3NQDA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqdA00
4BI7A 3G18A 5E0KA 3NYZA 3L21A 3QF0A 4FF7A 3B0VC 3S1XA 4NZFA 3QJAA 2GVJA 2DZXA 3NG3A 1VS1A 4LW7A 3TAOA 4AB4A 2I1OA 1JQVA 1TV5A 1KTBA 2VOMA 3EXRA 4O18A 3TDFA 5D33A 3W7OA 2VEMA 3W7PA 1IGSA 3F03K 1LRQA 3G1SA 4XBSA 3P8JA 4M6QA 3LCFA 2ZTKA 3PUDA 3W22A 5FF4A 5EA9A 4N2YA 3B06A 1S5TA 3BLFA 1CI1A 1K8ZA 1CX9A 3O6DA 4O1AA 3EWYA 2ZRXA 3MBDA 3O16A 2CLHA 1XFBA 3LCIA 1H7XA 2E5DA 3L0GA 1GEQA 2AQWA 3QYQA 3TW6A 3W1AA 1VPXA 2QAFA 1O5KA 3IIOA 5F2LA 3UY7A 4CNPA 1R2TA 2H90A 5CPNA 4NJJA 1EWDA 3M7WA 1TPC1 3MI6A 5C5YA 5G4EA 3KAOA 1YTDA 5EYWA 3DH7A 1I8JA 4BI5A 3A24A 2WSRA 1CW2A 5EKYA 2JKAA 3ANYA 2ZZ7A 3P67A 4ICNA 4NX5A 5DCDA 3MWAA 1KFBA 3W73A 4I7WA 1RD5A 2E5BA 1B4EA 3E49A 1ML1A 1O5XA 3DU0A 4M7TA 4TMBA 2J27A 3KHJA 4IXXA 2B0MA 4JTLA 1DQXA 4AMAA 2CZFA 2TMDA 2FIQA 3EKLA 3TNOA 5D30A 1F7BA 4UFHA 1ICSA 3BARA 4R33A 4LS1A 1ICQA 1RQEA 4FEZA 1F5ZA 3PVFA 4FHAA 2D73A 1VQTA 5TBOA 2VELA 1MZHA 3DBPA 2UV8G 1P0KA 3VI2A 3W2UA 1OX4B 1X7FA 3PULA 2CLKA 3WK2A 3BK0A 3DAQA 4O19A 4BWLC 4KWVA 1NF7A 1KFJA 2NLIA 1FCVA 4A29A 3ZR4A 3N3MA 2H8ZA 3MUXA 1TPDA 3LI1A 5T26A 3W07A 3G8EA 1TRDA 1OFBA 5CZTA 3THAA 3ABQA 4JS3A 3P74A 4LC8A 1T0OA 1C8VA 3LX9A 1XC4A 3TQ0A 3FFSA 2YSWA 4GE8A 4DBDA 2CFFA 2VENA 4O17A 3S8HA 3TUUA 4ADSA 1H60A 2BSLA 1NEYA 2FB3A 3NL5A 4IX2A 3OG3A 1GYNA 1QMLA 1EPXA 4IUOA 4DPQA 5I3JA 4FNPA 3S5OA 2VFEA 3JS3A 1FXQA 5A5WA 1Q6LA 2BXVA 1H1YA 1ZHAA 5DY2A 3BW4A 3IVUA 2W79A 4QISA 5TIMA 4DELA 1NVMA 2C3ZA 1YDNA 2R91A 3HPXA 1DORA 3KRUA 3ELFA 2ISSA 3HQ1A 1W5MA 1QFEA 3CPRA 4GJ1A 4UTHA 4GUFA 3L5LA 1RQHA 5H91A 4ZVJA 3O06A 3OIXA 4AWUA 1TJPA 3QMSA 1ZNNA 2QCDA 2HS6A 1KA9F 4OQVA 3W2MA 5LSMA 3NZ1A 1SPQA 4UTMA 3UZ5A 1KM1A 4JICA 2X1SA 4PL2A 2GJLA 5F2IA 1I4NA 3LOTA 1UASA 2Y7EA 4IPJA 4K36A 4U28A 1B3OA 3W85A 5K7JA 1OFEA 3GNDA 2DP3A 4GUGA 3QRHA 4MJZA 2Z1BA 1TO3A 2FPYA 3W84A 2CLOA 1PCWA 2P0OA 4O53A 1RR2A 4JTGA 1BKSA 1PIIA 3BW2A 3T44A 1B4KA 4HNUA 3SW6A 3G1FA 2EAWA 4Z1DA 5CSRA 5D09A 1D3HA 1TQXA 3H55A 3GKFA 1AW2A 1A5SA 4N9CA 4TMCA 3HPZA 1MXSA 5I3IA 4NJHA 4CLMA 2QUVA 2FTPA 1G4SA 3NOEA 3BLIA 4NXSA 4RZ6A 4O11A 1SZFA 4C1LA 5EL1A 4Q4KA 3TXVA 2Z6JA 2CZDA 4EVZA 1H7WA 1PV8A 3P62A 3PSWA 1PHQA 1FWTA 1E51A 4GUHA 3BO9A 3S0CA 2ZBTA 4OWGA 3E02A 2GQAA 1EUNA 3KFTA 3IRDA 2ZQ0A 5SWUA 2QCNA 4X3ZA 1SW7A 3GDLA 4MYXA 3STEA 2H6RA 3IIVA 1KTCA 4PA8A 4DF2A 2OMAA 3N34A 2A6NA 3W7GA 2A5HA 2OZ0A 2X16A 2ZZ5A 1AK5A 3IGXA 5F1VA 2YFOA 4IQLA 2ZA2A 3V1PA 4DEFA 2ZZ4A 4UTWC 3WJYA 1LM1A 3PSVA 5LGZA 4GXMA 1IIHA 3W1PA 1FX6A 3A22A 3LV6A 5IBXA 1KTNA 6ALDA 4ZQMA 5K3VA 5L9FA 3UWYA 3LCHA 4UFJA 1SO3A 1KFLA 1JCJA 1Q6OA 2WKJA 4JYDA 4D2JA 4WZHA 2NX1A 3RNDA 4I7UA 1KM6A 1IXOA 5FI8A 3B0UX 1LTDA 2HTMA 1EWEA 3FJ6A 1EEPA 4W9TA 5MHBA 3RFAA 3EXSA 4ORMA 2Y63A 2EHHA 3TC7A 3QEZA 5AHMA 1SQ7A 4IMEA 4XUGA 1VCFA 7TIMA 2TYSA 5CSSA 5AOUA 2G97A 3MYPA 2QJGA 3TKFA 1JR1A 1LBMA 3WJZA 3OA3A 4FNSA 5D2XA 3QFEA 2QF7A 2ZZ2A 4UCGA 4LS2A 4O13A 3QQ0A 3SJ3A 4AWTA 4UNLA 3LXBA 2J88A 4H4IA 3LHTA 3P80A 1X6UA 1GVOA 3PM6A 2A7PA 3TC6A 1I45A 4FXSA 1DJQA 3TAKA 1KBJA 1BTMA 8TIMA 4Y90A 3GNNA 3I7QA 4RKAA 3W1QA 5K9XA 1OFDA 4FX7A 2TPSA 1JJKA 4H3DA 3NQ7A 4N6FA 3IV3A 1VCVA 4UIOA 1HG3A 4WX2A 3QZEA 2Q8LA 1LBFA 3LBCA 2A1YA 2XFWA 3N9SA 4ZL1A 2DU2A 3HG2A 3JR2A 5LZLA 1LP6A 2AGKA 3DHDA 1TPB1 3LHUA 5D2VA 3M5ZA 1TIMA 3LCLA 3A5FA 3NPWA 1BWKA 2QKFA 3S1WA 1ZENA 5AHLA 4HSNA 4RK8A 3NQ2A 3HF3A 1VH7A 5CPOA 1FWWA 3I65A 1H1ZA 3T40A 5K9DA 2Y7GA 3R89A 4I9AA 5FEPA 5FF3A 4HT3A 1YTKA 3B8DA 4L4MA 1LORA 3FOKA 3C61A 3LTPA 1NAL1 3HGOA 3OVPA 1KM4A 3G22A 4GFSA 2C18A 1A5BA 1W5OA 4A2RA 2I9EA 4JTKA 3RF9A 3BW3A 3P61A 3L67A 4WXZA 1RZMA 1GTHA 3MYOA 5TQLA 4Z1BA 4AWSA 5FEXA 1W5QA 1G69A 3RMJA 4QNEA 3A9IA 3WJSA 4HN4A 2FQIA 3G3DA 4RXGA 3NNTA 2PURA 3C6CA 4ADTA 3IGSA 2R14A 1Q6RA 2ISWA 3U8GA 1GT8A 5BRBA 3RK8A 4UUIA 5A8GA 3DFTA 1S3HA 3FS2A 3P7YA 1I2NA 1LRTA 4HNNA 3O6YX 3GK0A 4HPJA 4JTUA 1RVGA 3UD6A 3CIXA 2F7FA 2ISVA 5BW6A 3S5YA 3T78A 3W87A 1IXNA 4OE7A 4O1CA 3TXZA 3NQ8A 3EWXA 1FDJA 2B7PA 2CW6A 3DKJA 4UFKA 5G1TA 5C6MA 3S9YA 5LGXA 4JR5A 5HWNA 2DZSA 3P82A 1TSIA 2Y89A 3GKAA 3B0PA 1VZWA 1BWLA 2QAPA 3SZ8A 3C4UA 3DHFA 5KINA 2KZHA 3TH6A 5AN7A 1R46A 1H63A 1XKYA 5CPLA 2J6XA 3W3OA 3LDVA 4IJBA 2ZA3A 3LM7A 4WQ6A 4AF0B 4NVTA 2QCHA 1EP2A 3W1XA 4OGZA 5HQEA 4JEQA 2V9DA 1W3NA 1AG1O 1XXXA 2VFFA 3NL3A 5CKSA 3W2JA 2HSAA 3HIJA 2OT1A 2X1RA 2ZRUA 1F2JA 3MJYA 1SW0A 3EX2A 4X22A 2X1UA 4FNUA 1LOLA 3LV5A 5AC7A 4QJ1A 3HOJA 1S5VA 1QOQA 1KV8A 2FB2A 3NQ6A 3U6WA 1W1ZA 2WSYA 2BTMA 3N9RA 1TCDA 1G6CA 2Z2UA 3LBMA 4O8RA 2Z6IA 3PBVA 5E93A 4BR1A 3ATZA 3CHVA 4MZ1A 2GOUA 1YTEA 1B57A 1JRCA 1B9BA 3DZ1A 3G1XA 1D3GA 1UB3A 3HGJA 2A21A 4JDBA 4X2RA 5LNWA 1XBVA 1F6PA 3NAVA 4MJMA 3PC0A 3QSRA 5CPMA 2NUWA 5IM51 1TTIA 4LVDA 3W70A 3B04A 2G5WA 1C9DA 4WXYA 3M5XA 1PVNA 1V7YA 3KOFA 3UWUA 1G7UA 4OU1A 3LCWA 1AL8A 3PB0A 4TIMA 3P8IA 2Q3RA 2A7NA 4A22A 4O15A 4ZQPA 3LTSA 4N02A 1K7FA 3LRKA 3QW4B 3UZJA 4C1KA 4HPXA 3QM3A 3TK7A 3C56A 1FCUA 3IIPA 1XL9A 1XDMA 4NZJA 2A0NA 3CB8A 1LOSA 5DBTA 3WK3A 1U5JA 4CCCA 1YADA 3TSMA 5G5IA 3L66A 1OX6A 3O05A 1I2QA 4X9SA 3CC1A 4Z0SA 3CT7A 5J5DA 4WY0F 2G96A 2Y6ZA 3UYCA 5AC8A 2W6RA 3W74A 1XI3A 1W3TA 1GYLA 2B4GA 2ZRYA 1QOPA 3NQMA 3GDRA 5HINA 4WOQA 1W8SA 2NUXA 2RHGA 4PL1A 1SZGA 4UTTC 2R8WA 4PH6A 3EXTA 1T99A 1KM5A 4JX5A 3M43A 2DZTA 4IMGA 3PBUA 4DO4A 4O16A 3WJWA 4DQWA 2NX3A 4PEKA 5DELA 2YDAA 3TCEA 3S42A 3NQCA 1ME8A 4IX0A 1O60A 1XBZA 3W1NA 4UTLA 4WD0A 2WNNA 4NNBA 4HNVA 2ATSA 3UY8A 1S5WA 4N9BA 1SFJA 4Y96A 5CZSA 1Z44A 2E6YA 2DORA 3L5MA 1JCLA 4Z08A 2VXNA 5AYYA 2YPIA 4JTHA 1GVFA 4ZQOA 4Z0JA 1OX5A 4K8HA 1OX4A 3MW7A 2QJHA 2Y62A 5C55A 4MY8A 3RLUA 2JBMA 3FLUA 1I2RA 3M1ZA 3AJXA 3C3NA 5AYZA 3F4NA 3M16A 3TSDA 4RZ5A 1A53A 1VGAA 3CIWA 3HG4A 1K02A 5EY5A 3N14A 3SI9A 3TMQA 3GVGA 2ZRZA 3LLDA 4JNMA 5BOOA 2E6FA 1X8FA 5DLCA 1C29A 2DJXA 3W23A 5EBUA 4OHQA 1H51A 4DXVA 4KFPA 3KX6A 3PAJA 4DF0A 1SUXA 1QO2A 4AH7A 1TQJA 1K7XA 3L65A 3G3MA 4O52A 1TPUA 2CWNA 3OVRA 4CQAA 3DFSA 1KLYA 4GC4A 1LDCA 3NL2A 5K9CA 5K4ZA 3DXIA 1VCGA 2EGZA 5GVJA 2OT0A 5EPDA 3ABOA 1TPH1 2NXGA 5DXXA 1JRBA 3G0SA 4JTIA 2FDSA 3ZS4A 1Z41A 4UTJA 1BEUA 2E68A 5LNRA 1G4PA 1JUEA 2CZ5A 2V0TA 4AHPA 2JKPA 2Q3OA 4A2SA 3W7QA 1GVRA 3TE9A 3C8FA 1SZEA 3YPIA 2TSYA 2NV2A 1GQNA 2Y7FA 5KMYA 4Q32A 5HWJA 1X1OA 5I3FA 3HMJG 3FYOA 1JVNA 2NWRA 2A6LA 4ZZ9A 3B05A 4TX9A 4AXKA 1QPNA 3CM4A 3WJXA 4DF1A 3S5ZA 4O4VA 4IMCA 4BF9A 4J9JA 4N9EA 2C19A 3VE9A 3T4CA 1OFRA 3EX1A 1V5XA 2H8XA 2WJZA 1WX0A 2E5CA 2PE4A 1PL9A 4ZQCA 1WQ5A 3H54A 1ZAJA 3LCXA 2C1HA 2HMCA 3OVQA 3UWZA 4B5NA 1EIXA 1MO0A 4MYAA 3RLVA 1GPWA 3WK1A 1GWJA 1SO6A 3R8RA 3HPSA 1VYRA 1ZALA 3STCA 5HULA 4JTSA 1QWGA 4MZ8A 3C2EA 4XZ9A 5KZDA 4FNTA 4O4WA 2C15A 3G0UA 4O28A 5G2HA 4JYFA 3BVJA 3JRKA 1P1XA 3PUOA 4Y8FA 4K8EA 5G4WA 3HBLA 4PCFA 1NFBA 1JUKA 5LKYA 3NA8A 1ADOA 3FYPA 2A7RA 3HB9A 3PR2A 1JCXA 3W7RA 1THFD 3T55A 2BX7A 4KFOA 4UTUA 1WBJA 4QNWA 3OHIA 3N19B 3V75A 4R7JA 3W7CA 3NQVA 1LCOA 1QPOA 1KV5A 3LRLA 3QMTA 2YR1A 4WY0B 1IXPA 3T7VA 2G95A 2X2GA 2A85A 2V5LA 4XQ6A 2EF9A 2J9XA 3NQAA 1OK6A 1P0NA 4IXHA 5AHFA 4YCOA 4LVAA 4YCPA 2ZTJA 3OBKA 1OF8A 5LHFA 4E0CA 4MLJA 1LZOA 1Y0EA 2DZWA 3NDOA 1TPFA 3HGRA 1TJRA 4UTWA 4ONVA 1VLWA 5J5RA 4N4QA 1Z42A 2VEPA 3H53A 1SW3A 1ZJIA 3ZWSA 3TFCA 1O95A 2CZEA 3CLMA 4HNTA 3C2OA 3DI0A 3KVMA 3W76A 3G1AA 4KWWA 1K7EA 1J4EA 2BLEA 4IMDA 3L0NA 4LS0A 4JN6A 1EUAA 4MOZA 1SU5A 1FQ0A 5BMWA 3W7DA 2YCEA 4N4PA 3LERA 1KBIA 3M9YA 4NQ1A 4NX0A 2RDWA 5F2GA 2PRLA 3MMTA 3UQNA 2YW3A 5I3GA 3R13A 1H62A 3MP5A 4XBKA 1L6SA 4QITA 5D2YA 4RV8A 3W7JA 1FCQA 3VKJA 4K37A 3LCGA 1A50A 1FUYA 1YXYA 2ZDRA 4K38A 3NL6A 1QAPA 2FPTA 2GVGA 4LVBA 5CZ0A 3K30A 3N73A 1OG0A 3EEGA 2YZRA 2E6DA 2OX1A 2QUUA 1SR9A 5D32A 5DY3A 3TW7A 4U4MA 3R5EA 5L6UA 3ZWTA 3LTYA 4WJEA 5KSWA 1QPQA 1DV7A 3W1RA 3N2XA 4FNRA 5F4SA 1XM3A 3UWVA 3GIYA 3PY2A 1XDLA 3B4UA 3TQVA 3E12A 4RZ4A 4BFAA 3BG5A 3KRZA 3GR8A 5BNKA 5ABTA 3S1UA 5AC6A 1PHWA 5K2ZA 3NPVA 4MUZA 4LVGA 1SSDA 1A5AA 5D04C 3O6CA 3TJLA 3G1HA 3NM1A 2YGYA 3W2LA 4HHPA 1NSJA 4CCDA 2WPBA 3OEXA 1NF0A 3MP3A 4QIUA 2XN0A 3LHWA 2NXIA 3GAYA 3NQEA 3B03A 1HTIA 1WOBA 1G4TA 1VHCA 2ALDA 1MEHA 1YDVA 2CLMA 4UXDA 1KM3A 4MFEA 5I3KA 3G24A 3GB6A 3PS7A 3UNDA 3KXQA 3LGEA 3O63A 2V81A 6TIMA 4R34A 4YXGA 4WOZA 3BG9A 4AVFA 4QAIA 5U4NA 4NJIA 4NNCA 4JX6A 2NUYA 2WO5A 3G1DA 5HUOA 1W56A 3P5YA 2QCLA 1WDWA 1OFPA 2ZA1A 3TMLA 3DKLA 2PRMA 3Q37A 5FESA 4IOTA 1FDZA 1L6YA 2Y88A 3HJZA 4JTFA 5AHIA 1Q45A 3QQ1A 3GXPA 1AL7A 1F6KA 3P81A 5LNUA 1LOQA 3SIZA 3W1LA 3PWAA 3I6RA 4N9DA 1JQXA 5AHNA 5D38A 4JIQA 5DN1A 1GZGA 1ONRA 1YPIA 3C2RA 4BI6A 3QC3A 1H7OA 4IMFA 3VE7A 3W71A 3W75A 5EMUA 2C16A 1H7RA 1EA0A 1ME7A 2NWSA 1JUBA 2BZNA 4O0ZA 3GDMA 1K03A 5K4XA 4FO4A 1TTPA 3GDTA 1O94A 4H6KA 4MKNA 3TU9A 1PCKA 2VFHA 2Y7DA 2C14A 2CLIA 4AHQA 4HKPA 4QSHA 1GJPA 1SSGA 2WNQA 3GX9A 4UFIA 4O57A 5U7SA 1LLWA 3DFQA 1KLZA 1OYCA 4UNKA 1OF6A 3EWBX 4FIRA 4AF0A 3NPXA 1OVDA 4XKYB 3DFPA 3PG8A 4LUIA 3NR0A 5F4XA 1SO4A 3O15A 2QDHA 1H7PA 5HJLA 5D02A 4I7VA 4QQ3A 1N8FA 4PODA 1J5TA 3F4WA 1ICPA 4POCA 1HUVA 3KVKA 2GQ9A 2YFNA 1TMHA 3F1QA 5LNSA 4QM1A 1OFOA 2CLFA 2AAMA 3M5YA 5DXYA 3S5NA 4M5PA 1ZCOA 4O0KA 2X30A 3BGJA 3TFXA 4P61A 3CTLA 2QUTA 2WQPA 4DPPA 2YYUA 3EX3A 4UMAA 1EX5A 4DO5A 5KZEA 3NM3A 5D37A 1GVSA 1TYGA 4RXFA 3D0CA 2ZZ1A 2W0UA 3TJXA 3MHFA 1GVQA 3PBYA 3GLCA 3MO7A 1LROA 3QH2A 2JKEA 1KW1A 2QCEA 3IGUA 3NO5A 1O4UA 1UBSA 5G2WA 3W1UA 1FWNA 3S1VA 3W86A 2VKZG 1AW5A 3USBA 3BGGA 1VR6A 3ZFHA 2RKXA 3UPWA 2V8ZA 2H3BA 4TU1A 3AO0A 1GTEA 1W3IA 3NEVA 1K3UA 4RX0A 2GPTA 1QO5A 4LU0A 3KRSA 1M5WA 1OJXA 1LRNA 1SFLA 1AMKA 4AEOA 3NGJA 1OYBA 3ABRA 3DFNA 4GUIA 2O7SA 4Q33A 4FXRA 3NQDA 3TA6A 1MEIA 2ZCGA 4RLIA 3CWNA 5KITA 3GYEA 3W7HA 2NV1A 2EPHA 2RFGA 4M7SA 4MIMA 3SY5A 1L6WA 3UWQA 1YXDA 2XN1A 1TRIA 1PS9A 4OBTA 5F2MA 3DFOA 4LV4A 3E96A 3TR2A 2ZRWA 1H50A 3VCRA 2NZLA 1N7KA 1TPWA 2QDGA 3LXAA 4K6AA 3UXDA 4YLWA 4UTTA 3W7EA 2GQ8A 1XCFA 1TPVA 3INPA 2O7QA 3NPUA 5D2WA 2GVLA 3LB0A 1IIGA 2V2HA 3QSTA 1DBTA 2RDTA 1H5YA 3Q58A 1F73A 1QR7A 3QPZA 1LYXA 5C2XA 2ABBA 1ZAHA 3W83A 3TQKA 3R2GA 2FJKA 4BWLA 1D9EA 1RQBA 1YPFA 2ZZ3A 2VFGA 1DKWA 1OFQA 4O50A 4XTIA 3P5ZA 4LWWA 2Q8ZA 1R47A 3QPYA 3R12A 4RJEA 1FDYA 4CQ9A 3W7LA 3HG3A 2HS8A 5E1QA 2VFDA 2YYTA 4JD4A 2FPVA 3L68A 1P5BA 3UPBA 3W72A 1OFAA 5H2ZA 3M44A 4ALDA 1VYSX 1XBYA 1WV2A 2J9ZA 1TV8A 4JYEA 4JDYA 3VFLA 1FY6A 1VJIA 4E2BA 1VYPX 1YDOA 1QNVA 3EKZA 1IXQA 3WK0A 2PC4A 1ME9A 5HUPA 4LTSA 2CLLA 4Z1AA 1TTJA 2B7OA 4UMCA 4HSOA 3SECA 3EB2A 3C52A 1TREA 4UFMA 1ZY9A 2B7NA 1HO1A 3FIGA 3C0JA 3LHZA 5G1YA 3SGZA 2YW4A 5HNRA 3L5AA 3MHGA 1JULA 3N2MA 3KVLA 2QCDB 2H3DA 1DJNA 3UXAA 4LV9A 4E2DA 2PCQA 2DZVA 1M7PA 1U83A 2OCZA 3L0KA 1GOXA 3IVSA 4OT7A 2ZYFA 2YXGA 4UFLA 5FF7A 4EIVA 3EX6A 3VNDA 1W31A 1R30A 1R2RA 1DOSA 1WA3A 3LHVA 1FWSA 2QCMA 1LLZA 2QR6A 3NVTA 4XWUA 1W5NA 3O07A 2ZRVA 1OYAA 4MZYA 1OK4A 2NXHA 3CEUA 4O1BA 1P4CA 3G1VA 1EB3A 4PTNA 2A4AA 2JK2A 2P10A 3A5VA 4Y9AA 2FFCA 2Z0IA 2R94A 1DL3A 3W1MA 1DHPA 4Z1CA 3IIXA 1ALDA 1PE1A 3I68A 3S6DA 5HR7A 3FKKA 1TPEA 3M0ZA 1W54A 4CQ8A 3I7SA 1F74A 3U2OA 4MY9A 1IF2A 3M6YA 4CNOA 3G0XA 4JIPA 5FEZA 4L4LA 1WYIA 5F1UA 1I2OA 3FEMA 1KFKA 3SR7A 5LHEA 1HO4A 2Y70A 5CGQA 5C54A 4KFNA 1J2WA 3WFAA 4CCEA 2E77A 3FA5A 1RPXA 3W2NA 2A2IA 3DENA 4KKXA 5AYXA 2DJLA 3W7IA 1TB3A 2NX9A 3FKRA 1Z48A 3EWWA 1K8XA 3LLFA 3G8RA 4TR9A 5FEWA 4XTDA 1L2UA 4JTJA 1FCBA 4OV4A 3TV8A 1KFEA 3W7MA 1H7NA 1UUMA 3GAKA 5I3HA 2E1DA 2XN2A 4K7YA 1DQWA 4GNJA 1YXCA 4S2CA 1YLVA 5IBXC 3L2IA 4JY8A 4JTEA 1OABA 3GZ3A 4YMZA 2JGYA 4ZMGA 1W37A 4S2BA 2ZFAA 5D03A 5D2TA 1X1ZA 1ZFJA 4NUWA 1OHLA 3QW3A 2P1FA 4WY0A 3P84A 4YL2A 1XBXA 4A3UA 1F05A 3PF3A 3KVJA 3P60A 1W5PA 1UJPA 2Y85A 4UTKA 2V2CA 3IIZA 5AB3A 2ABAA 1GG0A 4OV9A 4MY1A 2EKCA 3BLEA 1T8XA 4NU7A 4O12A 4S1FA 4LVFA 3W1TA 5F4WA 2J9YA 3MP4A 5DBUA 4RCXA 3W6YA 1YYAA 4YWIA 4CNNA 4LRSA 1RV8A 1KFCA 4ORIA 1R2SA 4K7VA 4O54A 4ZQRA 4FIQA 1ZAIA 3MI3A 2YX0A 5D05A 3O8AA 3TROA 4M6VA 4EWND 3LXCA 3PBWA 2C13A 1MEWA 4NT0A 4IWWA 4P2VA 2RDUA 3LRMA 3GR7A 4PC8A 2V5BA 3TIMA 2QJIA 1WAUA 2JGQA 4N6EA 3W7NA 4LC6A 4O14A 4IPIA 2BWGA 2QEZA 3ATYA 5KZMA 4UMBA 1MSSA 4AHOA 2GJNA 1HL2A 4K39A 3FJLA 2C6QA 3EX4A 4UC5A 4JGDA 3W7KA 2CU0A 2QCCA 4ADUA 4E38A 4MPQA 5AHEA 4NXKA 1VRDA 4WUIA 4PFMA 2WOQA 2GUUA 5DCBA 3C2FA 1M7OA 3DGRA 3BG3A 3CWOX 4BK9A 2V2DA 1JCYA 2B7QA 3C2VA 5LNVA 4JXCA 2J24A 4LT9A 5HWMA 2LLEA 1FXPA 1W0MA 4DO6A 1WXJA 1I2PA 4IGHA 5CZJA 1EP1A 1M6JA 4LUJA 2TRSA 4MVAA 4O10A 1G67A 4FNQA 3DI1A 3STFA 2X1TA 2DZUA 1FWRA 4O1DA 3EWZA 1T96A 1KM0A 3PG9A 2IQTA 5CG7A 1JCMP 4JY9A 4GUJA 4EOUA 1DVJA 1EP3A 3BV4A 1XUZA 3STGA 4NJGA 4UR7A 4M6PA 1HFBA 1WOAA 3L9CA 4GBUA 5AFDA 1FBAA 4JTTA 4EF8A 3TX9A 2VEKA 2OJPA 2WNZA 4AAJA 2WV8A 3GXTA 4NJKA 4LOCA 5G2IA 4R53A 1Q3NA 3LHYA 2Y61A 2ZZ6A 2VEIA 4LNYA 3A21A 4Y6GA 2DZPA 3THQA 4EF9A 5BMXA 3HG5A 1TV7A 1VLIA 5DCEA 1G7VA 1AW1A 3HGSA 2V30A 1GG1A 3UWWA 2QCGA 1QDSA 2CLEA 4ML9A 3W88A 5KTLA 1SO5A 3GDKA 1TTQA 4MLRA 3EWUA 2FLIA 3TSBA 3E0IA 4RR4A 4DBEA 4G1KA 4GWEA 3SGUA 1QPRA 1LBLA 3NXFA 4GRSA 1K8YA 3NZRA 1XUUA 5FF2A 3QMRA 5HR6A 1UCWA 4UR8A 1UUOA 3SFKA 3MI2A 3W2KA 1VC4A 4LY8A 4MFDA 3PUEA 4FX6M 3CU2A 3IEBA 1KM2A 1WBHA 3E9AA 3NQFA 4NNAA 3MBFA 3SSJA 3M41A 2I14A 3A23A 3Q2DA 4FB7A 4FX8A 1L9WA 1H61A 3G1YA 2E09A 3HO8A 3BPWA 2C0AA 2V82A 1SZNA 3NQGA 2E6AA 5HMSA 4LRTA 4JX4A 1A5CA 1Q6QA 3LI0A 2PRHA 1G4EA 3O1NA 2VFIA 3CQ0A 1N55A 3M47A 5FF0A 2VC6A 2WSQA 2F84A 3CEPA 1JCNA 3RU6A 3IVTA 3GXNA 3W9ZA 1VHNA 4TO8A 3I7RA 3PB2A 4XKYA 1F76A 2QCFA 1QCWA 4A21A 3ABSA 3Q94A 3M5VA 4M19A 2ATMA 4HIBA 4UTIA 2RH9A 4ZQNA 3MHUA
chains in the Genus database with same CATH superfamily
1DWIM 4BI7A 5E0KA 4FF7A 3B0VC 1GVYA 4EXAA 3SN4A 1V3IA 2GVJA 2OELA 1MXDA 1UD4A 3QZAA 2VNCA 4GABA 4E3TA 1ZCCA 3KBSA 1KTBA 2VOMA 1V0KA 5FSDC 4RL3A 3KP1A 3QV6A 2C0HA 3VIOA 3W7OA 3E2QA 1UWSA 2VEMA 1IGSA 3W7PA 3UGRA 3AYSA 3G1SA 4XBSA 5C7VA 4RNHA 2ZTKA 3BCDA 3W22A 3WF4A 1S5TA 4D6IA 5JU6A 4DXXA 3EWYA 4B3LA 4B5WA 2Z00A 1NWTA 4GH3A 1EF2A 1H7XA 5EBAA 1GEQA 2XUCA 3MU7A 3E1F1 3QYQA 3WO8A 2QAFA 3V1HA 4C6IA 5F2LA 4CNPA 4ZO8A 1ODUA 4LAUA 2CHOA 1R2TA 4AIUA 1FFRA 1TPC1 5A8MA 3CMFA 1T8QA 3B8WA 2WPGA 2QF8A 1Q66A 4ZR8A 3B0YA 3KL3A 2OU4A 5EKYA 2H9AB 3WQWA 4ICNA 3P67A 4I8DA 4NX5A 4XZHA 5DCDA 3BMWA 3B9NA 4GXPA 1UWIA 4HA3A 4I7WA 1RD5A 2E5BA 1TJ0A 1B4EA 4AX6A 1O5XA 3ZSSA 4M7TA 2J27A 1KGXA 5HANA 3H7UA 1B2YA 4B5UA 3EKLA 3PAOA 4ICCX 1WNOA 1F7BA 1PPIA 3UESA 1P7TB 3WEMA 4LS1A 3UR5A 4FEZA 1KKOA 4PB3A 3PVFA 1VQTA 5TBOA 2UV8G 3VI2A 1OX4B 3BK0A 4HU0A 2V38A 4BWLC 2EBNA 2NLIA 4MKSA 1I60A 1L6GA 2H8ZA 3MUXA 3OHMB 1DXIA 3WH9A 3G8EA 4IIEA 2QVNA 4C1NB 2PC8A 3THAA 3ABQA 4JS3A 3P74A 2BDQA 5BU6A 1C8VA 1EC8A 4DAFA 4NAEB 2PLJA 1Q7ZA 3HJEA 3FFSA 3FDGA 3RILA 2CFFA 4O17A 3TUUA 1P0DA 1JNDA 3IUIA 4F0SA 4CUCA 2NVDA 3NL5A 2DV0A 4HNCA 3SM0A 5I3JA 3VINA 2DT2A 1BRLA 2L5HA 4U3CA 1H1YA 3BW4A 3DYPA 1ISVA 4DELA 5TIMA 5A8OA 2C91A 1FWBC 2PDQA 1IT0A 5DO8A 3AXXA 1W6TA 4UQBA 2JEPA 1YEYA 1YKWA 1W5MA 1XD0A 1RQHA 4ZVJA 3OIXA 3MC5A 2JALA 3R6IA 2VDHA 1CECA 3VKKA 3NZ1A 1SPQA 1SYTA 1SJDA 4NASA 2MANA 1I4NA 3TN4A 2V3EA 2ZX7A 4HPGA 3QKEA 1DWFM 1DIOA 4MJZA 2Z1BA 4MB1A 3VZYA 3WIJA 4I5XA 4QE5A 3GHUA 1W3KA 1IR1A 3WZ0E 2IS7A 3MSDA 3BQ6A 4TTGA 1P6CA 2ZX8A 5CSRA 5D09A 3SO7A 3W6LA 4H41A 4PMDA 3GD6A 4R88A 3MUZ1 3GY1A 2PDUA 1G4SA 4HU4A 4V15A 3EA2A 3TXVA 3UJEA 4B15A 1XPGA 1FWTA 1E51A 4E3VA 4A8LA 1UUQA 3BJSA 1ZP3A 3S0CA 1RAKA 2J62A 1NP0A 5CJ5A 3LN3A 4E8CA 3MANA 3IRDA 4H1ZA 2OWCA 3CL8A 3OZMA 1SW7A 3GDLA 4MYXA 3IIVA 2AQVA 3ZT6A 1EGVA 2BY0A 4GKLA 2PAJA 2WMJA 4IJRA 3W7GA 3CZEA 1A0EA 2XZ9A 4PUWA 1SMAA 1QATA 3B8SA 4HSHA 2ZZ5A 4F0HA 3WYZA 5F1VA 4QLJA 2ZA2A 4R27A 4BZYA 3W81A 2ZZ4A 4S3AA 1GOQA 3WJYA 4GIRA 5CC7A 1ONWA 5JMUA 4GCXA 1FX6A 3LV6A 2XDFA 6ALDA 3UWYA 1SO3A 1KFLA 4WZHA 3QPEA 5HJYA 1KM6A 1IXOA 2I5QA 2ZC1A 5FI8A 3B0UX 4FOKA 5MHBA 4IIDA 1BAGA 4ORMA 3HV8A 3TC7A 3MA8A 5CBIA 1UKSA 3LD5A 3RJYA 2QV4A 2QJGA 1LBMA 3WJZA 3OA3A 2PDIA 2BHYA 1ZS2A 4IGMA 4AWTA 3LXBA 4L9ZA 3SCVA 3WBAA 3LHTA 1E1CA 3P80A 3GC5A 2A7PA 2PGRA 2VOTA 1XINA 4GY7A 4FXSA 3F5JA 2ZVRA 4JEJA 4R5EA 3WLHA 8TIMA 3BSMA 3GVVA 3QOKA 3ZYZA 2PDJA 4GI8A 3GXMA 4H3DA 2E7FA 4X0VA 2J7EA 3IV3A 1VCVA 2Z2BA 3II1A 3LBCA 2A1YA 3SN0A 4ZL1A 2PDHA 5LA2A 3GBDA 3CPUA 3UZWA 3DHDA 2INZA 5D2VA 4QBXA 1W9DM 3CZGA 1BWKA 1JYVA 3Q67A 4UOQA 4PUJA 3DGBA 1V6VA 2BVWA 2HK1A 4M81A 4ACZB 3UU0A 4GACA 1FWWA 4JTRA 1VEOA 4YWSA 1K4GA 1PBGA 2V3FA 2AKMA 1B30A 5AVNA 3S2MA 1H1ZA 3T40A 1GZ1A 4A8NA 3EBVA 3TTSA 3R89A 3OIHA 4DNHA 1MRQA 1GQIA 2WCGA 2C1GA 1Z7AA 2E8ZA 4US6A 1E0UA 2RUSA 4K8GA 5TQLA 3MYOA 4GG9A 4Z1BA 5FEXA 1G69A 4QNEA 2OQLA 3SCQA 3U48A 3W37A 5EB8A 3A9IA 2PGWA 4HN4A 4YYFA 3ZVHB 3NYDA 5GPRA 3H21A 3NNTA 2PURA 3C6CA 3FSTA 2R6OA 1Q6RA 3HZ3A 3WD2A 4Z17A 2VI0A 3CUXA 2GK1B 3KWSA 3P7YA 2EO7A 4W84A 2QGHA 2FYMA 4C6MA 3QV7A 4HPJA 4AY1A 4B5XA 3W82A 2PS2A 1XKJA 3RM9A 3VA8A 2YCLA 3DC8A 2BY1A 2PEVA 4MPKA 2B7PA 2CW6A 3DKJA 1MFUA 1OBAA 3S9YA 3EOLA 2D3NA 2G8ZA 4JR5A 2XWDA 5HWNA 3P82A 1TSIA 2Y89A 4KCWA 3ITLA 3BTNA 2XSAA 2PCEA 2HWGA 2VEFA 3VGBA 1OB0A 4AU0A 2V5KA 2J6XA 4IJBA 2ZA3A 3E3HA 2QCHA 4GVFA 4IFOA 2J7FA 1H41A 4OGZA 4ZB2A 1JF6A 3DECA 3ITXA 3KTXA 3NL3A 5I02A 1XFCA 3LSBA 3BWWA 3CT2A 2ZRUA 1F2JA 4J2PA 4KWUA 3MJYA 3LU2A 4HYWA 4URIA 3OGRA 3LV5A 4QJ1A 2HJPA 1ISXA 2FJUB 1KV8A 2CPUA 4DXKA 4EPDC 3NQ6A 1BWVA 2WSYA 1CLVA 3N9RA 1FWGC 5I6SA 2A3AA 2Z2UA 2QDDA 4DBWA 3K4AA 2WYSA 4O8RA 2Z6IA 2KX9A 3PBVA 5E93A 3U7VA 4MZ1A 3VGDA 1YTEA 2O9RA 1B57A 2WC4A 1MQQA 1JRCA 1QNOA 1VRXA 1EZWA 3HGJA 1XBVA 4QDMA 4MJMA 3PC0A 2ACRA 5CPMA 1C9DA 4WXYA 4GKTA 4AXNA 3MS8A 3PB0A 4TIMA 2I9UA 2Q3RA 2A7NA 4A22A 1UKOA 1QI2A 1K7FA 1L0PA 4I5RA 4C1KA 1BPLB 1GCYA 2Z2AA 3TK7A 1KGUA 4Q7NA 2JIEA 2X05A 3CB8A 1N82A 2ACUA 4UOZA 1YADA 2PD9A 1EDGA 3O05A 4X9SA 4DJFC 1K8CA 2D0GA 3CC1A 1KCXA 3CT7A 4WCJA 2QMJA 4WY0F 2G96A 4QLKA 2OOFA 3CLWA 1GYLA 1CEOA 2ZRYA 3KBWA 2V5CA 4G1NA 3CQKA 3MMDA 3HA1A 1XIIA 4Q22A 4IHCA 1XLCA 2RHGA 4ML4A 4UTTC 3F5KA 3UERA 1FOBA 1QHOA 1T99A 4JX5A 1D3CA 1GUVA 5E09A 3SADA 4DO4A 1H49A 1XSKA 3S42A 3NQCA 4IIFA 4JIRA 1XBZA 5C9ZA 4HNVA 3M46A 1SJCA 2VD9A 1EGMA 2WZTA 1SR0A 1SFJA 2R1KA 3ZR6A 3W28A 2E6YA 2DORA 2WLZA 3M0KA 3EKGA 3H2EA 1E72M 1NELA 2GUYA 5AYYA 2D2HA 2VX7A 5M03A 4PSRA 1OX5A 2PWUA 4K8HA 2QJHA 3VD9A 3CZLA 1GOWA 4L6OA 2EG6A 3EA1A 3RLUA 3EPOA 4TX8A 2GSHA 2JBMA 1VENA 1CGXA 3M1ZA 3AJXA 2IPJA 3TSDA 1JCTA 3CIWA 1UR4A 5EY5A 2Z4GA 3HN3A 1E9LA 2YCIX 3H7VA 1NU5A 3PZMA 5BOFA 5BOOA 4KT2A 4EK7A 1EYEA 4A4AA 1LUCA 1C29A 4KFPA 1XG3A 3PAJA 1SUXA 1BYBA 1K7XA 4L4OA 1TPUA 1Y5VA 3OVRA 4H8NA 2YJQA 3LMYA 3AIWA 1KLYA 1PDZA 1FWDC 3CO4A 3NL2A 3W25A 2R24A 3IJ9A 1OGBA 3ABOA 5DXXA 3G0SA 1JEZA 3NXLA 3RR4A 2FDSA 1JFHA 1Z41A 2PF8A 3U0HA 3VZZA 4W7WA 2E68A 4C6QA 1RJRA 5LNRA 5EMLA 3HQPA 3TYBA 1JUEA 2VL4A 3EEZA 3IWPA 2V0TA 4AHPA 2JKPA 4LYRA 4A2SA 4IH3A 4MF4A 1SZEA 2PA6A 4W7UA 4FLQA 1J9YA 3T2QA 5KMYA 4LBUA 4Q32A 4J3XA 2HROA 3TJ4A 1X1OA 5AY7A 4CN6A 3HMJG 3FYOA 1JVNA 1S2VA 2NWRA 2A6LA 3WQPA 4AVOA 3N9KA 4TX9A 2VX4A 4GINA 4JOMA 5CXPA 4DF1A 4H9ZA 5EFDA 4IMCA 1ZL1A 1OD8A 4DO7A 3T4CA 3BAJA 2NSOA 1C9WA 3UZYA 3KBJA 2C1HA 4B5NA 1VF8A 4MG4A 3RLVA 3KBVA 4U2ZA 3WQ8A 1GWJA 1UR8A 3R8RA 3IUHA 3H24A 1OG6A 4MZ8A 3ZXWA 1R38A 1O68A 4N0RA 4O4WA 1MWOA 3G0UA 1WDSA 3VIMA 3JZEA 3JRKA 1P1XA 2GOKA 3PUOA 2ICSA 1Q2SA 5LKYA 1ADOA 3PR2A 1XIFA 1XV8A 4PRTA 2Z7KA 4IG2A 3PNUA 2Y5EA 1JCXA 1THFD 3T55A 2P88A 4QNWA 3T09A 2V3GA 3V75A 4R7JA 3DEQA 2VHLA 1SVDA 1LCOA 2HDJA 4TOQA 5MKGB 3MVIA 4WY0B 1IXPA 2X2GA 2EXOA 3VDGA 2PDYA 4UQAA 2EF9A 4PMRA 1WKYA 2J9XA 4LVAA 4CN1A 3R11A 5LHFA 4E0CA 4MLJA 4NYYA 4ONVA 3W0KA 1XYCA 3KZSA 1F3TA 4XZBA 5B80A 3VOIA 2TODA 5FL1A 3TFCA 5A2CA 2UBPC 4IL0A 1AJZA 4OBRA 4HNTA 4DI9A 3ME3A 3G1AA 5LA0A 1P43A 1EIBA 1J4EA 2BLEA 1E6XM 1V02A 1EUAA 3ZSTA 4CGTA 3GU2A 1IYXA 3H2FA 4P5UA 4PCNA 1BG4A 2HE8A 3M9YA 4LXFA 1I1WA 3G1RA 2RDWA 3UQNA 2V5JA 4GVHA 2YW3A 4ZODA 2PDMA 1PKMA 5CC5A 5D2YA 2PWVA 4TXEA 2OO6A 4GY1A 2YDRA 1A50A 5T8GA 2ZDRA 3NL6A 1QAPA 2GVGA 3K30A 4MMWA 2EJAA 2WMFA 3WNMA 3IJLA 2YZRA 2E6DA 4FXFA 3H2NA 3VDCA 1VFLA 2JF7A 1AQ0A 4ZSUA 5DY3A 4V33A 3WUEA 3TW7A 4HMEA 1ENUA 1DV7A 4C6JA 3GIYA 3PY2A 3BH4A 4GY0A 2PPGA 1B1YA 4HPHA 3WLMA 1MFVA 4E4PA 3GR8A 2DSVA 3ARSA 5ABTA 5AC6A 3VX1A 1GOMA 4GIYA 4C6DA 5A8QA 4CEXC 2J7CA 4MUZA 2VZSA 5EGRA 3G1HA 4CCDA 1NY1A 2QXWA 3MP3A 1CLKA 3PZTA 3NQEA 4JQ3A 1WOBA 2AGTA 3CAQA 1JZ4A 2ALDA 3AIVA 1MEHA 3GZAA 3P6LA 3NURA 5M2FX 4UXDA 1KM3A 4GA8A 3G24A 3GB6A 3PS7A 3UNDA 3LGEA 3LPFA 1EOMA 3M0MA 4YXGA 2ZX6A 4WOZA 4B9ZA 3F2CA 3BG9A 4NJIA 1XIGA 2NUYA 3VOFA 4J3SA 2FTWA 1J8VA 1W56A 2BOGX 2E4TA 4GLEA 2ZA1A 4TV5A 3TMLA 1FDZA 2CIPA 2BASA 1Q45A 2YCJA 3QQ1A 3GXPA 3P81A 5LNUA 2GGIA 4N9DA 1JQXA 3QC3A 3SUUA 4IMFA 4C6LA 3RX3A 3W71A 3N1AA 1ME7A 5CQ1A 1HQTA 4F2UA 1IEVA 2HPMA 4MJ4A 1B54A 4Z2JA 2VEGA 4H6KA 6A3HA 1N2VA 4YVVA 1DXEA 1UWRA 4AX7A 2NQLA 3B8TA 4K1WA 3GX9A 1J0ZA 1H11A 1RA0A 4CNUA 2EPLX 4WGHA 1X98A 1QHPA 1RCOB 4AF0A 1OF6A 3EWBX 4FIRA 1Z89A 3WEZA 2X41A 3DFPA 4LUIA 3O15A 2PTYA 1YIXA 1H7PA 2ALRA 5D02A 1N8FA 4YN5A 1J5TA 3SQSA 4C65A 4WEVX 3F1QA 4WRHA 4QM1A 2ZE0A 3ZOAA 3M5YA 5CZKA 3HM7A 1EJVC 4QXIA 4S3JA 1ZCOA 4O0KA 3LZ3A 3BGJA 3TFXA 1OCBA 3EX3A 1EFZA 3KP0A 1NFGA 1GVSA 3ARWA 1TYGA 1UA7A 3SIMA 4REQA 7A3HA 2W0UA 5E9XA 3MHFA 1AQFA 3BLPX 3Q45A 3GLCA 3MO7A 4UCFA 4KEVA 3IGUA 3FAWA 1UBSA 3W1UA 4F0KA 1ZJHA 2AMGA 3NQBA 5GNZA 3S1VA 2Y24A 1AW5A 1VR6A 2RKXA 2V8ZA 2BVDA 1RHCA 3VIHA 2IMRA 4U33A 1W3IA 2ZUTA 4F0RA 5M17A 2FMNA 2GPTA 2CETA 3MKVA 1NDZA 1M41A 3T0AA 2VC7A 3APTA 1HZYA 1AZ2A 1J12A 5A94A 2WSPA 1QXLA 5E6ZA 1JYNA 1PXGA 2V5DA 4DRSA 5AZ1A 3CWNA 4DJFA 1MRAA 4KRTA 1X6NA 1TRIA 4LV4A 3RN6A 1ADSA 4Q8MA 3TR2A 3V0UA 2OSYA 2VX6A 4H8HA 3LXAA 2QDGA 4BQ3A 3DC0A 2D23A 2GGJA 4UTTA 3BAYA 4MHBA 2GQ8A 2WBKA 4DJFD 5I07A 3EWDA 3NPUA 1LWIA 3QSTA 2RDTA 4HVXA 2O56A 5BYWA 1LYXA 2X0SA 1ZAHA 4PFHA 2MNRA 4GZ7A 3IUDA 4TUFA 1OQFA 2ZUNA 2ZZ3A 2Y8VA 2C79A 2ZXQA 1G0CA 1SFTA 3FCPA 3VD3A 5HPCA 5C0QA 4RJEA 3SBFA 3GWQA 1PIFA 2VFDA 4PUMA 2J8GA 3CHDA 2FPVA 2FKPA 1UZDA 3LBOA 5H2ZA 3N4FA 1MQRA 4AC1X 1TV8A 4JDYA 3ARYA 6REQA 2F6KA 1QNVA 3WK0A 2W3ZA 2PC4A 4GYJA 1E6SM 4LTSA 3ORWA 3PTQA 3IJ6A 5TF0A 3SECA 1CPUA 3AIUA 4PTWA 3VGEA 3EB2A 3FIGA 4H7VA 1EA9C 4K1GA 3SGZA 3KS6A 3R94A 2D2OA 3WQEA 3S3GA 1ZTVA 4JQ1A 4ES4A 1HN1A 2DUXA 2A3CA 4G56A 1B0IA 4LV9A 4JFTA 4E2DA 2PCQA 1CDGA 1EZ2A 2QQ6A 1GOXA 5DMYA 1X96A 4GI4A 1W1VA 1HKWA 3VNDA 1W31A 5BWAA 3PZNA 1WA3A 3LHVA 1HJSA 3AYRA 1JYWA 1VBUA 3QVQA 1FWSA 4NRSA 1RLCL 4NG3A 5EMMA 2RGMA 1J79A 1OK4A 2NXHA 3CEUA 1XD1A 2BB0A 1VFSA 1EJ7L 4Y9AA 1DL3A 2FVKA 1PE1A 1V6WA 1V6XA 3F2DA 3M0ZA 4CQ8A 3R7MA 1F74A 5B7ZA 1EDQA 1IF2A 4CVUA 1MUWA 4QDWA 4JIPA 3QYSA 4L4LA 3CASA 5ABHA 2V67A 4C90A 1I2OA 3PZVA 2CZVA 3H4XA 4ZXOA 1KFKA 5CGQA 5C54A 5HAOA 4FOUA 3DENA 4KKXA 3AHZA 1V51A 3R8HA 3FKRA 3M0VA 2DY3A 3PJUA 5ENLA 4U31A 4TR9A 5FEWA 1A5OC 2GUBA 3W38A 4U5KA 2ONEA 3KW3A 2OZTA 4OV4A 3PPFA 1UMYA 5E5CA 1NM9A 3T0DA 2XN2A 1NWUA 1DQWA 2Y5SA 1YBQA 3DG3A 2DIJA 1YLVA 5IBXC 3CQIA 3L2IA 4AYSA 4I9MA 4JTEA 4YTSA 3BLLA 1W37A 4QGCA 1X1ZA 1KCZA 4NUWA 5XIMA 3QW3A 3WNLA 1XBXA 5JIPA 1O7AA 3ARZA 2UY2A 1F05A 1TUFA 3PF3A 2FDMA 2WJEA 1YE6A 1B3VA 3IIZA 4MNLA 2ABAA 5GQBA 2EPNA 2GJXB 4P7NA 2PBOA 4S3KA 4EPKA 2G0WA 4LVFA 4KS0A 3U2EA 1R9XA 1YYAA 3L4XA 4YWIA 1KFCA 1E15A 1ZAIA 1I0BA 4D8LA 2CITA 2YA0A 3FNDA 4C91A 4KESA 4CD4A 1X1NA 3N15A 2RDUA 3LRMA 3TIMA 2WHKA 4XD6A 4N6EA 3W7NA 4LC6A 4QFUA 2OLSA 5KZMA 4Q8OA 1MVYA 4WDTA 5FKYA 3KHDA 2GJNA 5HJXA 3FJLA 1OWQA 4IIGA 1U33A 2C6QA 1XIMA 4E38A 4MPQA 4HOWA 4BS0A 5AHEA 3W4RA 1GVEA 4NXKA 4WUIA 1KWGA 2PLMA 3BLKA 3CUJA 4UZUA 3CWOX 4J3WA 2V2DA 3M6DA 3UCQA 1JCYA 3OLEA 2OWWA 4RNFA 1E3XA 4JXCA 4IP7A 5HWMA 4LBSA 2LLEA 5FJPA 1EEXA 3WUGA 1QI5A 3P14A 4KEMA 1EJUC 1I2PA 5CZJA 1J96A 4LUJA 2TRSA 4O10A 5D9NA 3KTCA 1ZBVA 4O1DA 1X38A 1T96A 4LAOA 3T8LA 4HGXA 2QPXA 4GUJA 3GDBA 1DVJA 1E0WA 1E4IA 2FMOA 3BV4A 2YA1A 1J2BA 1EKOA 4UR7A 1HFBA 4FF5A 5C2GA 1N8WA 1QOXA 1R9ZA 4GJIA 3ZMRA 1NQKA 4JTTA 2CWXA 5IHRA 2OJPA 3MZ2A 4AAJA 4U3AA 3GHTA 4LOCA 4R53A 1YMYA 2P3ZA 3W27A 4QLLA 2VEIA 4LNYA 3A21A 3QLDA 3ARTA 3THQA 4EF9A 3USZA 3HG5A 1TV7A 4F40A 1VLIA 2YCKX 2VD8A 1AW1A 2V30A 1GG1A 2QCGA 3PZUA 3RJXA 1ZBWA 4HB7A 3E0IA 4DBEA 4GWEA 1PZ2A 2OYLA 5JVLA 1UQZA 3NXFA 3NZRA 1XUUA 2EG8A 4AW7A 2VYOA 1AH4A 1UUOA 1RP9A 3UA3A 1XS2A 1DE5A 3SFKA 3MI2A 3OYZA 4Q4MA 3K5XA 1WBHA 3LEPA 4L5ZA 2XJ7A 4NNAA 3SSJA 3A23A 3Q2DA 4FB7A 1H61A 3HO8A 3MSRA 3BPWA 4J1OA 4NHVA 3NQGA 5H6HA 1A5CA 1Q6QA 2WVVA 3V4BA 3CQ0A 2V63A 4B9YA 1N55A 2MUCA 1E6RA 1UH3A 1TCMA 2VC6A 3WG6A 2BMBA 1KCKA 1XLKA 3GXNA 2J8FA 3GXIA 2PTXA 3UXIA 3PB2A 4XKYA 2XVGA 4UTIA 4X60A 4C6FA 2WMIB 5T91A 3NYZA 3QF0A 4W85A 3S1XA 3BLDA 1HF6A 4NZFA 4GPNA 4IICA 3NG3A 4UBPC 2YZ5A 4X63A 3TAOA 4AB4A 1HXJA 2ZUUA 3SN1A 1QW9A 2VDIA 1EHAA 4C5YA 4FK9A 1NWRA 4FP1A 3VOJA 4D6DA 4KPLA 1LG1A 2QJMA 4M6QA 3PUDA 3WL0A 3B06A 4X0NA 2Q01A 3O6DA 2XIIA 4HZ7A 4XAZA 2CLHA 4G7EA 3LCIA 2GWNA 3L0GA 3FV9A 5A69A 3W1AA 1LG2A 1D8CA 3QC0A 4GYKA 2W9MA 5DMNA 4XSLA 2X1IA 1IGWA 3B8VA 2H90A 3EGJA 4O0QA 2WZIA 2HVOA 1BXBA 3KAOA 1PZ0A 4HA0A 4WLCA 5EYWA 1Q7MA 3DH7A 1I8JA 3V3WA 2OX4A 3A24A 5FJTA 1CW2A 1YW1A 2JKAA 1R9YA 3N17A 3MT1A 2QNEA 4FXJA 1AODA 1KFBA 3IJQA 1K6WA 3NIYA 3E49A 3WQCA 3DU0A 4PRWA 4J2MA 1C8QA 3KHJA 2B0MA 2QW5A 4AZ6A 4AD3A 2FIQA 3TNOA 1GONA 1GKQA 4KCUA 5D30A 3S47A 4GGHA 4UFHA 1ICSA 1PYMA 4R33A 3T05A 2E40A 1ICQA 2OWXA 3AI0A 2PWHA 2D73A 4FHAA 1MZHA 1LF1A 1P0KA 2RJHA 4YYCA 2CLKA 4YTUA 4GHRA 3GTIA 4O19A 4KWVA 4PGLA 4C5ZA 2OTDA 3N3MA 1XPYA 5T26A 1J5SA 3RRAA 4JIIX 3W07A 4IM4A 1HKMA 4K68A 1T0OA 4LUTB 1QTWA 1XC4A 3TQ0A 4DBDA 5E9AA 3AISA 2VENA 4JCMA 1NIUA 4V1XA 4C6EA 2XWEA 2BSLA 4ZOCA 4XAGA 1UH2A 2HPIA 2FZ8A 4IX2A 3OG3A 1B3YA 2WC7A 2OEJA 2IXVA 4PBFA 5B7YA 1MNSA 3S5OA 1W1YA 1W2VA 3WQ5A 4QQUA 1FXQA 1E6PA 3IVUA 2PZNA 4HU8A 2W79A 1A47A 4AWEA 4P7QA 2R91A 1F4AA 2G3FA 2Z24A 3BV7A 2DUAA 7PTDA 1QFEA 1Q63A 1C90A 4UTHA 2OODA 4GUFA 3O06A 1MI3A 4DWDA 2XG9A 3TOPA 3QMSA 4J3VA 1KA9F 3N2CA 4ZO7A 1D8WA 4DYJA 4UTMA 3D5HA 1HX0A 3V5CA 1KM1A 1A49A 3A64A 1UASA 4IPJA 1XH0A 4NAFA 3W85A 1OFEA 3GNDA 4DX3A 3QRHA 1M1BA 4H04A 3L4VA 4QHRA 1JPDX 2BFGA 2CLOA 4YTQA 1DJGA 1PCWA 2P0OA 3D6NA 4O53A 3K1DA 1V3HA 1GZJA 1HJWA 3B40A 1GOOA 1D3HA 5ECVA 3H55A 4Q6JA 1AW2A 1A5SA 1QK0A 4TMCA 3DDMA 1XR2A 1WDDA 1RALA 1PB0A 2INFA 2BGSA 4NXSA 4RZ6A 5LXXA 1BHGA 1V93A 3G2GA 3PJWA 4H00A 4FLOA 4MDOA 5FSEC 3RO8A 3UWEA 1H7WA 1OT1A 3PNZA 3P62A 1WDRA 2WKGA 3H4WA 3BO9A 1VFUA 4OWGA 2GQAA 2FZ9A 1EUNA 3KFTA 2OZ3A 5SWUA 4X3ZA 3LPOA 3KOZA 4AY8A 1KTCA 1EO7A 3MCOA 4H2CA 1XYLA 3N34A 4L61A 5C9WA 4CQCA 2A5HA 2OZ0A 4HYRA 1O5RA 2X16A 1R86A 2PUZA 2FFIA 2E9BA 1S2CA 2YFOA 3V1PA 2DSWA 5JBFA 1U5HA 1VPQA 1UP3A 4LB4A 4C6KA 3EOSA 5FJUA 4RDWA 5IBXA 5L9FA 3PWIA 4UFJA 1F8MA 1Q6OA 5BZAA 5BU9A 2NX1A 2G4JA 3RNDA 3ES8A 4I7UA 4GVGA 3A3XA 5LIKX 1C91A 3AZRA 3VC5A 1LTDA 1A0DA 4HJWA 1EEPA 1FHLA 4J7RA 1F4HA 3FGCB 4Q4SA 3OB8A 4X9YA 1VCFA 3HMCA 2G97A 4R7WA 1JR1A 1EXPA 4ICMA 2ZZ2A 1UKTA 2E8YA 4LS2A 3MCNA 3KM8A 2CYGA 5HXMA 3SCNA 3GH5A 3UJRA 4QRNA 1GVOA 2DH2A 3PM6A 1IR2A 4E2OA 2YKKA 1TA3A 1I45A 3TAKA 1KBJA 1TX0A 1AMYA 4Y90A 3GU9A 3PWGA 4RKAA 4CQBA 1W9BM 1RBAA 1OFDA 3OGSA 4FX7A 2P50A 3ITYA 5BXSA 3NQ7A 4N6FA 4ZOBA 4OIFA 4B5TA 2XFWA 3N9SA 4OUIA 1FFQA 2DU2A 4AG0A 4RDVA 3GO2A 3OA5A 2WBGA 3WUFA 3LHUA 1GJWA 5A2BA 5HNTA 1SMDA 2QKFA 3S1WA 1ZENA 2XINA 3HF3A 1TZ9A 1ECQA 4MSSA 4L9YA 3W29A 7REQA 3DESA 2VURA 2QLYA 4D8ZA 5K9DA 1A5LC 4I9AA 5FF3A 4HT3A 3B8DA 3AMKA 3WQDA 3VKBA 3C61A 3WY1A 2XVNA 3OVPA 3G22A 4GFSA 1A5BA 1W5OA 3GE7A 3SSZA 4A2RA 4D8AA 2I9EA 1XF0A 4JTKA 1QW7A 4DWSB 5CEWA 1RZMA 1FHDA 2WZHA 3GIPA 1XH2A 1QNRA 3H2MA 3WUBA 2D22A 4I90A 1POJA 3WJSA 4EPBC 2J74A 2ADAA 1Q6DA 1CT5A 4PB4A 1EJWC 2FVMA 3GS6A 1JZ2A 4ADTA 3IGSA 3OLIA 1VFHA 2BVYA 3U8GA 1GT8A 4IFKB 5A8GA 3DFTA 1EJSC 4IPNB 3UF9A 1I2NA 3O6YX 4GYPC 5AECA 3IK4A 3CIXA 4QE4A 4QE1A 4S3CA 1EHNA 2F7FA 5BW6A 3S2NA 3S5YA 4C7GA 1IXNA 4O1CA 4DWSD 5G1TA 1UPMB 1HIZA 5LGXA 2OLHA 1WZKA 3S4TA 3S1GA 4EANA 4OJYA 3QY7A 2CHNA 4B16A 2YA2A 4QG9A 4KQNA 4H6RA 5IOBA 3N2TA 4JQ4A 3W3OA 3PTDA 3LM7A 4NVTA 5HQEA 4B4FA 2VFFA 3MY9A 4WIWA 1KXHA 1FHUA 2OG9A 3HIJA 1XICA 4WSHA 4JKMA 4L9XA 3WF3A 2X09A 1ZB5A 3R0UA 3RM8A 1AQHA 1SW0A 3REQA 4ASTA 1QW8A 5I24A 3EX2A 4FNUA 5AC7A 1PX4A 3HOJA 1S5VA 1QOQA 4JNYA 1RUSA 5D9MA 2BTMA 3MKCA 1J93A 3KBNA 4HBKA 1MW0A 3O0FA 5HMEA 1JNEA 1ZLPA 3WL1A 4S3EA 4D1JA 3D3AA 4QJ3B 1D3GA 2ZUSA 1R3TA 3NAVA 3E2RA 2P76A 1TTIA 4LVDA 2G5WA 2VJXA 3DFHA 1W1PA 3M5XA 3CHFA 3KOFA 1J11A 1KBBA 3THCA 1AL8A 1XGZA 3U5YA 1JAEA 4N02A 3MSGA 2BGNE 2G3JA 1ITXA 3UZJA 3VO0A 1JPIA 1A3XA 4MUPA 2CXEA 1XL9A 3IIPA 1XDMA 4NZJA 3T2PA 2A0NA 1LOSA 4GZJA 1JZ8A 5DBTA 1AD1A 1U5JA 4CCCA 3TSMA 2GSJA 3L66A 1HW6A 1I2QA 3BMXA 4KEUA 4Z0SA 2YBUA 2HEJA 5J5DA 2Y6ZA 4RE2A 1KNWA 5AC8A 2W6RA 3CUFA 5M5DA 1XI3A 2NVCA 3UZZA 3GDRA 2WWCA 3R25A 4G9PA 2GZXA 5HINA 3GTFA 1W8SA 4XO6A 3ARUA 3SUTA 1LQAA 3EXTA 5FJOA 1KM5A 2XZ7A 1JDDA 2AL2B 3MVTA 1ME8A 4RPQA 4XSMA 1O60A 1S2AA 2NW0A 4WD0A 2WNNA 4NNBA 3DCPA 5A6JA 1S5WA 4U2YA 4Y96A 1Z44A 4XAFA 3KTSA 3L5MA 1R3QA 2VXNA 2R1NA 1GVFA 4ZQOA 4Z0JA 3MW7A 4Q8VA 3GNOA 1ZP4A 3UG3A 3KOWA 5A2AA 4GQ0A 4J27A 4Q8UA 3M16A 1A53A 1VGAA 2Q71A 2E25A 4HMCA 3WFLA 3N3TA 3GW0A 4AZCA 4JNMA 3OZPA 3WBEA 3A12A 2DJXA 4OHQA 5CSYA 1Y65A 4AH7A 1TQJA 3VIKA 4O8AA 3L65A 4ZEPA 2CC0A 2REQB 4GC4A 3CNYA 5K4ZA 1EJXC 5CPQA 2OT0A 5EPDA 1JRBA 1Q7QA 1UJQA 4JTIA 2HNHA 5CLWA 2WB5A 2Z26A 3DG6A 1W9PA 4UTJA 4C60A 1G4PA 1I0DA 2FGLA 1WZAA 3TJIA 3QGVA 3TE9A 1Q6GA 3YPIA 2Y7FA 1X39A 3WMSA 1XLHA 3A9BA 1ADDA 3WLRA 5HPOA 3OZOA 4XD5A 3CM4A 3WJXA 4O4VA 1OIFA 2GDUA 4J9JA 1EH9A 2C19A 1OFRA 3EX1A 4KEZA 1A4MA 1BD0A 1KXTA 2WJZA 2E5CA 5A3HA 6CGTA 1WQ5A 3OLDA 2HMCA 3E2SA 3UWZA 1EIXA 1MO0A 1GPWA 1V0NA 1JD9A 3HPSA 3SRKA 1ZALA 3WKZA 1X7IA 4JTSA 4PTXA 1QWGA 3C2EA 3BJTA 1VBRA 5KZDA 4FNTA 3UETA 2C15A 4O28A 3BVJA 4HZMA 4K8EA 5G4WA 4HPNA 3ITGA 4GQRA 4PCFA 4Y9MA 3B9DA 1R5YA 3SRFA 3QGKC 3NA8A 2GLKA 3AWNA 2OB3A 4DAIA 5TNVA 2QUMA 3W7RA 2BX7A 1IT7A 3WLQA 4ZO9A 3ANVA 1JGIA 3WLTA 3OHIA 1UMLA 2ZE3A 3W7CA 4V27A 1E0TA 4NP7A 2V3DA 2YLLA 2JEQA 4GX9A 1QPOA 4ENLA 1KV5A 3IARA 4XISA 4GJJA 3VDBA 2IPFA 4F66A 2W92A 4QDPA 3T7VA 2G95A 4HA1A 4CD8A 3ZLFA 1REQA 4DN1A 3NQAA 2F61A 4YCPA 3QTGA 4KIRA 5HMDA 1OF8A 1KGWA 1TJRA 2W61A 1VLWA 4N4QA 1Z42A 3SGGA 4F48A 3TYUA 4K3ZA 3FW6A 2HXUA 4L4PA 3FJNA 4Z1YA 5FD0A 3IV8A 5DQPA 1NDVA 3GC4A 3I4KA 2W63A 3VTRA 3DI0A 3Q65A 3EA3A 1KRCC 4E2VA 1K7EA 3L0NA 3WELA 3MO4A 5GNYA 2I16A 1W1TA 3W7DA 1V3KA 4N4PA 3BAWA 4HMNA 4P7OA 3LERA 4NQ1A 5REQB 6XIAA 2CLPA 3MMTA 2YB1A 1M53A 5I3GA 2G50A 3MP5A 4XBKA 5FJIA 1L6SA 4MWAC 9XIMA 3E38A 1RD6A 3LGDA 5A6KA 3LCGA 1FUYA 2DIEA 4AFYA 4PMVA 4AD1A 3N73A 1OG0A 2WM0A 3EEGA 1NP2A 2OX1A 4DBSA 2BVTA 1LT8A 3WN6A 4Q8NA 2ZVIA 2OLAA 4WJEA 2XGBA 1QPQA 3W1RA 3N2XA 3UWVA 1TWSA 4NZCA 3OO2A 3MZNA 1K9FA 3QGAC 3TQVA 4GQBA 4Z42C 3E12A 3SQLA 4BFAA 4J3UA 4V28A 4ATWA 4DI8A 5BNKA 3NPVA 4RE4A 5D04C 1Q4NX 1UD3A 1NSJA 3ZLHA 3U9IA 1E40A 2WPBA 4L80A 4DNMA 1DWAM 3LHWA 3GAYA 3B03A 1HTIA 4XK2A 4RDYA 1VHCA 3RCNA 5I3KA 2VUYA 1FKXA 2XFRA 1JF5A 4AVFA 4QAIA 2Z25A 3AC0A 5HUOA 4ZB0A 3W00A 1FH8A 5HMFA 2Z1KA 3P5YA 1RCXB 4MM1A 2QCLA 3Q37A 4IOTA 4CVWA 2BGQA 2WHJA 3DN5A 2AMXA 1LOQA 3SIZA 3UPMA 4QG8A 1XC6A 3I6RA 4FS9A 1NFPA 3FEQA 2Z7GA 1GZGA 1ONRA 4DUWA 1VPYA 1YPIA 1K70A 2QV5A 5EMUA 3W75A 1Q5MA 4GYPA 1OCNA 3WH8A 7XIMA 3BQ5A 3TWBA 4Z2HA 1JUBA 2BZNA 4DZ5A 1K03A 3TW9A 1O94A 1IZKA 4MKNA 4JKKA 2CESA 2Y7DA 1OCQA 2C14A 2CLIA 5HATA 4HOXA 4H9TA 3EDFA 4XIMA 3ZIZA 3AXHA 2WNQA 4NL1A 4UFIA 2NT1A 4O57A 1J6PA 5JBDA 3DFQA 4CNSA 4M80A 4JL1A 1KLZA 1JIBA 1OYCA 4UNKA 1US3A 4BJHA 4IISA 2PP3A 4LJ3A 3L4UA 1E4LA 2IPWA 4QQ3A 4ZENA 1YPXA 3N12A 3L4ZA 3KVKA 2GQ9A 2YFNA 2GSEA 1DXFA 5CBJA 3AQUA 4I6KA 4AIOA 3WLKX 2AAMA 1X8CA 5I2UA 5DXYA 1V6UA 4DJDC 4B2DA 1MNZA 1HGYA 2X30A 4CU8A 3O9NA 1VKFA 2XSXA 2YYUA 2QUNA 1F9CA 3VK5A 3K4WA 4JHZA 3NM3A 4A3YA 1XIBA 2ZZ1A 3TJXA 4IPLA 1GVQA 4HTBA 3HFYA 2ISDA 2VCBA 2X0HA 3DERA 1O4UA 3NZPA 5G2WA 1QI4A 4X2PA 4B2DD 2BV9A 4CCZA 5HOSA 3W86A 2ON3A 3QZ6A 5RUBA 3BGGA 3L4WA 3TTOA 1R3YA 3EDEA 2H3BA 2NV9A 4HCLA 2IXUA 1GTEA 3NEVA 4AUBA 1XSIA 5AVHA 4JTCA 2XH0A 5A6AA 4LU0A 1M5WA 3FAXA 3FDKA 2E1WA 1EQCA 1QHZA 5HQMA 1AMKA 3OJGA 3ABRA 3DFNA 4GH1A 1Q13A 4GUIA 4OUEA 2CNCA 3BCJA 4RLIA 4F79A 3GTNA 5KITA 3TCSA 2WWDA 1RJQA 1GHRA 2O4QA 4XAYA 2E9MA 2RFGA 4MIMA 3WF0A 3KCOA 2XN1A 4RNIA 1XCWA 1H50A 1FVPA 3VCRA 4K6AA 3PJXA 4W5UA 4YLWA 3WH5A 2WHLA 3W7EA 3PHAA 3RPTA 1TPVA 3TNBA 3FN9A 1MMFA 3H23A 2Z1XA 4JHMA 4CQDA 2GVLA 4RW5A 2PU0A 2VR5A 1PEZA 4W88A 1H5YA 1W3JA 5IXEA 3SQMA 1OZQA 1HL9A 3R2GA 2FJKA 1QWKA 1D9EA 1RQBA 1YPFA 1TZZA 3ECQA 4ZSTA 1OFQA 1O1HA 4O50A 1IWAA 4LWWA 4L1GA 2BY3A 3IS4A 3R12A 1BXCA 1FDYA 3B8UA 4CQ9A 1VIZA 3FVDA 1E0VA 3VOGA 4IT1A 3U4FA 3DBNA 2IKIA 1GQJA 3UPBA 3W72A 2RAGA 3M44A 3VIGA 4ALDA 1BRLB 3VFLA 5CC6A 1VJIA 3EMQA 4GQGA 3EKZA 1YDOA 2EPMX 4A3HA 1W3HA 2Z29A 1KBKA 1TTJA 2B7OA 2CBIA 1TREA 4UFMA 1HO1A 1BXNA 5G1YA 2YW4A 3L5AA 3PP7A 1R85A 2X7WA 1JULA 4FPSA 4G5DA 1MUMA 1Y8BA 4E8DA 1M7PA 5CAKA 2UY3A 4OT7A 1H2JA 2FVLA 2YXGA 4M24A 4UFLA 2XGZA 4BQ5A 2VRJA 4M29A 4W8AA 1R2RA 2QCMA 2QR6A 1Q65A 1W5NA 5IFTA 1OYAA 4MZYA 3K4DA 3G1VA 5A6MA 4PTNA 2A4AA 3A5VA 2P10A 4PMOA 2FFCA 2Z0IA 2R94A 4WSKA 1DHPA 3LYEA 6PTDA 4WK9A 3IIXA 1TKKA 4H9YA 3S6DA 2NQJA 3VIPA 1BFNA 1W54A 2Y8UA 2NQ9A 3UJSA 4MY9A 3T0TA 1CLXA 4BF5A 3QR3A 2DW6A 4CNOA 1GQKA 5FEZA 2I57A 1M04A 4OZOA 3AS3A 3TVAA 4S3BA 1HO4A 2Y70A 5E70A 2J4GA 1J2WA 3H6OA 3GNRA 3FA5A 1RPXA 1TB3A 3LNPA 3FVMA 4GIAA 1Z48A 3EWWA 1OC7A 1S5MA 3G8RA 4IP5A 2ACQA 3WQ4A 3GUGA 1GW9A 3PUGA 4JTJA 1O66A 3CV6A 4B91A 1V3LA 2I5IA 4W8LA 3SDOA 3TV8A 3VUPA 3W7MA 4DZIA 3N13A 1H7NA 2WM1A 1PTDA 2A3LA 2DGAA 2E1DA 1TWIA 1YXCA 2Y1HA 1KB3A 2J8TA 3PTKA 4Q8TA 1UR1A 4S2BA 1PKLA 2HRWA 5D03A 1R6WA 1MUCA 4G2DA 3H4GA 1ZFJA 1OHLA 2WC3A 1UYQA 3ES7A 3GSMA 3H70A 3P84A 1ONXA 3JVAA 2GJRA 4A3UA 4L6HA 1TUXA 4JHOA 3P60A 3R43A 1UJPA 4QS6A 1GOKA 3QHOA 4PSPA 3WMBA 2V69A 3M64A 3GHSA 3MSYA 1T8XA 5ABEA 4NU7A 4I3GA 4O12A 4S1FA 1W17A 2CEQA 4XB3A 3NTYA 3MP4A 3F4DA 5DBUA 4RCXA 4LRSA 1E1CB 4ORIA 3QFWA 2OEKA 3QN3A 2IKJA 3MI3A 4XVDA 5D05A 3TROA 4RUBA 1RBLA 4LYKA 3V18A 3LXCA 2C13A 3TN3A 3PZ9A 3HFTA 3XISA 3E0WA 3CUHA 3EB4A 3VPLA 1XLFA 3GR7A 4UR9A 3S2LA 3RITA 2QJIA 4O14A 1QUMA 5CPTA 3ARPA 3ATYA 4UMBA 4AHOA 1JAKA 4AZ5A 4K39A 3U57A 1M65A 4JGDA 2FHFA 2QCCA 4ADUA 2PP1A 4MWAA 3WFZA 3C0QA 2ZKMX 1XGDA 5DCBA 1UR9A 2A3EA 4BK9A 2XM2A 3BJFA 4M8UA 2B7QA 3C2VA 3R8GA 1DJYA 3RDKA 1DIKA 3VVGA 1CIUA 4OOUA 1FXPA 1W0MA 4F0MA 5HDRA 1WXJA 3UT0A 4MVAA 4PBEA 3UXKA 4FNQA 3AOFA 3BGAA 3DI1A 3FK4A 1FWRA 2AKZA 1KM0A 1P1MA 1IWPA 4JY9A 2Y4SA 1Z9AA 1VFMA 4XO7A 4AD5A 4NJGA 2XVKA 3AYVA 5CC3A 2YL8A 1KQZA 2OVLA 3T6CA 1FBAA 3CAKA 3BUVA 2WVUA 4Q4PA 2VEKA 3GXTA 2QGYA 5CGTA 4NJKA 5FIPA 3C5QA 2WVTA 2VGIA 3DFYA 3LHYA 4JKLA 4YVXA 1PJ9A 2QIWA 1PKYA 2DZPA 1GW1A 1XLDA 1XCXA 3O7UA 4YS1A 3B97A 3GUWA 5KETA 3UWWA 1ITQA 1QDSA 2VVSA 2CLEA 5ABFA 5KTLA 2YCLB 1ITUA 1DJXA 4EAMA 4KF1A 3S6OA 3A6OA 3GH7A 3EWUA 3TSBA 3WBYA 3VIFA 4IIBA 4HHMA 3QMRA 4UR8A 4D72A 4JIHA 4LY8A 5HA7A 3GW3A 1TFVA 3CUIA 1VFFA 3E9AA 3GU1A 3PFMA 1PWLA 1E6NA 1KCLA 4WKAA 1UBPC 2ASHA 1EPVA 3HQOA 3CUZA 3WQGA 2QZRA 1UC4A 2E6AA 1QJWA 1UR3M 4LRTA 4MWAE 4XX6A 3O1NA 2VFIA 5BCAA 3ABXA 8RUCA 5C71A 3M47A 4OBSA 2F84A 1LL7A 2QT3A 3RU6A 3HV9A 1ZPTA 3AROA 3W9ZA 4B3ZA 2Q09A 4TO8A 3MMUA 4ZOAA 3TP4A 3ABSA 3Q94A 1E4NA 4HIBA 1MZRA 4PB5A 4EP8C 3W01A 2RH9A 3MHUA 3CHCA 1UQYA 3L21A 1AZ1A 3XIMA 4KIEA 1LWJA 3QJAA 3POHA 2I7GA 3RU8X 1UW9A 1BVNP 2PDFA 1TELA 2QVHA 4INFA 4PTDA 3EXRA 3GVQA 4O18A 3TDFA 5C9XA 4L56A 4DJDA 3F03K 1LRQA 3P8JA 3VABA 4QJ4B 5GJPA 3L4YA 1UKQA 5EA9A 4N2YA 1FP9A 1K8ZA 1CX9A 4O1AA 2PODA 1UD2A 2ZRXA 3MBDA 3VGGA 1E70M 2QDEA 1XFBA 5D8ZA 1T6MA 2E5DA 5LIXX 2AQWA 3QBUA 3TTEA 1H4PA 4DJDD 1O5KA 3IIOA 1HJUA 1JL8A 3AIQA 1OINA 1Q6EA 4NJJA 1EWDA 4R85A 1XP3A 3M7WA 5C5YA 1YRRA 2W67A 2XIQA 3MUCA 4A8IA 3TYCA 4BI5A 4YVPA 3UVAA 3NFUA 2DZAA 5GJNA 1UPPA 3UYIA 1LLOA 1TWDA 5BRQA 3MWAA 3WLIA 2GQ3A 3RO6A 1ML1A 4TMBA 1CXFA 4EWJA 4E6MA 1DQXA 4AMAA 3N04A 2TMDA 2RJGA 4B90A 2XH7A 2D2JA 1XYAA 4PZVA 4AD2A 1K4HA 3LLXA 3WLJA 3BXWA 3T42A 2IKGA 3DBPA 2Q6ZA 3KS5A 3LPPA 3W2UA 3KEHA 4HP5A 5JH1A 3WK2A 3MCMA 4JFSA 3DAQA 1QBBA 1FCVA 1I1XA 4A29A 3ZR4A 2R9RA 3H26A 3BMVA 2J25A 3WQFA 1ZBCA 3AICA 1BSIA 1NOUA 1TRDA 1OFBA 3OODA 1UWTA 2PFHA 4LC8A 3WLNA 3LX9A 5CAHA 4ZB5A 3SRDA 3PTMA 3CAWA 1U1HA 4GE8A 4MNKA 3V16A 3S8HA 1LUCB 1ISWA 1H60A 2OKOA 3FY1A 1A5KC 3F4VA 3KUMA 2R1LA 1GYNA 2VQUA 3VKCA 1EPXA 1V3JA 4GFIA 4DPQA 2I17A 4FNPA 4IGNA 3BSGA 1G94A 3N29A 3BDKA 5A5WA 1Q6LA 4YNGA 2BXVA 1ZHAA 5DY2A 4M1BA 1ZJBA 1J0IA 3MPGA 4XZMX 3ITOA 3K8KA 3O3RA 4QROA 4QISA 1TR1A 1NVMA 3GVWA 1YDNA 4YU1A 4IMAA 3HPXA 5HBFA 3KRUA 1RA5A 3LM3A 3E6EA 2ISSA 3HQ1A 1W1IE 3ID7A 4WJXA 1NWSA 3CPRA 3OTRA 2VDGA 1M01A 3OW1A 3L5LA 2BG5A 4LAMA 3SCTA 1F8IA 4AWUA 1TJPA 1ZNNA 2QCDA 3UG8A 1R3VA 2F2KA 3W53A 5DT7A 2C71A 3UJ2A 1T7LA 3SCPA 5LSMA 4JCLA 1WKEA 1J18A 2DFAA 5LYRA 2X1SA 4PL2A 3QTPA 4GVIA 4K36A 5JH2A 3ANUA 2DP3A 4GUGA 3GFXA 3TYDA 3LY0A 5CSUA 1A3WA 2DW7A 1PX8A 1BF2A 1RR2A 3DIPA 3AHXA 3J7HA 3I10A 1BKSA 1PIIA 3NSNA 1S2UA 3T44A 4RPPA 1B4KA 2BXZA 2OR2A 4HNUA 3SW6A 3G1FA 1XG4A 2EAWA 4Z1DA 1TQXA 3H2CA 3S46A 4DUOA 4MGGA 2WANA 1E5NA 1MXSA 1RK5A 4HOZA 4NZ5A 4YHEA 5A6BA 5I3IA 4CLMA 3FYYA 3WLLA 2IQ0A 1VAHA 4KCTA 3LA4A 2VQTA 3BLIA 4O11A 4PRRA 4P8VA 5EL1A 4Q4KA 1SFSA 4D71A 3HU7A 1JDFA 2CZDA 4N7QA 3ABZA 1PV8A 1H0GA 4NY2A 1W8GA 5E0FA 4GUHA 4S39A 2ZBTA 4IG2B 3NOYA 4GI9A 1P6WA 5A6BD 2ZQ0A 2QCNA 4IQEA 3STEA 3OG2A 2H6RA 4DF2A 1K1DA 1RY0A 3AXMA 1B3XA 1UC5A 2HCVA 1AK5A 3IGXA 3OGVA 3NO1A 4IQLA 2PWEA 1H3GA 1KRMA 3F5LA 4DEFA 1LM1A 1L8PA 3PSVA 4FA3A 2HVMA 3MUY1 3W1PA 1UROA 2CBUA 5TAOA 4B5VA 3TEVA 1KTNA 5K3VA 4ZQMA 1H0IA 3LCHA 2Q8XA 4JYDA 2WKJA 4D2JA 2IKHA 4PMQA 3SUSA 3L4TA 3UFYA 2OQHA 2KAUC 4H7CA 1EWEA 3FJ6A 3A47A 3RFAA 3EXSA 2Y63A 5I03A 3KDNA 4YJ5A 4IMEA 7TIMA 2TYSA 1CB2A 5CSSA 5AOUA 3MYPA 4J3TA 3AIBA 4FNSA 3QFEA 2O0TA 4O13A 3VNJA 1KRBC 3QQ0A 3SJ3A 3WQOA 2J88A 4H4IA 3BOFA 5LIWX 2IUZA 4MB4A 1X6UA 2FH8A 3VD4A 3WLOA 3TC6A 1XRFA 4GIEA 1XLAA 2QJNA 6TAAA 2EPKX 1WKFA 5G1MA 2AAAA 4NI3A 1BTMA 3A4WA 3GNNA 3I7QA 4UQEA 5ABGA 3W1QA 5K9XA 1ESWA 1NTHA 3G6LA 1JJKA 2OZ8A 4UQDA 2PTWA 4DUXA 1M03A 3TYAA 1HG3A 4WX2A 1FKWA 2Q8LA 1LBFA 1UOKA 4QP0A 1UR2A 3TONA 5LZLA 1LP6A 3AAMA 1TPB1 2PDWA 1TIMA 3LCLA 2P53A 2YXXA 4DBUA 1FP8A 4ZFCA 2F38A 1JD7A 3FHAA 1QU4A 4HSNA 3NQ2A 3POCA 5CPOA 3CK5A 4D6HA 4WR3A 5FJRA 2A3BA 3I65A 3N6JA 5BOEA 2Y7GA 5FEPA 3N6QA 5DANA 1YTKA 3CJPA 4L4MA 1LORA 5I00A 3FOKA 3P0WA 3QHNA 4KBXA 2XFYA 3LTPA 1FWFC 1NAL1 3HGOA 3IK2A 1S46A 1KM4A 1FWHC 2XISA 5EMYA 1EBHA 4Y9OA 3BW3A 1OADA 3L67A 3P61A 4GXWA 2ANUA 1GTHA 4D6CA 2XIBA 3LZ5A 4AWSA 1W5QA 2P3EA 3WNKA 1CXHA 5D9PA 3G3DA 3GM8A 4B92A 1CGYA 4LUSA 3C3UA 4Q4RA 3CAVA 1P0EA 2R14A 3RK8A 3FS2A 3S9ZA 1O12A 4HNNA 4B4HA 3TOYA 1RVGA 5EFFA 2ISVA 3FA4A 4OE7A 3TXZA 3CMGA 3EWXA 1FDJA 1ZRQA 2NVAA 2NSXA 1VJSA 2DZSA 4HCHA 4LFYA 1O5QA 3GKAA 3B0PA 3N25A 1GYMA 1VZWA 5CH9A 3K1GA 1BWLA 2QAPA 4Q8WA 4YIWA 3SZ8A 1TV2A 3DHFA 4DJEC 2KZHA 3JW7A 2DQXA 1H09A 3QR1A 1R46A 4PYSA 4AZGA 3LDVA 4WGXA 4AF0B 4FOJA 1EP2A 4NSBA 3W1XA 1GOIA 4JEQA 1XXXA 2C7FA 2VVNA 3WEOA 4ERAA 4QJ5B 3NGFA 3MJMA 3W2JA 2HSAA 2J6VA 1FH7A 3VD7A 1QI0A 4PCPA 1JPMA 2WMKA 1GKRA 4X22A 4H6QA 3VKDA 1UIOA 3BANA 2FB2A 4DM2A 4AISA 3AS0A 1SGJA 3LBMA 3AIRA 1E71M 1G5AA 1X6LA 4REQB 3ATZA 3KLKA 2HV5A 2GOUA 3GG0A 1B9BA 3G1XA 3WMCA 5AC5A 2PD5A 2A21A 4JDBA 4X2RA 5LNWA 4WDUA 2ISFA 1HJXA 1TMLA 1BGAA 3QSRA 2XVLA 5IM51 3BOLA 2WZMA 3M0YA 1WDPA 1V08A 3CIVA 3B9AA 1CZ1A 1W3LA 4PMXA 3MWCA 3UWUA 1G7UA 2RGLA 1B90A 2DH3A 2X2YA 4KWOA 4O15A 2BS9A 3H8AA 3QM3A 1FCUA 3ZJKA 4Z2IA 3AIEA 4PUDA 1VEMA 4J40A 4UNIA 1A5NC 1YQ2A 5G5IA 1OX6A 2DSUA 2FZBA 4QSFA 4P8XA 2E3ZA 3AWOA 3C86A 4CKQA 1GPFA 2VT0A 4Z2LA 4PE8A 2B4GA 3KL5A 4LF2A 2D24A 3E5BA 1WKDA 4UQCA 3ARQA 2NUXA 2WMHA 1JI2A 1SZGA 4PR4A 2R8WA 4PH6A 3UZXA 4JFVA 2D0FA 2H9AA 3M43A 2DZTA 1XQKA 3PBUA 1F61A 3UGVA 4O16A 3WJWA 5BROA 2NX3A 3TCEA 2YDAA 2O4MA 3EDDA 1DJIA 2ZC8A 5D4YA 1GNXA 3UY8A 3HURA 4MAZA 5CZSA 3PANA 1P7TA 1JCLA 3STPA 1TV3A 2YPIA 1WXYA 4JTHA 4H6EA 4LB3A 1FTXA 4KGJA 1OX4A 2Y62A 4LANA 5C55A 1WZLA 3FLUA 4ROPA 4ZO6A 3C3NA 1ZZMA 1ITCA 2VCAA 2CKSA 1NARA 4JL2A 5H1WA 4C1NA 4AQLA 3TMQA 3GVGA 4NAEA 1W32A 6REQB 2PB1A 1BVZA 1Q6FA 3QY6A 3ZLGA 4JQ2A 4H8VA 5C9RA 2J77A 1T5AA 4JN8A 1OC6A 3W23A 5EBUA