DA 1AK5A
chains in the Genus database with same CATH superfamily
2Z6JA 1GW1A 3GTHA 1H41A 1R47A 3LMZA 3TA9A 3AS2A 1QI5A 4JEQA 3ELFA 1DJWA 4HA3A 4DF2A 2GVEA 3KLLA 1QI0A 5CZKA 3ARUA 3T44A 1GVYA 2FZNA 3QY8A 2DU2A 3MMDA 1B3VA 1EOKA 4H3DA 3PFRA 1X8CA 3LCXA 4LVFA 2XH2A 3CUFA 1W6TA 4LOCA 1EIXA 2GUYA 3OU8A 4AZIA 4AMCA 1PO9A 1XKJA 4H6RA 2NZLA 1ZBWA 4ICMA 1KBBA 2JIWA 2HXTA 2V2DA 2ZRZA 3OBAA 3MP3A 1VYSX 1WNOA 1ME7A 4DRSA 1F74A 3WNNA 4R53A 4B16A 4PFMA 3TXVA 1ISWA 1G67A 2FZ8A 1KFJA 3NWRA 2Y8UA 4UWMA 4LF2A 2G0WA 3NOYA 3THCA 2D0FA 1FP9A 1E0XA 1QOPA 3HQNA 3P7YA 4UTTC 2A21A 2E28A 1CWYA 1C93A 1GG1A 4IHCA 3OGSA 3NQFA 5M2FX 2XVKA 1C7TA 2W92A 1EXPA 1E9IA 3B0PA 4ZQMA 2E40A 3M0VA 2QDHA 2PZ0A 2ZIDA 2XN1A 4GH3A 1EJUC 2YL9A 3WENA 3W7KA 1IEIA 5D38A 2P76A 2WPGA 2PEVA 3CQHA 4NI3A 1F5ZA 1WZLA 3TZFA 1ML1A 4W86A 5SWUA 1ZS2A 3SEPA 1O5XA 1EUAA 2VVSA 2PBGA 1JNDA 3HPXA 3W7JA 1TE1A 2FPVA 3O05A 2HSAA 3IJLA 5HJLA 4RE3A 1SJCA 2DVTA 1CEOA 4MF4A 1XINA 4A2SA 2BS9A 1ELSA 4XBSA 3U6WA 4LNCA 1OD8A 1VD6A 3WLTA 3DG6A 2ZUMA 3PUDA 3NM1A 3MP4A 3REQA 3B97A 4G1NA 5G4HC 2RDUA 1ZZMA 4E4UA 4AIOA 2DUZA 3UVAA 2PDBA 3OLIA 1XYZA 4XK2A 2Q09A 3SY1A 3QC3A 1EGZA 4GHRA 3F4CA 4ACZA 4ZXOA 4L9YA 1FDJA 3WDHA 1HXJA 2GSJA 1GTEA 1T99A 1BXNA 1TPFA 1AA1B 1MUMA 1SW7A 1BAGA 1FHLA 3MBDA 3KDOA 1BWVA 2X0YA 4EE9A 3W71A 3QV6A 4PMQA 4ATDA 1T41A 2ISWA 2WLYA 4TMCA 3RLUA 3O3RA 3SJ3A 4CGTA 3EA3A 5G4WA 2XSXA 4J3WA 4JIRA 9XIMA 1KBKA 3UZXA 2JFEX 4CNPA 1H2JA 2YZRA 1UJPA 2VX4A 5I07A 2PTXA 4A6GA 4L61A 2Q02A 3G1RA 4UTFA 4LF1A 4IP5A 1GVQA 2VEFA 1V6UA 4PULA 3QN3A 2SFPA 3MWCA 1YKWA 5A6JA 2VZTA 2WKJA 3AYSA 4ZXLA 5A6BD 3W9ZA 4QDMA 3WYZA 1NFBA 1VGAA 4JKKA 2J27A 2P8CA 3R58A 1DWJM 2FMOA 2BHYA 3GH7A 3N9KA 1PSCA 1PZ0A 2EEXA 3WNKA 2J77A 2PWDA 5E0FA 4UTWA 3MMUA 1UOZA 3Q37A 2C91A 1Y0EA 3H55A 5D03A 1KB3A 4Y6GA 3NZRA 5EU9A 3RPDA 2UBPC 3TTOA 2VKZG 5ENLA 4GCAA 3RX2A 2XGZA 1YLVA 4NJIA 4JTFA 5LZLA 4WXZA 3CAKA 1FWGC 3CO4A 2PRHA 1G7UA 3TYBA 5D2VA 3PZIA 3RHGA 4I7WA 2VRQA 4GZIA 3E1F1 4A3YA 4KIRA 2D0GA 4XZWA 4JIPA 5DRCA 1OABA 3E96A 3HN3A 1ITXA 2ZXQA 3EEZA 2WOQA 4IPNB 4J3TA 5FSDC 2YL6A 3WQEA 3JW7A 2DQWA 4N9BA 3CXOA 2AAAA 5DT5A 4YTSA 3IIOA 3NDZA 2OB3A 1IYXA 3B9AA 1GKQA 3CV6A 1H0GA 1MNSA 1GPFA 3K4WA 3CYVA 3CZLA 1AQ0A 4QAIA 5A8PA 1TX2A 3L2LA 4Q8MA 1GWJA 2ZZ5A 3KL3A 4L65A 4PB5A 3NQEA 5GPRA 4TVDA 1WZAA 2GQ8A 2V3GA 5FJJA 1CYGA 3C4UA 5GJPA 1XH1A 4X0NA 2A5HA 1R2SA 3GXTA 5LHEA 3UJRA 4ERGA 5IXEA 2DSKA 2QCMA 3WLIA 1S5WA 3WH6A 4RUBA 4H7VA 1RJQA 3CTLA 4S3EA 4DNMA 2PTWA 1IIGA 4B5SA 4JFVA 1DWAM 3LXCA 2J62A 1UWQA 1OY0A 4O50A 1DXEA 3NTYA 3TQKA 3OQEA 5E5CA 3NQMA 4IMAA 1OB0A 1PZ3A 1YIXA 1YNQA 1YNYA 3RGTA 3DEQA 4JEJA 1F3EA 4JIIX 2OZ0A 4J2PA 1FXPA 4DUXA 1V6YA 4WY0A 5AVNA 2F9RA 1UZ4A 3VGFA 1S5TA 3LNPA 1CNVA 4UR7A 2ASHA 2HQAA 1UBSA 3A23A 3UR2A 1VQTA 4XIMA 1AH3A 2B7PA 3KWSA 3UNDA 3SSJA 2BTMA 1K9EA 3E0IA 2BG5A 3W6LA 1C8VA 4WIWA 1KV5A 3TC3A 4K36A 4O17A 1FFQA 2X8RA 4TUFA 1XPYA 3GXIA 3KHJA 4OECA 4AHQA 1KNWA 4E6MA 5ABEA 6XIMA 1JF6A 1DQUA 4A4AA 2Y63A 3U3HA 3EOSA 4J7RA 2VGFA 3UXLA 5CXPA 2V68A 2ZZ2A 2WVVB 3KDNA 1IXPA 1M7XA 5FESA 2ZA2A 1UUMA 3E5PA 4DHGA 4ZOEA 2CLKA 3NXFA 5KINA 1D7KA 4IICA 3AJXA 5ECUA 2PLMA 4HNUA 3B0XA 2YGYA 1XRVA 2QULA 4C6IA 3BLFA 1E0UA 4FK9A 4LVAA 5GJNA 2A6NA 4ZFCA 3GIQA 1P0KA 5FJIA 1G0CA 3A4XA 2DZBA 1OINA 1IZCA 4ZQPA 3LHUA 2F2HA 3K2GA 1BTCA 1Q63A 3LTPA 4FLOA 4LC8A 3SIMA 3UCCA 3E2SA 1UQYA 1U5JA 1MEWA 5I2UA 2PWHA 3IK4A 2H6RA 3UU0A 2PDHA 2G3IA 1H1ZA 1L6WA 3LHZA 1W1IE 3NGJA 3DGBA 3F1QA 3P61A 2Y8VA 2F84A 3GG1A 3QPEA 1PL9A 1RUSA 4P2VA 4M3PA 4PTMA 1W5NA 1YQ2A 1W5PA 9RUBA 3KHDA 4HP5A 3OLDA 5HINA 3N15A 1C7SA 3DX5A 2Q6ZA 3T6CA 5LNRA 3AIEA 1XSKA 3BV4A 4F4RA 3M16A 1U1JA 3EA1A 3NSNA 4JS3A 3VOIA 1S39A 4MDPA 1IT7A 4GQRA 4GI4A 1Y7VA 3V0UA 1Q6EA 4S3GA 1ZRQA 3OIXA 1NDZA 3URQA 2VT0A 5G2IA 2Z29A 2FTPA 2ZUVA 4XD3A 2P5NA 3LXBA 3TNBA 3V36A 3TN6A 4QE4A 5JXQA 4DWSC 2WANA 1J10A 3W6MA 3W00A 1HKMA 3W70A 4GX9A 3XINA 3ZR5A 3SGUA 1E9LA 3TQ0A 2NV9A 2GQ3A 1RQEA 1PHWA 1H5YA 3HIJA 2CHNA 4DZAA 3L7RA 1A50A 4BR1A 3O1NA 1PDZA 2BP1A 4X61A 2PLJA 3AICA 3BW2A 4PZVA 1GVEA 5DRIA 3TLQA 1W3LA 5GJMA 5CSYA 3NZQA 1W5QA 3VIHA 1CXIA 2WSPA 3AQUA 3WH5A 2INZA 5CZSA 5L6UA 3ARTA 3W87A 4K38A 2DJLA 2JKEA 4UFHA 4HTBA 4JX6A 1JCYA 3UG3A 2NVAA 1S5NA 4LAKA 3LV6A 1KTNA 1T0OA 4YPJA 4Q7BA 1A49A 3MHUA 1YX1A 2WNNA 2Y5SA 1M7JA 1BXBA 3NL2A 3RX4A 4CQDA 2X1UA 4WUIA 3NXLA 1KFKA 3G1YA 3MCMA 3C3UA 2D23A 3G5EA 1XBYA 3VKCA 4KIEA 2Y7DA 1B9ZA 2E7FA 2GFTA 3BW4A 4WDWA 4E4FA 2NLIA 3GHUA 2QZRA 4AVNA 5FOOA 4HQVA 2GVGA 3O0KA 1ODZA 3LBCA 4TX8A 1OFQA 3G6MA 4BCEA 1ZGDA 3QYSA 4NJHA 4Q4PA 3B4YA 2LLEA 1V3HA 4I8YA 4UOQA 1H7XA 1E51A 1JZ6A 4B9YA 2ABBA 2VRKA 4FX6M 3C86A 3II1A 4NASA 4IIFA 1EDTA 3SURA 3AIBA 2V5CA 5HUPA 3UR7A 3GR7A 4FX7A 4HCHA 3RO8A 2FGBA 3EKGA 1XXXA 2BGQA 2J6VA 3PZNA 5AHIA 3CAWA 1OFAA 1RHCA 4S3FA 5JVLA 2QF8A 4URIA 1G69A 1EJXC 1RP9A 4GNVA 4L6DA 3DI0A 4QJ3B 4QSFA 3J7HA 4FNRA 4G7EA 1DJHA 3LLXA 4ZE4A 3TFCA 2ZUWA 1LLWA 2HV5A 8TIMA 1LL7A 1RK6A 3LN3A 4FX8A 5I06A 1CENA 3WKZA 3NNTA 1US0A 1XLMA 3A9IA 3QEZA 4XG1A 4ZO9A 2IPJA 1BTMA 3UFYA 4ADUA 3MSYA 4HA4A 3NDYA 1TPUA 4AH7A 1A0DA 1KD0A 3Q45A 3QBUA 4PUDA 2DSWA 1W3JA 3ZIZA 4Q3MA 3TW7A 3MMTA 1HGYA 2JK2A 3SI9A 5CLTA 2NT0A 2WNQA 1FDZA 2OWXA 4GBUA 1FKXA 4AX6A 1A80A 4M6PA 4QE5A 1P0DA 2DV0A 2J7DA 3OBEA 1LG1A 2G8ZA 2CERA 4R3UA 2J7CA 1ONEA 2DPEA 1MEIA 4DUOA 3TW9A 2RAGA 2D2HA 3CLWA 2WHKA 4O4WA 3T08A 3L0NA 3HPSA 3B9OA 3R43A 1I45A 8XIAA 3RK8A 2JF6A 4LB3A 1X1NA 2NQHA 1VBJA 5EBUA 1UR4A 4AG0A 3BSHA 5C71A 4GWEA 1JCNA 3SJNA 5A95A 2Z7GA 5TF0A 1Z32X 4M1RA 3QW3A 2PCEA 2HDJA 3THUA 4JIEA 1O60A 3YPIA 2HVOA 3RILA 3GE7A 1CIUA 5CPOA 2GJLA 3TP4A 4D6EA 2KZHA 4QEHA 3N73A 2HJPA 2RDWA 4J5NA 1JYXA 1JZ4A 3ECQA 5ABTA 3AYTA 1NEYA 3IPWA 1ECQA 3WQVA 3WD4A 3T2QA 3N1AA 3T4CA 3WG6A 4HCLA 2Y4SA 4ZZ9A 4OJYA 3W29A 4PA8A 4DO4A 1JPIA 1UP0A 3CHDA 1AFSA 1V93A 5I02A 3ZVHB 3IIVA 1V0LA 4FNTA 1Q65A 4C6NA 3NZGA 1H1NA 1QVBA 1TMLA 4TMBA 3OP2A 3ORWA 4YYFA 4D6CA 3FY1A 1WXZA 2IPGA 3UWVA 4FIRA 3L67A 3AIQA 1SZGA 4FB7A 3BCDA 3P0WA 4IIHA 1XH2A 4WKFA 3MPGA 5DY2A 1NELA 1SVDA 1RAKA 5JH1A 1TO3A 3PTQA 4NIRA 3SUUA 4HTYA 5A69A 2WZHA 3K8MA 4TX6A 3KCOA 4JY9A 5DCEA 5FF3A 3RNDA 4PUJA 3INPA 4HSNA 3UETA 4IT1A 3ITLA 1W9PA 1MWOA 2XWDA 4DAFA 2QNEA 1BEUA 3SCUA 1KGWA 6XIAA 3ZJ6A 1GHRA 3ZSTA 4HHHA 4QEEA 1XRSA 2FVKA 1XISA 2ACRA 4L7ZA 3ARXA 1HIZA 3B8UA 1UH3A 4HSHA 1XLDA 3QZEA 4UMCA 4HNVA 2NWRA 1A3WA 3FW6A 3TAKA 1TPWA 1MYRA 5I3HA 4Q22A 4LGXA 3M0HA 2BDQA 2QEZA 1J18A 1W1YA 5CZTA 2J8FA 3WL1A 4TVCA 4IPIA 3GU9A 2HS6A 3ZOAA 4YL2A 3IVTA 1PX3A 4D71A 4HHMA 4PTVA 1EJVC 3BMVA 3EPMA 1TR9A 4NT0A 2C19A 1CECA 3TOPA 3I3EA 4B3KA 4WGXA 3GTIA 3HG4A 1EA9C 3ZYZA 1QBAA 1EWEA 3KX6A 1XIMA 1RR2A 2GVJA 5EKYA 5C9UA 4JTDA 3OZMA 5HWJA 5AB3A 1AMKA 1ADOA 1XPGA 4QJ5B 3N11A 2XFRA 3M43A 4JTUA 1DPMA 3DXIA 1KQYA 2VDHA 1Z3NA 5A6BA 2J78A 4WKAA 3RM8A 1I0BA 2WMHA 4V15A 1GJUA 3AZTA 4DO7A 5AYXA 1FWRA 1OGGA 1ZAHA 5BXPA 3GTFA 5HAOA 2WWDA 2Y7GA 5DCBA 4DEFA 3R1ZA 2P10A 1GOXA 4HK6A 2QXWA 1KXTA 3RU6A 4HA0A 1OFBA 1UD6A 1H5VA 2D2GA 3W73A 2ZZ4A 4JNMA 2X1TA 4GVIA 3TR9A 4HU8A 3OPSA 3UYIA 1EOMA 2PGRA 2ZICA 1Q45A 2ZBTA 4PSPA 2YKKA 5XIMA 4L4MA 2XIMA 4AWSA 1EXBA 2YA0A 1R38A 2VCAA 4EIVA 2E1DA 3KOWA 4PRWA 3UWZA 3VNMA 4I8DA 1OK6A 1XIEA 1IV8A 4F48A 3MVIA 1HP5A 3R4IA 4IQLA 3SFWA 3T9PA 3VDAA 3R7MA 2XYLA 1AVAA 5DX7A 5HQMA 2AMGA 1M7OA 1UR9A 1JD9A 4GZEA 3HFYA 3MJMA 3A22A 4MJ2A 3SCWA 1FA2A 5IDIA 1LUCA 2DZVA 4PRTA 2YL8A 1EFZA 4DWDA 3JVAA 4XWUA 2Q3OA 3Q58A 4RNJA 4QS6A 3VU2A 3ZS4A 4AY8A 4WX2A 1VBGA 4NXSA 4X63A 1TQJA 4EACA 3IJIA 3QRHA 4GJ1A 2ZRVA 4LYPA 2FHCA 1G01A 4CVWA 3C2OA 2C0HA 3WNOA 3V5FA 1UR0A 3ABRA 1JIBA 4KCTA 4IISA 1BVWA 4Z17A 4U2YA 1KBLA 3CUGA 3F4DA 1J11A 3DFOA 1HFBA 2J25A 4E5TA 3T1GA 5LSMA 3T2PA 3EOOA 1QWGA 1CT5A 4KCUA 2NWSA 6ALDA 1XBXA 4XISA 4FOUA 1MW1A 3LSBA 2NV2A 1B9BA 1ZL1A 2AQVA 4WY0F 2WO5A 3ALFA 4HBKA 2WZEA 2WZMA 1RV8A 1M04A 2VNCA 4DWSD 5HDRA 2V2CA 5FL1A 4HOXA 5CG0A 4LUSB 4QTGA 1SSGA 1YXYA 4LRSA 3GC2A 2Y6ZA 3RPMA 1DTNA 3BPWA 5KSWA 2X30A 2YDRA 1R3SA 2O9PA 3S4TA 2QJGA 4HPGA 4XTIA 1OK4A 1K7XA 1QI2A 5C6MA 4QCFA 1NM9A 1ONRA 1MNZA 3ARQA 2XJ7A 4EAMA 3QOKA 5AN7A 3WF4A 4ICNA 4B92A 5JBDA 1EGMA 3L4VA 4K8HA 1SJBA 3OG3A 1Q13A 4A8LA 2IQ0A 4B5XA 3F7JA 1VPXA 4HZMA 2YIHA 1CZ1A 3AHTA 4WF7A 2GSEA 3GRIA 4MNKA 2O9OA 3M41A 3WLPA 3QLLA 1UR1A 1Q4NX 1Q2RA 4JTQA 1CI1A 3WIJA 3GVWA 4XD4A 2BXZA 1KV8A 1EF3A 1PEZA 1U1HA 3M4HA 1W9VA 2P88A 3NJ3A 4FF7A 4DO6A 4PB3A 4MY1A 2E0PA 4X9YA 3SQLA 5REQB 3W2JA 3DERA 3WJSA 5CCZA 4H2HA 5M5DA 5D32A 2ADAA 4AEEA 1GUVA 3LGDA 5I00A 3AMKA 4LV4A 4FOJA 1FKWA 1TIWA 5XINA 1OJXA 4TXEA 3VMPA 4MB4A 3CHEA 1DIEA 1JCMP 2CU0A 4B2DD 4Q7IA 2EG7A 1NDWA 2I5GA 2I5QA 4FPSA 3T0BA 1T7LA 1MUWA 3K4AA 1ZENA 1KFWA 2ABAA 3WQGA 1E9ZB 1RPKA 4YCPA 2J8GA 4ONVA 4AUBA 4HYRA 1YE6A 5C7HA 4Z2HA 4FOKA 2C1GA 4Q4QA 7A3HA 3UQNA 3CL8A 3L12A 1G6CA 5D2XA 1WDWA 3P93A 4N9DA 3A3HA 5AYZA 1F8MA 1H3GA 5BWAA 1E4MM 1W1VA 4P7QA 3A9BA 2J13A 5DBUA 3ABXA 4Y9NA 2J7GA 2GJNA 3WLRA 1KM2A 1GZJA 4MB5A 4RZ4A 1UD2A 1XLGA 3G3MA 4C1NA 1JZ7A 4U4MA 4R88A 4C6DA 2PDMA 2VOTA 2YCJA 3STPA 3V16A 1E6ZA 1VBHA 2C1HA 5MKGA 1Z89A 1W32A 1QHPA 4ES4A 5FCZA 3NO5A 1GVIA 3TJ4A 3KVJA 4ROQA 4H2CA 2KX9A 5IBXA 1X7FA 1A3XA 3IAQA 1DBTA 4N6EA 4V33A 3TIMA 3TROA 1FWDC 1JCLA 2VO5A 4BQ5A 5C2GA 2WXDM 2QAPA 1XGDA 3HPAA 1QTWA 1U5HA 4M7SA 2PA6A 4QCEA 4NAFB 1TX0A 3W86A 3AMDA 4GIYA 3IGSA 3UERA 2XVLA 1HO1A 3TJXA 1ODUA 3F4NA 2WLZA 4DUVA 4NZJA 2D3NA 5LIXX 2E6AA 4LS2A 1M5WA 2FH8A 2V3EA 2XH7A 4OBRA 3U2ZA 4UQ9A 4TV5A 1QHZA 5I5RA 5C8BB 3LCFA 1UZ1A 1CTNA 1IEXA 2BVDA 2Z6IA 3GXNA 4H8UA 4B3ZA 3CAQA 1XCXA 1TA3A 1VEPA 1AL7A 1WX0A 1XLIA 1J2BA 4RNIA 3PTDA 3KW3A 3HGSA 3WMSA 3AMCA 1LWIA 1VJSA 3UXDA 1KO0A 2OYMA 4AYGA 2J6XA 3KP1A 4OFCA 7XIMA 3PNUA 3TTSA 3GXPA 1YPIA 3OZOA 3NVTA 1QT1A 4PMOA 4CD8A 3U2CA 3TSMA 1E1EA 5FF7A 1R2TA 3PBMA 1JAKA 3EWWA 3CPUA 2BV9A 5G4EA 1V51A 3PAOA 4XAFA 2PFHA 4O1CA 1SPQA 4F8XA 3PJUA 4AU0A 3GKFA 1PIGA 4YIWA 3A3WA 4LTSA 4KKXA 4I5XA 3WF2A 2DEPA 3NQAA 3Q67A 4KQNA 1KM6A 2X05A 3A5VA 1JFHA 1W3NA 3WNLA 1JCXA 3RFAA 2P0OA 1WAWA 3AOFA 1Q4WA 1TWWA 3FOKA 2VR2A 5KZ6A 1XSIA 2GWGA 1UB3A 1ECEA 3THDA 1J9YA 1JVNA 3QTPA 5JH2A 3M44A 2IPFA 3DC0A 4HK5A 1ZUAX 2I56A 3GH4A 3W84A 2G3JA 1ADDA 4X22A 2NSOA 2PDPA 3NL3A 3VOJA 2OODA 3S2MA 1BQGA 3HTWA 4LBRA 3C2EA 5C2XA 1AQFA 1Q8AA 5FJPA 1KGXA 1H49A 3PPGA 4YCOA 1EL3A 1FOBA 3M5YA 1VFSA 3KBMA 3BGAA 3W7DA 3SCNA 4PTWA 4BQ3A 3DG7A 2HISA 3O63A 4BEUA 4IMDA 3URBA 3LDVA 5DY3A 3VIFA 2V3DA 4UQDA 1QUMA 1P4CA 3VIJA 4ACZB 3AXHA 4M19A 4EF8A 3QM3A 2BODX 2F61A 2W62A 2BXYA 4PCPA 3UG8A 3PAJA 1QWKA 3SN4A 5AKQA 2PDLA 3V75A 3P5ZA 1P6BA 1RY0A 5M17A 4UQCA 1S2CA 1ITUA 1R9XA 3FHAA 3W85A 1R7AA 3S47A 3FJ6A 5BMXA 1JR1A 4DYJA 5LA1A 1G4PA 1G4EA 4UCFA 3KEHA 1MRAA 3B8DA 1KBIA 1DKWA 5M03A 1OCBA 3N6JA 3M5VA 4K1GA 4WVXA 4FNQA 5HXMA 5C70A 1RVKA 1JNEA 1MQRA 5K9DA 4E4PA 1AK5A 1ZCCA 1OCQA 1SU5A 1L0PA 3KOYA 3U48A 3GK0A 3W7GA 3W2NA 1JEZA 4XKMA 4E38A 2GDVA 1FWHC 5GNZA 2G4FA 4W7WA 5C55A 1RLCL 1NWSA 1IF2A 1DWHM 3W23A 4JX4A 2VM8A 1H7WA 4RZ5A 3FKKA 4MKNA 4BFAA 3EB4A 1OIMA 3CQ0A 1EEXA 3DECA 1XFCA 3V35A 1KRBC 2RH9A 4WJ8A 3W6YA 1E3XA 3U0HA 2CITA 1V77A 2CHOA 5HNTA 2QV4A 4Q8VA 4F0RA 1B57A 1KR0A 2PU1A 4HN8A 3RLHA 3SZ8A 4K1WA 2Y24A 4K8GA 3MJYA 4XZHA 3B8WA 2B81A 4G7FA 4PH6A 5CH9A 1HUVA 5AVHA 4CD4A 2BY1A 1E0WA 1TE6A 5KZEA 1S5VA 3WD1A 4QG9A 3PJWA 3C8NA 1CX9A 1ZQ5A 5CJMA 3W1XA 3POCA 2H90A 3U57A 3RR1A 5AHEA 3CAVA 5D4YA 1MO0A 4WDUA 1XQLA 2IW0A 1PB0A 1Z69A 1BWKA 2X09A 4HVXA 3ZLGA 2NQZA 5FA5A 4C1KA 3VD3A 3RMEA 3ABSA 5HPOA 3VX0A 3N34A 3SY8A 1LBFA 3VNYA 2DT0A 2C79A 2PGWA 1A5AA 4Z42C 2J9ZA 4J4KA 4DBWA 4FZIA 1W54A 1R3VA 4X2RA 4DZHA 1K9TA 3UZZA 2GJPA 3CUXA 1WBJA 3MS8A 1Z42A 1WV2A 1O7AA 3SUSA 2WJZA 3T09A 1RZMA 1AW5A 2VXNA 3DC8A 4XUGA 1UMYA 3BG3A 4Y9OA 5MKGB 2J7EA 1HKWA 3IS4A 5FI8A 2X1SA 1T6MA 2PC4A 4K3ZA 2JEPA 2ZXBA 5EMMA 3RU8X 1TZ9A 3HG2A 1B3ZA 4PR4A 3SUTA 1MW2A 3QY6A 1QRQA 4YTQA 4B91A 1GORA 2GDQA 4RJEA 3VZZA 2R6OA 1XCWA 3OHMB 2V9DA 3QGKC 1L6SA 4ZA0A 2O7SA 4W88A 4DM2A 2JIEA 2NVCA 1OFEA 4DN1A 1B0IA 1KA9F 3H7RA 2OWWA 3G0SA 1ZAJA 3VOGA 3ONBA 4H41A 1SFJA 4OOUA 4C65A 7ODCA 1KLYA 2CWXA 3ONCA 1UZDA 1RBAA 3UVIA 3WMCA 2FZ9A 4O8AA 2G3FA 1OCJA 3DG3A 2QR6A 3GR4A 4DJDA 3W1TA 8A3HA 4DYKA 4Q8WA 4DBDA 3SRHA 1ZP4A 1OC7A 1OQFA 2PCQA 5JBFA 3ZT6A 4V1YA 4S2BA 1DJZA 4WGHA 1XLKA 3UJEA 4F0LA 3OJGA 2VFFA 1YADA 1KCKA 1G9HA 4MAVA 2Y88A 3AU2A 1TWZA 3TJLA 3WCZA 4LUSA 5CAKA 3ERPA 5C9ZA 8RUCA 5G2HA 1LL4A 1IZJA 3TUUA 3WQCA 1MXGA 1D3GA 5I0DA 3AC0A 1UWIA 2DSUA 4ZCWA 2AKMA 4G7EB 3V0TA 4POCA 4LUYA 2Q01A 4DZIA 2R91A 3ZLHA 1XH0A 3HV9A 5BMWA 1IEVA 1PPIA 2WNZA 3WMLA 2YL5A 3N4AA 5TNVA 4S3AA 5IM51 2EPLX 3VPLA 3DYPA 5A1AA 4LVBA 1H50A 2OXNA 2G95A 5AC7A 1GVFA 3T8QA 2R1MA 2W9MA 4NXKA 4KEUA 1LWJA 3AU6A 5DO8A 3U8GA 3WK2A 5D9NA 1XP3A 4FS9A 2INEA 2GGGA 3Q4DA 3OODA 3E2QA 5K9XA 3LEPA 1F6YA 1L6GA 1T96A 2W4XA 3FVMA 2GDUA 4AD4A 1E6PA 1A5SA 1I2QA 3SCRA 3WH9A 4YTUA 2IUZA 2PDFA 3KZSA 3VOFA 1ONWA 2YBTA 1E0TA 1DIKA 1XD1A 1BYDA 3UXKA 1SSDA 3HPZA 4QLLA 1QNQA 5FF2A 2VFIA 3HM7A 4CKQA 4H6EA 3DFQA 1EPVA 4XAYA 4C7FA 1C90A 2DZWA 3KRUA 3OLEA 4IWWA 1BFNA 1LRNA 4ICCX 1M9HA 2PI6A 3VO0A 3H23A 1V3LA 3WMBA 1BKHA 1ZJHA 4IIGA 3B04A 5DELA 1EIBA 1AD1A 5EL1A 4GVGA 4Y9AA 4LQ1A 4UC5A 3TWBA 4J2MA 3KOXA 4M8UA 1HW6A 4JNYA 3NAVA 3A4WA 2VDGA 2PE4A 1Q6QA 1X39A 3ATZA 3LK6A 5D8WA 1D8WA 1W1PA 1TWDA 3S2CA 3W1QA 4IGHA 3MW7A 1OWQA 3NM3A 5CG7A 5EA9A 1M01A 4FP1A 5I79A 1SJDA 5I6SA 5CC5A 1EX5A 1YTKA 2A4AA 2A79A 1AJ2A 2Y5JA 1D9EA 1C92A 4FSAA 4MLRA 3RIKA 4HN4A 1FWIC 3L4ZA 2W61A 4GYJA 4Z1YA 1VLIA 3R2GA 2HXUA 2OQHA 2CZFA 2DUXA 2XM1A 2DORA 3MSRA 4DZ5A 4ORIA 4GKLA 5CC3A 2GQAA 3NZPA 1QW8A 3STFA 4ZBCA 1CGYA 2MNRA 3C2RA 3VK5A 2DY3A 2XFYA 3CS2A 4AC1X 2BZNA 2QJMA 3QXBA 3GBDA 2DP3A 1QR7A 1EDQA 1Z44A 3QOMA 4CQCA 4XVEA 5DLCA 4NX5A 3LBMA 2WJEA 3DU0A 1FCBA 4W5UA 3M0YA 2CFFA 1ZJBA 3MZNA 3LPOA 2BHUA 5BRQA 1P7TA 3CUHA 3F2BA 5E1QA 1S2WA 1UKOA 5HBFA 4IJBA 2CLPA 2VZUA 4A8NA 4AZ6A 2DIEA 4UOJA 3I4EA 1DIDA 5C9XA 1E4NA 1H62A 2GPTA 3UZWA 2PDUA 3LCLA 3N04A 7ENLA 2W0UA 1FRBA 1TELA 3EDKA 4E2VA 1KXQA 5D33A 5K9CA 3B40A 3AALA 1BGGA 1F73A 2FFIA 3CV7A 3L4XA 2PWVA 3H2NA 3TSBA 3WLQA 1OX4B 2BOEX 1DE6A 1N7KA 3FSUA 3RAOA 3QJAA 3C0SA 4XB3A 3PZMA 4Z1BA 1UBPC 4FNSA 4CCEA 4JAWA 3ZR4A 5DT7A 1GZGA 4BEQA 1EBHA 2ZVRA 2GOUA 3UZYA 4IXXA 1U5VA 4Y8FA 4TV6A 2Q8XA 3E2VA 1EJRC 2E77A 2YCEA 1OFRA 3NL5A 4KWVA 3VNKA 4BF7A 4IQDA 4X60A 2H8XA 1GOOA 3OB8A 1GQNA 1EZWA 5EMLA 2V5BA 2AGTA 3CO8A 1MEHA 1PYMA 5CBBA 4CU6A 3EWCA 1Q2SA 4PUNA 4GFIA 4UR9A 2V81A 1N82A 1Z8AA 2PZNA 3LOTA 1SFSA 3OGVA 4JKLA 8XIMA 1DL3A 3D0CA 4I9MA 3SADA 1M65A 3VD5A 2YCKX 3MUIA 4H83A 3IANA 5BXTA 4LW7A 3VM7A 1AW1A 3FV9A 2NVDA 1HF6A 5CJNA 1Q6OA 5LIKX 3UG4A 4MNMA 1DE5A 1V6VA 4IOTA 3APGA 3TVAA 1TYGA 3VC6A 3OVRA 4CU8A 2R24A 3KVKA 4I9TA 4NNCA 3GYEA 1UWSA 3TA6A 2G41A 1CLVA 2Y62A 3BMXA 1FX6A 5G1YA 2AQOA 1S46A 2INFA 5LGXA 4QGCA 3AHXA 1FH9A 5H8PA 2HE8A 4I6VA 1F4HA 3MUXA 4NAFA 4CD7A 5A8GA 1DJIA 3AYRA 1PTDA 1UQZA 5E6ZA 4K2SA 4AQLA 2QUTA 4IGMA 1S3HA 4D1JA 1UC5A 1UKTA 3TMQA 1FWWA 3KTSA 3KP0A 2RJGA 2VOMA 6TAAA 4W93A 2OTDA 1UG6A 1YNPA 4MDOA 4RDWA 5C2CA 2AKZA 4ECLA 4CU7A 4CNOA 2X40A 5DEZA 2I7GA 5LIUX 3OO2A 4B5UA 1QW7A 1Q6CA 2DJXA 4Z2IA 1GEHA 4P7LA 3SCVA 3TOYA 3SGGA 3U9IA 1NTHA 3BDKA 1F76A 1UP2A 4KPLA 3GNRA 1LDCA 3H2OA 1RVGA 3EXRA 2Q71A 3EYPA 2Z4GA 3L21A 1BF6A 4KH2A 1NH6A 3NPUA 1HKKA 2F8QA 3PBVA 1PVNA 4RE2A 3CNYA 3DYOA 3BAJA 4IL0A 4XQ6A 4PBFA 3CUIA 1JGMA 3IUIA 4ZENA 2HBVA 1V7AA 3DFNA 1VH7A 4R9XA 4LB4A 3G18A 1GVSA 3W7IA 4UIOA 4O1AA 1B4KA 1TPEA 4FI4A 4D2JA 2V0TA 4KWUA 3LTYA 1XIJA 1US2A 2XZ9A 3GAKA 3QGVA 4HMDA 4J3UA 4FXFA 3A5FA 3SQSA 4OZOA 1LBMA 3MUAA 3S2LA 3UXIA 4D9PA 2NT1A 4RLIA 3OVGA 3CC1A 3RRXA 4O1EA 1C8XA 5IDZA 1TTQA 7REQA 4J27A 3W1UA 4FNUA 1W9XA 4G8TA 4E8GA 1H7PA 2A3AA 1US3A 3EPOA 3F5JA 2Y0FA 4C5YA 2NUYA 3ZQ9A 4LANA 1AMYA 1VJZA 3STGA 3UYCA 3GZAA 4GQGA 4AYSA 1R0MA 4M6UA 3W25A 3FGCB 2NQLA 5H8UA 2DDXA 4HD5A 1AZ1A 3WLJA 4AEFA 1QU4A 1EGVA 1W91A 1V02A 2PC8A 1KRCC 4OUEA 3GYCA 1LLOA 5H2ZA 1PYFA 3R12A 1VJIA 4V27A 4WQ6A 1XIGA 3H2AA 1W9UA 1KKRA 3KS5A 4RL3A 2QJIA 2RKXA 5AC8A 5F4XA 3SR7A 1W1A1 3HJZA 4J3XA 5HJXA 1TRIA 2ZC1A 4JTCA 5KITA 3ZWSA 1EH9A 1F61A 1MDRA 4PEEA 2YYUA 4IXHA 2Y2WA 2V2HA 3ZJ7A 2QW5A 1MFUA 3ZR6A 4Q4OA 1FWCC 2CLEA 3CHCA 2FTWA 2OLHA 2YFNA 4H4IA 3R6IA 1ZJIA 2VJXA 4M1BA 4F3HA 4S38A 3QZ6A 2ZKMX 4GGHA 4HHPA 3EOUA 4JTJA 3K8LA 2C7FA 3E5BA 1LRTA 1F7BA 1V0KA 3AXMA 3ITXA 3SAZA 2FB3A 3A64A 1L8NA 4BA0A 1MVYA 1WE5A 3B0VC 4D8LA 4AXNA 3GNPA 4GIAA 5H91A 1ZCOA 3G1XA 1OX4A 3GR8A 3DFTA 2QDGA 2IQDA 2QUNA 2A3HA 2PD9A 3DHFA 4NNBA 1GT8A 3WEMA 1TMQA 3GIPA 3PZ9A 3G1AA 2DT1A 5D9PA 3C8FA 1VIZA 1SO3A 4RPQA 5FD0A 1ZP3A 3Q94A 3A4JA 3GUWA 4A3HA 3URAA 1FUYA 3VIGA 3KBJA 4MWAA 4JTHA 4XUYA 5C5YA 2YSWA 1FHVA 1SYTA 4UCGA 4IPPA 3D47A 3ITYA 4EWJA 3A13A 3CT7A 3BLOA 3F2CA 2QS8A 1MQQA 4XO6A 2Z1SA 1XIBA 2VHLA 1L9WA 1SFLA 4REQA 3QV9A 2EO7A 3WLNA 3ZLFA 2PS2A 1HVXA 1R7OA 2ANUA 3C2FA 1JG9A 4GVFA 3ENLA 2PDCA 1TV8A 3TYUA 1UW9A 3AIWA 2D1ZA 1PHQA 4PMJA 3AO0A 4LALA 4C6LA 1Q6RA 2HTMA 3PN8A 1K9DA 1ICQA 1JUBA 4L4OA 2AOSA 2GGHA 4DBSA 1X98A 2NQ5A 2QIWA 3W1AA 1K8CA 4E2DA 1NF7A 1K7EA 4JFTA 1XICA 4C6PA 2HE5A 1E43A 5DXXA 2OCZA 4F0KA 1F07A 1PX4A 4B5WA 1UA3A 4K68A 4Y2WA 1KWGA 1KCXA 1J01A 3H54A 4GMEA 3UPBA 4UQBA 5LNVA 4Q8UA 3D5HA 2X42A 1EC7A 3CHFA 1EF2A 4U3AA 3QQWA 1EHNA 3C6CA 1TSIA 1G7VA 2D22A 2ZTJA 3JU2A 3WJWA 3KL0A 3DBPA 3IIZA 2VEKA 2J8TA 4HNLA 1LBLA 4AC7C 3A47A 2I16A 5A2AA 1Q85A 1XLJA 1TV2A 4UMBA 3KBNA 1IQ8A 1XYBA 3CUJA 4GO8A 1RCQA 1E1FA 2XSBA 4W4QA 3WLKX 3LM3A 3LRKA 1P5BA 3TQVA 3TN5A 3PZOA 4ZODA 1HKJA 2OOFA 3M07A 4DWSB 1ICSA 2YBVA 3BICA 3VVGA 4JY8A 3ZVIA 2NXHA 4IMEA 3SN0A 5JQ9A 4UXDA 2V38A 1I2RA 4ADTA 4NL1A 4FXRA 5F4WA 1A0CA 3LI0A 3QKZA 4AXKA 3STCA 1QW9A 3WJYA 5IRPA 3TX9A 1NQKA 2A0NA 1CGTA 2OO6A 4I3GA 3O6DA 4J40A 3V5OA 2QCNA 3F4VA 2E9MA 3QY7A 4CD5A 1FXQA 3R0UA 3R94A 4US5D 2AL2B 3B9EA 3TXZA 2D3LA 5EFFA 3BOFA 1VLWA 5BXRA 1B3OA 1ALDA 5A2BA 4KEZA 3CB3A 1Q5MA 5HNNA 5E0CA 3TU9A 2W5FA 2VFEA 3E74A 3HB9A 2D0HA 3LMYA 4CQ9A 4PMYA 1JDAA 3AAMA 2JEQA 3VXGA 2BVWA 4ML9A 1V5XA 1CGUA 4M51A 1HG3A 3XISA 3NQ8A 1J0KA 3COTA 4UFJA 3OVQA 2OOGA 4RR4A 1Y65A 4MFDA 2ZZ7A 4GXWA 4JFWA 1TG7A 3ZXWA 4DQWA 5H1WA 2Z00A 4NSBA 2OQYA 4BI7A 4ZTXA 2WAGA 3UR5A 2J9YA 5DN1A 4UTHA 6PTDA 2ISFA 4X9SA 1XF0A 2EG6A 3VKKA 3CZGA 1R9ZA 1JXKA 3VDHA 1DIOA 3WQ5A 2E6YA 3VD4A 2PU0A 4F66A 1KM1A 3WBEA 5LGZA 1E56A 5BRPA 1X7IA 1TPB1 1PCKA 3CZ8A 2DT3A 1RBLA 3KOZA 4RW5A 5CJ5A 5CBIA 3EZ4A 1DQWA 4MTVA 2CC0A 4Y90A 2BBFA 2WCSA 5HA7A 2BGNE 1OSEA 4QG8A 3W83A 3UWQA 4X3ZA 3VDGA 4B5NA 2O4MA 2AGKA 1E15A 2A2IA 5LXEA 5CPSA 3PWAA 4J3ZA 3BOLA 3HG3A 3ES7A 4A21A 3TEVA 3FSTA 4H9XA 4KRTA 4ERAA 4TU1A 4ZR8A 5JMUA 2XIOA 3WFLA 1EYEA 4NRRA 3MUCA 1KGUA 4ROPA 4IFRA 1TV5A 4CCZA 1J96A 1K7FA 5CZJA 1TA3B 5E70A 4P7NA 3WDPP 3T8LA 4RV8A 3M6DA 4ML4A 3WEOA 4FLRA 2CWNA 2B7QA 3CHVA 1HKVA 1FVPA 1KRMA 1XUUA 4MZ1A 2VX6A 4YHGA 4EANA 3GHRA 3ZT5A 3BLIA 1EKOA 3RPTA 3WD2A 4XX6A 1ISXA 1RP8A 2I14A 2V67A 3ARZA 2GOKA 1QPOA 3WNPA 1R3YA 1AQMA 1T5AA 2ZWYA 3R8GA 3RXZA 4ADSA 1O1HA 1VFTA 3H7VA 3PBGA 2PD5A 1ZY9A 4HT3A 4JQ2A 4NZ5A 4OV4A 4BK9A 1LP6A 2DUAA 2BSLA 4TVUA 5AC5A 1GYLA 5LNUA 3L65A 1E5NA 2AAMA 3GVRA 1NY1A 1CLKA 4A8RA 1O68A 3DFPA 2V6AA 3PJXA 3FXGA 3L5AA 4MZYA 2WVUA 1FWSA 3H8AA 2IKGA 2WMKA 1XYAA 2ZTKA 4E0CA 4J3VA 1SMAA 2H9AA 4JIQA 5REQA 3PG8A 3GTXA 3RJXA 2G50A 3WLLA 3WZ0E 4BQ2A 4Q4MA 3CH9A 4RZ6A 3A4AA 1I6NA 5A2CA 1OC5A 4GXMA 2CEQA 1WZMA 1DWFM 3WQDA 1B2YA 2A3LA 5T9BG 4FXSA 2PWFA 3TLLA 4EPEC 2FTYA 4JD4A 1ITCA 3NQBA 4MUPA 4JCMA 3GFXA 2FDMA 3H22A 1F6KA 3S1UA 2O56A 2B7OA 3SDOA 3CL6A 4N0RA 1KM5A 3S1GA 2XDFA 2ATSA 1BG9A 2VCCA 1V3MA 2A7NA 1QK0A 4XBJA 3CZEA 1RA5A 4DI9A 3EPNA 4I90A 5LNSA 4DXXA 5JIWA 1P0EA 2WMIA 3OHIA 3LNMA 2QUUA 1JI2A 1W9DM 4M80A 3QPYA 2ZRUA 1JF5A 3S1XA 4C1NB 3G24A 1ZBCA 1GQIA 5G2WA 4X2PA 2Z24A 1UYQA 4AB4A 4N2YA 4QBXA 2EPOA 4S3JA 4KFOA 4GQBA 1EDGA 3MDUA 3GAYA 4BKNA 2Z2BA 4GUFA 2FDSA 1XBZA 1IIHA 1HJUA 1UWRA 4FXJA 3ABQA 1PUDA 3E02A 4DWSA 5A6LA 1O6IA 3TWAA 1CGVA 2B31A 3IJ6A 3KTXA 4JL1A 3SRKA 4HK7A 2H8ZA 3VDCA 3LHTA 1XD0A 4Y9MA 4ZOBA 2O55A 3LXAA 2PLKA 3FAXA 3S42A 1GYMA 2XHYA 4WDTA 3WDJA 4DJDC 1FQ0A 1S2VA 5A6AA 3U7VA 2E6DA 3S6OA 3VZXA 4AZCA 1OG6A 2HCVA 3VDBA 5BWFA 1MMFA 3GG7A 4R27A 4QLJA 1B31A 2J88A 3S6DA 3MMWA 3SIZA 3UCQA 1O5KA 3IIXA 1JD7A 2GUUA 2HZGA 3VGHA 1EX1A 3IGUA 3PR2A 3FGCA 2GVYA 3AS3A 3VNLA 1WZKA 5BROA 1IXQA 3S2NA 2UV8G 1I8JA 3CMJA 1X1ZA 2BHZA 1P1MA 1UPPA 3B0UX 1DJQA 4HNTA 2Z1KA 4IGSA 5CSSA 2Z2UA 4JTAA 4LAUA 4PMUA 3L2MA 1S5MA 1NQ6A 4DPPA 2E1WA 2QV5A 2HBXA 1XYFA 4AD2A 2VP8A 3MANA 4C90A 4EOUA 5JUVA 2XN0A 4W5ZA 2J24A 2ONEA 5C9WA 1TZ7A 2ISVA 4WJXA 3S46A 1XHGA 3M1ZA 1HT6A 1IXNA 4OUIA 4GGBA 1JCTA 2AMXA 4UTMA 3KBSA 5G5IA 3MI6A 1FH8A 3TH6A 4O12A 5C9RA 4QIUA 1A5UA 4O57A 1K70A 1BVNP 2REQB 1PWMA 3W7EA 1B54A 3UD6A 3T7VA 3P3BA 3QV8A 3DFHA 4HU0A 1TKKA 5EGRA 4GC4A 3H26A 2YBUA 1E6QM 3M0JA 5GNXA 1WDDA 4IP7A 4PCSA 3TFXA 1W5MA 2YW3A 2RDTA 3VGGA 1SFTA 1A47A 2I5IA 4WSHA 4XSMA 3GNNA 2BX7A 1PXGA 1OX6A 1HN1A 2W66A 6TIMA 4JTKA 1EJ7L 3SBFA 1GZ1A 2HVNA 2YXGA 5FJOA 2Y61A 3R13A 4IIDA 4Z08A 4UNLA 2GK1A 2OLAA 4PTNA 2WJFA 3QFWA 4XZNX 3V3WA 3PTMA 1E0VA 4D6HA 5F2GA 5BOEA 4KCVA 2OLSA 3HGRA 3RLVA 2ESCA 3PWGA 4M56A 2GGEA 2ZZ3A 3QYQA 3LX9A 2O9TA 4DBUA 1RY8A 5U4NA 1UIOA 3GB6A 2E9BA 3EOEA 1UC4A 2X1IA 4MUZA 5BXSA 3LHYA 3BWWA 4GISA 4PMDA 3P14A 4AZHA 1QPNA 4GJJA 3IJQA 4I5UA 4IMGA 5XIAA 3IK2A 1ZBKA 4QS5A 4QJ4B 4L1WA 1BF2A 4ZB5A 4HU3A 1MSSA 3RM9A 1Y8BA 4A3UA 4KEVA 1CXKA 1KC7A 2F7FA 2OEMA 4BWLC 2VGGA 3FA3A 3U2EA 2G3MA 1HKIA 2Y7EA 5DMYA 3CTTA 3VUPA 1FBAA 2VMFA 3IEBA 3NL6A 1WXJA 1PBGA 1FWNA 2HVMA 4UTLA 3ZJKA 3LGEA 3ABZA 1W2VA 1B90A 5FJTA 2Z0IA 2KAUC 3CPGA 5TBOA 3W7RA 3QPZA 3RJYA 1ONXA 2H9AB 4JTEA 5FEZA 3TCSA 4IH3A 3BCFA 4LBSA 4A8IA 4OTKA 1GVOA 2PWUA 3CL7A 3WEZA 3S5OA 4DBEA 2FFCA 1H61A 1UA7A 1P1XA 3LUTA 3N2BA 1FCUA 2CBVA 4QP0A 4B9ZA 4N7QA 3UEQA 2V69A 1DEDA 3E9AA 4CNTA 4MIMA 3B4UA 2YXXA 3GW0A 3CEUA 5EYWA 3PM6A 4U2ZA 1UCWA 3CU2A 5A3HA 3QR3A 4O16A 4GC3A 2FB2A 2C1IA 3R0DA 1TJ0A 4XAPA 3E0LA 4M82A 5J8LA 1QOQA 4V1XA 3AJ7A 4Q6XA 1TVNA 3PUOA 2WVVA 3CWHA 5A8MA 4GE8A 3T2OA 3HQOA 5H6HA 3Q65A 2WMIB 4S3BA 2QPUA 4U31A 5CPQA 1PKYA 4Q8OA 4RV3A 4H19A 4L64A 5I3IA 1ZNNA 3PZGA 4CD6A 4GVHA 1E72M 3HFTA 4KW2A 1TV3A 3AYVA 3WLOA 5LXXA 1YPFA 3NEVA 4ZQOA 4XD5A 2VUYA 2CESA 2ZE3A 4CQ8A 2DFAA 2DZUA 3ARPA 3U4AA 3NUKA 5FAJA 2EAWA 2VGBA 5B7YA 4XAGA 4A2RA 5F7UA 2JKPA 1CB2A 1DHPA 3UP8A 4ERIA 3OYXA 4YMZA 4KFNA 1RLDA 4DJEC 2PF0A 4HMEA 1J79A 2J74A 4Q6JA 5K7JA 1OF6A 2WKLA 1UR8A 3VUSA 3VMNA 5A6TC 3PULA 4GXPA 2OKOA 5JBEA 2DZXA 1SM9A 1MXDA 2F6UA 3KUMA 3LRMA 2XG9A 3UT0A 4S23A 4MYAA 2VGIA 1B3WA 1UD8A 4W8BA 5BNKA 1KM4A 4CNSA 3F4WA 3W27A 3G0XA 2EF9A 2NX1A 1GNXA 1DXFA 2G97A 4MOZA 3EKLA 1SW0A 4YN5A 1HNYA 2DIKA 3DDMA 2HEJA 4MWAE 4LVDA 3GDLA 2BVYA 3L0KA 4N42A 3W75A 2NLYA 1G4SA 4QQ3A 1REQB 4O53A 4KWSA 2IS7A 1XGEA 4BWLA 1Z6KA 1PCWA 4MGGA 3B8VA 2YOCA 1OG0A 2GL5A 5F2LA 1XDMA 1GHSA 3SCSA 3M0LA 1VENA 3SRFA 4CEUC 4M81A 4R7JA 1J0HA 2P1FA 4MY9A 4L1GA 4N9CA 1PKLA 3FK4A 4FA3A 2REQA 3HMCA 4AIUA 3EB2A 2FKPA 4EK7A 2CLIA 4JNZA 3GSMA 4EPKA 1S3TC 1PZ2A 3ZSSA 3BSGA 3W7HA 2QCDA 3H4WA 4O28A 4Q4RA 3AHVA 3NQ7A 4JQAA 3KS6A 1SGJA 4PUKA 4P5UA 3SN1A 1IR2A 1KFCA 1LROA 3BK0A 3IACA 4DLMA 4HPJA 1YPXA 4L4LA 2VEGA 4JZ5A 3N6QA 1LCOA 4QJ1A 5HATA 4MB1A 4GLEA 1QPQA 3CMFA 3CIVA 2HMCA 1KKOA 3LD5A 4JQ3A 4GIEA 2RGLA 4ZO8A 3STEA 3N13A 1DJYA 3N18A 3L66A 5AC4A 3DZ1A 1W3IA 2V5LA 4NAEB 5AHLA 1ZAIA 3QHNA 3AZSA 4MLJA 3WX7A 2JE8A 2PUZA 1E70M 1G5AA 5AOUA 5KZDA 2CPUA 2QPXA 3L68A 2HK0A 3E49A 3UBPC 4ATWA 4DI8A 4Q4SA 1TVLA 5A94A 4O1FA 2CHRA 3KBWA 1SW3A 5AYBA 2OQLA 3HF3A 4MPKA 1YDOA 3GY1A 3D6NA 3NGFA 4NQ1A 1N2VA 4IFKA 3M0XA 1CB7B 1K77A 3CWOX 2XN2A 1K4HA 2YLLA 3VOCA 3ZFHA 3LS9A 3SSZA 4KESA 1AH0A 4LV9A 3MSGA 4LS1A 1OADA 5AZ0A 4P8VA 3H2MA 4IFOA 4N9EA 5T91A 4UFMA 4LY8A 4F0HA 3G1SA 3U2OA 1W3KA 4QM1A 4U5IA 1IWAA 1RALA 4RE4A 2B7NA 4OHQA 4K7VA 2VQTA 2ZYFA 4PGLA 1JPDX 2BY2A 4AFYA 2FJUB 2FZBA 2JGYA 3UA3A 3FAWA 3IJ7A 4C6FA 4JOMA 4F2UA 3DFYA 1TMHA 4RXGA 1D2KA 1T40A 1R85A 4JTIA 4M0XA 4GYFA 4RW3A 5FF4A 6A3HA 2V8ZA 3L4TA 3C0QA 4UBPC 1LL6A 1I2PA 3T78A 2WQPA 1PE1A 3B8IA 1FY6A 2JQXA 3VCRA 4E3TA 4Z0SA 2B0MA 3GH5A 4MYXA 3RUBL 2NXIA 5D9OA 4YWSA 4HZ7A 2HK1A 3TKFA 2OZTA 3CH0A 3RM4A 1M1BA 1V6XA 4B4HA 5EB8A 1OC6A 2CXEA 4LEFA 3TMLA 2CETA 1VFFA 4CUCA 3DENA 1GPWA 4NYYA 5IOBA 5G1TA 2D2JA 1NWUA 1H51A 2G37A 1GOWA 1POKA 2E09A 4HMNA 3PSVA 1IZKA 3GNXA 4NX0A 1AODA 3EDEA 3O07A 4JTRA 3IJDA 4O15A 1MW3A 1WCGA 4JL2A 4AWUA 2MANA 4AWTA 2CZ5A 4XZLX 2Z1BA 3KL5A 3ME3A 3MYOA 3LLFA 3BANA 1GEQA 2XVNA 2Y8KA 3MBFA 3M9YA 3PC0A 3HMJG 1OCNA 3BOXA 4IIEA 3NPWA 1JQVA 2CW6A 2MUCA 2V5DA 3SUVA 4BF5A 1BRLA 1D8CA 3EDDA 4GZ7A 1D3CA 2C71A 1U1UA 3N29A 3W01A 5A5WA 3L5LA 3WQ4A 3FLUA 7PTDA 2QGYA 4AAJA 1ZB5A 3C5QA 4UZSA 1ESWA 1FDYA 3K1GA 5K4XA 3EDJA 3HA1A 4HOZA 5LNWA 2DVUA 3S5SA 2YB1A 3N2TA 4NZ3A 2O92A 3WL0A 3EMCA 4W8LA 4XZIA 4U3CA 1F3XA 4YYCA 1FCQA 3GXFA 4N4QA 2WSKA 3AMLA 3L5MA 3HPFA 2WPBA 1P43A 4WHBA 3TK7A 1NVMA 1A5MC 2QVHA 1UJQA 3B0YA 3BGGA 3W1LA 5AY7A 4D6IA 2VC6A 4IJCA 1X6UA 3NQGA 4GI9A 3BG9A 4Z1DA 3QVQA 4ZB0A 2O9RA 4M6QA 3UZJA 4TIMA 1KCLA 1QO2A 3QMRA 4IGNA 4WEVX 4ATLA 1XUZA 3UF9A 3PHAA 5I7GA 1WQ5A 1KM0A 1X6NA 3MDWA 1MUCA 4DF0A 3P74A 2EGZA 3MUY1 3WQWA 3HURA 2ZOXA 1VHNA 4OGZA 2V5JA 2RGMA 3AWNA 2E25A 3GFZA 1U2YA 3APYA 1RJRA 4H9YA 3MQTA 2VELA 1M68A 3MKCA 2QDDA 4Y8EA 2FGZA 1E6SM 2AL2A 2Y7FA 3WJZA 3P5YA 1Z48A 2QCLA 2TMDA 4AWEA 1BG4A 4PTDA 1VCVA 2XINA 4LRTA 3P60A 1FWAC 4UFKA 2E8ZA 3WD3A 2CZDA 3BL3A 4JQ1A 4PC8A 2WM1A 3AXKA 2J66A 1RPXA 4IJRA 3T0TA 3H53A 2GUBA 2XPKA 2PLCA 4QNEA 2YB4A 4NZCA 1IT0A 3B03A 4CCCA 3VX1A 2EJ1A 1M03A 4DYEA 3N19B 4HYVA 5EY5A 4JPGA 3EXSA 3S83A 4UTIA 2OVLA 3GXMA 1Q6GA 3GUGA 4C6KA 4CVUA 1E40A 4JX5A 4GK8A 1EO5A 1UWAA 2D73A 8CGTA 5HJYA 5KZMA 1UKQA 1MZHA 2Y5EA 4BQ4A 3C56A 1O95A 3M5XA 3MO4A 4L4PA 2HNHA 2VR4A 3TJIA 1MW0A 3NEHA 3P8JA 1FHDA 4O54A 3MUZ1 4P61A 4LT9A 3TSDA 3VD7A 1W5OA 1I2NA 4F0MA 1RSCA 3SCQA 1XX1A 2EPNA 4JXCA 3TR2A 4AZGA 3EX1A 3AI0A 1P7TB 5HR7A 3THAA 3V4BA 2C14A 1XKYA 1V0MA 1TCDA 2PURA 3PPFA 3MZ2A 3FEQA 3T55A 3QSRA 1DQXA 1VF8A 3R10A 2E68A 2IKJA 3UR8A 1BYBA 3P62A 4ZEPA 1X1OA 4YHEA 1DJGA 3H4GA 3VNDA 4CNNA 4LYRA 2C3ZA 4YU1A 1T8QA 5CC7A 3WUFA 5ABHA 3WLSA 3MCNA 3I6RA 2R14A 3K5XA 1NP0A 1EC9A 1UKSA 2POZA 1MDLA 3SW6A 3WY1A 4U28A 2PTZA 2Z2AA 4O0ZA 3CMGA 1JPKA 3MSDA 1QATA 4AEOA 3NFUA 1M53A 4MY8A 1LOLA 5AECA 3USZA 3LQGA 1EJTC 5L9FA 1SZNA 3EX4A 3HG5A 4XV0A 4EPBC 3NSMA 1JUEA 4GUJA 4R5EA 4XZMX 4IP4A 1VEOA 4LCSA 2OMAA 3RCYA 4BY3A 4CQBA 2NX9A 2QF7A 3DUGA 4HNCA 3SCPA 3LCHA 1GQLA 5CBJA 3M5ZA 2QAFA 4FR1A 3F5KA 2XFFA 1OHLA 1IEQA 4WD0A 1RK5A 2GWNA 5FEPA 4PCNA 5CSUA 1M41A 4YVXA 1Q8JA 4NI8A 3BVJA 2OPJA 1OBAA 1B3XA 2OYLA 3NR0A 2NXGA 2WM0A 3FJ4A 3OA5A 2DQXA