3NQDA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
b'VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqdA00
3EKZA 3PUOA 3LLDA 3NR0A 4Z08A 3EWUA 1ALDA 1W1ZA 1SR9A 3SZ8A 3TNOA 2NXHA 4KFNA 2X1UA 3M44A 1JR1A 5LNRA 4ML9A 2JKEA 3V1PA 2GQ8A 4XWUA 3W1NA 4IX0A 2EAWA 3HGOA 1UCWA 2P1FA 3PWAA 4MY1A 4FXRA 2V2CA 4CCEA 4O10A 3NQFA 3WK3A 3EX4A 3W2KA 4K39A 4JTHA 3RU6A 2R94A 1ICQA 1D9EA 3QSRA 1O95A 2Q3OA 3W1UA 3T78A 3NQGA 1TV5A 3W85A 5DY2A 2TSYA 2V30A 1RZMA 2YFOA 1PHWA 4QJ1A 4DPQA 1DOSA 1ZFJA 4Z1BA 2DZXA 2ZZ7A 1LZOA 3CB8A 2FTPA 3TXVA 3FFSA 1SZEA 3BW4A 3H55A 3LHWA 5AC7A 4IXHA 3QW4B 3THQA 2WPBA 3LHVA 2QEZA 4JNMA 2E09A 1KLYA 4FNTA 1HO1A 1M6JA 2ZYFA 3W70A 5KMYA 2ZA2A 4IMEA 1TTPA 1G4EA 1YXDA 2AQWA 3W7LA 5J5DA 3CU2A 3UXAA 3QM3A 2DZVA 1SW0A 4PFMA 4Y6GA 3UY8A 3O63A 2ZZ4A 5F4WA 1PV8A 2ISWA 5G2HA 3GXNA 1TYGA 4OQVA 1FQ0A 2ZRVA 4IMCA 4IJBA 4QSHA 2XFWA 4FIQA 3LXCA 1OHLA 3PM6A 2ZFAA 4DF0A 3M0ZA 5D09A 1Q6LA 5HQEA 2ZZ2A 3FJ6A 3QSTA 5BMXA 2VELA 3A5VA 1KLZA 4Z0JA 3SIZA 4BR1A 1F73A 1TCDA 2X1TA 4QNWA 3GR7A 3E96A 4LW7A 5CKSA 3TSBA 4Q33A 2BZNA 2Z6IA 5U4NA 3G8RA 1VCGA 4AF0B 1YLVA 1M7OA 4GWEA 2C19A 2NX1A 3LCIA 1A5AA 1AK5A 2CLKA 1ZENA 3EWZA 4LWWA 4NZFA 2G97A 2WJZA 5AHEA 5I3HA 4UTWA 4FX7A 1QPNA 1FXQA 4MZ8A 3M7WA 1XI3A 1TPEA 1YPIA 2E1DA 2YX0A 4MKNA 5KZEA 1IXQA 4PEKA 3PSVA 1HL2A 4MY8A 3M41A 2B4GA 2BLEA 2CLIA 4LV4A 3W7HA 4JYEA 1KBIA 3IIOA 5U7SA 1KBJA 2X1RA 3O8AA 2X30A 3M5XA 3G1AA 4UNKA 3VE9A 5J5RA 3TAOA 2NWSA 5D37A 2O7SA 1GOXA 4MFDA 3LXBA 2A6LA 2VFHA 3IIZA 1EIXA 5MHBA 3R13A 2QR6A 1FDYA 3MHUA 1OK4A 5C55A 1W5PA 3F4WA 3SFKA 1X8FA 2GPTA 2WO5A 4IXXA 3NL5A 4O0ZA 4ZL1A 5L6UA 3GKAA 3ZWTA 1OK6A 2Y70A 3NL3A 3S6DA 4Z0SA 4NXSA 5G2WA 1KM2A 2ZRXA 4BWLA 4UTWC 1KFEA 3KRZA 3WK0A 1O5KA 2IQTA 4DEFA 3NQAA 3L2IA 2P0OA 1NVMA 2Y88A 4NNCA 3RMJA 2VFGA 4MZYA 1XDLA 4EWND 1CI1A 3EX1A 2I1OA 4NT0A 4IGHA 2RDTA 1W5NA 4JY9A 4FX6M 4CNPA 2HS8A 1NEYA 4N6FA 3GDTA 1FDJA 2Y89A 1OF8A 3TUUA 2E6AA 3BV4A 2C0AA 3C56A 4X22A 3PBUA 4HNUA 3UWQA 5G1TA 4M6VA 4RK8A 4RXFA 3LOTA 3H53A 4ICNA 1FUYA 3D0CA 4L4LA 3OA3A 1TV7A 3CWOX 5D03A 5K4XA 4YWIA 3GNDA 2EKCA 1JQVA 2QDHA 3QMRA 3QYQA 1R47A 3S42A 5HULA 4DBEA 2TYSA 3NYZA 2Y62A 1P0KA 4UIOA 1X7FA 3B0UX 3IVUA 2CLFA 2V8ZA 1H7XA 1O5XA 3S1VA 1OG0A 3A23A 4KWVA 3E02A 4DF1A 4HNVA 3M5VA 1G7UA 1XDMA 4CCCA 3BGJA 2J27A 1Z44A 2OX1A 1K3UA 3EXSA 5I3GA 2H90A 3EWXA 1XUZA 4DPPA 1O60A 3C8FA 2A7PA 4YL2A 1TSIA 3LTSA 2QUTA 3UZJA 4JTJA 1ZNNA 3SY5A 1TRIA 5FEPA 1GYLA 3M43A 3O05A 3DFOA 2FPVA 3TW7A 1CX9A 1LBFA 5DXXA 1W37A 1EB3A 2I9EA 4JXCA 1JULA 3N3MA 1Q6OA 4K6AA 5K9CA 1YXCA 3HPZA 2HSAA 3GB6A 1H7RA 4UCGA 5FESA 5SWUA 1C8VA 2DZPA 3WJZA 2E68A 4CCDA 3LRLA 4HT3A 4IWWA 2NUWA 2A7RA 2E6FA 5TBOA 2FJKA 3T55A 3SGUA 3WJYA 1QFEA 3W2NA 3MW7A 3NPVA 3R8RA 4TR9A 4JTEA 2RDUA 4AHQA 3FA5A 3LHYA 2YPIA 3EX3A 4P61A 2WSYA 1TV8A 2E5CA 1SO3A 3M5ZA 3QQ0A 3JS3A 3ABOA 1T0OA 1GVFA 3EXTA 3W7IA 1TREA 1TTIA 3LRKA 3W74A 3PB2A 1D3HA 1B4KA 3P67A 4AHOA 5LHFA 2QCLA 2VFEA 3LV6A 4M7TA 2GJLA 3INPA 3SECA 3W1LA 2ZTJA 3Q2DA 3WFAA 4JTGA 3IIVA 1LRNA 1FX6A 1Z41A 2GQ9A 3G1FA 2DZTA 3W3OA 1PS9A 2OCZA 3LDVA 5D2YA 5EYWA 4NXKA 5D2XA 3IVTA 4N2YA 1GZGA 1J2WA 1LP6A 3P61A 1FWRA 4FIRA 1KM6A 3OIXA 5HINA 3DHDA 3P74A 3CHVA 2GQAA 5HWNA 1JCYA 1YTKA 1DHPA 5K7JA 2JKAA 3G1YA 3HGRA 3NM1A 1VHCA 1IIHA 3W7GA 3EWYA 1I8JA 1QDSA 3PB0A 5CPMA 4JDBA 4O1BA 1GG1A 1W5OA 1X1OA 2NWRA 2ZBTA 4NVTA 3W76A 1WYIA 1XL9A 3BO9A 3SSJA 4NJHA 1EEPA 1L6SA 2CZ5A 2G95A 4CNNA 5CPNA 4WD0A 4CQ8A 4A2SA 1KFJA 4A2RA 2GVLA 1DORA 4I7UA 1TIMA 3DFQA 3I68A 1VLWA 3NL6A 1SW3A 3DH7A 3W86A 1B4EA 1SU5A 1VPXA 4FNQA 4FF7A 1VS1A 4JTFA 3B04A 3FYOA 1DBTA 2XN1A 1FY6A 3NGJA 2QAFA 4UC5A 4G1KA 4QAIA 2Y85A 3MBFA 4BI6A 3BVJA 1ZCOA 5IBXC 3CEPA 5KINA 3O6YX 4JY8A 3A24A 5EY5A 4MPQA 3HG4A 1X1ZA 2C3ZA 4B5NA 4GXMA 1W56A 2YFNA 1VYRA 2PRMA 4GC4A 4AWUA 2OT1A 2RHGA 2V2DA 3P62A 3IRDA 1I2PA 4YXGA 1LDCA 2VEMA 1GQNA 1YDNA 1QWGA 4WX2A 5FI8A 4XTDA 1F74A 2QCGA 4GUGA 4Y96A 4I7WA 4EOUA 2I14A 2NXGA 1BKSA 1MXSA 1W31A 1H50A 1K03A 3LCHA 3RLVA 3TX9A 4QQ3A 2WNZA 1XC4A 2NUYA 3QMTA 2G96A 1RVGA 4LU0A 1OYAA 1ZY9A 2ZZ1A 3G22A 3QW3A 3RNDA 5AC6A 1OFBA 1W8SA 3TXZA 3DAQA 2CLOA 5BW6A 2D73A 4OHQA 3QQ1A 4OWGA 4IPJA 5CSRA 3LCLA 1J4EA 4K36A 3M16A 4WQ6A 1YXYA 1JCLA 4R53A 1QR7A 5CGQA 1JJKA 5F2GA 1THFD 4JGDA 2ZA3A 4O4WA 4CNOA 4UTJA 2R91A 4P2VA 3W7NA 4IUOA 1XUUA 5F1UA 1KM4A 1J5TA 4GUJA 1QO2A 1GVOA 2J24A 3S0CA 4N4QA 2ZZ3A 4NNBA 5KSWA 3DBPA 4JIQA 3O6DA 2AGKA 4O54A 1XXXA 4A3UA 4PL2A 1GVQA 2OMAA 4UXDA 3EEGA 1TMHA 5G4EA 3KVJA 4FX8A 2WV8A 4RJEA 3PBYA 3FS2A 3IGXA 3GAKA 4C1LA 5IM51 4LS2A 3W7QA 4BK9A 5LSMA 3AJXA 3MUXA 3A21A 1EUAA 2VFFA 4FB7A 1B3OA 3LB0A 3G0UA 2QCDB 2C15A 3WJWA 3MP3A 4QM1A 4EIVA 1I45A 1IXOA 1K8XA 1SO5A 1FCQA 1HUVA 3S9YA 1TPDA 3CQ0A 1W3IA 5LZLA 1KM3A 2WOQA 3I7RA 1ZAIA 3TR2A 1VGAA 1WXJA 1OFQA 3CTLA 2TMDA 1OABA 4LC8A 4O57A 3P8IA 3QF0A 3RK8A 2DORA 5DCEA 5CZTA 1PCKA 1G67A 2ATSA 2HMCA 1SQ7A 3P82A 1DL3A 2LLEA 4ORIA 1W3NA 4MLRA 4NZJA 2X1SA 3LI0A 3PSWA 1EWDA 1XFBA 1JVNA 3VE7A 2E6DA 4DBDA 3E9AA 1KTNA 1OVDA 4ADTA 3W83A 3ANYA 4M7SA 2B7OA 2CZDA 4O1DA 2V5LA 2HTMA 3TMQA 3PBVA 1MEHA 3IVSA 5DY3A 3N19B 1UUMA 3DZ1A 3NQ8A 1OFAA 4RR4A 2ZRWA 2QCDA 1L6YA 1F6KA 5ABTA 3MYPA 1EP2A 4O17A 1K02A 1L6WA 3TKFA 4ADUA 1H1YA 1FXPA 3LI1A 1KFBA 2NV2A 1XBYA 3KAOA 1QCWA 3CEUA 3VNDA 5LGXA 1GG0A 2EF9A 4GE8A 2A1YA 5D38A 1YDOA 1OFOA 4MY9A 3LGEA 3DKJA 1E51A 4O1AA 2VXNA 3QPYA 1TPVA 4C1KA 1WV2A 4I9AA 2WSQA 4UFJA 1TPC1 2VEKA 4MIMA 3W2JA 3W7PA 3BGGA 1WA3A 2JGYA 4GUFA 4RV8A 5BNKA 4OE7A 1S3HA 4A22A 1PCWA 4HIBA 2WNQA 4TMBA 5G5IA 3G1XA 3TC7A 1TPUA 3U8GA 1IGSA 4RX0A 3PS7A 4JTIA 2NUXA 4K8EA 5DCDA 2H3DA 1GVSA 4GJ1A 1NAL1 1QOQA 3W22A 3USBA 3LCXA 4TO8A 1TQJA 4O18A 4NX0A 1FCVA 4UTTA 4XKYA 3TQVA 1CW2A 1XBZA 1ME8A 2ZRUA 5HWJA 2J9ZA 3SJ3A 3L0KA 3KVMA 4E38A 2DZWA 2VEPA 3MJYA 2FLIA 3TFCA 1PL9A 3BLIA 4TIMA 2A21A 1TPH1 1S5TA 2JK2A 3NOEA 4JS3A 4FNRA 3P5YA 1LRQA 3HMJG 1YPFA 3O1NA 2QCNA 6TIMA 3T7VA 4TMCA 3GR8A 1SO4A 2QJGA 1VRDA 4LT9A 4BFAA 5G1YA 4TX9A 1QAPA 3UPBA 3WJXA 1KM0A 1QPQA 4PL1A 3UD6A 1PHQA 4ZZ9A 3E49A 1RQBA 3GDLA 3ATZA 3QMSA 4R7JA 3S5NA 4JYDA 4LOCA 2FPTA 4XBKA 1XBXA 2ZA1A 3UWYA 2ZQ0A 3KXQA 4RCXA 4AHPA 4NUWA 3G0SA 1PE1A 1TJRA 1JRCA 3BG3A 3TE9A 3PVFA 5BRBA 1IIGA 4X3ZA 5AB3A 4WXYA 4LRSA 3MP5A 5A5WA 5AHIA 1GJPA 2FDSA 3MWAA 4W9TA 1O94A 5LGZA 3LHUA 1I2RA 3HPXA 4CQ9A 3N73A 3STEA 2V2HA 1V7YA 3CC1A 3IGUA 5HMSA 1AL7A 3ABRA 3C3NA 4WY0F 2GOUA 3GK0A 2G5WA 5DBTA 1OFRA 4BWLC 2YCEA 2CLEA 4O4VA 1Y0EA 3NQEA 5CZJA 1FWSA 2ISSA 2J6XA 3EX6A 5DN1A 4JTKA 4RKAA 5E93A 4AWSA 5HWMA 1RQEA 3UXDA 3BLFA 3FEMA 1A5BA 4R33A 4UTLA 3W75A 4Q4KA 4CLMA 2F7FA 4N9BA 3FKRA 3W07A 4UUIA 1D3GA 3P60A 1X6UA 3CT7A 1WOAA 3LXAA 4LVFA 4IQLA 4ZVJA 2E77A 2NX3A 5I3FA 1UBSA 2WQPA 3KRSA 2UV8G 1B57A 3N14A 3NQCA 1VYPX 4GFSA 3F4NA 4HNNA 1GWJA 4NJKA 1QMLA 2Y7DA 1LRTA 3PUDA 2W0UA 4GUHA 1H7PA 3CLMA 3L0NA 3W7RA 2C18A 3TIMA 1BWLA 5K9XA 3BARA 2C14A 3I65A 2FB2A 3VFLA 2J88A 1I2OA 3BPWA 1KTBA 4M19A 2DZSA 2NV1A 5DXYA 4NJIA 2QUUA 2Y7EA 1H5YA 3KFTA 3MHGA 4LVBA 1HO4A 3GLCA 2ZDRA 3NQMA 2JBMA 4KFPA 1UASA 1OFEA 2Y63A 2VKZG 2BXVA 1G4TA 3LCWA 1H61A 1M5WA 2E5DA 3W2MA 3BLEA 1FWWA 1TTQA 3KX6A 1R2SA 5CPLA 4HPXA 3BG5A 4FNPA 5EA9A 3BW2A 1G4PA 4UTHA 3R12A 4NX5A 3E0IA 2ISVA 2XN0A 1NSJA 1IF2A 4QISA 3S5YA 2PURA 2OZ0A 1UUOA 3DI1A 3QJAA 1TPWA 2Y7GA 3HGJA 3T40A 4AWTA 2PRHA 4TU1A 3O15A 1TB3A 4XZ9A 3BW3A 1A53A 1GYNA 4LNYA 4O16A 3LERA 1ZAJA 1TPB1 1FWTA 3Q58A 3HBLA 1ICPA 3LHTA 5F2IA 4O14A 3LTPA 4FNUA 1TPFA 4EF9A 4GNJA 4X9SA 1FDZA 1SUXA 5HR6A 4FEZA 4BI5A 4HN4A 3EKLA 3NG3A 3L21A 3W1TA 1PIIA 1GTEA 3PC0A 3PG8A 2ZTKA 3N2XA 4XUGA 4I7VA 3TV8A 4ZQMA 4O53A 5BMWA 4UTIA 6ALDA 3LV5A 4AVFA 5K9DA 3FOKA 1W5MA 2B0MA 5F2MA 1KV5A 2VFDA 3KRUA 3DFTA 3GX9A 3MMTA 1NFBA 1IXPA 3VI2A 4WUIA 3W9ZA 5CG7A 3SW6A 3U2OA 2VOMA 1KV8A 4WOQA 3QZEA 5H2ZA 1BEUA 4FO4A 4K38A 2FB3A 3HG5A 3NZRA 5TIMA 2A6NA 2TRSA 1LLZA 3G24A 1GPWA 5G4WA 2EPHA 4DQWA 1YTDA 4OV9A 1WDWA 3GDKA 1HFBA 3W6YA 1KTCA 1LTDA 3TDFA 2R8WA 4UTKA 5LNVA 1I2QA 3G1VA 1P4CA 2FPYA 5FEWA 2Z0IA 3NQDA 4WJEA 2DP3A 3B8DA 3P5ZA 4N02A 4XTIA 3DXIA 3DGRA 2CFFA 1T99A 3HF3A 3SR7A 1LROA 3QEZA 4PCFA 2YYUA 3NEVA 2QJIA 3PG9A 3LCFA 4XQ6A 1EP3A 3HG3A 3M5YA 5F4XA 4XBSA 4K8HA 3YPIA 2YZRA 5AC8A 4AH7A 3TK7A 3GIYA 4HSOA 1FCBA 1R2TA 4LVAA 5HR7A 3B4UA 3IIPA 3LX9A 1ML1A 4N6EA 2V82A 2H8ZA 3HIJA 1EWEA 3FIGA 3F03K 3C61A 4U28A 1F05A 1XKYA 4E2BA 3CWNA 2R14A 4RLIA 3MI2A 3LHZA 3IEBA 1JCJA 1EX5A 5GVJA 1RV8A 4ORMA 4JDYA 1I2NA 4GBUA 4R34A 4ZQNA 4Z1AA 1GT8A 4UR7A 4MJMA 2B7NA 3LCGA 5F1VA 1MEWA 3G3MA 3UQNA 1AW1A 4JICA 1VZWA 1LCOA 3NVTA 3A9IA 4Y8FA 2ZZ5A 4ZQOA 1KM1A 1SSGA 4U4MA 2DU2A 4O12A 1ICSA 4O0KA 3NPUA 4UR8A 5CSSA 4JTTA 5F4SA 2OT0A 3EB2A 4N9DA 4RXGA 3FYPA 4JYFA 1W54A 1QO5A 3W73A 3TMLA 1TJPA 3W7OA 1F5ZA 3L68A 1OFDA 1LOSA 4EVZA 4POCA 4Q32A 4UFHA 1KFKA 4MZ1A 4AEOA 5I3IA 1P1XA 2PE4A 3M6YA 7TIMA 1RD5A 1T96A 3NDOA 4WZHA 4ZMGA 1H51A 3W1MA 1ZJIA 4OU1A 3W7DA 1BTMA 5D04C 2QCMA 2RDWA 3DFNA 1WX0A 4O8RA 4ALDA 4O11A 1DJNA 1TTJA 2E5BA 3NPWA 1K7XA 1MZHA 1VR6A 3CIWA 5CPOA 2NLIA 1JUKA 3L67A 3MI6A 3TCEA 3ZR4A 4PH6A 1KA9F 4PODA 2NXIA 3L9CA 3W72A 1WOBA 3ZS4A 2B7PA 4JTLA 1H7NA 2BTMA 3L0GA 2DZUA 5I3JA 3NZ1A 1WBJA 2VENA 4DELA 1TQXA 4YLWA 5A8GA 3TU9A 2H8XA 2W79A 4LS0A 3OG3A 1KM5A 1WBHA 5DBUA 4EF8A 4LUIA 2CZFA 4IMDA 5LNUA 3EXRA 3STGA 4MUZA 3EWBX 4DO4A 1AW5A 1UJPA 1G7VA 3C6CA 2NX9A 3LBMA 1VYSX 5I3KA 4LY8A 1G69A 1ONRA 4KKXA 3PR2A 2E6YA 2QDGA 1V5XA 3CM4A 1VCFA 2CLLA 1XCFA 3NXFA 3ATYA 5K3VA 3GKFA 1H7WA 3HB9A 8TIMA 3RF9A 3WJSA 1QOPA 1W3TA 3U6WA 1LLWA 1P5BA 3G18A 3CIXA 3UPWA 1T8XA 4AAJA 4JTUA 3FLUA 4HNTA 1MO0A 3W7KA 1JCXA 3ABSA 3R2GA 4XKYB 4AMAA 4UTUA 1UB3A 4Z1DA 2VFIA 2P10A 1H7OA 3UWZA 3W2UA 3MHFA 4LS1A 2ZRYA 3LLFA 3C2RA 4KWWA 4OT7A 5EMUA 3T44A 3G3DA 3HOJA 4UMBA 3GXPA 1BWKA 4HKPA 5BOOA 4S1FA 3S5OA 3KHJA 3DFSA 5AFDA 1SW7A 1W0MA 1L2UA 4JX6A 4UMCA 3K30A 5EL1A 2YYTA 2YSWA 2RKXA 1ZHAA 5AN7A 4LC6A 3I7QA 4UFKA 5LKYA 1RQHA 4QNEA 3TJLA 4O28A 2H6RA 3TFXA 4O1CA 2B7QA 4BF9A 3C2VA 3AO0A 3MI3A 5C2XA 1OYCA 1S5VA 2BWGA 3S1UA 2KZHA 3IIXA 5D2TA 3NPXA 3GAYA 2Z2UA 3DI0A 3W7EA 1Z48A 4O19A 3F1QA 1DV7A 4AB4A 3E12A 3RLUA 3P81A 3G1SA 3MO7A 2XN2A 3GDMA 1DJQA 1GTHA 5EKYA 5F2LA 2Y7FA 3NA8A 2VEIA 3PUEA 2A2IA 3TSMA 3V75A 4N4PA 4GUIA 4FHAA 1WQ5A 3JR2A 5AHFA 3T4CA 4MJZA 1C29A 2Q3RA 4ZQRA 2QF7A 1NF0A 3C2OA 4A29A 4UMAA 3A5FA 3VKJA 3HO8A 3L65A 3GNNA 4JTSA 3O6CA 2Z6JA 5CZSA 5DLCA 2V9DA 1JCMP 5C5YA 1HG3A 3W7JA 2HS6A 2RH9A 1VQTA 3H54A 2GJNA 1ME9A 4HPJA 5L9FA 2J9YA 3NL2A 2QJHA 2YXGA 3KVLA 5D2VA 2C13A 2W6RA 3P7YA 2PC4A 4MOZA 4E0CA 4GRSA 4ZQPA 3GYEA 4UTTC 3LBCA 4D2JA 1G6CA 4AF0A 3SGZA 1TRDA 2TPSA 3OVPA 3PY2A 1G4SA 4ONVA 2GUUA 3DU0A 3FJLA 4O52A 3B0VC 3QFEA 4HHPA 4HSNA 1AW2A 4FXSA 3TA6A 3G8EA 1VC4A 4NQ1A 1QNVA 4MLJA 3L5AA 1OJXA 3THAA 3M9YA 5D30A 3NNTA 3GVGA 4N9CA 4K37A 3UY7A 3G0XA 3S8HA 1OX5A 2Y61A 1Q6QA 3C2FA 1XM3A 1AL8A 1GVRA 2A4AA 3FKKA 1A5CA 2Z1BA 3N9RA 1JCNA 1LBMA 1VJIA 3B03A 2Q8ZA 3HG2A 3TC6A 2QUVA 1P0NA 1GEQA 2QAPA 4NJGA 2A7NA 5FF7A 1QPOA 3QC3A 2FFCA 5HNRA 3DHFA 2Y6ZA 4OBTA 3W7CA 3ABQA 3TROA 1F2JA 3IGSA 4AXKA 2EHHA 3OBKA 3R89A 4O50A 3CPRA 1W5QA 1ADOA 4JR5A 2CLHA 3MYOA 3RFAA 4L4MA 1R46A 5HUPA 3OHIA 1KFLA 3O16A 3OEXA 3S1XA 4IX2A 1FWNA 2OJPA 2X16A 3W1PA 1SFLA 4H3DA 2WSRA 3QPZA 2BSLA 3L5LA 1OX4B 2QCEA 3NO5A 5AHNA 1A50A 2J9XA 5EBUA 4JX4A 5KITA 5FF4A 3UNDA 5D05A 1SZGA 2ZCGA 3HPSA 3DFPA 4H6KA 3R5EA 1RR2A 3PBWA 1ZALA 2JKPA 4MFEA 1K8YA 2ZZ6A 4LUJA 4PTNA 1HTIA 1SSDA 4JIPA 2DJXA 1MEIA 1SO6A 1LM1A 5D02A 3TQ0A 3N9SA 3P84A 4YCPA 4LVDA 1R30A 2C6QA 4ADSA 3KOFA 3DENA 3B05A 3UWUA 3OVQA 5AYYA 5D33A 2C16A 3W71A 1KW1A 4IPIA 1OFPA 4DO6A 1K8ZA 3PF3A 3W84A 5LNSA 2YW3A 4J9JA 1JQXA 5KZDA 2ATMA 2YDAA 3HQ1A 5FF2A 3STFA 1A5SA 3L5MA 3UWWA 3TSDA 1JUEA 1OX4A 3VCRA 2DJLA 2CZEA 2ZRZA 3NQ7A 4BI7A 1NF7A 3W7MA 4O13A 2F84A 1LOLA 5LNWA 3C4UA 4S2CA 1VLIA 5LHEA 4UFIA 4N9EA 3STCA 3WK2A 2FQIA 4Z1CA 5FEXA 5DCBA 3GDRA 2Q8LA 5HJLA 4RZ5A 3W1XA 4DF2A 2A0NA 3B06A 4O15A 5DELA 1N55A 3LM7A 3JRKA 1LORA 3S5ZA 3UZ5A 1Q45A 5K4ZA 4NNAA 1XBVA 2QCCA 1AMKA 4KFOA 2ABBA 2NZLA 4CQAA 1EUNA 1H62A 4UTMA 4LV9A 2GVJA 3W1RA 5TQLA 2EGZA 2C1HA 3C0JA 2AAMA 3MBDA 3LTYA 3NAVA 3UWVA 4Y9AA 1I4NA 4JD4A 1F6PA 3O06A 3ZWSA 5IBXA 3TAKA 4UFMA 5AYXA 3ELFA 5FF3A 4WOZA 3TQKA 2ABAA 2BX7A 3UYCA 2JGQA 2RFGA 1K7FA 1RPXA 2CW6A 1R2RA 5T26A 3W1QA 5AHMA 2YW4A 4DO5A 3BK0A 5HUOA 1JUBA 1U83A 1DQWA 3W88A 3PAJA 5K2ZA 1LBLA 3W23A 4E2DA 4JEQA 1SZNA 1K7EA 4MVAA 3HGSA 1KFCA 4QIUA 3P80A 4A21A 1L9WA 3M47A 4QITA 1F7BA 3N34A 3N2MA 2V5BA 4DXVA 2YR1A 3GZ3A 2QCFA 3G1HA 4IOTA 4K7VA 5C54A 5G2IA 4X2RA 1DKWA 4RZ6A 3W1AA 4UNLA 2X2GA 1LOQA 4UFLA 4YMZA 1YDVA 4OV4A 4PA8A 3ZFHA 1ME7A 5AOUA 1AG1O 5EPDA 4IMGA 3OVRA 1Q6RA 1C9DA 1F76A 1IXNA 1YYAA 4LTSA 1Q3NA 3A22A 3EWWA 3I7SA 2V0TA 2YGYA 3W87A 2WKJA 5C6MA 3L66A 2ALDA 5FEZA 4Y90A 5D32A 3DKLA 5H91A 1N7KA 4PC8A 3P8JA 1H1ZA 4FNSA 4WY0B 2CWNA 1Z42A 3WK1A 5E0KA 4RZ4A 1FBAA 4WXZA 4MYAA 5E1QA 1O4UA 4LRTA 4M5PA 4NU7A 4ZQCA 1JRBA 1N8FA 3EX2A 1YADA 3I6RA 1WAUA 1EP1A 4LVGA 2WNNA 2A85A 2PCQA 3W2LA 3GXTA 1PVNA 1QPRA 3SI9A 4OGZA 2CU0A 4M6PA 2CLMA 2QKFA 3BG9A 5KTLA 3TW6A 3NM3A 3HJZA 1SFJA 1DVJA 2PRLA 5KZMA 4K7YA 2V81A 5D2WA 1B9BA 3KVKA 1LYXA 1EA0A 1OX6A 1SZFA 4MYXA 1OYBA 3QH2A 3NQVA 3C52A 1FCUA 4M6QA 2H3BA 4JN6A 4NJJA 1DQXA 1S5WA 4JX5A 1MSSA 3IV3A 3B0PA 2VC6A 3C2EA 3M1ZA 1YTEA 3MP4A 3TJXA 3Q37A 3NQ6A 1OF6A 1TO3A 3NQ2A 1H60A 5CZ0A 1H63A 2O7QA 4S2BA 5FF0A 5AHLA 5AYZA 3Q94A 4WY0A 3S1WA 4YCOA 4H4IA 1U5JA 1VCVA 3O07A 2GVGA 3PULA 4IMFA 3LRMA 3G1DA 3QRHA 3TH6A 2FIQA 1M7PA 1SPQA 1VHNA 2QCHA 1ZAHA 2A5HA 1EPXA 1VH7A
chains in the Genus database with same CATH superfamily
2CNCA 3EKZA 1S39A 3KDNA 4F3HA 4Z08A 2KX9A 1QT1A 1W1ZA 3K4AA 1JGIA 1W17A 3THDA 4WLCA 1ZBWA 4KFNA 3M44A 1IR2A 4LYRA 1JR1A 2JKEA 3N6QA 4W86A 4LUYA 4IX0A 1E72M 4ASTA 1W3LA 3PWAA 5A2CA 1B3VA 3IJ9A 4FAMA 4O10A 3EX4A 2Z1XA 2PDLA 4J5NA 2R94A 2D0FA 2GZXA 1O95A 2Q3OA 1TV5A 3W85A 5MKGB 4QJ1A 4DPQA 4DI8A 4PUDA 4D6HA 1ZFJA 1PTAA 2VHLA 2PS2A 4GBDA 3H24A 2DZXA 3NEHA 5DMNA 2C1GA 3AWOA 1HJSA 3BW4A 3H55A 3KZSA 1OB0A 5AC7A 4YWSA 3QW4B 3THQA 4D71A 4ATLA 1P6BA 1CGUA 4X9YA 2QEZA 4JNMA 1QI5A 1SGJA 3PZOA 4X60A 3LBOA 3PZUA 3W70A 3WQEA 3B8SA 5H8PA 2PLKA 2BVWA 3QM3A 2OQLA 3KP1A 5C9XA 4PFMA 1DEDA 5CPQA 3SUWA 5E6ZA 3WLQA 4AIBA 2ZZ4A 2C8NA 3V18A 1ODUA 2ZRVA 2XFWA 4FIQA 1OHLA 3WDIA 4DF0A 3CS2A 1Q6LA 5HQEA 3CTTA 4AD1A 4E8GA 2VELA 1F3XA 3A5VA 2A3HA 3UR7A 5DMLA 5CC5A 1Y8BA 4QNWA 1ZLPA 1XCXA 3GR7A 2DEPA 5CKSA 1KWGA 3TSBA 2Z6IA 1F6YA 1M7OA 1OGGA 2BS9A 5CH9A 3TYZA 1AK5A 3HPFA 4LWWA 3I4KA 2QS8A 4YVPA 2G97A 2WJZA 2E28A 3KL3A 1GKQA 1QPNA 2E3ZA 3H21A 1FXQA 4MZ8A 1XI3A 2YX0A 3KOXA 1UKOA 2C91A 2CBUA 1XYLA 1HL2A 2CLIA 3IIOA 4MPKA 3IPWA 5U7SA 4C7GA 3M5XA 1U33A 5J5RA 2YBVA 3TAOA 3IUDA 1KR0A 3ZSTA 3AWNA 1NWRA 3LXBA 2IS7A 2Z2BA 1FDYA 1WO2A 1OY0A 3KBVA 3SFKA 1X8FA 3UGVA 4D6EA 2O4QA 2XUCA 2WO5A 4PRWA 3NL5A 4ZL1A 1OINA 1OK6A 1LJYA 2Y70A 3O0KA 4M3PA 1TR9A 2ZRXA 1WKYA 1E71M 2HXTA 4JFTA 2IQTA 4B5VA 3GVRA 3EOUA 2OXNA 3L2IA 3AMGA 2VFGA 4MZYA 3L7RA 2ZDSA 4YNGA 4H7ZA 3EX1A 2O0TA 3IS4A 2GYIA 2IPJA 1PDZA 1W5NA 4JY9A 4CNPA 3VNYA 1NEYA 2DSWA 1OF8A 3BV4A 4X22A 3C8NA 5CG0A 4M81A 4HNUA 2QULA 2PWDA 3LOTA 2OZ3A 3OA3A 3TYCA 4W84A 5K4XA 3GNDA 4KCTA 2EKCA 3QMRA 3QYQA 4OUIA 1KFWA 7PTDA 5HULA 4DBEA 3NYZA 2OO6A 4O0QA 4AZ5A 5D9MA 3NCOA 1E55A 1M7JA 1W32A 3CHEA 1KWKA 3E02A 4IFOA 4HNVA 5DO8A 3CZ8A 2J27A 3PPCA 2OX1A 1X98A 3GXMA 2E8ZA 3QHNA 1VEPA 4GQBA 5JIPA 3C8FA 2A7PA 4YL2A 4GNKB 4QHRA 3WF0A 1JZ4A 3LTSA 1TRIA 2FPVA 1X96A 1EJSC 1CPUA 4CCZA 2ZXDA 3RM8A 3CUFA 1EB3A 4S3KA 2F9RA 4JXCA 1QW8A 3N3MA 4HBKA 3ZZ1A 4K6AA 1YXCA 1EJXC 2HSAA 5SWUA 2VX5A 2DZPA 3WJZA 4FMVA 3L12A 2GK1B 3GIQA 3T05A 3BGAA 2NUWA 4MUPA 1DHKA 3KDOA 4RNHA 1YHTA 4FLRA 3SGUA 3T2PA 3W2NA 3R8RA 5HDRA 2FH6A 2JFEX 3SSZA 1W1TA 1ZJHA 1LQ0A 3T1GA 2RDUA 1WE5A 3EX3A 1CIUA 1MFUA 2WSYA 5IDZA 4AY8A 5CC3A 3IWPA 4HYRA 3JS3A 3CQHA 1GVFA 1RLDA 3VIMA 2YCLB 3PB2A 4XO6A 1XRFA 5LHFA 3LV6A 1NELA 2GJLA 3SECA 2FVKA 1R87A 1FX6A 3ZJKA 1LL6A 2GQ9A 1VJSA 1PS9A 4PMUA 2O9OA 2OCZA 1H41A 1EDGA 3CQIA 5CPTA 3ANVA 4GQQA 4FPSA 1NP2A 2OFJA 1FWRA 4FIRA 1S1RA 3ZLHA 5HINA 3DHDA 4GI4A 1MFVA 4KEMA 2GQAA 5HWNA 1O66A 1GVEA 4EKJA 4C6QA 4NAFA 1IT7A 2JKAA 1HKJA 3FHAA 2D3LA 3EWYA 4EXAA 3KTXA 3L4XA 3PB0A 1BYBA 4JDBA 4EPKA 3B9AA 1V4YA 4PBGA 2PDXA 1IE7C 1ADDA 4L1WA 1RPKA 2CZ5A 3VMPA 4LX4A 5CPNA 1DJXA 3VA8A 4A2RA 3TYAA 1AQ0A 1DORA 2QW5A 4I7UA 1JG9A 1TIMA 3DFQA 1KBBA 3CPUA 4KPLA 1UD4A 4B5XA 2XVPA 3CZEA 1SW3A 4FNQA 4FF7A 3COTA 3B04A 5ABEA 4JFWA 1DBTA 1TWIA 2ZWZA 4OECA 3DG6A 1M53A 4WIWA 3WQ6A 4QAIA 1XH0A 4BI6A 2NQLA 3AZSA 5RUBA 3ARZA 4JY8A 4DN1A 5CLTA 4LAOA 3POCA 1FFRA 4GXMA 1EXPA 3NO3A 2PRMA 4PUEA 4GC4A 1LL4A 5HAOA 2V2DA 4PMDA 3UG3A 3U7BA 3MPGA 3T2OA 3OZMA 2VR5A 5GJPA 4J3UA 4WX2A 5FI8A 3OBEA 2YA0A 1F74A 2QPSA 4EOUA 5E70A 3CV6A 1W31A 4Q8WA 3EDEA 2PI6A 4LNCA 3QOMA 3QMTA 2P0IA 1RVKA 4AYSA 1ZY9A 5FJOA 2JF7A 3G22A 4HOZA 3UGRA 4LYQA 3TXZA 3QN3A 1OWQA 1UR0A 4Q4QA 4OWGA 4QEEA 4PTDA 1WDRA 5CSRA 2VR2A 3VZXA 4WQ6A 4ERAA 2BASA 1H09A 3RX4A 4XAFA 4Z2KA 1VBRA 1JJKA 5F2GA 1THFD 3W7NA 3AHYA 2A3EA 3SRHA 3ZSSA 4WKAA 3KHDA 1UHVA 2Z1WA 1TA3B 3U2CA 3VGGA 2J24A 3T0DA 2XWEA 2ZE3A 2YBUA 8XIMA 4JIQA 1IHIA 2AGKA 1E9LA 1JPIA 2OMAA 1T5AA 3LEPA 4IIDA 2WV8A 2YOCA 4RJEA 3PBYA 3OG2A 4L1GA 2J47A 3IGXA 2CHRA 3LMYA 4BK9A 5LSMA 1YX1A 5BU9A 3N6HA 1HL9A 3LB0A 1MYRA 2C15A 1WZLA 4W5ZA 4EIVA 1I45A 1IXOA 1UC4A 2NLYA 4DJFD 1MMFA 1SO5A 4LEQA 3DYPA 3ITCA 1E40A 1TPDA 3S2MA 3TLQA 5M5DA 3BJSA 3ZVIA 3RK8A 1LT7A 4XG1A 3ARRA 4KCUA 2AL1A 4R9XA 1XINA 1CB7B 4NZJA 2X1SA 4QDMA 5KEZA 1JVNA 4ZXLA 2VDHA 2E6DA 4DBDA 3E9AA 3URQA 3W83A 4MAZA 2EXOA 1OC5A 3RIKA 4FOJA 3TMQA 3I10A 3HTWA 4J40A 3WLMA 2OO0A 3DZ1A 3NQ8A 4CNTA 3VDGA 1L6YA 1F6KA 4IGSA 1CLKA 4O17A 1K02A 4DZIA 1HP4A 3AMKA 4MM1A 3Q4DA 4A8RA 5I07A 3GHSA 4ZB0A 3L2MA 3DCPA 4GE8A 5D38A 4NP7A 1OFOA 4MY9A 3DKJA 4NAEB 1B54A 3NTYA 1TPVA 2WSQA 4M24A 3BGGA 4EAMA 4GUFA 4HVXA 2ANUA 2J7BA 2V3EA 1C8QA 2ZUUA 5G5IA 3G1XA 1TPUA 4RX0A 4JTIA 3GC4A 3T8LA 1GQKA 2H3DA 4MKSA 2DDXA 1S2UA 1NAL1 1QOQA 4PBEA 1J18A 4NX0A 4UTTA 3TQVA 4DJFA 2OYMA 4I9MA 4M29A 3L0KA 3KVMA 2ZVRA 5FACA 2DZWA 2FLIA 3W25A 1XLMA 3MS8A 2XU2A 1KRCC 3PWIA 4AWEA 3S6TA 5D9PA 2OOFA 3OQ8A 3KEHA 3AIUA 6TIMA 2ZXBA 1F8MA 3T7VA 4TMCA 1XP3A 4JKLA 3AJ7A 4F2BA 4GACA 4C6JA 2PWUA 1BQCA 1QPQA 3I3BA 4RDWA 4S3AA 4PULA 1OIMA 2DQWA 1ITCA 3QMSA 4X0VA 3S5NA 4JYDA 4XBKA 4B4FA 1XBXA 2ZA1A 2XGZA 4RCXA 3ARPA 4Q7NA 1FWCC 3BG3A 1MW2A 4PE8A 5BRBA 4WXYA 2FZDA 2Z2AA 4E3VA 4QLKA 3S1GA 3LHUA 3HPXA 4CQ9A 1DE5A 3CAQA 3WBYA 1XRTA 4BEQA 1XLAA 3C3NA 4WY0F 4IGNA 3GK0A 5DBTA 1XSIA 2ASHA 3IJ7A 1TX2A 1LWJA 6TAAA 2J6XA 1Q13A 1OEPA 1VFLA 4LY4A 2WSPA 3W75A 4AZCB 2PDJA 4IP5A 3RG6A 1D2KA 3QYSA 3FV9A 1PJ9A 4TX6A 4IQLA 1VEMA 3OJGA 1B57A 1BRLA 4D6DA 1GWJA 2Z24A 3CLMA 3W7RA 3TIMA 1UD8A 4IZGA 3BARA 2HXUA 1X6NA 2PWEA 3I65A 4HB7A 2FB2A 1AFSA 2D69A 2DZSA 5HA7A 3VUSA 1H5YA 3MHGA 5BROA 2J74A 1HO4A 1Y65A 2JEPA 3GLCA 4J1OA 3GH4A 4IT1A 1OFEA 4KFPA 1UD5A 1G4TA 4MWAC 4NZ5A 4DB7A 2EJAA 1H61A 1M5WA 2E5DA 3BLEA 1FWWA 3KX6A 1R2SA 4HPXA 2EPKX 4EANA 2J13A 1WDQA 3HFYA 4JTCA 1G4PA 3CJPA 4NX5A 2ISVA 4KBXA 1Q8JA 1IF2A 1XKJA 1VENA 1QWKA 2PURA 3DG3A 1CLXA 3KWSA 4XZ9A 1SMAA 3BW3A 1AJ0A 2GGGA 2QV4A 1KXHA 2HK1A 3HQNA 3HBLA 3WF3A 1P0BA 3LTPA 4L4OA 1FDZA 2HVMA 1A4LA 3WNKA 1JYNA 3EKLA 3NG3A 1FWDC 3MQTA 5CGTA 5B7ZA 3G6MA 3N2XA 1W3JA 4ICCX 4I7VA 4AEFA 1JF5A 3TV8A 2G3JA 1Q63A 4M1BA 4ZQMA 4LB3A 1BQGA 3LV5A 3F4VA 4AVFA 4JEJA 4GQ0A 2B0MA 1O5RA 2QUMA 3BCDA 2IXUA 4O8AA 1R85A 1IXPA 4QE5A 1KV8A 3VNIA 4WOQA 1BEUA 5TIMA 4CNSA 3D6NA 1JYXA 2TRSA 2Y1HA 3E3HA 2QIIA 4E4UA 3WL1A 2QVHA 1YTDA 3AHVA 4NIRA 4OV9A 1WDWA 2XPKA 3OQEA 3AHTA 1KTCA 2OLHA 2HVNA 3I4EA 3TW9A 3PK7A 3TDFA 1I2QA 4PB5A 1DWAM 3RMEA 3OOQA 3MZ2A 1A4MA 2VI0A 1V7AA 4PBFA 3P5ZA 4N02A 4HN8A 4XTIA 1E0VA 3OGVA 3E2SA 4GIRA 2DUZA 3U0HA 2VO5A 1V51A 4H04A 2QJIA 2WYSA 3LCFA 4AQLA 1EP3A 3RGTA 3PHAA 2YZRA 4J3TA 1OQFA 4AH7A 3TK7A 5LA0A 2Y5SA 1ZCCA 4IGMA 3R10A 4JOMA 5HR7A 3IIPA 2V82A 3TC3A 3FIGA 2WJFA 4MGGA 4U28A 1XKYA 3CWNA 4H9XA 2R14A 3WCZA 3IEBA 4YHGA 5GVJA 2J7HA 3BTNA 1CXLA 4ZQNA 3WQPA 3WLKX 3BURA 1FOBA 1XIMA 3AIRA 1QJWA 4HNLA 5BXPA 1G94A 2YDQA 3KBMA 5A8QA 4IJCA 4U4MA 3O6AA 4O12A 5A2BA 2CXEA 2BB0A 2XM1A 5F4SA 4JTTA 3R43A 2OT0A 3AIVA 3WG6A 4N9DA 1SJAA 3FYPA 4CGTA 2DQXA 3TMLA 2RAGA 3LPGA 4DZHA 4EVZA 3ABZA 3U7VA 2AMXA 3K5XA 4WSHA 2CBVA 3NDOA 3AIWA 3APGA 1N8WA 3WNNA 3B8WA 1BTMA 2RDWA 1QW9A 4L65A 4F66A 1WX0A 3QV6A 4O8RA 2OEMA 4ALDA 1DJNA 2PP1A 1TTJA 3GUGA 1VR6A 2J6VA 2PDHA 3H2AA 1JUKA 3PTKA 2BMBA 3TOPA 3WZ0E 4PH6A 4DNHA 3WLOA 2Y5EA 4KGLA 3P14A 3W27A 2BTMA 3U57A 5I3JA 3BZGA 4ECLA 4DXXA 3N04A 1F07A 4YLWA 4C7DA 3N3TA 3AXKA 4GD0A 2XSXA 4KWUA 3OG3A 1WBHA 2X0YA 2J79A 2EEXA 1WUFA 2AKZA 1Q4WA 1MDRA 1W1PA 3PPFA 3EXRA 3R6IA 3STGA 4MUZA 4H6QA 3RU8X 3UPMA 4OFCA 1G7VA 3TZNA 1A5UA 4LY8A 3R94A 5E0FA 3K8LA 1U1JA 1CNVA 2QDGA 1XYBA 4U2ZA 2CLLA 1XCFA 3N9KA 5K3VA 5LIXX 3SAZA 1GJWA 3HB9A 2XIOA 3MMUA 1GPFA 3U6WA 1P5BA 3CIXA 2J66A 2NT1A 1MO0A 3CPGA 6XIMA 3R2GA 2QZRA 4XKYB 4AMAA 4GABA 3MDUA 1E1EA 4WGXA 4DAIA 3MDWA 1E0XA 5FJTA 5EMUA 1TWWA 3G3DA 4H6EA 3HOJA 1ZTVA 4HKPA 1OZMA 4XD4A 5BOOA 1ENUA 4XVEA 4M8UA 3S5OA 1PPIA 3WLNA 4JHZA 1REQA 3EDDA 1I1XA 5C7VA 3GH7A 3VD9A 3ARSA 1BYCA 5AN7A 4UFKA 4QNEA 3KBWA 3N13A 4LUTA 3RX3A 4WCJA 2Q02A 2QMKA 2CESA 3MI3A 3ITVA 2WZIA 2KZHA 5GNZA 3GS6A 3GBEA 1DJHA 3W7EA 1Z48A 3F1QA 1DV7A 1XDJA 3N6JA 4AB4A 4QROA 1PKMA 2EPMX 3P81A 2IPFA 2Q6ZA 3QTPA 3PUEA 4N4PA 1IV8A 2VX4A 4GUIA 4XAZA 3MUAA 5AHFA 3S5SA 1C29A 4ZQRA 4QAWA 2ZUNA 3TN3A 5HNNA 5BYWA 3WENA 4KF1A 2VQTA 4QJ4B 3W53A 5CZSA 4PYSA 5C5YA 3W7JA 1EO7A 5HMEA 5EB8A 2EQDA 2QJHA 3OLGA 4BKNA 5D2VA 1WKFA 1W2VA 4GZJA 4GRSA 3F4DA 4IIBA 4ZQPA 5TD4A 3RN6A 2VGIA 5I5RA 3UR2A 1G4SA 5D9OA 2CC0A 3AU6A 3QFEA 3CAKA 3AI0A 4HSNA 1JZ7A 1ITUA 3G8EA 1VC4A 4WSKA 4H2CA 3VPLA 4MLJA 1JAKA 1UPPA 3R1ZA 4V27A 4HNCA 3M9YA 3UYIA 4N9CA 4JHMA 2JF6A 1X6LA 3S8HA 3VGEA 4PCSA 1VEOA 4ZEPA 3SCOA 3VD3A 1JCNA 1FWFC 5CAHA 3LSBA 1EDQA 1XV8A 2W62A 3CH9A 3VOFA 2TODA 1RUSA 1QPOA 1RALA 3QC3A 3TJIA 3GC2A 4QTGA 3TROA 1ZBKA 3SB0A 3VKKA 2EHHA 4PTMA 5A95A 1RBAA 3KLKA 1E6PA 4O50A 4PMVA 4WGHA 5HUPA 3WFZA 3OEXA 1FWNA 2OJPA 3VMNA 5HMDA 1UKPA 2DVTA 2BSLA 3TN6A 3L5LA 2NSXA 2V6AA 1OX4B 3WQCA 4HU0A 4JCMA 3MUY1 3DHUA 5D05A 3AS2A 4DNMA 3HPSA 3R5EA 3PFRA 4KCWA 3PBWA 3CO8A 1EDTA 5C71A 3KZPA 2Z25A 5LA1A 3QR3A 1NDVA 4MFEA 4LBSA 1TX0A 3PZGA 4LUJA 1HTIA 3KWXA 5G4HC 3ZQ9A 4JCLA 2DJXA 1MEIA 3M46A 2ZUMA 1UJQA 1BLIA 4P7RA 3WLRA 2UY3A 4YCPA 1R30A 2R1MA 3QGVA 3OVQA 5D33A 2GVEA 2I5GA 4DZAA 4MNJA 4ZSUA 1K8ZA 3WH8A 3A4AA 3WDRA 1KGWA 5BWAA 2PDCA 4Q8UA 4GI6A 2D20A 3D47A 3VVGA 3E0VA 3H4GA 3UWWA 3WYZA 3VCRA 3O3RA 1XIFA 1AQFA 2I57A 4U3CA 2VGBA 3PPHA 4Y9NA 1XLEA 5B80A 1LOLA 4DWSC 1QNSA 3U5UA 1VLIA 1ISVA 3DBNA 1M9HA 4KS0A 4UWMA 3DECA 1A5KC 3MJMA 3UR5A 1QHZA 2GK1A 5I00A 4N0RA 2PGFA 1R3TA 1XBVA 4JQ1A 2QCCA 3RM9A 1OD8A 4G56A 2ABBA 4NZCA 5HJYA 1EUNA 2YJQA 1H62A 4LV9A 3DC8A 5TQLA 3FA4A 1QVBA 3C0JA 1X97A 4CD5A 4AX7A 1LG2A 1JFXA 3U9IA 1TWZA 2Y8VA 3UWVA 4Y9AA 1PB0A 1F6PA 3O06A 5IBXA 5EMMA 3AICA 1W6TA 4UFMA 4NI8A 3CZJA 3WD4A 1HKMA 2YCLA 1AJZA 3U2ZA 4I5UA 3MVTA 3OVGA 1CWYA 1E1CB 3NZPA 1CXKA 5T26A 3F2CA 3W1QA 3N29A 1XLHA 2OGYA 5AHMA 4G7FA 1JUBA 4PSPA 3W88A 2CKSA 4Q6XA 2BXYA 1KFCA 2IXVA 3WFLA 3M47A 1F7BA 2XH7A 4DBUA 5CLWA 2V5BA 4GJIA 1MW1A 3G1HA 1F4HA 2Z26A 4RZ6A 2VZUA 3ICJA 1LOQA 4UFLA 4YMZA 4EXQA 1TELA 3ERPA 3LA4A 1ME7A 1AG1O 3ARXA 2GLKA 3N4EA 3OVRA 1C9DA 2W92A 1YYAA 3UT0A 5AYBA 4LTSA 1Q3NA 4XV0A 1Z6KA 3I7SA 2YGYA 3W87A 1IEIA 3BLDA 1RLCL 3VDCA 2CCRA 3MUZ1 4P8VA 4JTQA 3DKLA 5H91A 4KW2A 4PC8A 2BP1A 5DT5A 3VKAA 3WX7A 4Z2GA 1UOKA 4RZ4A 2XZ7A 1MNSA 2DW7A 4MYAA 4KIEA 4QBXA 1VFFA 2UY4A 4LVGA 1D7FA 2VR4A 3H2EA 3S3GA 5GQBA 3QXBA 1IWBA 1UUQA 2YL8A 2MUCA 1QPRA 1QU4A 2BY3A 2J8TA 4M6PA 5KTLA 1C7TA 3FVMA 1DVJA 1LG1A 2X09A 4NASA 5I24A 4CN4A 1GZJA 1OX6A 5CBBA 3S4TA 1BGAA 1AQHA 2CBIA 3NQVA 3CZGA 1B3WA 4QJ3B 1X7IA 4MJ4A 4U3AA 1EGMA 1YDYA 1DQXA 2OSYA 1AH0A 4FZIA 3U4FA 3A12A 5E9XA 3MP4A 3TJXA 3M4HA 1OF6A 4UNIA 2O9RA 1F3EA 4S2BA 1ZSXA 1E70M 2E7FA 1DE6A 4YCOA 4H4IA 1U5JA 3EGJA 5LIKX 4IMFA 2CEQA 4ACYA 4NILA 2FIQA 1VHNA 2QCHA 2JIWA 4ZO6A 3V7PA 1EPXA 3F5JA 1VH7A 5IFTA 2ZUWA 3NR0A 3GG7A 2OQHA 3SZ8A 3TNOA 2NXHA 3KRBA 7A3HA 2VD9A 1E0TA 3VIJA 2IQ0A 2EAWA 2WNWA 3UJEA 1UCWA 4MY1A 3EEZA 2FZ8A 3WK3A 1UWUA 1GUVA 4K39A 1NFPA 4QRNA 4C6CA 4TXEA 1EJVC 4XD3A 3T78A 1RZMA 2YFOA 1FVPA 4L6OA 3QY8A 4Z1BA 2ZZ7A 3CB8A 4UQDA 1IEXA 1VPQA 3CL8A 3FFSA 1SZEA 3OGRA 3VDHA 1B2YA 1MI3A 2IKJA 5DMMA 2XIQA 4QDWA 4J7RA 3O9NA 1HO1A 3VUPA 2ZA2A 2PDKA 3E0LA 1FP8A 5IDIA 1TTPA 4I90A 1VFSA 1VIZA 5J5DA 3QBUA 3CU2A 3FSUA 1SW0A 1NOWA 4PN2A 4Y6GA 2ESCA 3Q67A 5C70A 4ILSA 4HA0A 3MSYA 4E2VA 4IMCA 4IJBA 4HD5A 2ZFAA 3CZKA 2ZZ2A 3WNOA 4Z1YA 3I3DA 3IAPA 5CCZA 4NHVA 4Z0JA 3SIZA 2X1TA 3GNOA 4EWJA 2AOSA 4PCTA 3SIMA 3ZR6A 1EPVA 4PFHA 3SO7A 3CV1A 3G8RA 5A6AA 3N2BA 1YLVA 4Q7BA 4GWEA 4UBPC 4ZOEA 2NX1A 1A5AA 2GDVA 1NWTA 5I3HA 3OLEA 4WDTA 2WVTA 2E1DA 3LNPA 4LYPA 2R24A 3TLLA 4MY8A 2B4GA 2BLEA 1EX1A 2DSZA 1MRQA 1DJZA 4W87A 1C92A 2X30A 4GZ7A 1F9CA 2O7SA 4MFDA 1JF6A 4HZMA 5I09A 2VFHA 5EMYA 3IIZA 1H4PA 1I1WA 3GVWA 5MHBA 3WQWA 1US0A 2J25A 5C55A 1W5PA 1QHOA 4PEEA 2GOKA 4KMQA 1HQTA 2GQ3A 2QLYA 2XFYA 4O0ZA 3VX0A 5L6UA 2HCVA 3GKAA 3VYLA 4FALA 4Z0SA 2ZUSA 4NXSA 5G2WA 4C60A 1IZJA 2ACQA 4UTWC 1KFEA 2RJHA 4IIFA 2P0OA 1CGXA 2VDGA 4D8AA 1NARA 2FJUB 2I1OA 4NT0A 4URIA 4IGHA 1BKHA 4G5DA 4FX6M 1J6PA 2OSXA 1KGUA 2Y89A 1BVNP 3BAXA 3TUUA 2I5QA 1DTNA 3C56A 3VINA 3PBUA 4JTAA 4RXFA 3VC5A 4DI9A 1E73M 4PCPA 4XZMX 4YWIA 1ITQA 2DIEA 4RPPA 4IPPA 2XISA 1WZAA 1P0KA 2CWXA 1X7FA 3NQBA 2CLFA 3CYVA 2VUNA 2OQYA 1G7UA 1WXZA 1UZHA 2REQB 1K3UA 1IT8A 1CXHA 3TONA 2W9MA 3WDHA 4RE2A 4CEXC 2QUTA 4JTJA 1FTXA 1B0IA 2P3EA 3O05A 3DFOA 2FGZA 4FA3A 3BZJA 3LN3A 2I9EA 2WJDA 4V1XA 4HSHA 1Q6OA 3TTSA 3EPMA 1GOQA 2Y8UA 1V93A 3ONBA 1W1VA 2ZICA 2DUAA 3NGFA 3D5HA 5FESA 1ZS2A 1C8VA 1GONA 1UP3A 2PDPA 3UESA 4XIAA 1C7SA 2E68A 4HHHA 4TVDA 3BMVA 4IWWA 4GGHA 3PP7A 2HPMA 1HN1A 3RDKA 4ZSTA 5JU6A 4I3GA 3BANA 4TR9A 1UPMB 3LY0A 4NAFB 4JTEA 4ZBCA 1VKFA 2X1IA 4AZCA 2DPEA 3SUSA 2YPIA 3ARTA 4PSRA 1SZRA 1TKKA 4UZUA 3I6EA 1F4AA 3PANA 1QBBA 1TV8A 2E5CA 4YYCA 3QQ0A 1GOMA 1HJUA 1T0OA 4J3SA 3EXTA 2X0HA 2YXOA 1TREA 2PODA 4L7ZA 4FOUA 1D3HA 2HWGA 4ROPA 1MQQA 2BGNE 3GYCA 3PFMA 2GFTA 3INPA 2WC4A 2ZTJA 4TOQA 3LGGA 3WFAA 1LRNA 3GVQA 3SY8A 1MVYA 4XX6A 3UERA 3AS1A 5D2XA 4QCFA 3UVIA 3P61A 3UA3A 3OIXA 1PYMA 3IJLA 3CHVA 4IMAA 5JQ9A 5K7JA 1VHCA 1IIHA 1I8JA 2Z4GA 1QDSA 2OYKA 2PDFA 4B2DA 1GG1A 3N18A 1VAHA 1W5OA 1X1OA 3AMDA 3ZT6A 1NQ6A 1Q7MA 4KRZA 3VO0A 3CUZA 3UZZA 4LYKA 4NJHA 1EEPA 1L6SA 2G95A 2PEVA 1QK2A 3WH5A 1KFJA 3FA3A 1E1FA 2GVLA 3I68A 1VLWA 1H49A 4KGJA 4W93A 1XLDA 2OPJA 1A0DA 1B4EA 2VOTA 4L6HA 3OHMB 1SU5A 1VS1A 1QBAA 3FYOA 2XN1A 1ECQA 3PZ9A 3NGJA 2QAFA 4UC5A 1QI2A 4DX3A 4G1KA 4H6RA 3UZWA 2Y85A 5FJPA 1UYQA 1ZCOA 2GSHA 3TJ4A 3OP2A 3W29A 1DJWA 3HG4A 1X1ZA 2NQHA 4B5TA 3AXIA 2OT1A 4L9YA 3P62A 1I2PA 2DV0A 2VEMA 1GQNA 1YDNA 1OT2A 1XLCA 3TCSA 3V0UA 1DXFA 1PIGA 2YKKA 4XTDA 1D8CA 2QCGA 4M80A 3VFCA 3QR0A 3H4XA 2NXGA 4PUNA 2PTXA 2G3NA 4W5UA 4JNYA 1H50A 4I5RA 3UG5A 3LCHA 4K2SA 2W66A 2G96A 1RVGA 3N12A 1QRQA 4RL3A 3T0BA 1UKSA 4LU0A 3RNDA 5AC6A 1W8SA 1EYWA 3WLLA 1TE1A 1CGYA 1K9DA 4HK5A 4I5XA 1J4EA 5D8WA 3M16A 4BS0A 1JCLA 1JPDX 1CYGA 2R82A 4H7VA 4WDUA 1UG6A 1S5MA 1JDAA 2VZSA 4UTJA 2R91A 2WKLA 4IUOA 4D8LA 3AZTA 1V6UA 2ZIDA 1EC8A 2Y2WA 1FKXA 2YXXA 3BE7A 3H22A 3KOWA 4GOAA 3S0CA 4N4QA 2ZZ3A 1XXXA 2HROA 4A3UA 4PL2A 4PMZA 1EYEA 4QSFA 4YVXA 3VDAA 4MWAE 3EEGA 1M41A 3CL7A 2FZNA 3FS2A 1OSEA 1Q6FA 3WF2A 3SM0A 2KAUC 4C1LA 4MB5A 4F0LA 4LS2A 3W7QA 2I9UA 2VCAA 4E2OA 5JVLA 3AJXA 2G4FA 3KCOA 1EUAA 1XQKA 2VFFA 5IFPA 1TMQA 3WL0A 1Q2RA 1GKPA 1K8XA 1VBHA 1XQLA 3CQJA 1FH9A 4YJ5A 1W3IA 5LZLA 2WOQA 3MSDA 3I7RA 1VGAA 3CTLA 2TMDA 4LC8A 1XLFA 1F3WA 3QF0A 4E3TA 3ZOAA 2PD9A 2ZX7A 1GCYA 5FOOA 4QP0A 5FAJA 2VX6A 1G67A 1YPXA 3R4IA 4M1RA 5A8OA 2BOGX 4ORIA 1DL3A 2LLEA 1W3NA 2XIIA 3MA8A 1BTCA 2V5JA 4A35A 1J0KA 4WRHA 2Z1VA 3VE7A 4IFRA 1DWJM 3RR1A 4UZSA 5A6JA 4M7SA 1ZRQA 4O1DA 2HTMA 3ME3A 3PBVA 3SCRA 1MEHA 4P7NA 3RHGA 3N19B 4ACZB 2QCDA 3WNMA 1KBKA 4KWSA 2CHNA 1UR9A 4ADUA 1R3WA 4GCXA 1MW0A 1E6SM 3EDFA 3EMCA 3TN4A 3E2VA 3CEUA 4JQ4A 5LGXA 3CXOA 1YDOA 4ZR8A 3I3EA 4M56A 4D8ZA 2XH0A 4UR9A 4I9AA 4G9PA 4UFJA 4LBRA 2VEKA 3GRIA 4MIMA 1HP5A 1A5MC 1IZCA 4MWAD 2JGYA 3CV2A 1S3HA 3UXLA 1BF2A 4HIBA 2WK2A 2GUBA 3PAOA 3PS7A 1OCJA 1TIWA 4HPGA 4GJ1A 4IPLA 2PBGA 3USBA 3LCXA 2R1LA 4DLMA 1TQJA 1O1ZA 1ZU8A 4O18A 1OM0A 3R8GA 4XKYA 1XHGA 5KZ6A 2P76A 1KXQA 1SR0A 1CW2A 2WPGA 1XBZA 2ZRUA 1KCKA 4A8IA 2JALA 2Z1SA 3SJ3A 4E38A 2VEPA 1XX1A 4TIMA 2XVLA 3CB3A 4F8XA 3G1RA 4PR4A 1Y5WA 4GYPC 2VRJA 3OZOA 2JK2A 4AZGA 3C2YA 7REQA 4FNRA 3P5YA 4KQNA 4YYFA 4XUYA 1LRQA 5HNTA 1YPFA 3BSMA 1SO4A 1QW7A 4BFAA 4GXWA 4PL1A 2WAGA 3FSTA 1BVZA 1SJDA 2GSJA 2PF0A 3HMCA 5AY7A 3B4YA 3HZ3A 5MF5A 4R7JA 3UWYA 2ZQ0A 3H8AA 4ZB5A 3KXQA 4CU8A 1PE1A 1TJRA 6XIAA 1Z69A 3TE9A 3CNYA 3KLLA 4LRSA 4B3LA 3SUUA 2L5HA 2FDSA 3MWAA 3PTMA 3STEA 1E0WA 4HPNA 4DIAA 1EJUC 2GOUA 2ZE0A 4GVIA 2G5WA 1V8EA 5CAKA 1EGZA 2J7EA 2YCEA 3DGBA 2GGIA 3TYEA 1Y0EA 3K8MA 2QUNA 5DN1A 1SJBA 1Z8AA 5HWMA 3FEMA 4CLMA 3OIHA 4QG8A 2DH3A 5CJMA 1I75A 4PRTA 4ZCWA 1WOAA 1OG6A 2P53A 2Q01A 2D23A 3DYOA 2WQPA 2UV8G 2WCGA 3N14A 3NQCA 3AU2A 3EOOA 4QJ5B 3PUGA 1QMLA 2XVKA 1LRTA 3PUDA 2W0UA 1H7PA 2PPGA 2WKGA 3L0NA 4HOXA 4QS5A 1BWLA 4GMEA 3KE0A 1E0UA 4ML4A 2HPIA 2R1NA 1O68A 1KTBA 1NDYA 4M19A 3VNZA 2NV1A 2AMGA 4NJIA 4Q4PA 2PSNA 3W01A 1MUCA 3ZT7A 3F7JA 3FK4A 3NQMA 4S3JA 4DBSA 1UASA 2VKZG 3IGHX 2BXVA 5JH1A 3W2MA 1TTQA 4A3QA 1US2A 4US6A 2D1ZA 2PZ0A 4D1JA 3UW6A 4WEVX 3DG7A 2DFAA 1FWHC 1RAKA 4MDPA 5EBAA 3WQGA 1NSJA 3KCLA 1HNYA 2INZA 3O7UA 1SJCA 4QISA 1HJWA 3S5YA 4F0KA 2OZ0A 4EPBC 1AH4A 1UUOA 1RP8A 3DI1A 3UJSA 1TPWA 3CV7A 3VD7A 3URNA 3QTGA 3DFYA 2BVDA 4IPNB 2PGRA 4TU1A 4PB4A 1A53A 2OG9A 4LNYA 4O16A 1P7TA 1R7AA 1FWTA 3AFBA 3Q58A 4LJ3A 1R9ZA 2YCIX 5F2IA 1EXBA 4FNUA 4S39A 4FEZA 3UFYA 2OWXA 1M7XA 2QMJA 3T07A 3A4JA 1XS2A 4H41A 1PIIA 3KS5A 3W02A 1KQYA 5IRPA 3PG8A 1K9EA 3TWAA 4O53A 1FWEC 3WMCA 4A8LA 1W5MA 4DYKA 5F2MA 3VCNA 1NFBA 2V68A 4BEUA 1DIOA 3SCSA 4A05A 3VX1A 3S46A 5EMKA 3KTSA 3QZEA 5H2ZA 1UIPA 4K38A 2FB3A 3UXKA 3GHUA 4KH2A 9CGTA 4F0MA 1GPWA 5G4WA 2EPHA 4UOQA 1YBQA 3VM5A 1HFBA 3W6YA 1LTDA 1T8QA 3VMOA 1Z3NA 1SM9A 3WELA 5EMJA 1A47A 3G1VA 4S3EA 1XD1A 5CBIA 2Z0IA 2R1KA 2DP3A 3RPTA 2WW5A 2O4MA 1GVYA 5LA2A 3SCNA 3DGRA 2CFFA 3TTEA 3AXMA 3PNUA 2V38A 5JH2A 5H8MA 1LROA 4L9XA 2Y0FA 4X0NA 3VIHA 4FR1A 4WDWA 2YIHA 3HG3A 3LPFA 3EMZA 1H5VA 4I8YA 1MUWA 1HVXA 4K8HA 1I60A 3YPIA 5FSEC 5AC8A 4KRTA 1CXFA 4JIIX 3CO4A 3N15A 3GIYA 4HSOA 2VYOA 1FCBA 1ZP4A 3RPDA 1R2TA 2JE8A 3OA5A 4TVCA 3UJRA 4CEUC 4NRSA 4GZIA 2H8ZA 4AVOA 5DRIA 5DFAA 3BAKA 5A3HA 2D22A 4E2BA 1K6WA 1SYTA 3LHZA 2PF8A 5I06A 1RV8A 4H1ZA 1E1CA 4ORMA 1I2NA 4GBUA 4C6MA 4MJMA 4NSBA 5F1VA 1MEWA 3VKCA 2ZX5A 4E4PA 4ZQOA 1HJVA 4AD2A 3BAJA 2Y8KA 3LQLA 3NPUA 4W7VA 2AQOA 5IOBA 1YW1A 1W54A 2BVTA 1TJPA 3W7OA 1F5ZA 1V6XA 5XIAA 1XGDA 4POCA 2OYLA 1PIFA 5CJNA 4UFHA 1KFKA 1E5JA 4MZ1A 1FWAC 2PE4A 1SFTA 1MW3A 4WZHA 4ZMGA 2NSOA 3W1MA 1Y5XA 5FD0A 4OU1A 5G1MA 3GFYA 3DFNA 5GPRA 1JZ6A 2ZXAA 2E5BA 1XIJA 1K7XA 3C86A 1AZ1A 4MAVA 5CPOA 2P50A 3L67A 1IZKA 4JFUA 3TCEA 2O56A 1RJQA 3ZR4A 2VP8A 1KA9F 4PODA 2W5FA 3ZS4A 1WBJA 2VENA 1XFCA 4XVDA 4B9YA 3WH9A 1TQXA 2VEFA 2QHAA 3FW6A 4LS0A 2VC7A 1RBOB 4MNKA 3NURA 4A8NA 2DVUA 4DRSA 4LUIA 4PUJA 1BPLB 4PMQA 2IQDA 2OELA 4DO4A 1REQB 4IIHA 5I3KA 3B97A 2CYGA 4KKXA 3U4AA 3QKEA 1VCFA 3LLXA 3NXFA 4M82A 3ATYA 3CHFA 3GKFA 3STPA 2FMNA 2HQAA 3HJEA 1H7WA 4LUTB 2MNRA 3MZNA 4F48A 3VABA 1W3TA 3PJWA 3G18A 3WMSA 1VF8A 4OVXA 4UQBA 5D4YA 1T8XA 3ZLGA 1R7OA 4AAJA 4JTUA 4CN1A 4HNTA 1JCTA 3ZJ7A 1BD0A 3B8IA 3L2LA 1UB3A 4Z1DA 2P10A 1IEVA 1SMDA 4LS1A 2ZRYA 2BDQA 3LLFA 2A3LA 1WZMA 3VTRA 5DEZA 2OU4A 1C3FA 1TWDA 3VM7A 3AXHA 4AX6A 3DFSA 5CEWA 1IQ8A 1Q65A 3M7SA 3N17A 1XPYA 2YSWA 1VJZA 3M0MA 3BICA 4LC6A 3I7QA 3LD5A 5LKYA 4NZ3A 4DUVA 3GM8A 3W26A 4O1CA 4C90A 1J0ZA 2B7QA 4BF9A 1JDCA 1XYFA 3A6OA 3GTFA 5D2TA 4RW3A 3CMGA 4HMNA 1PKLA 2QT3A 4O19A 3SCTA 1UWTA 5LXXA 4AY1A 1R3YA 3ECQA 1EQPA 3E0FA 4LCSA 1DJQA 3GDMA 1GTHA 1FKWA 4Y7EA 1UP0A 2A2IA 3TSMA 3V75A 4FHAA 1UZ1A 1WQ5A 3JR2A 2INFA 4MJZA 1NF0A 3C2OA 5ABGA 1XIHA 4A29A 1XLIA 2VDIA 1L8NA 2ZC8A 4H9MA 4P8WA 2YL9A 3GNNA 3O6CA 5AZ0A 3E5PA 5DLCA 1JCMP 2UBPC 2HS6A 1VQTA 3LU2A 3H54A 2GJNA 4B16A 1W9BM 4DWSD 4R88A 5BRQA 1G0CA 2VZOA 2Z7GA 3RAOA 1J11A 2YXGA 1M04A 2FTWA 1PKNA 4MOZA 1XCWA 3N2TA 3R58A 3ARWA 1ZL1A 4UTTC 1JDEA 3LBCA 1G6CA 2A3BA 4DJFC 4LAZA 3BH4A 4MB4A 2FDMA 3ITTA 3FJLA 2DW6A 1O7AA 2WMIB 3B0VC 1CB2A 3QKZA 1A5LC 2ZX9A 3TA6A 1E6ZA 1IT0A 2EG6A 2GGHA 3L5AA 5LIWX 3THAA 1R5YA 4GYJA 3FHQA 3UY7A 1OX5A 3PBGA 3C2FA 1XM3A 4PZVA 4P7OA 1ONXA 3FKKA 4HNOA 4UQ9A 5ECUA 3N9RA 1DJIA 3PPGA 2PWVA 1B31A 3WLPA 1Z32X 3EWDA 1B3ZA 1BYAA 3GUWA 2QUVA 1P0NA 1TJ0A 1S1PA 2Y4SA 3H7RA 4M6UA 4F0SA 3DHFA 1F2JA 4TTGA 3CLWA 3CPRA 1W5QA 3RFAA 2OTDA 3HQPA 4L4MA 1R46A 4H01A 4V1YA 3VOJA 2O92A 5E9AA 4H2HA 4TV5A 4B5SA 3W1PA 1GK8A 2WSRA 1Q6DA 3QPZA 4XAYA 1RH9A 1ZQ5A 5JUVA 3OO2A 4RE4A 2F6KA 1WUEA 3WQFA 1S5NA 3NO5A 1X39A 3AXXA 4JX4A 5KITA 1YE6A 1JFHA 4UQCA 2QJMA 4WVXA 3UNDA 1SZGA 1XRVA 3JU2A 3AIQA 3PZIA 2QJJA 1SSDA 4JIPA 3ZVHA 3E6EA 4NZ1A 2MANA 4C7FA 1KD0A 2YCJA 5D02A 1B5TA 2GJXA 3ITYA 1KGXA 3N9SA 3P84A 2V5KA 3B3DA 4LVDA 1QNQA 1DXEA 2C6QA 1R0MA 3NXLA 3UWUA 5AYYA 4WSJA 1H3GA 4DO6A 3W84A 2REQA 5BOEA 3WNLA 5C9WA 2YDAA 3EWCA 4HCHA 3KOYA 2DJLA 5CZKA 2CZEA 1PDYA 1Q66A 2DIKA 4BCEA 2PWGA 5HXMA 2AKMA 4S2CA 1EJRC 3FXGA 5LHEA 4UFIA 4N9EA 3STCA 3A9BA 3GDRA 3PWGA 2VGFA 3SCQA 3AIBA 3B06A 4O15A 1N55A 1KCZA 3JRKA 1JYWA 5K4ZA 4R9OA 4KFOA 4J28A 4BF5A 1RK5A 4CQAA 4UTMA 3W1RA 2E9BA 2C1HA 2AAMA 4GVHA 3CK5A 3LTYA 1PKYA 1G9HA 3BAIA 2WZEA 2E25A 2RJGA 2W4XA 4I6VA 3QQWA 3ELFA 3QV9A 1EF3A 3S6OA 3TQKA 2ABAA 1ADSA 2WZTA 5DMYA 2J78A 1J79A 1UMLA 3WLIA 1I0DA 2CW6A 5LYRA 2RDXA 3N4FA 3EB3A 4EK7A 2XH2A 3GG0A 3BK0A 3W4RA 1RSCA 3SUVA 4E2DA 1SZNA 3LK6A 3HGSA 5I03A 1OGBA 1BG4A 3FYYA 3ITLA 4XZHA 3N34A 5HK4A 1JYVA 3CHDA 4DXVA 4YTRA 4IOTA 4REQB 4X2RA 2WMKA 3F5KA 4GX8A 2X2GA 4J3XA 2NVAA 4XAPA 3ZFHA 1J10A 1QUMA 4W8BA 3KP0A 2FHFA 1DYSA 3EWWA 4J4KA 2VTFA 1UH4A 1DWHM 3AZRA 3L66A 2ALDA 5FEZA 4Z2HA 4N7QA 5F7UA 2PDYA 5FAGA 2WMGA 4HGXA 3AOFA 3N2CA 2CWNA 1Z42A 5E0KA 2R1PA 4LQ1A 1FBAA 4TTUA 2FZ9A 1O4UA 4LRTA 3PZTA 4M5PA 4NU7A 3I6RA 4CD8A 1GW9A 2Z7KA 2E1WA 2Z1KA 4OJYA 4OGZA 3U3HA 4LUSB 4HCDA 2ACRA 2QKFA 3BG9A 4DBWA 3SDOA 3RO6A 4UOZA 1SFJA 1XYMA 5D2WA 1B9BA 1LYXA 4PUWA 1EA0A 3IARA 4MYXA 1B90A 1OYBA 5HNUA 8XIAA 3QH2A 3MWCA 2OVLA 2YDRA 2WANA 1TMLA 4NJJA 3H7VA 4FF5A 3V16A 3IV3A 4D6JA 2ZXQA 3B0PA 4KESA 2A3AA 4BZYA 2WQDA 1TJ1A 1W9XA 3NQ6A 3RRAA 6CGTA 3LG3A 1GQJA 4W7WA 5CBJA 3II1A 5A6LA 3LSCA 2QF8A 3LRMA 3TH6A 1GOWA 3C3UA 1MQPA 3T6CA 1ZAHA 2V63A 4Z17A 3IAQA 3S9ZA 2FZBA 4XD5A 3LLDA 4G7EA 3EWUA 4HK6A 1ALDA 1RJPA 1TFVA 3AYRA 4PUKA 1SR9A 5AYIA 2R9RA 4R5EA 1V3JA 3M0KA 2WJEA 1U5VA 3WQ4A 4L56A 3V1PA 2GQ8A 4DM2A 3HGOA 2PGEA 2D0HA 4S3DA 2V2CA 4CCEA 3WIJA 3NQFA 4RNIA 3W2KA 2YL5A 4A4AA 2C0HA 1ICQA 3W1UA 2WWCA 3SJNA 5DY2A 2V30A 1OADA 1PHWA 1XLJA 1PUDA 2D2JA 1DOSA 3WDQA 3NJ3A 2WMHA 4EPEC 1PO9A 1LZOA 2FTPA 3TXVA 1YRRA 4HMEA 2WPBA 3LHVA 1LL7A 1S46A 3AYVA 1KLYA 4FNTA 5BCAA 1M6JA 2ZYFA 4AISA 5KMYA 2VQUA 4IMEA 1YXDA 2V3GA 2AQWA 2WZMA 3SCPA 4PGLA 3UXAA 4HHMA 2DZVA 3AIEA 3UY8A 2A79A 1OCBA 1RY0A 2ISWA 3VOCA 1FQ0A 4QSHA 2DT3A 4BQ5A 3LXCA 1M68A 1R8LA 3PM6A 1K9FA 3FVDA 1P1MA 1RXOB 3KL5A 5BMXA 3ZXWA 3GXFA 1KLZA 4C5YA 1F73A 4H8NA 3GD6A 3MKVA 3E96A 4LW7A 2BHUA 2J77A 5U4NA 4IL0A 2E8YA 4LAUA 4F0RA 2C19A 1B1YA 3MVIA 3EWZA 4QQUA 4NZFA 5BRPA 2YB4A 2PTZA 3WDJA 3WN6A 4PMYA 5AHEA 4FR6A 5D9NA 4UTWA 2QPXA 2XYLA 4ACZA 4MKNA 4C6LA 1IXQA 1EF2A 4PEKA 4JTDA 3M41A 1S3TC 1QI4A 4QG9A 4LV4A 3W7HA 4JYEA 1KBIA 2X1RA 3T8QA 3GH5A 3G1AA 2YBTA 4YPJA 1Z9AA 5D37A 3CUHA 4GXPA 4IG2A 2V67A 2XWDA 2A6LA 1EIXA 2I7GA 2VC9A 3VOGA 3R13A 2QR6A 3AROA 4HYWA 1OK4A 3A3XA 3OBAA 3QC0A 3F2DA 3ZWTA 1F3TA 4AIUA 3S6DA 2WBGA 1KM2A 1WKDA 1E9ZB 4BWLA 3KRZA 2X7WA 3WK0A 2WLZA 2AAAA 3NQAA 2DUXA 3SCVA 2CXGA 2I56A 1NVMA 2Y88A 3WEZA 4H00A 2H9AA 3RMJA 3APTA 1CI1A 2BY1A 1EC9A 2RDTA 1XH2A 4XB3A 4N6FA 1FDJA 2E6AA 2C0AA 1XF0A 3E2QA 3K13A 3UWQA 5G1TA 3ZO9A 4M6VA 4RK8A 2Z29A 3IJDA 4GY1A 4ICNA 3CWOX 1MWOA 5D03A 1UD6A 1JQVA 1K4GA 1OCNA 2O55A 4GVGA 2TYSA 4DYEA 2Y62A 4XZIA 4IIGA 3B0UX 3IVUA 1J8VA 2V8ZA 3HQOA 3OZPA 1H7XA 3S1VA 2PWHA 1OG0A 3A23A 4KWVA 4Q8TA 4DF1A 4MB1A 4W7UA 1XDMA 4LH8A 3BGJA 3P93A 2FZMA 1O60A 2EJ1A 1K9TA 2HZGA 4IIEA 4FI4A 2GGJA 5FEPA 1GQIA 3ARQA 1JI1A 3M43A 2PLMA 2QGYA 1PZ2A 1CX9A 4X61A 5HPOA 4UTFA 1W37A 3VC6A 1JULA 3HN3A 2OWCA 2PDMA 3I6TA 4C1NA 1H7RA 4YVVA 1W2PA 4HU8A 4GHRA 4XBJA 3DEQA 2Z00A 2BY2A 3GTNA 4HT3A 1HT6A 2E6FA 5TBOA 2FJKA 4BA0A 3WJYA 1QFEA 3WH7A 3K8KA 3OB8A 4AHQA 3LHYA 4P61A 4YTSA 3S47A 2ZX6A 3ISIX 2V5DA 3WBXA 3M5ZA 3AHZA 5J8LA 3ABOA 4DYJA 2GDUA 1JIBA 4H9TA 4D6IA 1EBGA 3W6LA 2PDNA 3SY1A 1GORA 3LRKA 2VCBA 4QXIA 3W74A 3BJFA 3MMWA 4U2YA 1B4KA 1NJJA 3P67A 3BCJA 2YDSA 1X38A 2VFEA 4AFYA 1IR1A 4M7TA 5C8BB 3W1LA 3Q2DA 4JTGA 3IIVA 1YE4A 1RCOB 1UOZA 2DZTA 1TVPA 3W3OA 4JTRA 1RA0A 4WF7A 3A13A 1CZ1A 2PC8A 5D2YA 3T81A 3IVTA 1IWPA 3GXDA 4AZHA 1J2WA 1LP6A 3HU7A 1SFSA 3NYDA 1NY1A 2ONEA 2PCEA 4Y2WA 1YTKA 1G5AA 3HGRA 3KUMA 5CGMA 3W7GA 3M64A 4TV6A 4D6CA 2FYMA 3SRFA 3P0XA 2G4JA 3QZ6A 3JZEA 3VNMA 3PTDA 4RPQA 2NWRA 4NVTA 3W76A 1XL9A 3GC5A 3SSJA 1E6QM 4BJHA 2D3NA 3FAXA 4CNNA 4WD0A 4CQ8A 1X1NA 4AMCA 3QLLA 3BLKA 4A2SA 2BOFX 2BHYA 1TVLA 4I9TA 4S3CA 1P48A 4JZ5A 4G2DA 4YIWA 2F2HA 3UJFA 1CECA 4Z42C 2WC3A 3GFXA 2Z27A 3EA2A 4GY7A 5CJ5A 4LB4A 3WD2A 1W8GA 1VPXA 3G77A 3VU2A 3PBMA 2CIPA 5CSYA 3TYDA 1ESWA 4ZOAA 3MBFA 2G0WA 3BVJA 3GBDA 2P88A 5IBXC 3CEPA 3A24A 3TNBA 1T6MA 4FS9A 1W56A 2DH2A 2YFNA 3ZIZA 2UY2A 3BOXA 3V5OA 3IRDA 1W9PA 3S9IA 1J12A 3GHTA 3XINA 4M51A 4YTQA 1M3UA 4MADA 3VGFA 5A69A 4Y96A 4I7WA 1R38A 2ACUA 2XJ7A 2BGSA 2DT1A 6REQB 2EG8A 2DVXA 1BKSA 1PX8A 4BQ4A 3EDKA 1K77A 3ZR5A 1WP6A 4S3GA 2D24A 1PAMA 4QQ3A 2WNZA 5CSUA 1XC4A 2NUYA 4IICA 5TNVA 4H9UA 1DIKA 2P5NA 3K4WA 2IPGA 1P0EA 1OYAA 3GZAA 3QW3A 1HKIA 1Q7QA 1OFBA 3SEPA 4Z2LA 3DAQA 4NG3A 2G37A 4J3WA 1KRAC 4IPJA 3LCLA 4H19A 2WHMA 4R53A 3LYEA 1QR7A 3EYPA 1JNDA 1FWJC 4L5ZA 1JXJA 4S3FA 5I6SA 2AQVA 1KB3A 4CNOA 3M6DA 2X7VA 4P2VA 3OZYA 1A3XA 1XUUA 3H7UA 3MSGA 5F1UA 8CGTA 5T8GA 1AD4A 4GUJA 2GUYA 3VNLA 4L64A 2W3ZA 1XLGA 1GHRA 1GVOA 4IHCA 1EZWA 3ORWA 4NNBA 5KSWA 3DBPA 1QK0A 3HPAA 1CEOA 5ABFA 1GVQA 4UXDA 4GO9A 1TMHA 3KVJA 2ACSA 1HX0A 1TZZA 1GQLA 5IM51 2XDFA 3C0LA 2VVNA 3RR4A 4B91A 3A21A 4FB7A 1XLLA 2QCDB 3WJWA 3MP3A 5HBFA 2X2YA 1HUVA 3VKDA 3WBEA 4AUBA 3S9YA 3V3WA 1Z7AA 2XSAA 3CQ0A 4K1GA 4L4PA 1KM3A 1ZAIA 3TR2A 3G6LA 1OABA 4GINA 4O57A 3P8IA 3LPOA 2JEQA 1G01A 1W1A1 3QLDA 1FH8A 3BC9A 1J96A 3SQLA 1PCKA 2VCCA 3LQGA 7TAAA 5TAOA 1C93A 4MLRA 3PSWA 3F2BA 1EWDA 3WKZA 3Q45A 1KTNA 3MO4A 4NRRA 4AU0A 3FAWA 2VEGA 2QNEA 2PDBA 5I3DA 2PFHA 2CZDA 3AS0A 4WJXA 1NM9A 3IVSA 3P0WA 5DY3A 4JL2A 1UUMA 1OFAA 3IK4A 2ZRWA 5ABTA 3R0DA 3MYPA 1L6WA 1XRSA 2DZAA 2DY3A 1A3HA 3C0QA 1H1YA 3WD3A 1FXPA 3BAWA 1KFBA 1AVAA 2NV2A 5LIYX 3NZQA 3GW0A 1FHVA 4D6GA 2BGQA 4ZODA 3EPOA 1TZ7A 1GG0A 7REQB 2YZ5A 3WUFA 3ZMRA 1E51A 3AAMA 1GW1A 4O1AA 3SQMA 4GYPA 4C1KA 4HJFA 2G8ZA 5A2AA 4M0XA 1E3XA 5GNYA 4MNLA 2WZHA 3K46A 3W7PA 1WA3A 4RV8A 5BNKA 4OE7A 3K4DA 4GC3A 1PCWA 1IEQA 2WNQA 4B92A 3TC7A 3U8GA 1IGSA 3A4XA 2DSKA 2ICSA 4KEZA 4Y9OA 2HJPA 2P8CA 5DCDA 4LGXA 1GVSA 4YN5A 3NWRA 3MT1A 4PB3A 4HJWA 3HV9A 2PP3A 2ISFA 1TUFA 4MMWA 1ME8A 5HWJA 3R11A 1W9VA 3NO1A 3C0SA 1ELSA 2J4GA 1TPH1 3NOEA 1MQRA 3B9DA 3UBPC 3HMJG 1Y5VA 3O1NA 2QCNA 1QI0A 1VRDA 1R3RA 5G1YA 5GNXA 3UPBA 3WJXA 1KM0A 4KEUA 3GDBA 4HMCA 4HU3A 3ZJ8A 1PHQA 4MWAB 2C7FA 1MUMA 3E49A 5FCZA 4JFVA 3ATZA 3MCMA 1HJXA 4LPCA 2PMQA 3EBVA 4LCRA 4NUWA 5E6YA 3G0SA 4UQEA 1JRCA 4ZOBA 2E9MA 3MP5A 3RM4A 1Q7ZA 1GJPA 4HYVA 4FXFA 5FJJA 2VGGA 1OC7A 4CKQA 7ODCA 2AL2B 4X63A 3GQYA 3U48A 2V2HA 3V5CA 4CUCA 1V7YA 1V3MA 1RCQA 1AL7A 4J2PA 3DYMA 1DIDA 2VZVA 2VMFA 2WHKA 3Q65A 3RJYA 3NQEA 5CZJA 3REQA 3XIMA 2ISSA 3EX6A 3P6LA 1UW9A 2D2HA 4JTKA 4RKAA 1S2VA 4AWSA 4R33A 4Q4KA 4N9BA 5FKYA 5H8UA 3FKRA 3W00A 1FWGC 3P60A 1X6UA 3CT7A 3LXAA 5XINA 2WMFA 1AD1A 2E77A 5I3FA 4F4RA 4RUBA 3ANUA 3GNRA 1DP0A