3NQDA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqdA00
2CLIA 3PUDA 1KFBA 2OT1A 4HHPA 3P8IA 3DAQA 3C56A 3FYOA 4UFLA 2B7PA 3PBUA 5HWMA 2O7SA 5AHLA 3W1NA 3C0JA 2GOUA 3PR2A 2EKCA 2ZZ1A 4ZZ9A 4JICA 2HS8A 3QFEA 1XBVA 3P60A 3L0NA 4QM1A 5DN1A 3TC7A 3W2UA 3W73A 5K2ZA 3HGSA 3N2XA 3OVRA 5FF7A 4J9JA 5T26A 3HMJG 2FIQA 1JCXA 3GDTA 5BW6A 1FXPA 3L5MA 4LT9A 5G2WA 5FF3A 3B0PA 3EKLA 2DZPA 4O1AA 3G1YA 1H5YA 2J6XA 5U7SA 3KFTA 4ZQOA 3O16A 4HSNA 4MJMA 1ML1A 2W0UA 3TSMA 3IIZA 2GVLA 4LRSA 3LHUA 4RKAA 1MSSA 4UFIA 1PS9A 4NJGA 5LHEA 4NU7A 2WNZA 1TJPA 3L21A 4JTKA 1G7VA 1DJNA 3W7MA 1M7PA 2WOQA 2P0OA 1JQVA 2R94A 3DZ1A 1I8JA 1GVRA 1K7FA 4PODA 3VE9A 2NUXA 2J24A 5F4SA 4WZHA 3QW3A 3BG5A 1NEYA 4KFNA 2QF7A 3I7SA 3HG2A 4IGHA 2Y61A 1G4PA 1ADOA 1C29A 1VJIA 1WDWA 3G1XA 3R8RA 1ONRA 3S5YA 2GQ9A 3NQ7A 3PBVA 4K8EA 4CCDA 3BG9A 1KTBA 1YDNA 3JR2A 4FX8A 4XWUA 3IRDA 5LNRA 3LCIA 3LLFA 4MFDA 1ZAJA 1LDCA 3CU2A 2Y62A 4BK9A 2ATMA 3BW2A 1EB3A 1OK6A 3TROA 1N8FA 5KMYA 5E93A 1LROA 4GBUA 1VYRA 5F4WA 2OMAA 2RDUA 3MI3A 4M7TA 1VYPX 3TR2A 4JTGA 1QWGA 2ZZ5A 4R53A 2DU2A 4O4WA 4OE7A 3FKRA 3G18A 1EWEA 1JUEA 1TPVA 3L68A 3DKJA 3I68A 5KTLA 1OX4B 3LGEA 3LXBA 3HJZA 1OFRA 1RPXA 1I2OA 1XUUA 5EYWA 2HSAA 3Q58A 3A5FA 4O18A 5FEZA 3A22A 3CB8A 5HR7A 1QMLA 2Q3RA 4EF9A 4O11A 5AYXA 2GJNA 1P1XA 3F03K 2ZRYA 1FUYA 2NXGA 5CZJA 3GDKA 4FX7A 3PBWA 4NNAA 4UR8A 3S5OA 3G8EA 1I2QA 4GUIA 3NQ6A 1GWJA 4Z08A 1XCFA 2C15A 3BGGA 4IWWA 4LOCA 1AW1A 3HF3A 3TX9A 5IM51 1K7EA 4RZ5A 4UFHA 4KFPA 1C8VA 3SGUA 1X1ZA 3HGOA 1XBXA 1YXCA 3U2OA 1GT8A 1QPOA 3NO5A 1X6UA 1YDOA 3SGZA 2TMDA 1AW5A 3BGJA 4X9SA 3AO0A 4JDYA 1RZMA 1XC4A 4JXCA 3QEZA 2VEIA 1H1YA 3G0XA 3Q37A 3NQFA 3O63A 2Z2UA 3NDOA 1OF8A 3VFLA 2Y70A 1P5BA 1FCQA 1W37A 2VXNA 3IVUA 3NVTA 4UUIA 4AF0B 3B04A 1IXNA 3OG3A 5EL1A 1FXQA 4LNYA 3C2FA 2WNNA 4XTIA 3LB0A 3GXPA 1DORA 2Q8ZA 3TK7A 3T4CA 1FCUA 4UTIA 1KV5A 3IEBA 3W1PA 4FB7A 1F5ZA 5AC7A 3P5ZA 1VYSX 3T55A 4L4MA 1GVOA 1T96A 3M43A 1Q3NA 3A5VA 3O8AA 1WXJA 3LBCA 1W3IA 1I4NA 3ELFA 4N9DA 3RU6A 4N6EA 3W88A 1KM0A 3GKAA 1TV8A 3C3NA 4Y9AA 4YL2A 3O07A 3DGRA 2YW4A 3FJ6A 5TIMA 1OFBA 3EXSA 1DL3A 2C13A 3KVJA 4O14A 1E51A 3P7YA 1YTDA 2E6DA 1OX5A 5G2IA 5LNSA 3MI6A 4AAJA 5G2HA 1X1OA 1OYBA 1W0MA 4O1DA 1EA0A 1Q45A 3UZJA 3ZWTA 4O0KA 1ZHAA 1L6YA 1FWWA 3UXDA 2Q3OA 1O4UA 3L66A 4O1CA 2A21A 2I14A 3W23A 1ZFJA 4JIQA 4KFOA 4UTMA 4FNUA 2F7FA 5EPDA 2YW3A 2NV1A 3MHUA 3PB2A 5L6UA 3RLUA 3O6CA 4HN4A 2QCDB 3EWXA 1NF0A 1ME8A 3EXRA 5G5IA 4NJJA 4EOUA 4IX0A 2QCNA 1H51A 3S1XA 4RX0A 5FF4A 3M44A 2E5BA 2TRSA 1ICPA 3DFQA 4D2JA 1K8ZA 2E77A 3KVMA 4K38A 3CLMA 3LHZA 4FNTA 2G96A 1V7YA 4LVBA 2QDHA 3QPZA 4XBKA 4CLMA 1QNVA 3LDVA 2YR1A 1SO4A 5LGZA 1VC4A 4GNJA 5CZTA 2X1RA 4FIRA 5I3IA 2V0TA 2J9ZA 4N9EA 3W1LA 3STFA 4PL2A 2W6RA 3B0UX 3MHFA 3FYPA 6ALDA 2KZHA 3NL5A 5D05A 5HNRA 3LCFA 4UFJA 3W1UA 1Y0EA 3N9RA 3QMTA 3W1TA 5GVJA 2A4AA 3NZ1A 5A8GA 3M0ZA 1W56A 1D3GA 4WQ6A 1H7PA 2JK2A 3I65A 1Q6RA 2PRMA 4WD0A 5E1QA 4Q4KA 5HQEA 4HPXA 1QOPA 5AHEA 4UTTA 3NM1A 3B0VC 3W07A 4MYXA 1OFOA 2XFWA 2B7QA 2UV8G 1G4TA 1M7OA 3BK0A 1HO1A 1TPEA 4MZ1A 4JTLA 2TYSA 2FPTA 1YDVA 4RV8A 1THFD 4FNRA 2J88A 3W3OA 3W2JA 1B57A 1P0NA 3SY5A 3GNNA 2GQAA 2NV2A 3HQ1A 3A21A 1HG3A 3NR0A 3CQ0A 4ZL1A 2G97A 1OK4A 5IBXA 3SECA 1ME7A 1VLIA 4HSOA 2WKJA 2WQPA 3R89A 1VPXA 2ZA2A 4MY1A 5FESA 4Y8FA 5CSSA 2YDAA 2ZTKA 4CNOA 3N2MA 4AHQA 2C3ZA 3EX1A 3LOTA 2P1FA 5HUOA 5AB3A 5AOUA 5C2XA 4O8RA 2QJIA 3FIGA 2DJXA 1TO3A 3TQVA 3NPUA 5D32A 1LLZA 1YTEA 1JR1A 5F2MA 3TMQA 2ZZ2A 3PG8A 4K6AA 4MOZA 2B4GA 2QEZA 3LBMA 3QC3A 1PVNA 4X22A 2CLLA 4GJ1A 1K3UA 3CT7A 4QIUA 1N7KA 3H55A 4EVZA 4AEOA 3LCWA 1JQXA 3TA6A 1XKYA 1TPWA 2WPBA 3HIJA 5LNUA 2X1UA 1LZOA 1YXYA 3DFSA 1U5JA 4QISA 4E38A 4JN6A 3CTLA 5BRBA 2PRLA 2B7OA 5CPLA 4MLJA 1T0OA 3BPWA 3R5EA 1MEHA 2ZA1A 2ZRXA 1OYAA 2Y7EA 3Q94A 3THAA 3PAJA 3G1SA 4FNSA 2EPHA 4MPQA 4IX2A 5K3VA 3BO9A 3NM3A 1TIMA 4N9CA 4O4VA 2CLHA 1ICSA 1JJKA 1VHNA 1TTPA 1GG0A 1FWSA 2QDGA 4R34A 1XDLA 4ZQCA 3W7KA 2H3DA 1SO3A 5D2TA 2FDSA 3UWQA 1UUMA 4E2DA 2ZZ4A 1F7BA 1TJRA 3NL2A 4N6FA 3LTSA 3W2MA 5AYYA 3F4NA 2VKZG 5CPOA 3N34A 2E5DA 4MKNA 1PCWA 2JGYA 4EWND 5G1TA 4LTSA 4WOQA 3M41A 2CLKA 3OIXA 4WOZA 3IVSA 3L65A 4Q33A 2RDWA 3I7RA 4JR5A 3TH6A 2QCLA 4CQ8A 3NL3A 2A1YA 4DBDA 4LRTA 4WXZA 2EHHA 3MMTA 2CLFA 5HR6A 1I2PA 3UY7A 5CGQA 4POCA 1UJPA 4K8HA 3CWOX 1SPQA 3MP4A 3LCLA 3NQMA 3IGUA 4MUZA 1EX5A 4XKYA 4O19A 3RF9A 4R7JA 5D33A 4P61A 1ZJIA 5HMSA 3V75A 1SZEA 3MI2A 4PTNA 2FB2A 3W7NA 4I7UA 1RVGA 3TXVA 2ALDA 3FS2A 4UC5A 3LXAA 1DQXA 2OT0A 3LHYA 1Q6OA 1XBZA 3EX6A 4Z0SA 2BWGA 1P4CA 1ZY9A 1W31A 5DLCA 3IIVA 1CI1A 4IMEA 3W7JA 5L9FA 1YLVA 1T8XA 1BEUA 4TMCA 3TUUA 4ADSA 4JYFA 4QJ1A 3W7EA 3RFAA 2ZZ3A 3MP5A 5J5DA 1TPH1 5TQLA 2Y6ZA 4I7VA 3W86A 1VR6A 4YMZA 4WXYA 4GE8A 3LCXA 3TW7A 2JKAA 3YPIA 3QH2A 5K7JA 1JCNA 4M7SA 3KVLA 1TPB1 4IJBA 3EXTA 5BNKA 4CQAA 3WK1A 1FX6A 3KRSA 5D04C 4NZFA 3W1XA 2GVJA 1S5TA 3GK0A 4HNVA 1KM4A 2NWRA 1RD5A 3BV4A 4CNNA 2A7NA 4JTSA 3DFOA 2GVGA 1UBSA 2QUVA 3CHVA 2JKEA 2QCHA 3UWVA 4JY9A 3C2EA 3PM6A 1XUZA 2ZBTA 3W83A 1JVNA 3G1HA 2C6QA 3JS3A 4NZJA 3VE7A 1F73A 2C19A 3HPZA 3P61A 3GDRA 1UUOA 3SFKA 3VKJA 3W7RA 3NQAA 1X8FA 2V5BA 3C8FA 5DBTA 3QQ1A 5CKSA 1AK5A 3TKFA 4PEKA 1PCKA 2WSRA 3NGJA 4AMAA 5I3JA 4ALDA 5KZMA 5D2YA 1OYCA 2V2CA 3O15A 3O6DA 3P82A 5AC6A 4E0CA 1EP1A 3S1VA 1D9EA 1A5SA 1KTCA 4S2CA 4ZQRA 4I9AA 3UWZA 5KSWA 5D38A 3M5YA 1B9BA 1XBYA 1LBLA 3PC0A 1L6WA 3PF3A 5AHIA 3M16A 1A5CA 3HPXA 4EIVA 1QR7A 4HPJA 1I45A 4GFSA 2FPVA 4QQ3A 1H63A 3QZEA 4RJEA 2ZZ7A 1NSJA 4IMDA 1GEQA 4Z1AA 4FX6M 3SIZA 1ZAHA 3N9SA 4NX5A 4Z0JA 1V5XA 3NEVA 5I3HA 5LKYA 3LHVA 2VC6A 2HTMA 4H6KA 4OV9A 3S6DA 4ADUA 1K8YA 4I7WA 3JRKA 3W7CA 4Y6GA 1ALDA 2V81A 1G6CA 1BWLA 5D37A 1MO0A 3HG4A 2VEMA 1SFJA 5E0KA 1TV7A 1AL7A 4NX0A 4ZMGA 1SFLA 1SUXA 4TMBA 4JTUA 2YFOA 4M5PA 1JCMP 3SI9A 4GC4A 1R46A 4RZ4A 2QCCA 4ADTA 3DU0A 4HNTA 1A53A 2J27A 4JX5A 4TU1A 3GKFA 2ISSA 5FF2A 4IPIA 3WJWA 2BXVA 2CZDA 3TQ0A 1T99A 4A2RA 5LZLA 3W7GA 3TC6A 4AB4A 1G67A 4WY0A 3DH7A 2PURA 1QDSA 4XUGA 3W74A 2DZSA 2NWSA 4LC8A 3EWUA 2I1OA 4BFAA 4A21A 3C4UA 1XM3A 2VFFA 4YLWA 1XI3A 3LTYA 3NYZA 5DBUA 4RCXA 2YX0A 2DZUA 4DPQA 1M5WA 3Q2DA 1OG0A 2C14A 4OWGA 3VI2A 5AC8A 1FDZA 4NJIA 5DXYA 3G1AA 3W1QA 2B7NA 3GXTA 4DO4A 3I7QA 1GPWA 3LI1A 2QCEA 4QITA 2YYTA 4ORIA 3BVJA 1WOAA 3NL6A 5K4XA 1IIGA 2QJGA 4LV4A 1R2RA 4NNCA 3LCGA 1SSDA 1VQTA 5C5YA 4A22A 1S5VA 3CM4A 3SR7A 3CEUA 2DJLA 1WYIA 2NX9A 5H91A 2CWNA 1J5TA 1KA9F 3FFSA 4RXGA 1TB3A 3TW6A 1SW0A 1KFCA 3CWNA 2XN2A 1TQXA 1OABA 1DVJA 1MXSA 4HKPA 3ABSA 3OA3A 4A29A 3W87A 4NJHA 1K7XA 3UWYA 4MY9A 1GVQA 1RQEA 2RH9A 1O5XA 3E02A 3OVPA 1WA3A 3V1PA 1B4KA 5FEXA 2C16A 3B4UA 5LGXA 3T7VA 2E68A 3L5LA 4QSHA 5F1UA 1A5BA 3HOJA 3RK8A 2QAFA 2CLMA 2BX7A 4B5NA 3QW4B 3LTPA 1R47A 2E1DA 4ZVJA 1SR9A 3UWUA 3KAOA 4ZQPA 5KZDA 3E49A 3TAKA 1EUAA 3KOFA 3M5ZA 1DHPA 3HGJA 4XKYB 3OHIA 4WJEA 1L9WA 1GVSA 1QPRA 3C6CA 3ABQA 3UWWA 4N2YA 3IIPA 4LUJA 4M19A 2HMCA 5LNVA 2X2GA 3FOKA 2VFGA 2NXIA 5G1YA 3MO7A 2R8WA 1Q6LA 3UPWA 4O28A 3O1NA 4JD4A 3NOEA 4OBTA 1EP3A 1FWNA 2E09A 4JTEA 3UXAA 5HWNA 3RNDA 2NUYA 4DQWA 1XFBA 4IMFA 2D73A 1I2RA 1OJXA 3ZWSA 4ONVA 4GRSA 2ZQ0A 1O94A 3ZS4A 1OX4A 1KFLA 4O1BA 3NPXA 4H4IA 3UZ5A 2BLEA 5EKYA 1TTIA 1YTKA 3LM7A 2AAMA 3VCRA 4LC6A 4N02A 2QKFA 2WSYA 4O57A 2WV8A 4K7YA 3HG3A 3W7QA 4UMCA 1TPC1 1L2UA 4FEZA 2A7PA 3NZRA 3T44A 4HNUA 3UD6A 1EPXA 4RXFA 1H61A 4NJKA 1R2SA 2X16A 1Z44A 1Q6QA 3M9YA 1LCOA 1XDMA 3LERA 3G1DA 3INPA 2WJZA 4UTHA 1A50A 3G0UA 1KW1A 3HBLA 3QRHA 2ISVA 1H1ZA 1TV5A 2JGQA 5CSRA 3BW3A 5MHBA 3NQCA 1JRCA 2ISWA 3P84A 3QQ0A 2Y89A 3PBYA 5LHFA 3MWAA 3TSBA 4UTWA 2AQWA 2RDTA 2R14A 1G4EA 3R2GA 1DJQA 4JNMA 3EKZA 4Z1DA 3BW4A 1W5MA 4BWLC 4GUGA 4RLIA 2CZ5A 2EAWA 3DKLA 2VOMA 4CNPA 4O50A 1F6KA 1CW2A 1KM6A 3SZ8A 3L5AA 3LHTA 4MYAA 2P10A 4TX9A 2Z6JA 4O17A 5F2GA 2WO5A 3KVKA 4FO4A 3EX2A 4JTJA 1LOLA 2H90A 4IXHA 1XL9A 4C1KA 1C9DA 3VNDA 1O5KA 4MZYA 3U8GA 4LS2A 1PV8A 1F2JA 1KFKA 1RQBA 2BTMA 1WX0A 4K7VA 3NA8A 3GZ3A 1W5PA 4AWTA 1VS1A 2XN1A 1B3OA 1H60A 5DY3A 4O52A 4TR9A 3GYEA 2YCEA 4LW7A 3QJAA 1FQ0A 4DF1A 5LSMA 4YXGA 4MZ8A 5H2ZA 3C2RA 4NNBA 5CPMA 3MUXA 4GXMA 3O05A 3NG3A 4JS3A 2ZCGA 2ABBA 2JBMA 1N55A 2YZRA 3S1WA 2CZEA 4O13A 1TPUA 1XXXA 1ZENA 1YPFA 3L9CA 1KLYA 4GUJA 5CZ0A 4XBSA 1RQHA 2NZLA 2OJPA 1J4EA 1ZALA 3TJXA 1VCGA 4UMAA 4K36A 2Y7FA 4XZ9A 5HUPA 3ANYA 2YYUA 3G3DA 1VCFA 2VFEA 2DZXA 2FLIA 1W3TA 5AHNA 3TXZA 4MVAA 3STGA 1BKSA 1DV7A 3GNDA 5FEPA 2TSYA 5DCBA 3IGSA 1HTIA 2G5WA 2OCZA 4N9BA 1TREA 4BI6A 2C0AA 4RK8A 4DF0A 1EIXA 1ZCOA 3TCEA 4FNQA 3LRKA 3G8RA 4O0ZA 5KZEA 3STCA 3QM3A 2ABAA 3M47A 2ZRUA 3SJ3A 3KRZA 1S3HA 4R33A 4WY0B 1LRQA 1CX9A 3I6RA 2YFNA 5IBXC 1SW3A 1GYNA 2GUUA 1NF7A 4Y90A 3PB0A 1EUNA 4UTLA 1LM1A 3PVFA 4S1FA 4UR7A 1NFBA 1B4EA 1QO2A 2Z6IA 2A7RA 2NXHA 4GUHA 2YPIA 5KITA 1AG1O 4UCGA 2HS6A 3UQNA 2PE4A 3ABRA 4M6QA 4P2VA 5HWJA 3THQA 4O10A 3M5VA 4NUWA 4W9TA 1AMKA 3CPRA 3WJYA 3HGRA 5J5RA 3W7LA 5FEWA 2J9XA 4FXSA 3GLCA 3S42A 4BF9A 3DENA 3KXQA 4O12A 1MEWA 1QO5A 2ZFAA 5F2IA 5ABTA 1WQ5A 3K30A 4HNNA 3B03A 3W7IA 2GJLA 5D03A 3WJSA 3S8HA 3EWWA 3W85A 2Y7GA 1IIHA 4ORMA 5TBOA 3PULA 2FFCA 4UFMA 2A2IA 4LS1A 3TJLA 3WFAA 3L0GA 2JKPA 1NAL1 3TV8A 1HL2A 4DEFA 1GVFA 1KBIA 2V8ZA 3TE9A 3UYCA 2FPYA 1AW2A 1ME9A 3GDMA 1KFEA 4MIMA 3IIOA 3NQGA 3NXFA 3M7WA 3EEGA 3USBA 3DBPA 3S1UA 1HUVA 4YCOA 4UNLA 4JTIA 2Y88A 3N14A 4X2RA 4MFEA 4C1LA 1BWKA 1DBTA 4UMBA 4S2BA 1TQJA 3TFCA 4K37A 5BMWA 3TSDA 1G7UA 1YADA 1JCJA 4FHAA 1LYXA 4IMGA 3EX4A 3EB2A 2V2HA 2QR6A 3PSVA 2YSWA 4BR1A 1OFPA 2PRHA 3DHFA 4JTFA 4XQ6A 2VFDA 3W1AA 2CW6A 1VLWA 1GJPA 3TAOA 2CZFA 1F76A 3B05A 1Z41A 5FI8A 1FWRA 3P74A 2YXGA 3HG5A 5F4XA 5D2WA 4OV4A 2EGZA 2H3BA 4AWSA 3W7HA 3C2VA 3O06A 2EF9A 1OHLA 4JIPA 5CZSA 5C6MA 3MYPA 2QCMA 5HULA 4FXRA 4MLRA 2NUWA 2Z1BA 3QPYA 1MEIA 3QMRA 1H50A 3W1RA 3M6YA 2VEPA 3FA5A 5K9XA 1KM5A 4DO5A 4OQVA 2J9YA 2AGKA 5D2VA 4ZQMA 3W6YA 3U6WA 1IXPA 3FLUA 3IIXA 3PY2A 2E6FA 2GQ8A 2O7QA 3NQ2A 4O54A 3M1ZA 5EBUA 1H7RA 3STEA 3QF0A 3KHJA 1IXOA 4DF2A 3PWAA 4DXVA 4PCFA 2ZYFA 1SQ7A 4JGDA 5LNWA 3S0CA 4RR4A 2NX3A 3MBFA 4BI7A 4PA8A 3GVGA 4PC8A 4LWWA 1UASA 2X30A 3C61A 2QCFA 4NXKA 4KWWA 3AJXA 3MHGA 3S5NA 1K03A 4L4LA 4PH6A 4LUIA 1TRDA 4UTUA 2TPSA 4RZ6A 4IUOA 4DBEA 1KM3A 2CU0A 3LLDA 3OEXA 3EWZA 1TPDA 2ZZ6A 3A24A 1FCBA 3BG3A 3NPVA 1SW7A 3A23A 1GOXA 1KTNA 2ZA3A 4OU1A 3PUOA 1W1ZA 2ATSA 3G1VA 1GG1A 1SSGA 4AVFA 3TIMA 1UB3A 3NNTA 1YYAA 2GPTA 4JYEA 2H8ZA 3N3MA 3CIXA 4OGZA 5DXXA 4CQ9A 1ZNNA 3LXCA 3BARA 1VH7A 1F74A 3P5YA 3PS7A 3W76A 4M6PA 2Y63A 2RKXA 5HJLA 2VFIA 1EP2A 1FY6A 1OFEA 3RMJA 3S9YA 2QJHA 3P8JA 5AN7A 5DCEA 3T78A 1TCDA 4NQ1A 3P62A 1LOSA 4AHOA 2V30A 3CEPA 1SO6A 4ML9A 1IF2A 1RR2A 1W5NA 2A6LA 3BLEA 3NPWA 1HO4A 2A0NA 2F84A 3P67A 4Z1CA 2FB3A 3EWYA 3DFTA 2R91A 3LX9A 1G69A 3NQ8A 3DFPA 1TTQA 4JTTA 3GR8A 2FJKA 2I9EA 4GUFA 2FTPA 8TIMA 5K9CA 5EA9A 1IGSA 1UCWA 1WAUA 3FEMA 3NQDA 3LV6A 1MZHA 3LHWA 5C55A 3P81A 3GAYA 2A6NA 1TSIA 1F05A 4GWEA 3P80A 5CPNA 1A5AA 4BI5A 5F2LA 1DKWA 2V2DA 2VFHA 4O15A 1ZAIA 3G3MA 3H53A 4WY0F 4TO8A 3MP3A 1KLZA 4G1KA 3W71A 2OZ0A 3R12A 5AHFA 1GYLA 1OFQA 1SZNA 3W7OA 1KV8A 2ZDRA 1JULA 3TNOA 1LLWA 3OBKA 1TYGA 2WNQA 1Z48A 1HFBA 1H7NA 4QNWA 1GTHA 3W84A 5SWUA 1JCLA 1OF6A 1FWTA 4LS0A 1U83A 4YCPA 1H7OA 3W72A 3DI0A 1KM1A 5DY2A 5D02A 1PIIA 4YWIA 1D3HA 1JUKA 3CIWA 2E6YA 5EY5A 1H7WA 1S5WA 1WV2A 4BWLA 2VENA 1EWDA 3GX9A 2PCQA 2H6RA 1VHCA 4A3UA 2Y85A 5K4ZA 5I3KA 4FNPA 2NLIA 1KM2A 3B06A 1SZFA 4UTKA 7TIMA 3IGXA 1OVDA 4Q32A 4XTDA 4ICNA 2LLEA 2DP3A 3CC1A 3LRMA 1QPQA 4JX4A 3G24A 3EWBX 3PUEA 1DOSA 1VGAA 3O6YX 3MW7A 4JEQA 2RFGA 2Q8LA 4N4PA 4U4MA 4OT7A 4Y96A 2IQTA 5D09A 2RHGA 4CCEA 4NT0A 2QUTA 1WBHA 2V82A 1LRNA 3D0CA 4IMCA 3W7PA 4HT3A 4U28A 1PHQA 4NVTA 1LOQA 1J2WA 5BOOA 3TQKA 1LBMA 1VCVA 1M6JA 3GAKA 3LV5A 3G22A 3GXNA 4WUIA 4LVAA 1VZWA 2ZRWA 3LI0A 1TRIA 3E9AA 1OFAA 4JX6A 3W9ZA 3WK0A 4E2BA 4KKXA 1TPFA 1KBJA 2PC4A 4DPPA 1GQNA 4H3DA 3L2IA 4JDBA 4M6VA 4K39A 4TIMA 1AL8A 4AHPA 2X1SA 3DFNA 2BSLA 1I2NA 1JUBA 1Z42A 1QPNA 4QNEA 1FDYA 5I3GA 1DQWA 2VEKA 4IXXA 4WX2A 3GR7A 1K8XA 3N73A 3W2NA 3PG9A 2DORA 4JTHA 4LVDA 2BZNA 1QFEA 3IV3A 1O95A 1PL9A 1K02A 3GIYA 3E0IA 2C18A 3W70A 4MJZA 1LTDA 3KX6A 2A5HA 3LCHA 4LU0A 5I3FA 3QYQA 1H62A 2CFFA 4N4QA 3C52A 3R13A 1LORA 4X3ZA 2G95A 1W5OA 4Z1BA 3HB9A 3UY8A 1YPIA 2X1TA 5D2XA 3S5ZA 3EX3A 3ZR4A 1YXDA 3UPBA 3TFXA 3QMSA 3WJXA 3TU9A 4DELA 4MY8A 1OX6A 1TTJA 3NQEA 4O16A 4AWUA 4OHQA 3MYOA 1IXQA 3SSJA 3W22A 3GDLA 3F4WA 4FIQA 3UNDA 2E5CA 3MJYA 3T40A 1EEPA 1W3NA 2W79A 5DELA 3W7DA 2FQIA 3LRLA 4JYDA 4DO6A 5F1VA 3TMLA 1GTEA 4UXDA 1QAPA 2OX1A 3BLFA 2E6AA 4PL1A 1R30A 3L67A 1SZGA 4LVFA 4AF0A 5EMUA 1W8SA 5U4NA 5C54A 3SW6A 4A2SA 3E96A 1SU5A 1FBAA 1WOBA 3W1MA 3W75A 1TMHA 5BMXA 4NXSA 3A9IA 5G4EA 1LBFA 3RLVA 5AYZA 5DCDA 2C1HA 3W2KA 4IPJA 4IOTA 2B0MA 2VELA 4IQLA 1FDJA 3IVTA 3H54A 1QCWA 1W5QA 3DI1A 1SO5A 5HINA 2A85A 1FCVA 3NQVA 1QOQA 2DZVA 2QCGA 5CG7A 1F6PA 4HIBA 2ZRZA 1NVMA 1PHWA 2DZWA 1VRDA 3QSTA 2V5LA 3PSWA 4CCCA 1LP6A 4KWVA 4UIOA 4UNKA 1G4SA 3ATYA 3ATZA 3HO8A 3QSRA 5AFDA 3G1FA 4PFMA 3E12A 5D30A 2XN0A 1BTMA 3HPSA 4UTTC 3C2OA 4FF7A 2DZTA 3TDFA 3L0KA 1R2TA 3ABOA 5FF0A 1LRTA 3DHDA 3GB6A 1P0KA 4UTJA 3W2LA 5AHMA 1H7XA 3WK3A 3N19B 3WJZA 1ICQA 2H8XA 4EF8A 3NAVA 6TIMA 2QUUA 3ZFHA 1L6SA 5K9DA 1WBJA 4LV9A 1JRBA 2NX1A 2CLEA 4LY8A 3G0SA 4LVGA 4ZQNA 2Z0IA 2QAPA 3FKKA 4O53A 1O60A 2Y7DA 1JCYA 4UFKA 5KINA 3BLIA 3M5XA 4AXKA 3WK2A 5A5WA 1GZGA 4UTWC 3DXIA 4AH7A 2ZTJA 1RV8A 4JY8A 2QCDA 3MBDA 3F1QA 3OVQA 1KFJA 1X7FA 2ZRVA 5G4WA 2YGYA 2CLOA 1PE1A 3B8DA 2WSQA 3KRUA 2V9DA 4QAIA 1OFDA 3FJLA 1W54A
chains in the Genus database with same CATH superfamily
4KWSA 3C56A 3FYOA 2B7PA 2O7SA 4OUIA 2ZUUA 2ZZ1A 2FVKA 3ENLA 3VOHA 1XRFA 4PUKA 4QM1A 5LIKX 1XLGA 3N4EA 5FF7A 3BH4A 2EPNA 3POHA 5EFFA 1FH7A 1AQFA 3WF0A 3ZJ8A 3V0SA 3EKLA 1E1FA 2J6XA 4IIGA 5H1WA 5U7SA 3KFTA 3G5EA 1RD6A 4GQBA 4KCUA 3LHUA 2F9RA 3AISA 4GXPA 1W9VA 4NU7A 3W02A 4X0NA 1K4HA 2X8RA 2WOQA 2P0OA 3SRHA 1ZSXA 5BROA 2R94A 2EBNA 1K7FA 4QFUA 4PODA 1RJQA 3N11A 4WZHA 3F5JA 4OTKA 3NSMA 4EP8C 4IL2A 4DWDA 1RBAA 3WMSA 1ADOA 4YTRA 2OSWA 2R1MA 3VGBA 3G1XA 3AUJA 1BQCA 2DQWA 4MB1A 4NAFB 3JR2A 4FX8A 3BMWA 3WF4A 2ZXQA 1QI4A 2WBKA 3W24A 1OK6A 1HF6A 5E93A 3CB3A 3H2MA 3XISA 4GBUA 4TVCA 4M7TA 1VYPX 2PDYA 3TR2A 3PZOA 4JTGA 2ZZ5A 4R85A 3SRDA 3E5BA 3GVWA 2P50A 4XUYA 5KTLA 3LGEA 3LXBA 3Q45A 1XUUA 1I2OA 4OKDA 3AMLA 3SY1A 4D8LA 1KD0A 1QMLA 4W5ZA 4EF9A 1Y5VA 5AYXA 1B30A 2CBUA 2ZRYA 2CCRA 5DRIA 1C8XA 2G37A 2AKMA 1VEOA 4NNAA 1HGWA 3LGDA 3APGA 4UR8A 3ZQ9A 3S5OA 4TV5A 3UR5A 4LQ1A 1XCFA 1R8LA 1VIZA 3HF3A 4M3PA 5IM51 4AW7A 2XG9A 1AQHA 4MWAE 1C8VA 1S38A 1GKQA 2OYKA 2HE8A 1X1ZA 3C3UA 3KCLA 3HGOA 1Z89A 1GQJA 5KETA 1V6WA 3U2OA 5F7UA 1C92A 3VGDA 2UZ9A 3W38A 1PZ0A 3SGZA 2TMDA 1VB9A 2VUYA 1RZMA 1XC4A 1BXCA 3Q37A 4KT2A 2Z2UA 5XIMA 2ESCA 4TX8A 1OF8A 3SBFA 3VFLA 4FR1A 2DVXA 2I57A 2VXNA 5A94A 2YL5A 3VIHA 1VPYA 5AC4A 4AF0B 3B04A 3KP1A 4UQAA 1EXPA 3CMFA 4E6MA 4G2DA 3GY1A 2NQ9A 5CSUA 4XTIA 3GXPA 3QLLA 1K6AA 5JH1A 3AWOA 4GC3A 1KV5A 1GHRA 4EXBA 1VYSX 1BYBA 1GVOA 3M43A 2V38A 3O8AA 4CD7A 3UXLA 2DPEA 3ELFA 3PJXA 4N9DA 3RU6A 4N6EA 3OODA 4DRSA 1TIWA 5CG0A 4B91A 3DGRA 3R8GA 2BVDA 3EXSA 1OC5A 1VFHA 1DIKA 3SUTA 3P7YA 2OEJA 2WVSA 3MI6A 2J7DA 4AAJA 1MMFA 1W0MA 1O5RA 2VGIA 1Q45A 2EG6A 4NZ5A 1XLJA 4S3DA 4DJFC 7XIMA 4WDTA 1D7FA 5IFPA 3G1RA 1EZ2A 2XH4A 4ZBCA 1KR1A 4K8GA 2A21A 2I14A 1PYMA 3AJ7A 3CHFA 4E8CA 4MKVA 4YVPA 1OBAA 2DEPA 2YW3A 2NV1A 4HN4A 3VU2A 2QCDB 2D24A 3AXKA 1MI3A 1V6UA 1JDEA 3DYPA 3KZSA 2OWXA 3S1XA 4RX0A 5FF4A 1UYQA 2GQ3A 4MNJA 4DAIA 1ICPA 3VDCA 5M03A 4LYQA 1K6WA 4RW3A 3VM7A 7A3HA 4RDVA 3KVMA 4K38A 1I9CB 4OIFA 2PP1A 4XBKA 4V33A 4CLMA 2RGLA 1SO4A 1DWHM 3R4IA 3HQNA 1VC4A 1JZ6A 5CZTA 3C0SA 3TWAA 1M01A 4FIRA 5I3IA 2V0TA 1PBGA 3FYPA 4KEVA 5D05A 1JPIA 5HNRA 1XYLA 1VFTA 2O4QA 2VUNA 4L9YA 3VM5A 1Y0EA 3W1UA 2ZKMX 2FZMA 5A8GA 1ZU8A 2OR2A 2P88A 4XD5A 1I1WA 3UJFA 4WQ6A 2BOFX 2JK2A 3A4WA 4MDPA 1QI0A 2PC8A 4Q8UA 1DIOA 2WAGA 1E3ZA 4UTTA 2IPGA 3UR7A 2RJGA 3B0VC 3AYSA 4MYXA 3HFTA 1OFOA 4NRSA 4MNKA 3BK0A 4HTYA 4MZ1A 3MC5A 1KGXA 4BEQA 4Q8NA 1THFD 4FNRA 2WMKA 1B57A 3SY5A 2Y8VA 4JZ5A 4MAZA 3CQJA 4DBUA 1K9DA 1TWIA 2G97A 3R0KA 1OK4A 5IDIA 4RV3A 5IBXA 1OM0A 3JUGA 3SECA 4HSOA 3T2OA 2WKJA 1UR8A 1NWUA 1OWQA 2ZA2A 4MY1A 2ZTKA 3PZNA 2GJXA 1IZCA 3TLLA 4Z2LA 4QDWA 4UZSA 2W62A 4MWAC 3HU7A 2VNCA 3FIGA 2DJXA 1UQZA 1TO3A 2XTKA 4YYCA 4F66A 3NPUA 5PTDA 5D32A 2PDHA 1LLZA 2F6KA 5A6BD 1AZ2A 1XKJA 1JR1A 5F2MA 1JD9A 3TMQA 4K6AA 3PG8A 3IAQA 4ZSTA 2EKGA 3R58A 3QC3A 2CLLA 4GJ1A 4W5UA 4QIUA 3GU1A 4NASA 2Z29A 3G77A 3LCWA 2HPMA 4X61A 3M0JA 2CZVA 1XKYA 1TPWA 2WPBA 2J75A 5LNUA 1YXYA 4LY4A 3QOKA 3DFSA 4KETA 3TTOA 1REQB 4JN6A 3CTLA 5BRBA 1E9YB 2QS8A 2WVVA 2FFIA 5CPLA 1FWDC 1WZKA 5EMYA 3B9NA 1NDZA 2NVDA 4Q6XA 1Q8AA 3PAJA 2OGYA 1C91A 4Y9MA 3MANA 3RYSA 1Z32X 3W27A 2QIIA 1QI2A 1XLLA 4DIAA 2B31A 1TELA 3GFZA 2HBVA 4P7RA 1CB7B 1GG0A 3VMNA 1NDWA 3P3BA 4R34A 5EFDA 4AUBA 3W7KA 1SO3A 1JPDX 5A69A 2FDSA 3UWQA 5CGMA 2ZZ4A 1MRAA 3AXIA 5CPQA 3LTSA 4OOZA 5G4HC 9CGTA 4LUSA 2E5DA 1U5HA 4MKNA 3O9NA 4WRHA 1AJ2A 2D3NA 1ONEA 2WHLA 4GA8A 3L65A 4Q33A 2RDWA 3EMQA 3I7RA 1F3WA 1B31A 2V6AA 3SY8A 2REQA 3GHUA 3LGGA 3NL3A 4H2CA 2A1YA 2A3AA 5GNZA 4WXZA 2EHHA 3D5HA 5HR6A 3GTIA 5CGQA 4POCA 4K8HA 3IUDA 2OLAA 1EX5A 5DQPA 4QBXA 2NT0A 1YW1A 4GIAA 3LEPA 4M81A 1P6WA 2BY0A 4I7UA 1RVGA 1A3XA 3T81A 3LXAA 4FLOA 3LHYA 2OT0A 2BWGA 1ZY9A 4RW5A 3K5XA 3KHDA 3IIVA 5C9WA 1CI1A 4IMEA 1EDTA 1T8XA 3F4VA 3EGJA 3I6TA 2RUSA 3CUFA 1HNYA 1TPH1 2Y6ZA 3W86A 1QBAA 1XYFA 2E25A 3LCXA 2JKAA 2VRKA 3YPIA 2OEMA 4B4HA 3LENA 2ZUMA 4M7SA 1UA7A 4GIRA 3MY9A 1TPB1 4IJBA 1P7TB 3WK1A 2PDIA 3KRSA 5CCZA 1OADA 5D04C 3W0KA 4YNGA 3W1XA 2GVJA 1B54A 2NWRA 2IKIA 3JW7A 1U5VA 1NQKA 3WO8A 2OGJA 4IFRA 4FP1A 4MNMA 3ANVA 3VX1A 4JY9A 2XUCA 1P6BA 1EHAA 3IJLA 3R0UA 4LANA 2CBJA 4FLSA 2UY5A 3VE7A 1HQTA 2C19A 3GDRA 2WW5A 2V5BA 3C8FA 1CZ1A 3W6MA 2VGFA 1CNVA 3BOLA 2X7VA 1PCKA 3THUA 5T9CE 2X7WA 4AMAA 2YJQA 2OX4A 1ZJAA 2IPWA 2WJDA 3MO4A 3BV7A 4ALDA 1HJUA 3WQ6A 3O6DA 5AC6A 4E0CA 1VJSA 2OELA 4AU0A 3W4RA 4S2CA 4JAWA 4I9AA 3N2BA 4C6IA 4IIEA 4C6PA 1GEHA 3PC0A 1GPFA 1TVPA 3PF3A 4H9MA 2OKTA 3GTXA 3UJRA 4JFUA 5ABGA 4KESA 1DHKA 4LBUA 4B3LA 2FPVA 2J78A 1A5LC 2UBPC 1NSJA 2DV0A 1JDCA 2G41A 4EAYA 1V03A 3N9SA 1V5XA 2JQXA 3NEVA 2G50A 4JL2A 5J8LA 2F6XA 2HTMA 4OV9A 3S6DA 1K8YA 2HE5A 3ITCA 3AS1A 4AY7A 2E9MA 3R43A 1JF6A 1EJTC 1TV7A 3R6IA 4YTUA 5EB8A 3AOFA 4HA4A 3SI9A 1W1A1 3GM8A 2VR5A 3AU6A 4ADTA 3DU0A 2J27A 5FF2A 3WJWA 3PWIA 2CZDA 1HX0A 4A2RA 3DH7A 4KEUA 1K9FA 1RCXB 1UP3A 1XYZA 2PURA 3MV01 3N25A 5D9PA 1QDSA 5REQA 2I1OA 4J1OA 3DHUA 2XH2A 1XI3A 1XPGA 3A4JA 2PFHA 1OC6A 2XIJA 4C1NB 1DWIM 1R6WA 2FTYA 1KXTA 2ISDA 2C14A 1FDZA 3KBJA 3EZ4A 3G1AA 4K3ZA 4K1GA 1X96A 2B7NA 3I7QA 1GPWA 1WDRA 2QCEA 4IF2A 3KS6A 4ORIA 1M3UA 2Z2AA 2IKHA 4F48A 3MKKA 1M1BA 1IIGA 1FWCC 1R2RA 4XZWA 4CNSA 2PSNA 1VQTA 1K77A 3RUBL 1L6FA 3SR7A 2AMXA 2DJLA 3WH7A 3GG7A 4HNCA 3FFSA 2BXZA 4R88A 1KFCA 2J62A 1TQXA 1LWJA 2J79A 3OB8A 4RDYA 2FGBA 1MXSA 1J18A 4DLFA 1R9XA 4A29A 3W87A 2FHCA 4S3EA 2XZ7A 5E5CA 1GVQA 4H9ZA 1GOIA 4XSMA 3ZMRA 1WA3A 5LGXA 1SJDA 3H2NA 4KWUA 3PZTA 2CLMA 2QJMA 2OTDA 4B5NA 4ZVJA 1RALA 4CEUC 3WH5A 3WBYA 3T6CA 1ISXA 3KBVA 1A5KC 3M5ZA 1ENUA 4XKYB 4PBEA 1NWTA 1XPYA 4F2BA 3C6CA 5ECVA 4LUJA 5LNVA 3FOKA 1W91A 4QJ4B 2QULA 1QI5A 5CC7A 3WKZA 4K68A 4HN8A 5JH2A 1Q6LA 3W82A 3MUIA 2ISFA 3GG1A 2VT0A 5HWNA 3ZVIA 2D73A 1I2RA 4LF1A 3ZWSA 5E9XA 4ONVA 2ZQ0A 1DTNA 2DT0A 3UXKA 2C1IA 3H24A 4Q4OA 1TTIA 1JPHA 1YTKA 4DVOA 4E3VA 3PBGA 2WJEA 2QMJA 2AAMA 2VZTA 2FJUB 3BZGA 3HG3A 4L1GA 4BHYA 4F3HA 5CEWA 4FAMA 1PKMA 4PSRA 4NJKA 2X16A 1Z44A 4AIUA 3M9YA 4JNZA 1LCOA 1XDMA 3LERA 1EEXA 3BJTA 4J3WA 4GNVA 5EMMA 3P84A 3QQ0A 1W8GA 1ZCCA 2Y89A 3TOYA 4US5A 4HYVA 4IP5A 5FJOA 2BODX 2AQWA 3CZGA 3TSBA 2WZTA 1V6VA 1WDPA 1G4EA 3R2GA 3IWPA 3ZSSA 2GFTA 4Z1DA 1HVXA 2RDXA 2I5GA 2VX5A 3IS4A 3VIIA 1CWYA 4ASTA 4RLIA 2E0PA 1KXVA 3HA1A 4O50A 1CW2A 4MYAA 2WO5A 3KVKA 2CESA 4IXHA 3MSGA 3PN8A 3VNDA 1E72M 1O5KA 1V6XA 4HCDA 5I23A 4MZYA 2PMQA 4MJ2A 1IWAA 1W1PA 4XZBA 5HPCA 1PV8A 1F2JA 1BGGA 3BGAA 2D2GA 5DMYA 4CNUA 4PE8A 2NQJA 1DEDA 3CZEA 1Z9AA 2V63A 4S39A 4DAFA 3MQTA 5GNXA 1CLKA 4R7WA 4GI8A 1UR1A 5KEZA 4LW7A 4DF1A 1L8PA 4MZ8A 1DJWA 5H2ZA 5CPMA 5RUBA 4GXMA 3G6LA 4ZEPA 2ABBA 2JBMA 4GNKB 1OQFA 2DT2A 5TNVA 2PDGA 1ZENA 1W32A 3CGTA 4QCEA 1W1B1 5CZ0A 1RPKA 1MW2A 4MF4A 2NZLA 2OJPA 1J4EA 4KBXA 4J3UA 1R3YA 3KOWA 3TJXA 3VKBA 3SCVA 1EC9A 4FA3A 3VO0A 2PI6A 2Q6ZA 3G3DA 2D0HA 2DZXA 1O6IA 3TXZA 2BHUA 4UQCA 1UH4A 1YE6A 3CNYA 3IGSA 5AC5A 1ZZMA 3UGVA 3H70A 3KTXA 2XSBA 4IP7A 4RK8A 1PPIA 4AEFA 2GGHA 2Z25A 5A1AA 3TC3A 2QHAA 4HHHA 4HHMA 4O0ZA 5FKYA 1CDGA 1E56A 1XYCA 2ABAA 3SJ3A 3KRZA 4RPQA 9XIAA 1CX9A 1X39A 7REQA 1MNZA 2BS9A 4W7VA 3T07A 3M0MA 3PVFA 4S1FA 4UR7A 4CU8A 4UR9A 2Z6IA 3RHGA 4GUHA 2YPIA 1J0KA 1TUXA 3ORWA 3ABRA 5HWJA 4P2VA 2IPFA 4NUWA 1V3KA 5J5RA 1CIUA 3W7LA 5FEWA 4FOUA 2J9XA 1NY1A 2YA0A 3S42A 3DENA 3APTA 2QPUA 1Q85A 5I03A 1MEWA 5F2IA 2GJLA 3QR0A 3WJSA 4P7QA 4ZXLA 4JCMA 5TBOA 5I78A 3GQYA 2ZICA 6ENLA 2QMKA 1O5QA 3B4YA 1K4GA 3TJLA 4QLJA 2ZXDA 3T2PA 2JKPA 2VHLA 4TTGA 3CUXA 1GKPA 1GVFA 3ARRA 3UYCA 2BGQA 1DWAM 3GDMA 1Q7MA 1KFEA 1A0DA 3EEGA 2YCIX 3USBA 3GIQA 3TN3A 4PB3A 1ISYA 2MANA 4YCOA 1QBBA 1BG4A 4LGXA 4MNLA 3THCA 2BDQA 3N14A 4V28A 4REQB 2CPUA 2CIPA 4C1LA 1VFFA 3TFCA 3GRIA 1V0MA 3ONCA 2ZX7A 3A12A 3TSDA 1YADA 3EX4A 3H7RA 3EB2A 4X9YA 2PDFA 2G3NA 3TTYA 3KL5A 4JTFA 3OHMB 3EKGA 1V0KA 1VLWA 1GJPA 3N2TA 4Y8EA 3IARA 1RVKA 1KCXA 2Z1VA 4ZTXA 5AY7A 1EF3A 1F76A 5B7ZA 3V18A 4J2MA 1ZS2A 4UOJA 3TYZA 4JTRA 1ONWA 3QQWA 4JNYA 1NWSA 2H3BA 2JFEX 3SCQA 2EF9A 2PDCA 1DWFM 1BRLA 5CZSA 5HULA 1XIMA 4ACZA 2NUWA 3QMRA 3W1RA 4GGBA 4TXEA 1GNXA 5K9XA 4OQVA 2J9YA 2ICSA 1G01A 4D6GA 4OVXA 4ZQMA 2DW7A 1QT1A 1N8IA 3FLUA 1XIFA 4A3QA 3K13A 4C6JA 2NQLA 1EPVA 2GQ8A 1MW0A 4GQQA 3STEA 1DYSA 1E6NA 2Z00A 4DF2A 2INZA 4GIEA 2OZTA 4UOQA 4RR4A 1Q5MA 4BI7A 3C0LA 2VX7A 4DJFA 2G3JA 2WSPA 3M7SA 1XGEA 4ES4A 4LWWA 1UASA 1IV8A 1TKKA 2OYMA 4AG0A 4QDMA 2QCFA 4NXKA 3GHSA 3MHGA 4GO9A 1K03A 4L4LA 1PIGA 4IJRA 1TRDA 3PBMA 4HMEA 3S9IA 3LLDA 4KEMA 3B8UA 3K4DA 1VF8A 4F79A 3A23A 4OU1A 1UH3A 2C8NA 1W1ZA 3P0XA 2ATSA 1GG1A 1SSGA 3WLHA 3ZT7A 4AVFA 1SM9A 3TIMA 1UB3A 3VNKA 1LUCA 1YBQA 1FTXA 1YYAA 1C8QA 3FSUA 3AIVA 1MXGA 1E5NA 1Q13A 2H8ZA 1JZ2A 4C7GA 5DEZA 5FIPA 1HP4A 3VA8A 4GLEA 1YDYA 4JTDA 1ZNNA 4B5TA 2XISA 4H6QA 1R86A 5FACA 3VIOA 4H9VA 3PS7A 3W76A 4M6PA 1OFEA 1OG6A 5CAHA 1PTDA 3CEPA 1SO6A 4DNMA 3EDEA 1MQPA 4IH3A 1BXNA 2PLJA 3NQ8A 5FD0A 3RPTA 3QKZA 3N18A 3N12A 3VDGA 2QLYA 3FEMA 3NQDA 1H4PA 2PWHA 2AMGA 3AYRA 3CXOA 3LV6A 3T8QA 1JCTA 1F05A 2J7EA 3WQDA 2F8QA 4ZXOA 3UG5A 3HJEA 1PZ1A 2V69A 2V2DA 4YVVA 1YE4A 2C7FA 2X09A 3H53A 3N6QA 4TO8A 3UA4A 2DUAA 3W71A 2BNJA 3R12A 1EJUC 4U3CA 5AHFA 1KV8A 4PTVA 5CQ1A 1H7NA 4QNWA 5H8UA 1GTHA 4LYRA 1JCLA 3LQLA 1OF6A 1FWTA 4LS0A 2D2OA 4PN2A 4W8BA 1A0EA 4YCPA 1JZ4A 5CJNA 3DI0A 3W72A 5KZ6A 5DY2A 1TE1A 1C8YA 4B3KA 1JUKA 3CIWA 1CXEA 2E6YA 3AUOA 3P6LA 2VENA 1FA2A 4M1BA 1H11A 1X1NA 4E8DA 4A3UA 4NAFA 1QI3A 1KM2A 4Y2WA 4JN7A 3UF9A 2JEQA 3GC2A 3QR1A 2XFRA 3VIMA 1OINA 1BG9A 4C90A 2LLEA 3CL6A 2JF7A 3EWBX 3T8LA 1VGAA 4JHMA 4PUWA 1FP8A 3MW7A 4N4PA 4U4MA 4HD5A 4US5D 1Q6GA 1A3WA 2XH7A 1LRNA 2CLPA 4DZIA 2R9RA 1PHQA 1Z8AA 1AVAA 1UZ4A 1J2WA 3TQKA 3GSMA 1TWDA 4B5WA 1VCVA 1M6JA 1CGVA 1KRBC 1TE6A 1XS2A 1PWLA 3UJEA 1VZWA 5TAOA 3E9AA 4E2BA 4KKXA 4JIIX 1WXYA 4WKAA 1E6SM 2WHJA 1ITQA 2GK1B 3L2LA 1K9EA 1XLBA 2ZC8A 3UT0A 3UWEA 2BSLA 1QTWA 1JUBA 1Z42A 4MTVA 1QPNA 4QNEA 2INFA 1S1PA 1DQWA 2XM2A 2NT1A 2NQHA 3GR7A 1K8XA 4LVDA 4HZ6A 1F4HA 4WSHA 4MDOA 1QASA 1LTDA 2A5HA 5I3FA 3MUCA 2CFFA 1LORA 4DM1A 4Z1BA 2G95A 1JNEA 4PBFA 1YPIA 4H00A 2Q09A 3S3GA 2X1TA 2ZIDA 4GACA 1WUEA 1XICA 3OYXA 3N04A 1U22A 4Z1YA 3TFXA 1NP2A 4GG9A 3TU9A 4DELA 4MY8A 3BAKA 4AWUA 4OHQA 3MYOA 4Q4MA 2V3DA 4LFYA 4FIQA 5D9NA 3U0HA 4CCZA 1EEPA 2W79A 2WBGA 3M46A 5DELA 2G3IA 4UXDA 4PCTA 1HL8A 3MUZ1 4XD4A 1MZRA 5I07A 1R30A 4LVFA 4AF0A 2XINA 1W8SA 1KRMA 2PU0A 3EB3A 2QYGA 1EYWA 3DDMA 3RLVA 4IPJA 1KR0A 4KQNA 4H2HA 3F7JA 1FCVA 5CLTA 1ITCA 1F6PA 2O9TA 3S2NA 3A3WA 3PTMA 2PDUA 1LP6A 3LA4A 1CTNA 1RH9A 3QSRA 3AHYA 3MPGA 3FJ4A 2DVTA 3HPSA 1V3MA 3WUBA 3C2OA 3WNNA 1KBKA 6REQB 3EDDA 2V3FA 1P0KA 2CBVA 4AEEA 2PBOA 1GHSA 3NAVA 2QUUA 3ZFHA 4XISA 1L6SA 3UYIA 2GVYA 1JRBA 4LY8A 2QDEA 2W66A 4LEFA 1J0IA 4V1YA 1S2AA 3WH9A 1DE5A 4J3SA 4UFKA 2JE8A 3BLIA 4AXKA 3WK2A 4UTWC 3DXIA 2QCDA 5EMLA 5G4WA 3NGFA 1VIWA 2YGYA 3B8DA 3KRUA 4QAIA 1OFDA 2CLIA 1HJXA 3PUDA 3VIKA 4HHPA 3P8IA 5AHLA 3T42A 3W1NA 5E9AA 4GVGA 2GUBA 2GOUA 3QFEA 1XBVA 5DN1A 2E67A 3W2UA 3W73A 5K2ZA 3N2XA 4LUYA 4J9JA 5BOEA 5ABFB 3OTRA 4FS9A 3VGEA 3AC0A 3BDKA 4OECA 5BW6A 4LT9A 3NYDA 3B0PA 1FOBA 1DWGM 4P8VA 4ZQOA 3O16A 4HSNA 1I0DA 1ML1A 2W0UA 4XK2A 2XPKA 2PF0A 1HKKA 3NDZA 4UFIA 1OCQA 4NJGA 1F61A 2VVSA 4GO8A 5LHEA 4INFA 3GNOA 1HKJA 3AROA 3L21A 1JYWA 3COTA 2WKGA 1WKYA 1ZRQA 1Q7ZA 5F4SA 1JDFA 1YIXA 3CV1A 1DIEA 3BG5A 4KFNA 1WPCA 3I7SA 3HG2A 1Q4WA 4AISA 2YB4A 1C29A 1RP8A 4DZAA 1RK6A 1WDWA 3S5YA 2GQ9A 3NQ7A 4CCDA 1XH1A 1EBHA 4ROQA 1YDNA 2FMOA 1UOKA 1I60A 4QRNA 1J2BA 4GK8A 4BK9A 2ATMA 3TROA 2WB5A 4Q4QA 2FZDA 4G56A 2VC9A 2OMAA 2RDUA 3VMPA 3UZYA 1IT8A 1QWGA 4QSFA 4R53A 3ITTA 4EX4A 3A4AA 2DU2A 3CPUA 1J79A 1S5NA 2P8CA 1JUEA 4QLKA 3UFYA 1ODZA 4R9XA 1JYVA 3RCNA 3UR2A 1XRTA 1UKPA 3CB8A 3LMYA 3P0WA 5CSYA 3EMZA 3KDOA 3FY1A 1XJBA 3RN6A 2GJNA 2FHFA 1P1XA 1FUYA 4XZIA 3PBWA 4PMZA 3RAOA 1REQA 3G8EA 1RLDA 4GUIA 2HK1A 2C15A 1JD7A 3BGGA 1FWBC 3EOOA 4LOCA 1AW1A 3TX9A 4H9YA 1CECA 4JTQA 4UCFA 4L65A 2TAAA 1G1YA 5CZKA 4D8ZA 5FSEC 1CXIA 1YXCA 1BGAA 3TNBA 3BQ6A 4CU7A 1QPKA 2P8BA 3SURA 1YDOA 4A35A 3KL0A 3BGJA 3AO0A 4JDYA 3IV8A 2VEIA 3IPWA 4DN1A 1H1YA 3G0XA 3QV9A 3NQFA 3O63A 1XIEA 3M0HA 3B8SA 1XRVA 1DXFA 3IVUA 3URBA 4UUIA 3RJYA 4F0SA 3ALGA 5DT5A 4KGJA 1Q7QA 4Q4PA 2GDQA 1OD0A 1QK2A 3LB0A 3TN6A 2Y5JA 3GUGA 1DORA 4W89A 2WSKA 3T4CA 3W1PA 3KE0A 4FB7A 1F5ZA 5AC7A 1O7AA 3T55A 4L4MA 1Q3NA 4QCFA 3LBCA 3WQ4A 4Y9AA 3JVAA 4H8VA 2YW4A 2C79A 1UWIA 1EJXC 1J6PA 1TX2A 7ENLA 2EPKX 2FGLA 5A6JA 1YTDA 3UNTA 1PKYA 3S5SA 5LNSA 2PTYA 4B5SA 3HURA 3NXLA 3OZOA 5G2HA 1EA0A 4XBJA 1XD1A 3UZJA 1EO7A 1DP0A 4RDWA 5FAGA 2HPIA 1FWWA 3L66A 1EBGA 1BYAA 2DGAA 1ZFJA 1MWOA 4KFOA 4NRRA 3U4FA 1MW1A 4FI4A 4Q8WA 1Q4NX 2PWFA 2F7FA 3QHNA 3EA1A 5CBJA 3MSYA 3O6CA 3RLUA 1ME8A 3EXRA 5G5IA 4NJJA 2E9BA 3IJ9A 4GYPA 1XFCA 3GHTA 1H2JA 2E4TA 2NV9A 3L12A 2TRSA 3DFQA 1KGUA 5AZ1A 4B90A 3EPOA 5BU9A 1E9IA 3F2DA 3OZPA 4CUCA 2PPGA 2G96A 2OQLA 4LVBA 4UB9A 4DWSC 4KW2A 1QNVA 2YL8A 3LDVA 3DN5A 4D6CA 5LGZA 3TYUA 2VURA 1GW9A 1E73M 1XG3A 1KB3A 3STFA 4A3HA 2XGIA 3GBDA 3A9BA 7TAAA 2Y2WA 2VQTA 3NZGA 2A4AA 1V0NA 4CN1A 3GG8A 3FEQA 4AD4A 1Q6RA 5E1QA 4HPXA 4HVXA 3CO8A 4Q22A 1L0PA 3W07A 2XFWA 4N42A 1M7OA 2NQZA 3V1HA 1HO1A 1TPEA 3TTEA 5T8GA 3MVTA 5CXPA 3K8LA 3ARSA 4DO7A 2DZAA 4XB3A 3LNPA 3MCNA 3E0FA 1P0NA 2PODA 1E6QM 5CJ5A 3IUHA 1MFUA 3SCRA 1CXKA 4C6QA 1G5AA 4NYYA 1ME7A 1VLIA 3QTPA 2UY3A 3S2MA 1LL7A 5CSSA 4L64A 2C3ZA 5HUOA 1U1JA 1JFHA 4O8RA 1TA3B 1E6XM 3KW3A 3WLMA 2BP1A 3VOGA 3LPFA 1GOKA 5M1TA 2XYLA 1PYFA 5A6AA 2ZZ2A 4MOZA 1FP9A 1YHTA 2QEZA 2FKPA 3LBMA 1PVNA 1K3UA 3CT7A 3CJPA 1N7KA 3H55A 4PCPA 4EVZA 4AEOA 1Q2RA 4C1NA 4AZGA 3WEZA 3TA6A 4DBWA 3C0QA 3BLDA 2XWDA 3CASA 3HIJA 1LZOA 3H23A 4GQRA 3OBEA 2F61A 1FWJC 2B7OA 2ALRA 2ZRXA 4PUUA 4ZB2A 5CAKA 3MMWA 2EPHA 1EGVA 3B8TA 3NM3A 1TIMA 4O4VA 2CLHA 3AIQA 3FK4A 1TTPA 3QV8A 1GUVA 4U31A 3SRKA 5D2TA 2X05A 3V0UA 4HA0A 3LG3A 4E2OA 1UUMA 4P5UA 3AFBA 4E2DA 3MSRA 4HP5A 3VNYA 4PMVA 1QATA 3W2MA 5AYYA 2VKZG 1XIIA 3N34A 5CPOA 3U48A 2E40A 1XGDA 2J7BA 4H6EA 2JGYA 3WQWA 4EWND 4AIEA 4LTSA 3EDJA 1UWUA 3OIXA 4WOZA 3LY0A 3DOPA 2XVPA 3TH6A 1ZTVA 2HJPA 3OLIA 3I3DA 1P0BA 2EPMX 3EOLA 3R79A 1FWIC 4LRTA 1FHVA 3L4VA 3ITGA 1U1HA 1J0JA 3QR3A 5E6ZA 1SPQA 3LCLA 2VWTA 2V5JA 4IPLA 1EGMA 1K1DA 4XKYA 4D6FA 5BXRA 3RF9A 1ZJIA 1FWAC 1NIUA 4LYPA 3CUHA 1R3RA 2ALDA 3FS2A 4UC5A 1RCOB 1DQXA 4Z0SA 2CETA 4WKHA 1P4CA 4TOQA 3S2LA 4FPSA 4CVWA 4D71A 2O0TA 3N4AA 3W7JA 5L9FA 4MAVA 1YLVA 3S46A 4QJ1A 3RFAA 3MP5A 4ZOBA 5C9RA 1GQLA 4HZ7A 1UD2A 4YMZA 3FJNA 2VWSA 1CXFA 3IJIA 2BFGA 1JCNA 5CPSA 3KVLA 1OC7A 2OQHA 4CQAA 4GXWA 2HNHA 2EG7A 3S6OA 1UD6A 3WLIA 3BV4A 1RD5A 4UQEA 4PTMA 3BAYA 1ECQA 1E40A 1LG1A 1JXJA 1UBSA 4LH8A 1AFSA 2FH6A 2JKEA 1AODA 1F07A 2I5QA 2QCHA 3K8MA 2BG5A 3PHAA 1QVBA 3ECQA 3RPMA 1XUZA 2ZBTA 2WK2A 1NDYA 3W83A 3UU0A 3WG6A 4A8LA 4B15A 3G1HA 5TF0A 4NZJA 4YWSA 5H6HA 3O6AA 1UUOA 3SFKA 3CQKA 3QQ1A 5CKSA 1AK5A 4HMDA 4PEKA 1V79A 2ZUWA 3G6MA 2WSRA 3RMEA 5I3JA 4TX6A 1LT8A 1CT5A 5KZMA 1OYCA 1JPMA 4U5IA 2XVKA 3BMVA 1KTCA 3UWZA 4A05A 2QVHA 1PX3A 3M5YA 2QZRA 2XIOA 4LAMA 5BXSA 5IOBA 5BZAA 4GZIA 4NHVA 1TVLA 1SJAA 3M16A 4QG8A 2YXXA 1QR7A 4P8XA 5GJMA 3DX5A 1E71M 4GFSA 3QZEA 2ZX6A 3OJGA 4IMDA 1GEQA 2FZNA 4LB4A 4FX6M 4IPNB 2HRWA 3V4BA 3PFRA 3WYZA 3VD9A 1ZAHA 2O55A 3HQOA 4Z0JA 3RILA 2X1IA 1NARA 2I16A 1ZGDA 5LKYA 4LBSA 3LHVA 1J01A 3TQPA 3QV7A 1W2PA 1SMAA 4I7WA 3W7CA 4GX9A 1FKXA 1MO0A 3HG4A 1SFJA 1S2CA 1BYDA 2YLLA 2VYOA 4NZ3A 1SUXA 4TMBA 3B0XA 2YFOA 2WM1A 2XIBA 4M5PA 1JCMP 3CHCA 2DIKA 4GC4A 1R46A 4H83A 4IIHA 3W6LA 2FZ8A 3GZAA 1SMDA 4JX5A 2ISSA 1M41A 2WZHA 4GX8A 2VDHA 3H2CA 4O0QA 1T99A 3TN4A 1E1EA 2Z1SA 3W7GA 4AB4A 1XF0A 4HBKA 3U57A 1EJVC 2DZSA 2NWSA 4LC8A 2ZWZA 3EWUA 3UZZA 3C4UA 1IT0A 4IGSA 1UPMB 4YLWA 2A3HA 4XD6A 2J6VA 2Y1HA 5DBUA 2YX0A 1HIZA 2NVAA 3CAKA 1S2WA 3MMDA 4XZMX 5AC8A 4G9PA 7PTDA 4IJCA 4AIOA 3W1QA 4K1WA 3GXTA 3MCMA 3VNIA 3LI1A 1HJSA 1NFGA 4DJDA 2XJ7A 3H4GA 1WOAA 2VGGA 4RE4A 3AIWA 4NNCA 1KFWA 1H1NA 3HN3A 3PPFA 1LWHA 3CPGA 1GVEA 4WIWA 3A13A 1C90A 3CM4A 3ICJA 2HVMA 3II1A 3MZ2A 2NX9A 3H2OA 4CD5A 8XIMA 4FK9A 1BVWA 1SW0A 3CWNA 3BAIA 4PMYA 4HK7A 2AL1A 1F9CA 1OABA 3WLPA 3WCZA 1DVJA 4UZUA 4JPGA 4HKPA 1VAHA 3ABSA 4KMQA 3OOQA 3VC5A 4NJHA 3AHZA 3VABA 4ZCWA 1RQEA 3NOYA 2RH9A 2A3LA 2VDIA 4LUTB 3ITVA 2R1NA 3E02A 3OVPA 1B4KA 1B2YA 2C16A 3B4UA 3GNPA 4REQA 2E68A 3M0VA 5FCZA 5M17A 3RRAA 4B9YA 3LTPA 2E1DA 3UWUA 3KAOA 4ZQPA 3VYLA 1VBUA 5KZDA 1UBPC 3WLLA 4J3VA 3SCPA 1FWHC 1SGJA 3Q4DA 3HGJA 9XIMA 3TYEA 1L9WA 2FZ9A 1GVSA 2EPOA 3EYPA 1G9HA 4R3UA 4YU1A 4C5YA 3KBWA 3QY8A 2NXIA 3FXGA 2SFPA 1D2KA 2QGYA 3PZ9A 4O28A 4JD4A 4OBTA 5EMKA 4JQ3A 1FWNA 1ZL1A 2FYMA 2NUYA 1XFBA 4WDWA 4BY3A 4YTSA 1XIBA 1O94A 3ZS4A 2DZBA 4MM1A 1OX4A 3WELA 5EKYA 1OY0A 2PWVA 2UY4A 2OLSA 1ISVA 3ZLHA 5C9ZA 1EC8A 3VCRA 2HQAA 4LC6A 4N02A 1JDAA 4O57A 2WV8A 4M56A 4ERIA 3GTHA 4GKLA 4FEZA 2A7PA 2ZVRA 3T44A 8XIAA 1JZ3A 2PTXA 3UD6A 1EPXA 4HNOA 1H61A 1UUQA 3LPGA 4CD8A 1WB0A 1QK0A 2WJZA 4UTHA 3HBLA 3G0UA 5BXPA 3WMCA 5MHBA 1JRCA 3PBYA 1PWMA 3MWAA 4UTWA 2ZUTA 1FFRA 3SUWA 4DYEA 3EKZA 5XIAA 3BW4A 4ZGYA 2D2HA 3GNRA 2PDKA 3K8KA 3THDA 4WDXA 4YJ5A 4WLCA 4M8UA 2CZ5A 1RJRA 2VOMA 4CNPA 3GE7A 1F6KA 1KM6A 3L5AA 3LHTA 4JQAA 4TX9A 2Z6JA 4A3YA 5I2UA 4FO4A 1XRSA 3EX2A 3GS6A 4IGMA 1LOLA 2H90A 1C9DA 1CGXA 4S3AA 4IQJA 1OT2A 1KCKA 4P8WA 3IJ7A 4MHBA 1WX0A 4I6VA 4AWTA 3CHDA 3OZYA 4YTQA 4HU4A 4PB5A 2R1LA 2XN1A 1B3OA 3WSUA 4O52A 3BLLA 4TR9A 3GYEA 1AH4A 3OIHA 2ACRA 4NKCA 1WUFA 2YDRA 3B3DA 2Y8KA 5CPTA 3ID7A 3S1WA 2CZEA 2I56A 4S3BA 1XXXA 3SFWA 3L9CA 3TYDA 1FHLA 1XYBA 4GUJA 1SR0A 4XBSA 1UOZA 4RPPA 4DM2A 4TVDA 4PUNA 2IS7A 1XLKA 2Y7FA 2X2YA 5HUPA 4J3ZA 3VD5A 1VCFA 3TA9A 1W3TA 3K2GA 4MVAA 3STGA 3SUSA 1J93A 3GNDA 5FEPA 2TSYA 3M64A 2G5WA 2YL6A 5A6MA 5I5RA 3TCEA 5LIXX 4FNQA 3LRKA 3GXIA 4IMAA 1FWFC 2ZWYA 1V02A 3VNZA 4NI8A 3G8RA 1E0WA 3CH9A 3QM3A 3QZ6A 1WKDA 3AHVA 3M47A 3EWDA 4JFVA 4WY0B 3U4AA 2EQDA 1LRQA 4FLRA 1NDVA 3I6RA 2A3BA 4ZO8A 4ECLA 2Q8XA 2J8FA 1LQAA 1NF7A 3RR1A 5HNTA 4UTLA 3WBWA 1LM1A 1OCNA 1DQUA 1QO2A 5KITA 4UCGA 2Z2BA 2HS6A 3UQNA 2EEXA 3THQA 3M5VA 3WFZA 3HGRA 4EANA 3EAUA 4FXSA 3GLCA 1X97A 4EAMA 4I6KA 2WZMA 1QO5A 2ZFAA 5ABTA 1WQ5A 4HNNA 3VZYA 3GW3A 3IRSA 5JQ9A 2X0YA 1P43A 2YLAA 5HMFA 3S8HA 3EWWA 1OZMA 5D8ZA 2PBGA 1IIHA 4GINA 4MB4A 3AXXA 4XZNX 3ABZA 2VX6A 3VAVA 3FV9A 1KBIA 2Q02A 2NVCA 1IR1A 2GK1A 2FPYA 1AW2A 1ME9A 3NZQA 1XLIA 2VZUA 3S4TA 3RGTA 3B8VA 2BASA 3S1UA 3WUGA 2ZADA 4JTIA 2DVUA 3SB0A 1BWKA 4WJ8A 1EQCA 1GVIA 4UMBA 1P48A 4K37A 4BJHA 3DFYA 3ES8A 3QFWA 3VKKA 4GMEA 1G7UA 1PX8A 3AIUA 4IMGA 4LNCA 2V2HA 4MWAB 2YSWA 2VFDA 3W1AA 1ZB5A 1AZ1A 4DJED 3SN4A 3ZVHB 5HPOA 2Z1WA 2E8ZA 3GW0A 1BAGA 3VNJA 3P74A 3HG5A 4JFSA 4RNIA 2EGZA 1OGBA 2BVWA 3C2VA 3O06A 2W27A 3K1DA 1OHLA 4JIPA 4EPBC 1RY8A 4O1FA 4V2XA 4FXRA 2Q71A 1UKOA 3QPYA 3VK5A 1H50A 3MS8A 3H8AA 2FVLA 2GOKA 3SM0A 1PZ3A 2AGKA 4W86A 5D2VA 3WQVA 4J5NA 2PZ0A 2YXOA 3D6NA 3WD0A 3SCSA 3PY2A 3OO2A 4IFKB 2O7QA 3WL0A 1UROA 1IXOA 1BF6A 5C2CA 4DXVA 4GIYA 1SYTA 4JGDA 2Y24A 4IGNA 3MBFA 4PC8A 1XD0A 4IICA 3VOIA 4QX4A 4NZCA 4B9ZA 1UC4A 1OB0A 4D1JA 3AJXA 2GGIA 5C2GA 3TEVA 1LL4A 4LUIA 4B2DD 6REQA 1AQMA 1UMLA 2OB3A 4UTUA 2TPSA 4IUOA 3UZWA 1FCBA 1D8CA 3WZ0E 4DJDD 5ABEA 1D7KA 3PUOA 3H2AA 2VDGA 2PUZA 2OOGA 2PDMA 2DSWA 2WC7A 3SUUA 3PPGA 4CQ9A 3H4WA 3V7PA 3UR8A 1X6LA 1F74A 1LT7A 3S1GA 3GO2A 2Y63A 5HJLA 2VFIA 1FY6A 3S9YA 2QJHA 1WDSA 5M2FX 3T78A 3W00A 4BCEA 1B90A 1P0EA 1TCDA 1LOSA 1LJYA 4GVIA 3EPMA 1JYXA 2D20A 1RBLA 5BWAA 4DNHA 1KQYA 3BLEA 2O9OA 4W87A 2A0NA 4AZ6A 1YKWA 3A6OA 2FB3A 3GXDA 2VM8A 2R91A 1UR9A 1G69A 3LX9A 3DFPA 1TTQA 4JTTA 2DH3A 2WVVB 3GR8A 1DJXA 5CBIA 4GUFA 2FTPA 8TIMA 1KBBA 5K9CA 5EA9A 3BAWA 1KBLA 2OO6A 4AYGA 1GJUA 5ABFA 2ON3A 3ZOAA 2PWUA 3M07A 1SJBA 2PZNA 4QEEA 3AALA 4JIEA 5C7HA 7CGTA 2V3GA 3LHWA 4WVXA 5C55A 4EACA 4U3AA 1TSIA 4HQVA 3P80A 5CBBA 1V4YA 4ZE4A 4BI5A 1DKWA 1E3XA 4O15A 3T08A 3ITYA 4WY0F 4RE0A 2VOTA 3MP3A 5A6SA 1KLZA 4G1KA 1QWKA 4QTGA 1SZNA 1VKFA 3VUSA 2ZDRA 2VX4A 1Q6FA 1LLWA 3IJDA 3R7MA 1HFBA 4CQDA 2WQDA 3W84A 3KEHA 1Q65A 1E4LA 1U83A 1ZP3A 1KM1A 2Z7GA 4DBSA 1KRCC 4KRTA 1US3A 4YWIA 2VEFA 3FSTA 4M80A 1H7WA 1S5WA 1WV2A 5HMDA 1J0HA 3STPA 4BWLA 5E0FA 2PCQA 2QJJA 2D23A 3EB4A 5BXTA 2IKJA 2WNWA 5C9XA 3B8IA 2R82A 1PKNA 4YHEA 2NLIA 3ARVA 1KCLA 2DT3A 1QHPA 4UTKA 7TIMA 1YNYA 5FL1A 4H8HA 2ZE3A 4H41A 1UR3M 2DP3A 1J11A 4GZEA 3G24A 1M04A 3QHOA 1ADSA 2WLZA 2CC0A 3UJ2A 3H7UA 3HZ3A 4Y96A 4C6LA 2XFFA 2DSUA 3KLLA 4C6KA 3W7PA 4HT3A 1LOQA 5BOOA 3DYOA 1LBMA 3LV5A 3GAKA 3S9ZA 4WKFA 3USZA 4AZHA 5I7GA 3AQUA 3VGFA 3D3AA 2ZRWA 1O12A 1TRIA 3W9ZA 1OFAA 3PJWA 4S3FA 4D6EA 3MDWA 1OD8A 4L6HA 1UD4A 1TPFA 4AD0A 1GQNA 4H3DA 4JDBA 4ZOEA 4IIBA 4FOJA 4TIMA 2Z28A 3VCCA 1AL8A 4RUBA 1I2NA 3KLKA 1NOUA 4GYJA 1TX0A 1FDYA 4C7DA 3FHQA 4WX2A 3CIVA 1T7LA 4TV6A 3N73A 2F38A 3EMCA 2VR4A 1RLCL 2DORA 4C6OA 1QFEA 3IV3A 2G3MA 1K02A 3E0IA 3W70A 4MJZA 4K2SA 4QDPA 1IEXA 3K46A 4A6GA 3QYQA 1H62A 2Z1KA 4BA0A 4R5EA 3CL8A 4YIWA 4W4QA 3R13A 3UY8A 1JFXA 1HN1A 3ARQA 3ZR4A 2PGWA 1OX6A 1TTJA 1NFPA 4O16A 4D6JA 1IXQA 2YCLB 4PRWA 3SSJA 3GDLA 3F4WA 1TJ0A 3T40A 1F4AA 2RJHA 3IUIA 3LRLA 4DO6A 5TD4A 3TMLA 1BTCA 1QAPA 2IXVA 3JZEA 1FFQA 4DHGA 4QQUA 1UKQA 2PDPA 1QXLA 3WD4A 5C54A 4B16A 1Q8JA 4CGTA 4A3RA 3UVIA 2EG8A 3OG2A 3W1MA 4NXSA 5G4EA 1OT1A 5AYZA 4H8UA 3CT2A 3PANA 2C1HA 4IT1A 3EA3A 2B0MA 3OGVA 1QCWA 3VGGA 4EXQA 2WMFA 4V15A 4IG2B 1O68A 3NQVA 4X0VA 2DZVA 4ILSA 2ZRZA 1VRDA 2NLYA 4U33A 3ARYA 3QSTA 2V5LA 3CUIA 2P3ZA 3HO8A 4R9OA 5AFDA 3G1FA 1C3FA 4AZIA 4UTTC 3GXMA 1BF2A 2DZTA 3L0KA 4IZGA 5CJMA 4Z17A 5FF0A 4F4RA 2VJXA 4UTJA 3W2LA 4CNTA 2A3CA 2RGMA 3WK3A 1ICQA 1XIHA 4U2ZA 3TOPA 1QUMA 4JHZA 2MUCA 1TWWA 4D6HA 4LVGA 3G0SA 1I1XA 2Z0IA 3U2EA 1EXBA 1R3VA 4HZ8A 1DIDA 1JCYA 3I6EA 1ZLPA 3URQA 4C5ZA 1E43A 1RV8A 3OVQA 1X7FA 3CK5A 2YZ5A 3FJLA 1W54A 5CGTA 1KFBA 2OT1A 2HNEA 2QPXA 1U30A 4IL0A 4UQBA 3PR2A 2EKCA 3A47A 5JIPA 1MDRA 3HV8A 3P60A 2FGZA 4L56A 3L0NA 3OBAA 1V3HA 3SN1A 3GH4A 3TC7A 4BEUA 4JHOA 4GGHA 3OVRA 1HJWA 5T26A 5DANA 2QW5A 2FIQA 1JCXA 2XM1A 2ZC1A 3L5MA 1W1YA 5FF3A 1UC5A 4HYWA 3S83A 3VUPA 4O1AA 2DZPA 3APYA 3G1YA 1H5YA 2E28A 4MJMA 4XZHA 3IIZA 2GVLA 4LRSA 1YPXA 4RKAA 1M68A 2WWDA 1TJPA 2BGSA 4EK7A 4JTKA 1DJNA 3W7MA 1M7PA 1EZWA 1JQVA 1I8JA 4JQ1A 1GVRA 1J12A 1MQQA 3GDBA 2J8GA 1UIOA 1PEZA 3BICA 3VILA 2HXUA 4AC1X 2QV4A 3QW3A 5IRPA 4IGHA 4TVUA 2YA1A 4Z2KA 2Y8UA 4J7RA 4TUFA 2JF6A 5A8NA 1VJIA 1EJWC 3S2JA 4G7EB 1ONRA 3NFUA 2PP3A 3PBVA 4V27A 2WHMA 2OYLA 1HKVA 1ZJBA 3DFHA 3CZLA 3OGRA 3IRDA 3QBUA 5LNRA 3LCIA 4HYRA 1ZAJA 1LDCA 3M0YA 2Y62A 4C60A 4HOWA 1EB3A 2BY2A 3ZJ6A 1N8FA 1C7TA 1VYRA 5F4WA 5C0QA 4HTBA 1Y8BA 3MI3A 4XAZA 1F8IA 3SN0A 3KTCA 3FVMA 1TA3A 4MADA 1IEQA 4O4WA 3ZJ7A 3G18A 1BD0A 3IGHX 3BSHA 1D3CA 1E55A 2JIWA 4FLQA 3B9OA 5JIWA 1OFRA 1RPXA 5EYWA 2HSAA 3Q58A 4ACYA 2JEPA 4O18A 5FEZA 3A22A 3FCPA 3ZO9A 1ISZA 2Q3RA 4O11A 3F03K 3LSCA 3N15A 3GDKA 4FX7A 3NQ6A 1GWJA 4E8GA 5H8PA 1SJCA 4AD3A 5H8MA 4UFHA 3NDYA 4KFPA 2FHBA 3NVDA 4HCLA 4F0LA 2GUYA 4W85A 4Z2IA 4QG6A 5HMEA 4MJ4A 4OBSA 1GT8A 3VIGA 4QE5A 4UQ9A 1HJVA 3NO5A 2J47A 4OJYA 2X0SA 5I02A 1AW5A 4X9SA 3WY1A 1PB0A 3T05A 4D9PA 3WLTA 4JXCA 1R0MA 1X98A 4WEVX 4LBRA 1CB2A 3NDOA 2Y70A 1W37A 2ZUVA 3MUY1 1QHOA 5LIUX 3HMCA 1XLMA 2DIEA 1IXNA 3O0FA 1ZP4A 3OG3A 5EL1A 4MB5A 4H9XA 5M5DA 4KRZA 2WNNA 2Q8ZA 4XZLX 1FCUA 3IEBA 1JZ7A 3BCDA 3A5VA 2VRJA 1W3IA 1I4NA 1WDQA 3R11A 2PDNA 3W88A 3GKAA 1TV8A 3C3NA 1EIBA 3N4FA 4YL2A 3WNPA 5T91A 5TIMA 3KVJA 3VOFA 8A3HA 1R3QA 1UWRA 1M7JA 5DF0A 5G1MA 3V0TA 1A0CA 5G2IA 1GOOA 3GC5A 3U7VA 3FA3A 2AGTA 2AAAA 4FR6A 1WO2A 3O2LA 1ZHAA 4GH3A 1R85A 2Q3OA 5E70A 3P2VA 1O4UA 4O1CA 2MNRA 3ALFA 2OZ8A 4UTMA 4HNLA 5C9UA 2ZE0A 3MHUA 3S6TA 1M65A 2YDQA 1CLXA 2P0IA 2PA6A 3EWXA 1FHDA 4EOUA 3L4XA 2CKSA 3E5PA 1E0VA 5FL0A 3J7HA 3M44A 3OQEA 4F2TA 1HKWA 2E77A 3CLMA 3PZGA 2KAUC 1R87A 1V7YA 3R1ZA 4H8NA 3BE7A 5M3WA 4NAEB 3QPZA 3T0AA 3AU2A 3KL3A 2OZ3A 4GNJA 1GOWA 3QV6A 2J9ZA 4GJJA 4N9EA 3W1LA 3I3EA 2KZHA 3NL5A 3ME3A 4UFJA 3N9RA 1N8WA 1EGZA 3M4HA 3BCJA 3NZ1A 3M0ZA 3QPEA 1W56A 1D3GA 2VRQA 3PJUA 3ITXA 1ZQ5A 3I65A 1E4IA 3O3RA 4E4PA 2PRMA 3T4WA 4WD0A 3EDKA 4Q4KA 5HQEA 1QOPA 1GK8A 4H6RA 1SFTA 3NM1A 1M53A 2PEVA 3D47A 3N29A 2B7QA 3WIJA 1W1IE 1TUFA 2TYSA 2D22A 2FPTA 3PJTA 1YDVA 4RV8A 4CVUA 3EEZA 3GNNA 2GQAA 2AOSA 2NV2A 3WUEA 2AL2B 3A21A 3CQ0A 3L4WA 4F40A 2ZXBA 3CZJA 4OBRA 1T8QA 2WQPA 3ABXA 3R89A 3WD3A 1UW9A 3CHEA 4Y8FA 2R6OA 4CNOA 5LA1A 2UY2A 2XGZA 3WQEA 3EX1A 4H04A 1WP6A 3LOTA 2P1FA 5AOUA 1BFNA 2QJIA 3TCSA 3HQPA 3TQVA 2XZ9A 5FJIA 2F6UA 3GH7A 4XX6A 3MZNA 3TLQA 1F8MA 1YTEA 3W01A 4D6DA 7ODCA 1IEIA 3BCFA 1HP5A 4C91A 3DG3A 2W9MA 4D6IA 1WZMA 1JPKA 1ODUA 2HXTA 1JQXA 4ZO9A 2IQDA 1JXKA 2X1UA 3FDGA 4H19A 3NSXA 1U5JA 3WQGA 4DY1A 2W61A 3CQIA 3SQMA 1XIGA 4MLJA 4ATWA 3R5EA 1MEHA 2ZA1A 4HSHA 3NCOA 3VMOA 1L6GA 3WBAA 4IX2A 5K3VA 3BO9A 4Y9NA 1DTUA 1JJKA 4WSJA 3BOFA 1CPUA 2D0GA 2H9AB 4HA1A 1ISWA 1XDLA 4ZQCA 2H3DA 3GFYA 3A3HA 4F9JA 1F7BA 1TJRA 1MNSA 4N6FA 1ZJHA 1VBRA 3F4NA 1PCWA 4LUTA 4H1ZA 2PDLA 3ZIZA 3M41A 3KM8A 4J3TA 2CLKA 3IVSA 2WJFA 4NSBA 2PB1A 4UOZA 4FXFA 3AS3A 2QCLA 3EDFA 4M24A 4FF5A 3IACA 3DC0A 5HDRA 1UJPA 1K70A 3UJSA 3WENA 3CWOX 3MP4A 4Z2GA 3IGUA 4MUZA 2EXOA 3A4XA 4QXIA 4Z42C 3CYVA 2WCAA 4R7JA 3OP2A 4P61A 3V75A 4QEHA 3TXVA 1B3WA 4ZOCA 1Q6OA 1XBZA 1E6ZA 2DH2A 1QNSA 2OSXA 3QOMA 1WKEA 3VXGA 1W31A 3SADA 5I09A 3GFXA 3CTTA 4TMCA 1XSIA 4Q8QA 4JYFA 3TJIA 3W7EA 2ZZ3A 1NJJA 5J5DA 5TQLA 3AMKA 4JIRA 1LL6A 4H9TA 1XIDA 4GE8A 4ICMA 2J74A 3TW7A 3QH2A 5K7JA 1XP3A 2BV9A 5HANA 3EXTA 5BNKA 2Y0FA 4O8AA 1K8CA 5CLWA 3ARUA 1A5NC 4L1XA 1S5TA 4HNVA 1KM4A 4GBDA 4AY1A 2WVTA 3V3WA 4F0RA 2GVGA 2QUVA 3CHVA 1LG2A 3W25A 4YN5A 2OQYA 2POZA 3UWVA 2Z26A 4B5XA 3PM6A 3SQSA 2WWCA 1V3JA 3FXYA 1B3ZA 1U1UA 3EOUA 2ONEA 1EJ7L 4DZ5A 3JS3A 5IXEA 1F73A 3P61A 3R0DA 4E4FA 2XSAA 5FJPA 3NQAA 5DBTA 3TKFA 2GJPA 4B3ZA 3PK7A 2QDDA 1PIFA 2YBTA 1B9ZA 2UWFA 3P82A 4JFTA 3TONA 1S3TC 4LCSA 1VRXA 1XHGA 3S1VA 1D9EA 3KWXA 1A5SA 3CQHA 1H0GA 4ZQRA 4JTCA 4AYSA 5D38A 3GH5A 1B9BA 2BMBA 4DLMA 2VR2A 4GPNA 1L6WA 3ZR5A 2VL4A 5JBEA 5DO8A 3G2GA 5AHIA 3R25A 2PGRA 1A5CA 1PDYA 2GDUA 1I45A 2C1GA 4AX7A 4P8UA 4QQ3A 2VZSA 3VKAA 2Y4SA 4PSPA 3F5LA 4Z1AA 2YBUA 4NP7A 3SIZA 3I4EA 5I3HA 5MF5A 5LIWX 1HJQA 1WZAA 4MUPA 4PYSA 4ADUA 1PXGA 3JRKA 4GD0A 2QQ6A 4Y6GA 3L4ZA 1ALDA 2V81A 3AXMA 4P7NA 5D37A 3REQB 3WQCA 3MCOA 1AL7A 4ZMGA 3CMGA 3AMGA 1XH0A 4I9MA 2L5HA 1RUSA 4RZ4A 2QCCA 1Q6DA 1B5TA 5LA2A 4HNTA 1A53A 4IPIA 2BXVA 2GGEA 4G8TA 2XIIA 4BQ4A 5LZLA 3CAWA 1JNDA 1TWZA 4WY0A 4AWEA 8RUCA 3F4CA 2G4JA 3W74A 4Q3MA 4BQ3A 2P3EA 2QUMA 1AJ0A 1ZBVA 2VFFA 1Z7AA 1JEZA 3NYZA 4U2YA 2VD8A 2DZUA 3HFYA 1M5WA 2R1PA 1GVYA 3VI2A 2WMIB 4NJIA 4PMRA 1DJIA 3B8WA 4G6CA 3L4YA 2YYTA 3BVJA 1LQ2A 3N6JA 3ARXA 4NG3A 2ZX9A 4LV4A 2VGBA 5GQBA 1SSDA 3ONBA 4PMNA 2CBIA 1M9HA 3AYTA