3NQDA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqdA00
1GJPA 1LBMA 1I8JA 3QMTA 3L0NA 4TR9A 1EUNA 5C54A 1OK6A 1FWWA 3V75A 1OYAA 4YLWA 3OHIA 5CZSA 5FF2A 2H8ZA 2YDAA 2E6DA 6TIMA 1OFAA 1GG1A 3L68A 3QF0A 3DHFA 3DKLA 1W0MA 2E6AA 3UWZA 3QMSA 3W76A 5I3FA 4UFLA 4DXVA 4QJ1A 4LUJA 2CLIA 2VELA 2ZZ6A 1H51A 2O7QA 4O12A 4G1KA 1W31A 1A53A 3G1HA 1TQXA 5D05A 4Q4KA 1LYXA 1KM3A 1UBSA 3S1VA 3PB2A 4RZ6A 2Q8LA 1Q6OA 4GC4A 4ONVA 4UTJA 3W7QA 1IGSA 3IRDA 5CPLA 4TU1A 1ALDA 3VI2A 3HGJA 4X3ZA 1QOQA 4GWEA 2WO5A 1HUVA 1G7UA 4CQ8A 2C3ZA 1YXDA 1NF7A 3GDRA 1MXSA 3W2UA 4I7VA 1LLZA 3HO8A 3PWAA 3NQ8A 1W37A 4O15A 3WFAA 4YL2A 3W9ZA 3A5VA 4JNMA 1OYCA 4GBUA 4JICA 1XBYA 4Z1DA 5FEXA 3GAYA 2A6NA 4EVZA 2F7FA 1KM2A 5AYYA 1W5OA 3NEVA 1OX6A 3FYOA 3EX3A 5LNVA 3QSTA 1VQTA 1PHQA 4L4LA 4KWWA 4ZQPA 4N2YA 3PUOA 3U6WA 3L66A 1W3NA 5E1QA 1LLWA 4M5PA 3C2OA 3HJZA 3E96A 4O4WA 4GUIA 4LVGA 3W7DA 3DZ1A 2Z0IA 1GZGA 2QJHA 3USBA 4NX0A 3TW7A 1ME8A 4IPIA 1TMHA 3UPWA 1TRIA 3PULA 1I2NA 1IIHA 1KTCA 1TPC1 3NQDA 4X9SA 5BW6A 3LTYA 5F4SA 3I7SA 1J4EA 5CZ0A 2BTMA 2R14A 3Q94A 3L0GA 1XUUA 1Z48A 3STEA 1HO1A 1QPQA 1YDNA 2ZFAA 2RH9A 1WQ5A 5CG7A 1KBIA 2ALDA 4EF8A 1SW3A 4LV4A 5IM51 3LHZA 1FCUA 4A21A 5LKYA 3NPVA 3JRKA 4R34A 4KKXA 5CSRA 3ZWSA 2NV1A 3M6YA 1K02A 3TC6A 1YXYA 3W07A 3LI1A 2WNZA 4Z0JA 1IXPA 2NZLA 3ABRA 2Z1BA 2HS6A 4LS0A 4GJ1A 3ELFA 1L9WA 3W7OA 2DZXA 1QDSA 1L6WA 1GQNA 1BWKA 1AW1A 2ISSA 5A8GA 4CNNA 1IXNA 3NGJA 3EKZA 3O07A 5FESA 1K8YA 3DXIA 4XQ6A 5AHFA 3C2VA 5EKYA 3SJ3A 4O53A 2A7RA 1H5YA 1XBZA 1AG1O 3BARA 4FEZA 3ATYA 4TMCA 1AK5A 2C18A 3D0CA 3HGSA 3G1AA 2TPSA 1XL9A 1VZWA 1AL8A 1ZAHA 5CPNA 1VJIA 1NVMA 4K36A 4PL2A 3VNDA 3QFEA 3NL3A 4O28A 1PCWA 3H54A 1ZCOA 3C2RA 3MHGA 4QITA 2OX1A 1Q6RA 1SO3A 3I6RA 1W5MA 4R7JA 2XN0A 4LVFA 2GPTA 4ORMA 1R2RA 5HMSA 2YFOA 2J9YA 3S5ZA 3CB8A 2KZHA 4FNSA 3TH6A 2EHHA 1SFLA 1HFBA 1TTQA 4NNCA 5LHFA 4UTUA 1JJKA 3TUUA 3KFTA 3TX9A 1F6PA 2DJXA 1SW7A 2FPTA 3PM6A 4MYAA 3W84A 3STCA 3AO0A 3E9AA 3R13A 1WBHA 4DBDA 4Y9AA 2VFIA 1SFJA 4OV4A 1QNVA 4UC5A 3TAKA 1A5AA 1OJXA 2RDWA 3N9SA 2FQIA 2DORA 1FWNA 2EF9A 2CZEA 4LS1A 5KINA 4EWND 4W9TA 1VLWA 3LM7A 1WX0A 5D09A 4IPJA 3G1VA 3NZ1A 3YPIA 3LBCA 4FNUA 2Y62A 4FXRA 3HGRA 4FNPA 1YDVA 2NLIA 1ZJIA 4Z1AA 4FIQA 4CCCA 1IIGA 2YZRA 3DKJA 4R33A 4IMFA 3M5VA 3P82A 1KFKA 1OYBA 3PVFA 1JCYA 2ISWA 1TB3A 4H4IA 3O6CA 1WOAA 4QSHA 4RZ5A 2OT1A 2B7QA 2Y89A 3EWBX 3UYCA 3MI3A 3N2MA 3PUEA 2WNQA 2GVLA 2NXHA 1ZENA 3GDLA 4XZ9A 3P84A 4Y90A 1HTIA 1IXOA 1W5QA 4HN4A 2ABAA 1TO3A 4M6VA 4K8EA 1FWTA 5LNSA 3EWXA 3W7CA 3NM3A 1W8SA 1VCFA 4DF1A 2Z6JA 2I9EA 4A22A 4CQAA 4IMDA 3R5EA 3UNDA 1TSIA 4JTIA 3NOEA 2PURA 1P0KA 1RD5A 4JTHA 2QCMA 3PBUA 4FNQA 4N02A 5FEZA 3M16A 2J27A 1GVRA 1QWGA 2QUVA 5DY3A 1TPEA 2R94A 3QW3A 3PAJA 5EYWA 1GT8A 1P0NA 2IQTA 3CLMA 4CQ9A 4ZQMA 4DELA 2JK2A 2W6RA 3S8HA 4UCGA 1QMLA 3W7PA 2A4AA 5DLCA 1UUMA 4UFJA 1QPNA 3GK0A 4EIVA 3LV5A 1EP1A 1KM1A 1GWJA 3KXQA 2E5DA 1GVQA 5F1VA 4OV9A 1L2UA 2E68A 1P1XA 4ZQCA 4IGHA 5SWUA 2A6LA 1R2TA 1FUYA 3OEXA 3LX9A 3HMJG 1JCMP 3MYPA 3IVSA 1DV7A 2EPHA 1EEPA 4ZZ9A 2V8ZA 4WY0F 5AHIA 3QZEA 3Q58A 4WUIA 1FWRA 1P4CA 4WJEA 4XTIA 2VC6A 4EOUA 1XXXA 3PG9A 4UMBA 2NX1A 1PVNA 1SO6A 1SR9A 4LC6A 2TYSA 5G5IA 2A7PA 4ADSA 4N9DA 3W7LA 3A21A 3KX6A 4PEKA 2WOQA 3M47A 1SUXA 1SPQA 4HIBA 2A21A 2OMAA 4O16A 1H7OA 3SGUA 3WJXA 2CZ5A 2WKJA 3NQAA 4MJZA 1O5KA 3G22A 3HQ1A 3JS3A 4JXCA 1L6SA 3M9YA 3IEBA 4UR7A 2VOMA 1VCVA 2CLLA 4TO8A 2NXIA 2JBMA 3FEMA 1YTEA 2YCEA 3EWYA 5A5WA 1QO5A 1R2SA 2ZRUA 3R8RA 3W7NA 5FI8A 2YGYA 2CWNA 4XKYB 3M5YA 5D2VA 3CT7A 1GVFA 4HPXA 1I4NA 3WJYA 3L65A 2HSAA 5K3VA 3FFSA 4MY8A 4NU7A 4AHOA 3BLIA 5TIMA 4AH7A 5HNRA 3L2IA 4RXGA 4ADTA 1KFBA 5K9DA 3W2KA 5D2YA 1Q6LA 1LORA 1KFLA 1L6YA 2ZRVA 2GJNA 2ZZ7A 5U7SA 2A2IA 4CNOA 1RZMA 2QUUA 5F1UA 3TK7A 4K7YA 2FB2A 5CGQA 3IIZA 3BGJA 3TSMA 4QAIA 2O7SA 1U5JA 4A3UA 1FY6A 3W7HA 2YX0A 3S42A 3LV6A 3UXAA 1TPDA 1XBVA 2EGZA 5G4EA 2QDGA 3KVMA 5IBXC 2RHGA 2XN1A 3G8EA 3NQ7A 3DFSA 3ANYA 4WY0A 2Y6ZA 1CW2A 5CSSA 4IWWA 2WV8A 3B8DA 1AW5A 4E38A 4LVDA 5FF7A 3N3MA 5DXYA 4IUOA 1TTJA 4JYFA 3BK0A 1B4KA 1F73A 3M1ZA 3FJLA 4I7UA 4M19A 1WA3A 1UASA 3TCEA 3NZRA 1DL3A 3TNOA 3M44A 3LRMA 3MP4A 3MI6A 4WX2A 1H1YA 1H7WA 2CU0A 4C1LA 1TQJA 2E1DA 5I3KA 4IXHA 3W7RA 1PL9A 4ADUA 3NAVA 1W3TA 1T99A 4ZL1A 4RJEA 1JCXA 3KVJA 1D9EA 2PRLA 2JKPA 3LCWA 1E51A 4ZMGA 4CLMA 2C6QA 5BOOA 5CZJA 1MO0A 2VFHA 1S5VA 2DZWA 3MBDA 3B05A 4JD4A 2BSLA 4JTUA 2AGKA 5HQEA 3W88A 2X16A 1FCVA 1TIMA 2WJZA 1OABA 4WXYA 4BF9A 3N2XA 1LBFA 3L0KA 5F2LA 4RLIA 1EP2A 5FF4A 1XFBA 3I68A 5D2XA 4O14A 5AB3A 1WXJA 1H50A 3CPRA 1GTHA 4DPPA 4DEFA 1RQHA 2E5BA 1KTNA 4NJKA 3HG5A 2P0OA 3W1UA 3DFPA 3LRKA 3IIXA 3GVGA 1LDCA 1QAPA 3PBYA 4GUHA 1X6UA 2V2HA 4Z1CA 4NNBA 1JRCA 3GIYA 3PY2A 5I3GA 1OFEA 2A0NA 1KBJA 4N4QA 4OGZA 1LRTA 2B7PA 4A2RA 3PBWA 4DPQA 3GNNA 3LCIA 4FHAA 3Q37A 5FF3A 6ALDA 3QW4B 2DZPA 4AAJA 2ZA1A 3C56A 1I2OA 2QCHA 1ZY9A 1IF2A 3S1WA 4UFIA 2BLEA 4K38A 5K4XA 3W22A 2NUYA 2ZYFA 5C55A 1H60A 3ABQA 5T26A 4UTLA 1EP3A 1G4TA 1K8ZA 1W5PA 3HPZA 3PSWA 4O0KA 1FCQA 2AAMA 1SSDA 2X1TA 4LRSA 4XWUA 4BI5A 2YSWA 1JUKA 2ZBTA 1VR6A 5KZEA 2EKCA 1TPH1 2X1RA 2BX7A 3TIMA 4RZ4A 2VEMA 2FJKA 1O94A 4MVAA 4DQWA 3BV4A 2G5WA 3C61A 3MP3A 4LS2A 2DU2A 3P67A 4HPJA 1PHWA 2C19A 1WBJA 4UR8A 1H7RA 5BRBA 2F84A 3H55A 4JX4A 4GUFA 3V1PA 4BK9A 4FB7A 5DELA 3QEZA 2Y7EA 3QH2A 3EEGA 1YXCA 4IMCA 1DJNA 3UQNA 2QJGA 1M5WA 3LBMA 1XI3A 2BXVA 2AQWA 3CWOX 4QNEA 4DO4A 3LHVA 2ZRZA 4AEOA 5FEPA 1JR1A 3EX4A 3SSJA 3N19B 3BW3A 3SZ8A 1LBLA 1ZHAA 2DZVA 4JX5A 3DFQA 3E0IA 3CEPA 3L5MA 3JR2A 4J9JA 1G7VA 2ATMA 1NEYA 5CPOA 1KM6A 4HKPA 4BR1A 3IVTA 1LROA 3VE7A 5D30A 5EY5A 3MI2A 2Z2UA 1G67A 3NPUA 2Y7GA 3MBFA 4HNUA 1GOXA 4MY1A 4NJGA 1DKWA 3W1PA 5IBXA 3LXCA 1KM0A 3P62A 3MHFA 3LHWA 1LRNA 5L6UA 5DCDA 1J5TA 4KFPA 1M6JA 2OT0A 4YWIA 5G4WA 3TU9A 1ME9A 3TROA 5KITA 1XDMA 1DVJA 3G3MA 3NA8A 1N55A 1U83A 2G96A 1R46A 2YW4A 2OCZA 1DQXA 1RQBA 4S2BA 4AWTA 4DO6A 3LB0A 1TTIA 2NUWA 3PB0A 4OE7A 4ZQNA 1XKYA 1Z44A 3IIPA 1F76A 1VHCA 2E6YA 1YADA 4O50A 3UY8A 1K7XA 2J6XA 2H3BA 3S0CA 5K4ZA 1G4SA 2DZSA 3MWAA 3NQ6A 2H90A 3S5NA 1TTPA 1G4EA 1VH7A 1QO2A 2J9ZA 5CZTA 2GQ9A 3VCRA 1QPOA 2B4GA 2QR6A 5K9XA 4MZYA 3TXVA 3GKFA 1RV8A 1TJRA 2W79A 4NXSA 4P61A 5D2TA 4EF9A 4ZQRA 4DF0A 5TBOA 3HF3A 3OBKA 2WSQA 2ZA2A 3GXNA 4NVTA 5G1YA 3TQKA 1JVNA 3FJ6A 3DAQA 3EX6A 1J2WA 1PCKA 1SSGA 3W83A 2NX3A 4K8HA 2I14A 3LCFA 3R12A 3RU6A 1K7FA 4JN6A 4XTDA 4ORIA 3NL5A 4E2DA 4NNAA 1G6CA 2ZZ4A 4O10A 1I2QA 1TPFA 1ADOA 4TIMA 4PH6A 5D33A 5E0KA 5D02A 4LV9A 3VE9A 1ZNNA 2GOUA 3HBLA 3EXTA 3LCXA 1WAUA 3T44A 2V5LA 1NFBA 1QPRA 1FQ0A 4JIPA 2V9DA 3U2OA 4UTMA 2ISVA 4I7WA 3OVPA 4M7TA 5G2IA 3C2EA 4JR5A 5HR7A 3T55A 1ML1A 4I9AA 2XFWA 3IV3A 1Q45A 3S6DA 2W0UA 4E0CA 3HIJA 4TX9A 2QUTA 4O13A 3WK2A 1T96A 3GYEA 3TE9A 1MSSA 4K7VA 2G95A 3STGA 2C15A 4FF7A 4YCOA 4NX5A 4JS3A 4WOZA 3SIZA 3TDFA 1OFQA 3NO5A 2Y61A 1OHLA 3DFTA 4Z0SA 4JX6A 4JTFA 3W71A 5DCEA 4FNTA 3EKLA 5KSWA 1GTEA 3W2NA 4M6PA 5EL1A 2NXGA 1R30A 2FIQA 1DJQA 1JUEA 1VPXA 2QCDA 1TRDA 3NQCA 4QM1A 2WSYA 3BGGA 3EWWA 3RK8A 2GVJA 4NJIA 3C4UA 1H61A 3EWZA 4HNVA 1O4UA 1W3IA 1YTKA 2JKAA 4JY9A 4BWLA 2QAPA 1TPB1 2ZZ3A 5AOUA 4GNJA 2VFFA 3G1DA 1Q3NA 2ZZ5A 4AHPA 4JTJA 4UIOA 1OF6A 3UD6A 3DU0A 3M5XA 5D03A 5C2XA 5AC8A 1SQ7A 3S1XA 4NZJA 3OA3A 1KW1A 2ABBA 2V5BA 3P5YA 3QPYA 2ZTJA 4FNRA 1EIXA 3R2GA 4KFOA 3W2JA 1H7PA 3W1RA 2CW6A 1M7PA 1VS1A 3LLFA 5AHEA 1GG0A 1ICQA 4UFMA 3AJXA 3T7VA 2OJPA 5F2IA 4CCDA 1X1OA 2Q3OA 2QDHA 3F4NA 5BMWA 4O57A 1OK4A 1ZFJA 1F7BA 3W70A 1DBTA 1PE1A 1TPWA 3IIOA 4FXSA 2VENA 5J5RA 5EPDA 5AFDA 1FCBA 3B0VC 5DXXA 4IMGA 3MP5A 3NDOA 3FA5A 4N4PA 2E5CA 3TSDA 2VKZG 2B0MA 1WDWA 3B04A 5CKSA 5D37A 4GXMA 2ZRWA 3O06A 2GJLA 2VFDA 3UZJA 5G1TA 1VCGA 3TQVA 3P81A 4UUIA 3SFKA 3WK0A 1B4EA 3FOKA 2PRMA 5AHMA 1XBXA 1F6KA 4NUWA 3EXSA 1SZNA 1LOSA 3BPWA 1QCWA 2HTMA 2J9XA 4TMBA 2CLFA 1EPXA 2YFNA 2CLMA 3PSVA 1GVOA 1OF8A 1ZAJA 3W87A 3O16A 3ZWTA 2X1SA 3ATZA 3BO9A 1F5ZA 5F2MA 4UFHA 1LZOA 1YPFA 1SZEA 3M43A 2GVGA 5D2WA 3I7QA 5BMXA 3RMJA 3GX9A 3RLVA 3NPXA 3P8IA 1TV7A 1TPVA 3WK1A 2YXGA 2CLOA 2QCNA 2ZZ1A 2EAWA 4LY8A 3VFLA 3UY7A 4KWVA 2ZZ2A 1FXPA 1H7NA 3EXRA 3SGZA 3CU2A 4O1DA 3LCLA 3R89A 5DBUA 5H91A 4MFEA 3W7KA 2QCFA 3KOFA 4YCPA 4JYDA 3QM3A 4LOCA 3CC1A 2Q3RA 4JEQA 4E2BA 1HO4A 1A5SA 4FO4A 2R8WA 3W6YA 1KLZA 4N9EA 3TXZA 4ML9A 4IMEA 3HPSA 3CIWA 3A22A 2X30A 4S2CA 5L9FA 1RPXA 3PS7A 3GR7A 1LM1A 2QEZA 2P10A 3W23A 1ONRA 4O52A 5K2ZA 3FKRA 1RVGA 2FPYA 3NR0A 3U8GA 4O11A 4ICNA 4XUGA 3W1MA 3BLEA 3INPA 1JULA 1XCFA 3BVJA 3L9CA 2XN2A 3C3NA 4RV8A 2C16A 2A7NA 7TIMA 3NL2A 2NWRA 1KTBA 2NV2A 3N9RA 2Y63A 1KV5A 3B0PA 4HHPA 4PA8A 5HWMA 1YTDA 5K9CA 4UTWA 1ME7A 4JTEA 1HL2A 5LNWA 3DBPA 3UXDA 3MYOA 2QCLA 4O54A 4O0ZA 2TSYA 3LGEA 2QJIA 3P5ZA 4PODA 3QRHA 3M0ZA 3WJZA 1SZGA 1VLIA 3C2FA 3CEUA 2TRSA 5BNKA 4M7SA 5H2ZA 4WY0B 2RFGA 4FX6M 4JDYA 2YW3A 3G3DA 3L5AA 1K8XA 2ZA3A 1JCLA 2Y7FA 5AHLA 4OHQA 3QYQA 1MEWA 2Z6IA 1P5BA 3THAA 4JTKA 4MYXA 3KVKA 5D32A 3W1TA 4GRSA 2H6RA 5EBUA 4RR4A 5I3JA 3A5FA 3BW2A 3QC3A 3IGSA 3TR2A 1OFPA 1I2RA 3DFNA 1OFDA 2H8XA 2DJLA 4IOTA 3THQA 4JIQA 1SO4A 5I3HA 1GYNA 4NXKA 4MZ8A 3W1NA 2V0TA 5ABTA 3HB9A 2VEKA 5HWNA 1W5NA 4N6EA 4PCFA 1VHNA 4Y8FA 3TW6A 1WYIA 2VEPA 3QSRA 3G0XA 4U28A 4UMAA 3M5ZA 1A5CA 1O60A 3H53A 2VFGA 2WNNA 3NQ2A 3E49A 3B4UA 3E02A 4RKAA 1A50A 2JGQA 2FDSA 1SZFA 3NL6A 2A1YA 3HG3A 3IGUA 2C14A 3P7YA 3O15A 3LTSA 2QCGA 3DFOA 3B03A 4MLJA 1AW2A 1SO5A 5C6MA 3BW4A 2GQAA 2CZFA 1C9DA 3MO7A 4UMCA 3RF9A 2QCDB 5LNRA 5F4WA 1OFOA 2G97A 2VEIA 2DZTA 3NQFA 2OZ0A 3C52A 3TFXA 4JY8A 4WOQA 1H62A 8TIMA 1OG0A 4MPQA 1B57A 3G8RA 4U4MA 3W2MA 3P74A 4MJMA 1H7XA 3F1QA 2X1UA 1WV2A 1JCNA 4O1BA 3L21A 3W7MA 4NJJA 1W56A 3FKKA 1XM3A 3L5LA 3P61A 3UWVA 5G2HA 4OQVA 4MIMA 3DI0A 5J5DA 2RKXA 3TKFA 4UFKA 2VFEA 3UPBA 2I1OA 3F4WA 3PF3A 4MUZA 3RLUA 4CNPA 4NQ1A 1R47A 1ZALA 3TMLA 4ALDA 4UNKA 4BI7A 1O95A 4Y6GA 4UNLA 3PBVA 4PC8A 3TAOA 5G2WA 2ZCGA 3DHDA 3QMRA 1JUBA 1KLYA 3MJYA 4LU0A 1ICPA 1LOQA 3LTPA 3TQ0A 3W74A 3MMTA 5HUOA 1B9BA 2DP3A 4LVAA 1GVSA 3DGRA 1DQWA 2RDUA 4IX0A 1EWDA 4MFDA 1QOPA 2JKEA 5AN7A 1VYRA 4LVBA 3UWUA 5KZDA 3RFAA 2ZTKA 3C8FA 1TJPA 1LCOA 3GB6A 4LNYA 3P8JA 1JCJA 4ZVJA 2ZRYA 5DN1A 3VKJA 5EMUA 2Y7DA 4HT3A 1HG3A 3A24A 5HUPA 1I2PA 5HINA 2HMCA 4MY9A 3T78A 2PRHA 2WSRA 3I65A 4AF0A 3G1SA 2FB3A 4CCEA 3HOJA 3TA6A 1TYGA 1XDLA 4DO5A 4YMZA 1KFCA 3W1LA 2J24A 4O1AA 1C29A 1K3UA 1UCWA 3M7WA 1CX9A 5LNUA 4NT0A 1YPIA 1FWSA 2CZDA 3IGXA 3KAOA 5HJLA 3O05A 3GXPA 4UTTA 2YPIA 3BG9A 3ABOA 3W2LA 1GYLA 2BWGA 3NQEA 4MKNA 1F05A 4AB4A 3W86A 1LP6A 5FEWA 3G1XA 1QFEA 4IJBA 1XUZA 3CQ0A 3SR7A 4O4VA 1UB3A 1WOBA 1DOSA 1W1ZA 1S5TA 2PCQA 3LHYA 3NNTA 4LC8A 3TC7A 3EX2A 2YYTA 2V2DA 3GKAA 1NSJA 4X2RA 1KV8A 4RX0A 1GPWA 2ZDRA 4PFMA 5F4XA 1OX4B 1TV5A 3W85A 4AVFA 1FXQA 4LTSA 5MHBA 4DF2A 3UWYA 3W7GA 2QKFA 2FPVA 3OVRA 2WQPA 1H63A 1IXQA 2B7NA 1TCDA 3LERA 4JTLA 3GZ3A 1ICSA 5HWJA 2Y70A 4LRTA 2V81A 3GAKA 2E77A 3CWNA 1KM5A 4H3DA 1KM4A 1N8FA 1X7FA 4NZFA 4N6FA 4HSOA 1QR7A 3OVQA 5DCBA 3GNDA 1M7OA 1ZAIA 5LGXA 4LUIA 1VRDA 3E12A 5KZMA 1C8VA 2GUUA 1D3HA 3W72A 4B5NA 1BTMA 1V7YA 3B06A 2RDTA 3NVTA 5EA9A 3NQGA 1F2JA 1YLVA 4FIRA 2J88A 4UTTC 2NWSA 1Z42A 4AXKA 2GQ8A 4RXFA 4AWUA 3LRLA 2BZNA 5E93A 1MEIA 3W1XA 1Z41A 1THFD 3I7RA 2FTPA 3KRSA 4Z1BA 1O5XA 4QQ3A 4WQ6A 1Q6QA 4JTSA 4OWGA 4JTGA 2A85A 1EWEA 2D73A 3EB2A 3PR2A 3G18A 2Y85A 2P1FA 3CHVA 1SW0A 3HPXA 3SY5A 4JYEA 5TQLA 1JQVA 4MLRA 3SW6A 3TV8A 1MEHA 4GUJA 3HG4A 5HULA 1TV8A 4OU1A 3G1YA 4P2VA 3N34A 3W7JA 5LGZA 2UV8G 1LRQA 3GR8A 3LHTA 4AMAA 1MZHA 1LOLA 3PUDA 2CFFA 3FIGA 2HS8A 4N9BA 5LZLA 1CI1A 4ZQOA 2PE4A 3NQVA 1T0OA 1TPUA 1DORA 4FX8A 5LHEA 3W1AA 2FLIA 3DI1A 3P80A 4YXGA 3QPZA 5DBTA 4BWLC 5U4NA 4X22A 3LCHA 1K7EA 4A2SA 4UTHA 1G69A 5AC6A 4O17A 4LT9A 3LXBA 2TMDA 3TMQA 2QCEA 1N7KA 2QF7A 3OG3A 1VYSX 3EX1A 3BG5A 4FX7A 1W54A 2LLEA 4Z08A 4UTWC 4HNNA 3M41A 4QIUA 5AYXA 3GDKA 1VGAA 4AF0B 1OFBA 2ZRXA 1FDJA 3IIVA 5CPMA 1YYAA 3MHUA 1GEQA 3FLUA 4QISA 3UWWA 4M6QA 3T40A 1G4PA 1RQEA 4PL1A 4WXZA 4Y96A 4OT7A 2CLHA 4D2JA 4C1KA 1I45A 3PC0A 3GDTA 3P60A 5DY2A 1AL7A 3A23A 2V2CA 3LHUA 2E09A 4Q33A 4AHQA 3G1FA 3N14A 2PC4A 3TJLA 4K6AA 4LWWA 3BG3A 2FFCA 3W1QA 1PIIA 4O1CA 2CLEA 4KFNA 1T8XA 3GDMA 3N73A 3Q2DA 3KRZA 2QCCA 3NXFA 1UUOA 1FX6A 3ZFHA 5AHNA 1X1ZA 4RCXA 2NUXA 1FDZA 1LTDA 3S9YA 4XBKA 4GE8A 3CM4A 3LCGA 1FBAA 4WZHA 1DHPA 3L67A 2VXNA 3STFA 4UXDA 5GVJA 3LXAA 2C13A 4IXXA 3B0UX 3FS2A 3WK3A 2QAFA 3HGOA 5AYZA 2ATSA 4RK8A 4IX2A 2E6FA 1OVDA 1H1ZA 1XC4A 5LSMA 1EB3A 2C1HA 3NQMA 2DZUA 4DBEA 1OFRA 1TREA 2Y88A 3DENA 2YYUA 4XKYA 5KMYA 1PS9A 3BLFA 3W3OA 3TJXA 1NAL1 1OX5A 2YR1A 4MOZA 4S1FA 3ZS4A 3UZ5A 1KA9F 3TSBA 3QQ0A 4QNWA 5K7JA 5D04C 4HSNA 3O8AA 3MW7A 4OBTA 2ZQ0A 1RR2A 2V30A 4GFSA 3ZR4A 4H6KA 5FF0A 3HG2A 5HR6A 1KFEA 3C6CA 4K39A 1S5WA 3G24A 1KFJA 2V82A 1JQXA 3O6YX 4AWSA 3LLDA 3EWUA 3OIXA 4PTNA 3S5YA 3K30A 5C5YA 1OX4A 4L4MA 1K03A 3O6DA 4N9CA 3RNDA 3O63A 3G0SA 4BFAA 4UTKA 1VC4A 1D3GA 4R53A 2CLKA 4O18A 3W7IA 1JRBA 1S3HA 3O1NA 2B7OA 1AMKA 2A5HA 3MUXA 1BKSA 3F03K 3PG8A 4O19A 1PV8A 2WPBA 3A9IA 4JTTA 3KHJA 4O8RA 3CIXA 3LOTA 4LW7A 1NF0A 4XBSA 3QQ1A 4A29A 4GUGA 4NJHA 4UTIA 1UJPA 3QJAA 3DH7A 3GLCA 1EUAA 3G0UA 1SU5A 3T4CA 5D38A 3ABSA 3CTLA 2C0AA 2NX9A 2JGYA 1F74A 2H3DA 3KVLA 4K37A 2X2GA 3NPWA 1A5BA 3NYZA 3SECA 3WJSA 3NG3A 3W75A 3KRUA 4Q32A 3S1UA 3C0JA 1X8FA 3FYPA 4JGDA 3LI0A 5F2GA 3S5OA 3UWQA 3IVUA 2Q8ZA 4JDBA 5AC7A 1B3OA 4HNTA 4WD0A 3GXTA 1Y0EA 3SI9A 5I3IA 4BI6A 1VYPX 1FDYA 1YDOA 4MZ1A 1BEUA 1V5XA 3TFCA 3NM1A 5KTLA 1BWLA 4IQLA 1EX5A 3LDVA 1EA0A 3W7EA 4POCA 2R91A 3WJWA 3W73A
chains in the Genus database with same CATH superfamily
4Q8TA 3QMTA 1MDRA 2F9RA 1EUNA 5C54A 4YTSA 4GA8A 4DO7A 1IR2A 4TV5A 3QF0A 3LSCA 3DHFA 3QMSA 3W76A 4UFLA 3SCRA 1QUMA 1JAKA 1MW2A 2GSHA 1RA5A 3ZR5A 3OB8A 2NQ9A 1CGYA 3LN3A 4O12A 5H8PA 3H7VA 1UPMB 2ISFA 1NIUA 4Q4KA 3FK4A 1LYXA 1KXHA 2Q8LA 1B3VA 1W6TA 4ONVA 1CGTA 4FOUA 3W7QA 2GL5A 3QLLA 1K9EA 4MWAD 3M0KA 4XAZA 4R5EA 4ZOCA 1BRLB 2C3ZA 3I3DA 4ZGYA 4PEEA 1MXSA 1E4LA 4LAOA 1C8XA 5GJPA 3PWAA 3NQ8A 5I03A 1VPYA 4YL2A 3A5VA 3I10A 4JICA 1XBYA 4QTGA 3GAYA 2WWDA 2F7FA 1KWKA 3NEVA 4C90A 3FYOA 3QGVA 4LAMA 1KGXA 4KWWA 3PUOA 3L7RA 4DX3A 3CAWA 2FTYA 4OBSA 4M5PA 3TOPA 3C2OA 2V69A 3C2YA 2VZSA 2YA1A 4GUIA 3DZ1A 4B2DA 3TTEA 1LG2A 2QJHA 4W7UA 1QTWA 1EC7A 2DW7A 1TRIA 4Q4MA 3APTA 2PWHA 1I2NA 1TPC1 5CAHA 2Y8VA 5BW6A 3W26A 2WHMA 3Q94A 3WNKA 4GH3A 3BMVA 1HO1A 1E9YB 4DWSD 4YTRA 4FLRA 1FWBC 3OJGA 4EF8A 1UC5A 1WPCA 5ECUA 3WBWA 3SAZA 1XYCA 5LKYA 3JRKA 4R34A 4KKXA 1PKLA 3CL6A 3ZWSA 2J7CA 1JNEA 3M6YA 4G9PA 3VD3A 5LIXX 1YXYA 2J79A 2WNZA 1IXPA 5TNVA 3ABRA 5MF5A 2HS6A 2V68A 4XD6A 3C0SA 2E8ZA 3C0LA 3QKZA 4C6JA 3WF3A 2PF0A 1GQNA 1AW1A 1XYBA 1XLAA 3WZ0E 3V16A 1IXNA 5DRIA 3F2BA 5FESA 5CEWA 1NOWA 1NM9A 3RCMA 5DMMA 1FHDA 1XBZA 1AG1O 3CYVA 3OLDA 3CV1A 3WLIA 5HMDA 5C9XA 4ZA0A 1AVAA 4QQUA 1QI3A 5E0CA 1XL9A 1EQCA 1ZAHA 2XU2A 3NCOA 1U1UA 3OW1A 3VNDA 3VOCA 4AMCA 2A3EA 3NL3A 1ZQ5A 1RPKA 3UXLA 3MHGA 4HCDA 2GVYA 3L12A 2Z27A 2OX1A 1Q6RA 1SO3A 3WLMA 1PDYA 3SDOA 1VFUA 4WDTA 2CYGA 5HMSA 1XJBA 2MNRA 3S5ZA 2KZHA 4FNSA 1HFBA 2RGMA 4XB3A 3TUUA 2VCBA 4GIYA 2DJXA 2FPTA 3W84A 3NQBA 3STCA 2YJQA 3AHZA 3R13A 4PMRA 1WBHA 4DBDA 2VFIA 1UR0A 4X0NA 4JTRA 4UC5A 4GABA 2WMFA 2WHKA 4FAMA 4HMDA 1OJXA 4F48A 3U4AA 1C91A 2EF9A 1B3YA 3CUZA 3ARWA 1WX0A 3NZ1A 3E3HA 3UJEA 1GVYA 2Y62A 4FXRA 3ARRA 1ZJIA 4WVXA 4Z1AA 1FH8A 3KOXA 3TLLA 3L4UA 4JQ1A 4REQA 2YZRA 4IMFA 5IHSA 1SZRA 3M5VA 1XIFA 4I9MA 5HDRA 5GPRA 4WSKA 2NVAA 3G6LA 3WD3A 3O6CA 2X7WA 3WUEA 3CZJA 3A6OA 4P7LA 3EWBX 3P0XA 3VKBA 3MI3A 1W9XA 3OLEA 4ICMA 4TXEA 1ZENA 1Q6CA 3A9BA 1YX1A 4Y90A 1E6ZA 3HJEA 4HN4A 4PSRA 1B54A 5BU6A 1FWTA 5LNSA 1UPPA 1TMQA 4HJFA 4QDWA 1W8SA 2YL8A 2NSXA 3BCDA 3ITOA 4A22A 2Z7KA 3CAQA 3R5EA 4IMDA 3KL0A 1KCZA 4JTIA 4H19A 2PURA 1EX1A 1RD5A 2G50A 1EPVA 3E1F1 3K4DA 3MUY1 2BY1A 5FEZA 3M16A 5DY3A 1KKOA 4JIRA 2V3GA 3OYZA 3GD6A 1IWAA 4QFUA 2XTKA 1FHUA 3H4GA 1GT8A 2BHZA 2C0HA 1XRFA 3KE0A 5I00A 3V0SA 3S8HA 1QMLA 1UUMA 3GK0A 4MDPA 5DT5A 5HK4A 1WE5A 1EP1A 2NQJA 5F1VA 3OZPA 1BYBA 3E2RA 1P1XA 7CGTA 3MDUA 3MWCA 1WDDA 4IGHA 5SWUA 2DT1A 3W28A 2A6LA 3BJTA 2G4FA 3AWNA 4EWJA 3HMJG 1JCMP 1DV7A 2EPHA 3CWHA 5AHIA 3QZEA 4XAYA 5FJRA 4LUYA 1V7AA 3DYOA 1K6AA 4K1WA 4A3HA 1JPHA 4IIBA 3AXHA 5AZ0A 4EOUA 3ANUA 2WCSA 4AIBA 1O68A 4ADSA 1K4HA 3PFRA 3A21A 3AIBA 4YVPA 3FX4A 1YBQB 4X9YA 1IT8A 2A21A 2X0HA 4JTDA 3SGUA 2P76A 1V3JA 5HANA 3UU0A 2WKJA 4HOWA 4DBWA 4MJZA 3JS3A 5A6BA 4JXCA 3I6TA 5T9BG 2CLLA 1R3VA 4P7QA 1IV8A 4NZ1A 1YTEA 1UR8A 1XCWA 2YCEA 5A5WA 3RR1A 5KZ6A 1CCWB 5HNTA 3R8RA 2XH4A 2YGYA 1VIWA 4TX6A 3L65A 3MMDA 3JUGA 1XGEA 3LENA 5K3VA 3RM4A 4MY8A 3M0MA 3L4YA 4AH7A 1BVNP 4F0SA 3ECQA 3RLGA 2OYLA 5K9DA 5D2YA 3OHMB 5C0QA 1W3KA 3O9NA 2ZRVA 3PBGA 1EBGA 5CGQA 3EEZA 2O7SA 4GZJA 4KRZA 1ITUA 4C65A 1FY6A 3W7HA 3LV6A 1XBVA 2EGZA 3VXGA 3TYBA 3KVMA 1YIXA 4C6LA 4U3CA 3NQ7A 2REQA 3ANYA 2Q71A 5A94A 5CSSA 3IJDA 3AIWA 4Q8VA 5FF7A 4FR6A 3BK0A 4E5TA 1MRAA 1H49A 4I7UA 1R8LA 1J0JA 3CZ8A 3O3RA 4MB3A 5J04A 3TCEA 1DL3A 3M44A 3LRMA 3MI6A 3V1HA 1TQJA 3ME3A 4IXHA 3ZT5A 1M03A 5ABGA 1A5UA 1T99A 4IGMA 2D24A 4ZL1A 3QGKC 3SURA 3UZWA 2YL5A 3KVJA 1R3YA 1D9EA 4A3RA 2PRLA 3URQA 1W9VA 4CLMA 1S5VA 3MBDA 3T8LA 1TJ1A 3VD5A 1TIMA 4HBKA 4WXYA 2QV4A 3N2XA 5TD4A 3U2ZA 2BVDA 1EP2A 1XFBA 5D2XA 4V1XA 3N13A 4DEFA 1RQHA 1RCXB 4WHBA 1R3QA 1B9ZA 3TYDA 5A3HA 3VUSA 3IIXA 3SRHA 1QAPA 5JUVA 2V2HA 4NNBA 5FCZA 1JRCA 1MFVA 3AC0A 3PY2A 3WDIA 4CQBA 1OFEA 1HJQA 4HGXA 4N4QA 4OGZA 4A2RA 4C6IA 4CGTA 3PBWA 4DPQA 5B7ZA 5JIPA 3GNNA 1YE4A 4FHAA 3WENA 2VDGA 6ALDA 4Q7NA 1XG4A 3TZFA 3LS9A 3S1WA 1ISYA 3BURA 3N2OA 3CHFA 5C55A 1ZU8A 3WMCA 3ABQA 2YBVA 2QYGA 1Z6KA 1JZ2A 2OWXA 3HPZA 4O0KA 4LRSA 4XWUA 2YB1A 3QYSA 4J1OA 2PGRA 1ZP4A 4DUXA 1AQMA 2BX7A 2WZEA 4D8ZA 3T6CA 5ABHA 1BG4A 3MP3A 2DU2A 1H7RA 5E70A 3MV01 1OADA 4BK9A 1KCXA 2ZVRA 2R9RA 2Y7EA 3QH2A 3VABA 4LF1A 1R3RA 2QJGA 3LBMA 1XI3A 5JBDA 4CVUA 2RGLA 2XUCA 4KS0A 1R0MA 2WXDM 4DO4A 1O1ZA 3BW3A 3HN3A 4QROA 2QGYA 4IIFA 3SCVA 3WMBA 5D8WA 1NEYA 4ZO9A 4AZ6A 4HKPA 4AZCA 1HJSA 1QW7A 2D2JA 1QVBA 3ZJ7A 3VE7A 5D30A 5KEZA 4HNUA 1GOXA 4PB4A 3RXZA 5L6UA 4ML4A 2Q01A 4YWIA 2G3JA 2G96A 2OCZA 4G1NA 1RQBA 4GLEA 2W27A 4HOZA 1CLKA 4L7ZA 4IFKA 1LJYA 3VGBA 1GK8A 1GW1A 1Z44A 1S1RA 1VHCA 5XIMA 3KP0A 4UOZA 1L8PA 4U5KA 3UY8A 3APGA 2J6XA 2BOEX 2EQDA 3RAOA 3MWAA 4XKMA 1RAKA 1ZBVA 3QOMA 1VH7A 5CZTA 4PBGA 1MNSA 5I5RA 4MZYA 2QJJA 1HJVA 1HP4A 1RV8A 4P61A 4J2PA 4XZMX 4ZQRA 2QQ6A 5EMKA 3HF3A 5TBOA 2BHYA 2C71A 1SSGA 1V3HA 2YCJA 5A2CA 3URBA 2DVTA 4XTDA 3ID7A 4ZOBA 4IQJA 2FVLA 4O10A 2WMGA 4PH6A 4QE1A 4LV9A 1ZNNA 5EMJA 3HBLA 1PUDA 1NFBA 1QPRA 4IICA 1FQ0A 2V9DA 4XO7A 3RILA 2OQLA 4H9TA 4UTMA 2ISVA 4IIDA 4CVWA 5G2IA 4DBSA 3T55A 3GHSA 3W00A 3OZYA 4NILA 3S6DA 2SFPA 1NFPA 1V51A 2PPGA 4IQDA 2I9UA 3OLGA 4H7CA 2QUTA 1T96A 2QW5A 3PJWA 1MSSA 1JI2A 2G95A 4FF7A 3B8WA 5CBJA 1U5HA 4NX5A 3CB3A 3SIZA 3URAA 3KP1A 1OFQA 4HJWA 2FZBA 5JIWA 1TWSA 4Z0SA 3EKLA 5KSWA 4L6OA 4M6PA 5FKYA 1A47A 4EE9A 4PGLA 1VRXA 2WSYA 3BGGA 3EWWA 1AH3A 1H61A 1O4UA 3W24A 3C0QA 4JIEA 2QAPA 1TG7A 4AD5A 2VFFA 3CIVA 4QBXA 4XBJA 4MTVA 3G1DA 4AHPA 3VNKA 1OF6A 3DU0A 4ZB0A 2HDJA 5HAOA 1EXBA 4N7QA 3MKKA 3AISA 1XIIA 3OA3A 2PAJA 1CXEA 2AOSA 2PZNA 1TWDA 1I6NA 3I3EA 1NOFA 3W1RA 1VS1A 3LLFA 1GG0A 4UFMA 4B16A 5F2IA 4CCDA 1X1OA 3BCJA 5REQB 2QDHA 5HQLA 3WG6A 2WVTA 1ZFJA 2D1ZA 2OG9A 1F7BA 5DRCA 1PE1A 1TPWA 1FWIC 4HZ7A 1RK5A 4C6DA 5EPDA 1WUEA 5HXMA 1FRBA 4MWAC 4IMGA 3RM8A 3FA5A 2C1GA 2E5CA 2DH3A 2J74A 3B04A 5CKSA 1B30A 3AXIA 1GYMA 2GJLA 2VFDA 3BAKA 2Z24A 5EMYA 2WWCA 3QZAA 3S2CA 3LQLA 3SFKA 1XIMA 1A0EA 4U5IA 1U1HA 3AYSA 1DWGM 3MZNA 1SZNA 1O66A 5A8OA 1LOSA 4FK9A 1QCWA 1RLCL 2HTMA 4TMBA 4UOJA 2YOCA 3LZ5A 2A3AA 1E70M 3RLHA 4X2PA 5E5CA 1JPKA 3CO8A 4A8IA 1ZAJA 2X1SA 3KCLA 3VC5A 4RDZA 4RNJA 1SZEA 1AFSA 3RLVA 3P8IA 3WK1A 3V5CA 1WP6A 4WCJA 4ZFCA 2DZAA 2ZZ1A 2HJPA 3UY7A 1H3GA 3UP8A 4JHOA 3HMCA 2FZ9A 3R89A 5DBUA 5H91A 3FA4A 3VDCA 1XQKA 2QCFA 1U5VA 1F9CA 1KKRA 1VEMA 1ZZMA 3KL3A 3QM3A 3LPPA 3HM7A 4JEQA 2Q3RA 4CNTA 1WDSA 5JBEA 4PCTA 5B80A 4N9EA 3GG1A 3TXZA 2GUYA 3RGTA 1US0A 3GR7A 2P10A 3W23A 1ONRA 3FKRA 2DIJA 1AMYA 2FPYA 4ATWA 8A3HA 5IRPA 3NR0A 3ZMRA 4WGHA 3OYXA 1TUXA 3BLEA 4L9ZA 1XCFA 3L9CA 5CC6A 3C3NA 2ZE3A 4RV8A 2XM2A 3LGGA 2VURA 3SGGA 1IEQA 2GFTA 2NV2A 1F8MA 4I5RA 2F8QA 1TV4A 3REQB 3ZJKA 4HHPA 5K9CA 2WJFA 3LGEA 4TVCA 3WJZA 3DBNA 4M7SA 1HL9A 2RFGA 1A3XA 4B5UA 4FX6M 3L5AA 2VGGA 4AEFA 5AHLA 3B8UA 1PJ9A 4DAIA 3QYQA 2Z6IA 4EACA 1P5BA 3H23A 2YXXA 4L1GA 4GRSA 3V0TA 3A5FA 4DWDA 2PFHA 4QEEA 1OFDA 4NAFB 2DJLA 2CBVA 2BY0A 5LIWX 2PDHA 4NXKA 3W1NA 2V0TA 1A5MC 5ABTA 1GQKA 2DSWA 4F0RA 1I1WA 4PCFA 3AUJA 2PP0A 3QHOA 2VEPA 3G0XA 3IARA 2CXEA 4UMAA 5D8ZA 3DOPA 4DWSC 3M5ZA 2VFGA 3H4WA 4QLKA 2EBNA 4V15A 1A50A 2JGQA 2BP1A 1SZFA 3MSGA 3HG3A 3IGUA 1YRRA 2C14A 2VI0A 3P7YA 5EMLA 1TA3A 4DAFA 2QCGA 4MLJA 2PD9A 4M3PA 2OYKA 1EF3A 3MO7A 3RF9A 2E1WA 5F4WA 1OFOA 1QI2A 6XIMA 3WLNA 1EJUC 4ACYA 1OG0A 1CGXA 1B57A 1C93A 4Q8PA 3U0HA 4C6BA 3P74A 4CD5A 1BVWA 4C1NB 3F1QA 2X1UA 1J11A 1T6MA 4O1BA 3PZVA 4IPLA 3S3GA 4Z2JA 5G2HA 4PULA 4LUTA 2DT3A 3U7VA 5J5DA 4B5VA 3SN1A 3EPNA 3MS8A 3F4WA 4NQ1A 3UETA 1YQ2A 1RBAA 1AD1A 4UNLA 3PPFA 4ENLA 3DHDA 1KCKA 2WPGA 3CNYA 3LTPA 3OG2A 2IQ0A 3W74A 1F3EA 4NI3A 4DWSA 3TWBA 3FVMA 4ZE4A 1HKIA 2DP3A 2OO0A 4H6QA 3WD2A 2VRJA 1GVSA 3BSHA 1DQWA 1M65A 2RDUA 3CMJA 1EWDA 5AN7A 4GQBA 4LVBA 1ITXA 4XUYA 4S3FA 1PX4A 5E0FA 2GGEA 1UIOA 2GOKA 2IQDA 4F9DA 4D6FA 2Y7DA 1HG3A 3GYCA 1C7TA 5HUPA 1DIEA 2BFGA 1YDYA 1RJRA 4EXQA 3W27A 1O1HA 4ACZB 2PRHA 1TCMA 1OINA 2DSVA 2DUAA 1CBGA 5T91A 2HCVA 3G1SA 3SSZA 3VIOA 1TYGA 4OUEA 4MB5A 1OIMA 2VR2A 5KETA 1H11A 1HXJA 1K3UA 1UCWA 1CX9A 3MDWA 5LNUA 1YPIA 4H7ZA 2OELA 4EANA 1DE5A 3WO8A 4AD3A 1NJJA 3W6MA 3TJIA 1GYLA 2BWGA 5CXPA 2A3BA 4DJFD 5FL0A 5A6SA 5C2CA 3BL3A 3A64A 4C7GA 4AD0A 1LUCB 1CGUA 1R9ZA 3E0LA 4HK5A 1WOBA 1DOSA 3LPGA 2PTXA 3LHYA 1AQHA 1DJZA 3VOJA 3AICA 2YYTA 1NSJA 2ZDRA 5F4XA 3AYRA 3ITVA 1TFVA 4LTSA 5HPOA 2O9OA 4DF2A 4D6DA 4Q8QA 3T0BA 3BLLA 2B7NA 1RY0A 4QG9A 1H0GA 3CAVA 4ERAA 1JD9A 1ICSA 1JZ5A 1TE1A 3W01A 4LRTA 2V81A 1N8FA 1X7FA 4NZFA 2QVNA 1YMYA 1VF8A 4GI8A 1W1TA 4H7VA 3N04A 5LGXA 4LUIA 1VRDA 4GOAA 2ACUA 5EU9A 1BTMA 1V7YA 2CEQA 4WEVX 2WW5A 3NVTA 3PPHA 5EA9A 3T1GA 4A3YA 4IJCA 4MWAA 4NYUA 1YLVA 4FIRA 2WM0A 2AQVA 4AWUA 4GH1A 3KBWA 4JCLA 4HA1A 1ZJBA 1Z41A 1THFD 2YLAA 2O4MA 4HZ6A 1DEDA 3KRSA 1O5XA 5BWFA 3WMSA 4JTSA 1EWEA 3T4WA 3EB2A 2PGEA 3WL0A 3NIYA 2PI6A 3P3BA 5JBFA 4XAPA 1SW0A 5CC7A 3SY5A 2D23A 4JYEA 5TQLA 2GUBA 4X63A 3WBAA 1TV8A 2GDUA 3G1YA 4P2VA 3W7JA 4M24A 4NIRA 1BQGA 1JCTA 1LRQA 3U5YA 5HMEA 1UYQA 2AKMA 4GYPC 3W29A 3PUDA 1WNOA 5CG0A 3FNDA 3NQVA 1T0OA 4KETA 1DORA 5LHEA 3DI1A 3P80A 4KRTA 4BWLC 4JTCA 4XO6A 3MY9A 3K4WA 3TZNA 3HQOA 3THDA 4JAWA 1GOWA 1GQIA 4UTHA 4P7RA 4TVUA 3UR2A 3LXBA 1EDTA 3TMQA 2QIWA 1ONXA 2QCEA 1OCNA 2FJUB 4QRNA 5FJPA 2NVCA 2OU4A 1PZ3A 3MCNA 1UP2A 3M41A 5AYXA 3GDKA 4E4UA 2HBXA 3R58A 3IIVA 4G7EB 1YYAA 2V3FA 4MKSA 4M6QA 3N11A 3U2CA 4WXZA 5GNZA 3FJNA 4GBDA 3TR9A 1I45A 1DJXA 5DY2A 3UERA 4HMEA 2E09A 4AHQA 1POKA 2BDQA 3N14A 2VQUA 3OGVA 3VKKA 1E56A 1GW9A 2FFCA 3WBEA 4AWEA 1PIIA 2VOTA 4O1CA 2CLEA 4KFNA 4AIOA 4JKMA 1UD4A 3CT2A 3N73A 1J8VA 2QCCA 1CLVA 4C7FA 1KNWA 5GNXA 1FDZA 3CXOA 4C6KA 3CM4A 3LQGA 2UBPC 1F61A 2PTDA 1DHPA 4UXDA 3AMKA 4JTQA 4GD0A 2HNEA 3QC0A 4B2DD 2Z1VA 2QAFA 1UKQA 2ATSA 4IX2A 2E6FA 4Z2LA 4R27A 5BROA 1ODUA 2DZUA 1OFRA 3FYYA 1H5VA 4WK9A 1F6YA 3O6AA 1BVZA 4WDXA 2X0YA 1U2YA 2J77A 2YYUA 3LU2A 4XKYA 3W3OA 1E72M 1ADSA 2V5DA 1OX5A 2YR1A 1QBAA 1GNXA 3TSBA 4QNWA 4PMVA 4HSNA 1XYFA 1J10A 2PGWA 3TTQA 4MSSA 4C6MA 5FF0A 5HR6A 1KFEA 6XIAA 4FMVA 1GQLA 3G24A 4JPGA 1KFJA 2OQHA 1PIFA 2QMKA 3O6YX 4UQAA 3LLDA 3S5YA 3K30A 4L4MA 2XSXA 4DI9A 4J5NA 1GEHA 1A49A 1M53A 4ZOAA 1H0IA 3L4VA 1D3GA 3UPMA 4DM1A 3W7IA 1JRBA 1S3HA 2PWDA 2Z25A 1VEOA 2B7OA 4OUIA 3MUXA 2PB1A 3KDNA 1DXIA 1BKSA 2X1IA 3RO6A 1UKSA 4K3ZA 1PV8A 4IFKB 4NI8A 3MANA 3B8SA 3E2VA 2PEVA 4LW7A 1NF0A 3HZ3A 3S4TA 1X38A 1FWFC 1ADDA 4GY7A 5FJTA 2ZC8A 3DH7A 2R1NA 1QNOA 2BOFX 4HCLA 4IPPA 1SU5A 2BG5A 5D38A 2C0AA 1WZAA 1F74A 2H3DA 3KVLA 1SYTA 3MA8A 3PTKA 4HA3A 4K37A 3VUPA 1Q13A 1A5BA 4HNCA 1UHVA 1Q5MA 1PDZA 3DIPA 1HJUA 2J8TA 3W75A 3C0JA 4D1IA 1X8FA 4KCWA 3SCPA 1UR4A 1XD1A 1OSEA 4JDBA 1EJTC 2ZOXA 2V38A 2ZUMA 4HNTA 3TC3A 1NY1A 3SI9A 4FF5A 1VYPX 2IKGA 5I0DA 1FDYA 2BBFA 4M29A 4LH8A 1MZRA 3CJPA 3S2LA 2YDRA 1A0CA 5JU6A 2V5JA 1ECEA 1V8EA 1JF6A 1L8NA 1HKWA 3LDVA 1EA0A 3CL7A 1G9HA 4PCPA 3U7BA 4POCA 4WDUA 3F4VA 4LBUA 3W73A 3SBFA 1GJPA 1LBMA 3AS3A 3UXKA 4NHVA 3BLDA 3OBAA 1W1IE 2UY4A 4Q8UA 4YLWA 3OHIA 5FF2A 2YDAA 4K68A 6TIMA 3ZYZA 3F5LA 5CSUA 1NWSA 2E6AA 1IEVA 4LUSA 3GUWA 1J0HA 3II1A 2VELA 4DY1A 2ZZ6A 2O7QA 2YDQA 3NZQA 1N8IA 4GO9A 4HU3A 3G1HA 5E9XA 2RDXA 3S1VA 4QGCA 1Q6OA 3CQHA 4GC4A 1IGSA 1LWIA 5C70A 3VI2A 3HGJA 4W88A 4UQ9A 2VZUA 3WYZA 2WO5A 2VC9A 4HA4A 3CLWA 1MQQA 3W2UA 1HL8A 3HO8A 2POZA 3WFAA 3W9ZA 3MC5A 2VWSA 1FH7A 2VX4A 4INFA 2VYOA 2A6NA 4GG9A 5CC3A 2D0FA 4HK6A 1I9CB 4O1FA 1OX6A 2W61A 3EX3A 5LNVA 2DQWA 3COTA 2ISDA 4L4LA 4ZQPA 4N2YA 3GVQA 3M46A 1VBRA 1W3NA 1WUFA 1LLWA 3HJZA 1FWHC 4KPLA 1AJ2A 4LVGA 2Z0IA 3FGCB 2OKOA 1GZGA 3DYPA 3UJ2A 3USBA 1IYXA 1MUMA 3ES7A 5M17A 3SADA 4W89A 1WDPA 3NQDA 1GJUA 4XZLX 5F4SA 2F2KA 3I7SA 5CZ0A 2BTMA 4GQGA 3S9IA 4IGSA 2XWDA 1E55A 4WJXA 3FGCA 1LL4A 5CG7A 1QXLA 1QK2A 2QZRA 4A21A 2BNJA 4BEUA 1K77A 3I4KA 3NPVA 1DJHA 4JIIX 1CDGA 2OSWA 1C7SA 5A2BA 3TA9A 4QJ3B 1K02A 3TC6A 3TNBA 3W07A 2NZLA 2Z1BA 4XISA 4JFUA 4GJ1A 4LYPA 2WKLA 4IM4A 5BCAA 2DZXA 4J3SA 4EPDC 1NWRA 1M68A 3GC5A 4CNNA 4LEFA 2C8NA 5AC4A 5D9NA 3SJ3A 1MW0A 3N4FA 1H5YA 3RCNA 4FEZA 3QOKA 1AK5A 1KBBA 3TN6A 1QHOA 3G1AA 1VZWA 5CPNA 3ZOAA 4CQDA 4O28A 3DN5A 1ZCOA 4QITA 1A4MA 1RJPA 3I6RA 2VCCA 9XIMA 3OA5A 3RG6A 1QI0A 4UQDA 2J9YA 4EPEC 3CB8A 3TH6A 2WNWA 2F2HA 1LQ0A 5LHFA 3EZ4A 2IW0A 4D6IA 3TX9A 1JXKA 3AHYA 1F6PA 4XAGA 4GZIA 1UQYA 4MB1A 1EKOA 2PTWA 1SFJA 4AD4A 1QNVA 3TAKA 4MUPA 4QCFA 1E6XM 1A5AA 3NSNA 1A80A 2OWCA 4WKHA 3KZSA 2CZEA 4LS1A 5KINA 4EWND 1S2WA 3LM7A 5D09A 4D1JA 3FN9A 2F6XA 4FNPA 3WNLA 1R87A 4Q7BA 1DWJM 1DYSA 4E3TA 2QLYA 3ZJ8A 1QOXA 2Z1SA 1IIGA 4ERGA 3WLSA 3DKJA 2RJHA 1PYFA 4EAYA 2OO6A 3H21A 3WNMA 4GX8A 3WQVA 4RNIA 1KFKA 2ZXDA 1OYBA 4RE0A 2Z2BA 2ISWA 2J7EA 2PGFA 1GHRA 1VD6A 4H4IA 2VHLA 4QSHA 4RZ5A 4AZIA 2OT1A 2B7QA 4QDPA 4KF1A 1UP3A 2ZADA 2WNQA 2GVLA 4GVGA 4EPKA 3JU2A 3GNOA 2I16A 4LEQA 4KT2A 3OBEA 1NWUA 5DT7A 2ABAA 3WH8A 4M6VA 4K8EA 3EWXA 3W7CA 1B5TA 3NM3A 4TX8A 2IKHA 5CGTA 3T0AA 4GZ7A 1VCFA 3PJUA 2Z6JA 4HMCA 1AZ1A 1RLDA 3DESA 4UTFA 4AD1A 1E1EA 3NOEA 1P7TB 2PDBA 4JTHA 2PDLA 4N02A 3WLTA 1N2VA 1Q4NX 2CKRA 2EJAA 2ZUVA 2J27A 1GVRA 1F3WA 2HBVA 3DX5A 5GQBA 5EYWA 2P8CA 3CLMA 3O0FA 4ZQMA 4HYVA 2JK2A 2W6RA 4UCGA 3E0FA 3W7PA 3WFLA 3VFCA 4M6UA 2RUSA 1GWJA 3GZAA 2VP8A 1GVQA 1SJBA 4OV9A 1L2UA 3FCPA 1DJWA 5FJOA 4US5D 2NW0A 1R86A 2PDGA 3LX9A 2A3CA 1EEPA 5J8LA 4ZZ9A 1JDCA 2OPJA 1R3SA 3U5UA 3Q58A 1FWRA 1ZTVA 1U22A 3AMCA 1RVKA 1L6FA 4M0XA 4I9JA 4ES4A 5FAJA 3TN3A 1DHKA 2IS7A 4DM2A 1SO6A 2I56A 1XW8A 2GJXB 2A7PA 2GSEA 3FAWA 1X6LA 3M0LA 1C8QA 4EKJA 4AQLA 4N9DA 1Q2SA 3W7LA 3KUMA 1XIBA 2ZKMX 2EPMX 2W92A 3AU2A 4GFIA 1DWHM 2VR4A 3H2NA 4O16A 4ZSTA 4DUVA 1RCQA 4LGXA 3MUIA 5DMYA 4AU0A 2P3ZA 1OG6A 2WK2A 4PYSA 2NXIA 3FEMA 2YKKA 3EWYA 1XRTA 2IUZA 2ZRUA 3G5EA 5FI8A 2QNEA 3PZMA 1UP0A 1JDFA 4AVNA 2PDMA 4C1NA 1EF2A 4M81A 1R9YA 2XFRA 4Q6XA 3SUTA 5PTDA 1IR1A 4Z42C 3L2IA 3ERPA 4RXGA 5I07A 1KFBA 1BD0A 1EYEA 3D3AA 1LORA 1KFLA 4ZR8A 3WD1A 4LANA 2ODOA 1Q4WA 5U7SA 4JNZA 2QUUA 3AZRA 4I5UA 4URIA 2FB2A 1M7XA 2IPFA 1XCXA 1XX1A 3BGJA 3IIZA 1V6XA 3VOHA 2P88A 1VFMA 3KBVA 4A3UA 3ITTA 3S42A 4FZIA 2EG6A 3FVDA 1WAWA 1K9DA 3VIMA 3CQIA 2RHGA 5IBXC 4RDVA 2XN1A 2UY2A 3DFSA 3P93A 2W67A 4UNIA 4CD7A 3WQDA 4YPJA 4HU8A 1HP5A 1AW5A 4LVDA 4NAFA 4D6JA 4JYFA 1B4KA 1UW9A 2HVMA 3FJLA 1WA3A 3QVQA 1UASA 3NZRA 2YCLB 3TNOA 1EDGA 3KRBA 3MP4A 4HQVA 4WX2A 1BKHA 1H1YA 4B5TA 4AVOA 4C1LA 2XIBA 2YB4A 4YHEA 2E1DA 1W1PA 4RDWA 1PL9A 4XK2A 5M3WA 3NAVA 3T0DA 4MPKA 4GI9A 4P7OA 1JCXA 1W9PA 2Z2AA 3LCWA 1PTAA 4ZMGA 3MMUA 2C6QA 2FMOA 1MO0A 4Q4RA 4U31A 3R8GA 4JTUA 2AGKA 3W88A 2PS2A 2X16A 4DJEA 4MNMA 2PBOA 1OABA 1EH9A 4CQCA 3L0KA 4LB4A 3H12A 3WDHA 3I68A 4CCZA 2CPUA 4GC3A 2VJXA 1YHTA 4A3QA 1H50A 5A8PA 4X61A 1J79A 1KTNA 2L5HA 1BRLA 4GISA 1TUFA 2Z7GA 1ESWA 4Z1CA 1RCOB 5H1WA 4N0RA 1PTDA 2DH2A 2PDJA 5I3GA 2EXOA 1CGWA 1LRTA 3BGAA 4MHBA 3LCIA 1BXBA 3Q37A 4AD2A 3QW4B 2DZPA 3R0DA 3WQCA 5HPCA 2ZA1A 3C56A 1PYMA 1I2OA 2QCHA 1IF2A 5BU9A 1UWRA 2A3LA 2BLEA 4Z2KA 4K38A 4P5UA 1R85A 2NUYA 3MSDA 5I78A 4EXBA 1BWVA 2CLPA 4X0VA 3VNYA 1E43A 3LPOA 3H4XA 1HJWA 2P50A 1RHCA 3TYAA 3K46A 1T5AA 2ZBTA 1VR6A 3AIEA 4RUBA 3QGAC 2EKCA 4C6FA 1VPQA 2VEMA 1BAGA 2ICSA 2FJKA 1O94A 4MVAA 3BV4A 3KS6A 3C61A 4BA0A 1PHWA 1V79A 1P1MA 2C19A 1WXZA 1Z8AA 5BRBA 4JX4A 3GIQA 3V1PA 1LL6A 4FB7A 1V0NA 2OOGA 2W5FA 5GJMA 2FZNA 4DJEC 1YXCA 1UZ1A 1GOIA 4QNEA 2J13A 2ZRZA 4L6HA 5FEPA 3SZ8A 1LBLA 3AAMA 1GVEA 3DFQA 4W93A 3E0IA 3CEPA 4MADA 1VFOA 3JR2A 1UZDA 3UR5A 4Q8MA 2ACSA 4FLSA 4B3KA 3SM0A 4BR1A 1LROA 1XISA 2OFJA 1HX0A 5LIKX 2Y7GA 3EOEA 1C9WA 3NPUA 1JYWA 1NOUA 3GFXA 4B5XA 3APYA 1VJSA 1TZZA 4RPPA 3W1PA 3WMLA 4FOJA 5IBXA 3LXCA 5DCDA 4KFPA 1XC6A 3N3TA 4XZWA 5G4WA 1ME9A 4GX9A 2YCKX 1DVJA 3G3MA 1D7KA 3NA8A 3CPUA 1N55A 1MMFA 3TTOA 3A4WA 4GYKA 3H2CA 4Q4QA 3GQYA 3CV2A 4AWTA 1HNYA 4IG2B 1FTXA 2GYIA 2ON3A 1EC9A 4PSPA 3WD4A 2NUWA 3PB0A 4OE7A 3R79A 3IIPA 1NFGA 3UF9A 5ABFB 2VEFA 4KCUA 4O50A 1K7XA 3ZJ6A 2H9AA 1G4SA 1TE6A 2DZSA 3NQ6A 4LF2A 2H90A 3S5NA 1TTPA 2WVVA 3AXKA 1G4EA 2GQ9A 3TXVA 3GKFA 2BV9A 4FR1A 4Q8OA 4HHMA 5DANA 4EF9A 3CO4A 3RJYA 3ARYA 3XIMA 4XG1A 5CSYA 2BXZA 3OBKA 3GXNA 3GH5A 2HNHA 1SJDA 1J2WA 1E0XA 3W83A 2NX3A 3W25A 4K8HA 1UH2A 1NTHA 2I14A 4I3GA 1O5RA 3CYJA 4L64A 1EIBA 1X1NA 3R12A 3VMOA 4JN6A 3EOLA 1S2UA 4HNLA 3U3HA 4F2UA 3NL5A 2GJXA 2YL6A 1G6CA 2ZZ4A 3GW0A 3SN4A 1NELA 1TPFA 4TIMA 5D33A 2V63A 3EDFA 3KTXA 5I09A 4L6DA 1R5YA 2Y0FA 4UBPC 5DQPA 4KGJA 1JZ4A 3SUWA 1PWLA 4J7RA 3AYTA 4XD5A 3PWGA 3S2MA 4PB3A 2VR5A 4ZTYA 4AXNA 3NUKA 1Q45A 3NYDA 3ENLA 2O9TA 3HIJA 4TX9A 2PMQA 3RO8A 4L65A 3GE7A 3R10A 4C6QA 1W3JA 1QWKA 4WOZA 2X2YA 2Y61A 2Y8UA 3GXIA 1OHLA 3PZUA 4LX4A 4MAVA 4JTFA 4LBRA 3QV7A 3WN6A 4LSBA 5DCEA 4FNTA 3QQWA 3TYEA 3DFHA 4XZBA 1EFZA 1R30A 2QCDA 1TRDA 3NQCA 4MNJA 2R1KA 3WLQA 1MQRA 3EWDA 4HNVA 1YTKA 4JY9A 4QCEA 1TPB1 4M8UA 2FVKA 1MW3A 3MPGA 2OZ8A 3W82A 1Q3NA 4ZOEA 1XINA 4XZIA 3BUVA 4JTJA 3UD6A 3AIVA 1SQ7A 3M7SA 4PRTA 4NZJA 1KW1A 2ABBA 2QMJA 3WLLA 4GY0A 5A6JA 1UG6A 3W2JA 5FAGA 2YZ5A 3ARPA 2ZUNA 3TTYA 3UR7A 4Z1YA 1O5QA 4C7DA 2Q3OA 3F4NA 5BMWA 5AC5A 1OK4A 3W02A 1PKNA 1YPXA 2G3FA 3GTFA 1UD6A 5IFPA 4MB4A 5CAKA 2PDFA 3EDKA 5A6LA 2W3ZA 2VENA 3SCWA 5J5RA 4DXKA 5AFDA 1FCBA 4IH3A 1RP8A 1XH2A 5DXXA 2E25A 4N4PA 1QHPA 1F4HA 2BGNE 5ABEA 3LY0A 3TSDA 3DFYA 2B0MA 4WRHA 1J6OA 3VPLA 5D37A 3PN8A 5D9OA 2CZVA 4JL2A 3O06A 1XHGA 3UZJA 4C5ZA 4PMQA 3LD5A 1K6WA 3P81A 4UUIA 3UT0A 3FOKA 1EJSC 1X6NA 1F6KA 4GIAA 5A2AA 3ZSSA 2OKTA 3IAQA 3C86A 2Q6ZA 3WBYA 1KR0A 3BPWA 4H9YA 2Y5EA 3LM3A 3K8LA 2CLFA 1EPXA 4H01A 3PTMA 5AVHA 2E67A 1GVOA 1OF8A 3UZXA 5MKGA 4JHZA 3W87A 3AXMA 2NVDA 3QN3A 4KERA 3WL1A 3FSTA 5F2MA 3Q67A 3M43A 5ENLA 3FSUA 1XS2A 1TV7A 1TPVA 3TN5A 2YXGA 5A8MA 1H2JA 2ZIDA 4LY8A 3CU2A 5AKQA 3LMZA 2VQTA 3VOGA 3PZTA 2EO7A 1E73M 4PBEA 1KGWA 4LXFA 4LOCA 3EBVA 1XLCA 4ZO7A 1A5SA 3H2MA 4FO4A 2R8WA 1KLZA 1DIOA 4ML9A 2WHJA 3WDQA 4IMEA 3MKCA 1G94A 3CIWA 4S2CA 5L9FA 4HU4A 4J3WA 1QNPA 3PS7A 2HVOA 3CH9A 2OEMA 2HXUA 3GU1A 5K2ZA 3U4FA 2HQAA 1Q7QA 4O11A 3UJRA 1C92A 2O92A 4XUGA 3W1MA 3WNPA 3INPA 1QW8A 3AMGA 2XZ9A 2XN2A 4G8TA 1KGUA 1M1BA 3Q45A 3NL2A 3B8VA 1PSCA 1KTBA 1HJXA 1ME7A 4JTEA 2FZDA 3UA4A 1X7IA 3DBPA 2D0HA 3K5XA 2QCLA 4O54A 1EDQA 1H1NA 3WF4A 4Q22A 1SZGA 3B40A 1UWSA 4NKCA 4JDYA 2YW3A 4YNGA 3FJ4A 8CGTA 3WEZA 1Y8BA 3UVIA 1B3WA 1MEWA 2G8ZA 1W9DM 1QW9A 5A6BD 4MYXA 3VX0A 3KVKA 3W1TA 3SUUA 3GW3A 4GGHA 4BKNA 3W37A 1A5NC 5EBUA 3WSUA 2ZX9A 2OWWA 1PIGA 2QF8A 3SQSA 1JGMA 1OFPA 2AKZA 3DFNA 2H8XA 2WM1A 4Q7IA 1FKWA 3AHXA 4JIQA 1DXFA 3THQA 5I3HA 1GYNA 4BQ5A 5HWNA 1TR1A 1GVIA 3BICA 4X60A 1WYIA 3SRFA 3IWPA 1XYZA 3CV7A 1K70A 1IHIA 3D46A 1EXPA 1KXTA 3B4UA 3E49A 4UWMA 3E02A 1XLDA 4RKAA 2FDSA 5FJJA 3NL6A 4LYRA 1F07A 2FFIA 2IXUA 3LTSA 2Z00A 3DFOA 1PEZA 1Z89A 1AW2A 5C6MA 2GQAA 1C9DA 1RJQA 5LNRA 2WBGA 2VEIA 4GQQA 4K8GA 2WB5A 1V08A 4WOQA 8TIMA 4MPQA 3GIPA 4F79A 4MJMA 4JOMA 1K4GA 4F40A 2HK0A 1BF6A 2X7VA 4NZ5A 4NJJA 3TTSA 3UWVA 1I60A 2R1LA 4CUCA 4LUSB 4MIMA 3SFWA 3DI0A 3RITA 1E4MM 2R82A 4S38A 2RKXA 1XQLA 4I6KA 2VFEA 2Z28A 2I1OA 1ONWA 3UJFA 3RLUA 5D9PA 1ZALA 5FOOA 1TWIA 4UNKA 2QGHA 3T9PA 1O95A 4J35A 4Z17A 3PBVA 1YBQA 1TV2A 5G2WA 1JUBA 4RW3A 5HA7A 3KBMA 1FA2A 1CEOA 3TQ0A 3MMTA 3KW3A 5HUOA 1XLFA 5BXTA 4C6NA 4AYGA 4M82A 2C1IA 4IX0A 4MFDA 1QOPA 3I6EA 2O55A 5KZDA 3RFAA 4QJ4B 3C8FA 1TJPA 1XPGA 3GB6A 2IPWA 3THCA 3P8JA 1HF6A 8XIMA 2ZRYA 4IUGA 5BRPA 1P6WA 5DN1A 2C7FA 4HT3A 1HKJA 4B90A 3WX7A 2HMCA 1GOMA 5EBAA 4MY9A 4W84A 2WSRA 3F5JA 2D20A 2BB0A 1Y7VA 1E0UA 1QK0A 2VX7A 4CCEA 5XIAA 4YMZA 1HVQA 1KFCA 3W1LA 2J24A 4A6GA 3V18A 3QR3A 3MKVA 1FWSA 2CZDA 2D0GA 3O05A 4UTTA 3NQEA 1FWDC 3G1XA 1QFEA 3RMEA 3LBOA 1XUZA 3OIHA 1BXNA 1R3TA 4O4VA 3AS1A 4IFRA 3A3HA 2IMRA 1S5TA 2D3NA 4TTUA 4LC8A 4R88A 2V2DA 4OFCA 4X2RA 4CEXC 4AISA 4PFMA 4NAEB 3VX1A 1OM0A 1VBJA 1FHVA 3CMFA 2ZICA 3CGTA 4KW2A 4GJIA 3W7GA 3CUFA 2PLMA 4GY1A 3MO4A 3OVRA 1Q6DA 2WQPA 1XRSA 1LWHA 1RK6A 1E6RA 4YVVA 1XKJA 2PWVA 2C91A 2QV5A 3NGFA 3A4XA 2E77A 3CWNA 2ZX7A 1JIBA 3AZSA 2GQ3A 1VFHA 4N6FA 4HSOA 2AQOA 2PU1A 4E8DA 2I5IA 3H24A 3WFZA 1C8VA 1D3HA 2PWUA 5AY7A 3ZSTA 2RDTA 2HPMA 1PXGA 4Q4PA 1X98A 4OOZA 3RIKA 3GH4A 3PAOA 1DIDA 1S2VA 3KOZA 3WQ8A 4RXFA 1OGBA 5MKGB 2CIPA 3N4AA 1SMAA 2BGQA 3W1XA 1YEYA 4YU1A 1B3XA 2XIJA 4PUKA 2PP3A 4Z1BA 4QQ3A 2Z1WA 3N18A 2ZUWA 4EPBC 1RH9A 4OWGA 2D73A 3K2GA 2EEXA 3M0XA 4W5UA 2XGIA 1I0BA 3G18A 1R9XA 3RR4A 1JQVA 4MLRA 1W3LA 1MEHA 4GUJA 1KO0A 1E6QM 4OU1A 1ZLPA 1VFTA 3N34A 6A3HA 3GR8A 1MZHA 1YKWA 5LZLA 4OZOA 1CI1A 3PANA 4ZQOA 2R24A 5FD0A 5XINA 1DWAM 3EA1A 2BODX 2EG7A 4YYFA 1CIUA 2HROA 2ACRA 1ONEA 2PSNA 3BCFA 4JFTA 4GI6A 3VNMA 1G69A 2PDWA 3WF1A 2DIEA 3CBWA 1DPMA 1TVLA 1N7KA 2QF7A 3WLHA 1VYSX 4PN2A 1CXHA 5C9WA 1IWBA 4HNNA 3IS4A 1VGAA 3NZGA 4AF0B 1OFBA 1FDJA 4ACZA 5CPMA 4US6A 1GEQA 3FLUA 3GTXA 4QS6A 1GKQA 3T40A 1V3IA 3BDKA 2CLHA 4C1KA 3IUDA 2JIEA 1UD2A 3GDTA 3P60A 4EK7A 1F3XA 1E3ZA 3G1FA 7ENLA 5TAOA 2PC4A 3LMYA 2OQYA 4K6AA 4PMYA 3BG3A 3TJLA 3T05A 3PPCA 5DMNA 4OECA 3Q2DA 3NJ3A 1S3TC 2Q09A 1US3A 1FX6A 4CN1A 3AI0A 3WLPA 2NUXA 2DGAA 2JEPA 4OBRA 4XBKA 2BY3A 3ITCA 4OKDA 3LCGA 1FBAA 3POHA 4UCFA 2VXNA 2EKGA 4IF2A 1WZKA 4DYJA 1XSJA 4GJJA 3VIKA 4HYWA 3A4JA 4DZAA 2E9MA 4M51A 4UQEA 1DJGA 2NQZA 3HGOA 5AYZA 2WCAA 5A1AA 3WLOA 1H1ZA 1V02E 1XC4A 5LSMA 1EB3A 5IXEA 2WVVB 4PUNA 2UY5A 3DENA 4IP7A 3LYEA 5KMYA 2O9PA 1TJ2A 2WHLA 3TJXA 1RP9A 4S1FA 2X41A 2ZWZA 3UZ5A 2B31A 3QQ0A 4KWOA 5D04C 3RJXA 1UZ4A 1TX2A 3I3BA 3ZR4A 1HKMA 4K39A 4H9XA 2V82A 1JQXA 2WVUA 3RHGA 2F38A 1V0LA 5H8UA 4PTNA 4B4HA 4F9JA 1OX4A 1K03A 3P0WA 3GHUA 1V6VA 3O63A 2ANUA 3G0SA 2AAAA 4UTKA 2AL2A 1A4LA 2CLKA 5DF0A 3WELA 2E28A 2XPKA 3RCYA 3PG8A 3EWCA 2DT0A 3P2VA 4BY3A 3KHJA 4IG2A 4HOXA 1KRAC 5CJMA 2BS9A 1E0WA 4NJHA 1UJPA 3N4EA 3GLCA 3VC6A 3SUVA 2OZ3A 3QFWA 1UR3M 4HB7A 2NX9A 2X09A 4I9TA 4HNOA 3HQNA 1TVNA 2XVPA 3NYZA 3WJSA 4JNYA 2ZX8A 1EJWC 1K8CA 4IPNB 1E4NA 2XZ7A 3OPSA 4UQCA 3IAPA 4Y7EA 3VGHA 4HMNA 3IVUA 2OEKA 4CN4A 3EA2A 3ABZA 3BJFA 2A3HA 3GDBA 3WD0A 4GQ0A 1P0DA 2DUXA 3ITXA 2VX6A 1HZYA 2GZXA 3ZLGA 1V5XA 2I7GA 2WMJA 5KTLA 1XGDA 4F0LA 1J93A 1BWLA 4IQLA 1EX5A 4J27A 1ISWA 4YHGA 2VDIA 1MXGA 3TCSA 1MUCA 2FGZA 1P7TA 2CHOA 2WC7A 3WJWA 1H4PA 1I8JA 1MRQA 3VNJA 5B7YA 3H7UA 4TR9A 2ZXAA 1A3WA 1M01A 2O4QA 3V75A 3T08A 5CZSA 2VD8A 1TX0A 1GG1A 1UQZA 3G1RA 5LA2A 3DKLA 3UWZA 4ZSUA 4LUTB 4DXVA 3DC0A 3SCUA 4L4PA 2PDNA 4QJ1A 1GZJA 4S3CA 3NXLA 1QATA 5CPTA 1H51A 2OVLA 1SM9A 4G1KA 2BMBA 4DRSA 1A53A 4FOKA 5D05A 3M0JA 1KM3A 1UBSA 4ASTA 3PB2A 4RZ6A 3WF2A 1W1YA 4UTJA 2WZIA 3TP4A 1Z69A 3IRDA 4TU1A 1PO9A 1FWCC 4X3ZA 4GWEA 4CQ8A 4GIRA 1YXDA 1NF7A 4I7VA 1E3XA 1LLZA 2QPXA 4O15A 4RV3A 3V4BA 3J7HA 4WJ8A 4IIGA 3SUSA 4JNMA 1OYCA 4GBUA 5JMUA 4F8XA 4Z1DA 4EVZA 3N2CA 1JG9A 1KM2A 1W5OA 4HD5A 3QSTA 4FI4A 1VQTA 1ITCA 4NYYA 1PHQA 2WMIB 1XIHA 3U6WA 1LWJA 1MW1A 3GFZA 4FPSA 3M07A 2DDXA 5A8NA 4NX0A 3TW7A 3RN6A 2QS8A 1J0KA 1ME8A 4XZHA 3PULA 3O0KA 1KTCA 1XR2A 5I23A 2FHFA 3LTYA 2INFA 5CLTA 1CB2A 2R14A 1E9LA 3E38A 4H9UA 1XUUA 2QPUA 3STEA 2ZFAA 2RH9A 3QHNA 2ALDA 4QE4A 2CERA 4DB7A 3KOWA 3LHZA 1FCUA 1H41A 2VM8A 4WGXA 2WMIA 1TVPA 3LI1A 4GGBA 3QHMA 4L80A 4LS0A 3BQ6A 3R0UA 1L9WA 3W7OA 5EFFA 1BWKA 2ISSA 5A8GA 5DEZA 4WIWA 4GXWA 3LSBA 3VDHA 1RSCA 1K8YA 1UR1A 3C2VA 1CXKA 3ES8A 3NSXA 3RYSA 3BARA 4GNKB 2ALRA 1E1CA 3AMDA 3F4DA 2C18A 1LQ2A 3HGSA 2TPSA 3QTGA 3IGHX 1AL8A 3IANA 3ARXA 4K36A 2WMKA 3UG5A 3C2RA 1T40A 1Q6GA 2WZTA 3VOIA 2FYMA 4QLJA 1W5MA 4R7JA 2XN0A 4HTBA 3S5SA 3VDBA 5C9RA 2GPTA 2XH2A 4GVHA 2YFOA 4LYQA 4PR4A 1V0KA 1DJIA 2EHHA 1SFLA 3V0UA 1B2YA 1KBKA 4UTUA 3KFTA 2CESA 4IP4A 2WC3A 5BOFA 4MYAA 1XLJA 3WUGA 4DN1A 3AO0A 8RUCA 4Y9AA 2AMXA 1KQYA 3CZKA 2FTWA 3W4RA 2RDWA 1BXCA 3IJLA 1OZQA 2DORA 2G3IA 4FLOA 3IJIA 3CZGA 4RE3A 1HQTA 1T8QA 4FNUA 1Z9AA 1YDVA 3EMQA 5LIUX 1P43A 5CJNA 2XFYA 3PVFA 1EGMA 2Z29A 1JCYA 2NQ5A 1NP2A 1TB3A 1OC6A 2Y89A 3VZZA 2P8BA 1W2PA 3N2MA 3PUEA 4HYRA 3AIRA 2NXHA 2ZXBA 1I1XA 4DJDC 4ZENA 3P84A 1R6WA 1W5QA 3AQUA 4FS9A 1ELSA 3ALGA 1XLGA 2PDYA 4HZMA 3L4XA 4DF1A 2I9EA 3MTWA 3VIFA 4CQAA 4ZFMA 3N15A 1NWTA 4A4AA 2VRQA 1P0KA 1FWEC 4D8LA 1IZCA 1H09A 4O1EA 3PBUA 4PTWA 3UVAA 4NSBA 3ZZ1A 2QUVA 4AZCB 4W87A 4WKFA 2DUZA 2R94A 2VGIA 1D3CA 4BQ4A 2DZBA 1AA1B 4GPNA 1P0NA 5FIPA 1WKFA 4CQ9A 1E71M 3H26A 1W9UA 5DLCA 3TVAA 3B9DA 1BF2A 3LV5A 4HTYA 3WQFA 4M1RA 3S1GA 2UWFA 2YIHA 1OCQA 2O56A 3BAYA 4H8VA 3CZEA 3DG7A 2X05A 1EYWA 3VM7A 2W63A 3WF0A 3OEXA 5M1TA 3IVSA 2ONEA 2V8ZA 3VKCA 2XG9A 3OO2A 3VIGA 9CGTA 2VC6A 1EZWA 4MJ4A 1XXXA 2YA2A 3PG9A 4UMBA 2NX1A 4P8VA 4CN6A 1PVNA 4E8CA 5I24A 4J3XA 4K1GA 3B4YA 4H41A 4LC6A 5G5IA 1RBOB 4IP5A 4F66A 4P8XA 5I3DA 4Y8EA 3PTQA 3K1DA 3QY7A 4PEKA 2WOQA 3N25A 3R25A 2Y4SA 1SPQA 4HIBA 1RUSA 1V3MA 4KRUA 3BAXA 3WJXA 3CH0A 3PNUA 2GWGA 4ZBCA 3JW7A 3GNXA 3NQAA 3CHDA 3G22A 4L5ZA 2J66A 3GWQA 4W4QA 1L6SA 3M9YA 3IEBA 2VOMA 1VCVA 2W4XA 2JBMA 3NWRA 4C91A 3OGSA 1QO5A 2YL9A 1R2SA 3W7NA 4PMNA 2CWNA 4XKYB 3M5YA 3CT7A 1GVFA 3WJYA 2VZVA 4NZ4A 1PPIA 5CLWA 3FFSA 5TIMA 5C7VA 4JFSA 4BCEA 3U48A 5HNRA 4DI8A 3GG0A 3K4AA 5I7GA 4Q4SA 3W2KA 1Q6LA 2GGGA 3PJXA 4XVEA 2GJNA 2ZZ7A 2A2IA 1RZMA 5F1UA 3H8AA 2OSYA 2QULA 3SEPA 2GDQA 2WMHA 3SCSA 5IOBA 3QV9A 4MWAE 3TSMA 3SN0A 1N82A 3HV9A 3IJ8A 3R8HA 3S6TA 3GG8A 4HHHA 4PMJA 2XSAA 3UXAA 1TPDA 4ZB2A 2XVLA 5G4EA 1AH0A 2QDGA 2QUNA 3G8EA 4NRSA 2Y6ZA 1CW2A 5EGRA 2WV8A 3B8DA 3A12A 4IUOA 3KDOA 1TTJA 1BYCA 3DHPA 3M1ZA 4IISA 3KEHA 2ASHA 4M19A 1S1PA 5HMFA 2XSBA 4CD8A 4J28A 3DERA 4DHGA 2CU0A 3W7RA 4ADUA 1JZ6A 1ISVA 1W3TA 1AZ2A 3B0YA 4RJEA 4GYJA 3BJSA 4LPCA 3TJ4A 2E0PA 2J47A 2JKPA 1E51A 3ZO9A 2GDVA 4XX6A 4DJED 4LYKA 5CZJA 2DZWA 1Q7MA 3B05A 3GUGA 4JD4A 2BSLA 5HQEA 2E3ZA 1FCVA 2WAGA 4NZCA 4BF9A 2QDDA 1HN1A 1JPMA 5F2LA 3CUHA 1OT2A 4O14A 5AB3A 1WXJA 2P0IA 4DPPA 1A0DA 3M6DA 5FJUA 1S2CA 3HG5A 2D2GA 2P0OA 4RDYA 2PD5A 3DFPA 3LRKA 3FHQA 3UG8A 1LDCA 3UCQA 1X6UA 3QBUA 3S9ZA 3GIYA 3RDKA 1YNQA 1CGVA 3LNPA 3GG7A 1ISXA 1R38A 2Z1KA 3D47A 1KR1A 4AAJA 1NP0A 1ZY9A 4R85A 2WVSA 4ERIA 5K4XA 2G3NA 5I77A 1EHAA 6TAAA 2ZYFA 1H60A 3DUGA 3VD4A 2PDKA 3BXWA 3ZR6A 4UTLA 1EP3A 1K8ZA 1FCQA 1SSDA 4ZODA 4BI5A 1J5SA 3AJ7A 2D69A 4Q6JA 3WQGA 1QBBA 1QRQA 2X1RA 3EGJA 4F2TA 1Q85A 4DQWA 2YXOA 3O7UA 2G5WA 3PWIA 4LS2A 4OVXA 4PUMA 2QPSA 4HPJA 4KEUA 1WBJA 3DEQA 2F84A 3UNTA 3H55A 1J0IA 3QEZA 5HJYA 4GNVA 4KEVA 3KBNA 1DJNA 1JYNA 5CBBA 3UQNA 3WLJA 5G1MA 1M5WA 2AQWA 3CWOX 4S3EA 2F61A 3LHVA 1JR1A 3SSJA 1ZHAA 2GJRA 1SJAA 1V02A 3T09A 4Y9MA 3L2MA 3TEVA 2ATMA 2I5QA 1KM6A 3IVTA 3PUGA 5EY5A 2Z2UA 1QNRA 3MBFA 4MY1A 1DKWA 1FP8A 1Z7AA 1KM0A 3P62A 4J2MA 4DIAA 3LHWA 2XVGA 3BLPX 4TTGA 5DO8A 3L4ZA 1M6JA 2OT0A 1XDMA 4E2OA 4E2VA 1Y5WA 3PZGA 4PB5A 1R46A 3RRXA 3M0VA 4H9ZA 4XSLA 4PTXA 2EPKX 4W8LA 4H8UA 3KWSA 4ZQNA 7XIMA 1XKYA 4PZVA 1DIKA 1F76A 2E6YA 5IFTA 3N6QA 3MB9A 3GY1A 3N9KA 4JQ4A 2XWEA 7PTDA 5K4ZA 4K2SA 3RX2A 3LLXA 4PUEA 1QO2A 4MGGA 1QPOA 2QR6A 1EOMA 5JVLA 3BWWA 2HPIA 2W79A 2F6KA