3NQDA

Crystal structure of the mutant i96t of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
219
structure length
219
Chain Sequence
VMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAITVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the orotidine 5'-monophosphate decarboxylase-catalyzed reaction: importance of residues in the orotate binding site.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nqdA00
4YMZA 2QCLA 1JUBA 3EX4A 3IIXA 1JRCA 4CNPA 3RU6A 3MHGA 1DHPA 1F5ZA 3M47A 4D2JA 3PG9A 3T4CA 1YADA 4MJMA 1OK4A 1O60A 3V75A 3UXDA 5MHBA 1LDCA 4XQ6A 3DENA 4FX6M 3KX6A 2DJXA 3GR8A 3CWOX 3P74A 4YCPA 5K4XA 2TMDA 4AMAA 2GQAA 3DKLA 3N2MA 4CQ8A 5CG7A 3W7PA 3EX3A 3LCIA 1U83A 2GQ8A 2J6XA 1UCWA 4ZQCA 4IWWA 4UTUA 3QW3A 4BI5A 4O4VA 5HUPA 2DP3A 4N4PA 3VFLA 3BGGA 1JCMP 3A9IA 4IMDA 4MJZA 3RLUA 4N02A 3TQKA 4QNEA 4M7TA 1EWEA 1E51A 3LX9A 3R5EA 1TRIA 4O14A 4WD0A 2FTPA 2BLEA 5KZDA 1IXQA 1H5YA 5EPDA 3MHUA 4FXRA 1B4KA 3LRLA 3QMRA 3L5AA 4IGHA 5HR7A 1GTEA 1VLIA 3C3NA 2V82A 1OFQA 3LCLA 1PS9A 1TV8A 3UZJA 2Z6JA 3DHFA 1H7PA 1J5TA 1DJQA 5D2WA 3S1WA 5DXYA 4AF0B 3O8AA 1M7PA 3C2RA 3CM4A 2C0AA 2O7SA 3W76A 3G24A 3LXBA 3W7OA 4E2DA 4LRTA 2TSYA 4UMCA 1O5XA 3GDTA 1H7XA 2JGYA 2R91A 1VR6A 3HF3A 3U8GA 4B5NA 3FEMA 3CQ0A 5FF4A 3FOKA 3DAQA 1JCYA 1QAPA 4ORIA 3L67A 1FXQA 5CZ0A 4M6PA 1G4SA 2C18A 4NQ1A 2O7QA 3G3MA 1SFLA 3WJZA 2A4AA 2I14A 3M1ZA 4XBKA 5KINA 3EWUA 3UY8A 1KFBA 2E6DA 1RPXA 4Q4KA 1HFBA 3OIXA 4JDBA 3G1FA 1QR7A 5C2XA 1G4EA 2ZRVA 1A5BA 1IXPA 1T96A 1THFD 3L21A 2VELA 3DFPA 4C1KA 2HTMA 3FS2A 2GJLA 1ME7A 1SO3A 3BW2A 3L66A 5KITA 1AW2A 3R8RA 4O4WA 3ABSA 3O1NA 4UTWC 4LT9A 3W2JA 3OEXA 3PM6A 4DF1A 1O95A 4UR7A 1FDJA 4WY0B 3DKJA 3NNTA 1O94A 3T78A 3E96A 3W2NA 3WJSA 1KBJA 5CSRA 4UUIA 3OA3A 3TAOA 1YPFA 4Q33A 4IMEA 1X8FA 2P10A 1NSJA 3IIVA 5I3IA 1RQBA 3PSWA 4O17A 4NZJA 1W54A 3UNDA 1TTIA 3ABRA 4K39A 1LORA 4WJEA 4UTIA 2P0OA 3S42A 3NQGA 3W84A 1DKWA 4AF0A 3BO9A 2BXVA 4FNSA 2OCZA 1Z41A 3Q2DA 3P5YA 3KXQA 1N8FA 1LRQA 3RMJA 4RV8A 4UCGA 4PODA 1GG0A 1GYLA 3GKFA 4O19A 4TU1A 4KWWA 4JYDA 2G96A 3RNDA 5EL1A 1G4TA 2FIQA 1EP2A 3P84A 4NXSA 4O8RA 2XN1A 3QSRA 2QUUA 1I2QA 3N3MA 1GTHA 1KLYA 2HS6A 2H3BA 1K02A 3W1NA 3PSVA 5HWMA 4YWIA 4OWGA 1EX5A 5F1VA 4UNKA 4AAJA 3NEVA 3TC7A 2Z6IA 3DFNA 3R89A 2J88A 3W70A 4O10A 5HULA 3G8EA 3UWUA 3LBCA 1TPH1 2VFHA 1IXNA 3MO7A 3TMLA 1TJRA 1XBZA 5CZJA 5DCEA 1GEQA 3BLIA 1LP6A 2X30A 1OYBA 4LTSA 3LXCA 4MVAA 4JX6A 2V30A 3PUDA 4M7SA 1JR1A 4RX0A 1LZOA 2QCMA 4O0ZA 1K7XA 3WK0A 5DBTA 1EIXA 4N6FA 1PCWA 3SW6A 2D73A 2J9YA 3G3DA 1VC4A 1HO4A 1UBSA 4JD4A 1PV8A 3UZ5A 1OF8A 5E1QA 1FXPA 3W7QA 5LSMA 3PUOA 1KM2A 5GVJA 2JKAA 3FKRA 1OYAA 3TE9A 3GVGA 4MZYA 2EKCA 1H7WA 5G5IA 4O1CA 1JCNA 3NDOA 4HKPA 3NGJA 5FI8A 1NAL1 1DJNA 4WZHA 3W7MA 4ML9A 2ZA3A 2XN2A 2B7OA 5F1UA 1WX0A 3OVQA 2NWRA 4GJ1A 1SSGA 3I65A 1H60A 3QW4B 3LGEA 3O6DA 4A2RA 1AK5A 1HL2A 2HMCA 3NAVA 4IMCA 2Y6ZA 2ZQ0A 4CQ9A 4HNVA 3W7KA 5FF0A 2GJNA 4UTJA 3TJLA 1WXJA 4JX4A 4E0CA 4RXGA 2YYUA 3W88A 4IUOA 1LLZA 5I3JA 4A21A 3E02A 3K30A 2QDHA 3P82A 5I3GA 3HPXA 3W1RA 2V8ZA 5D32A 4MYAA 4AB4A 3SIZA 2NXIA 3OG3A 4JNMA 2YFOA 4GBUA 1OFEA 2UV8G 3TJXA 3I7QA 4FNPA 1IF2A 4K6AA 1F05A 2QUVA 5LNUA 3G0SA 3GR7A 4NT0A 5AN7A 1WOAA 3HG2A 3SECA 5KTLA 3P61A 2I1OA 3QMTA 3KRUA 3SGUA 3HG3A 3NQ8A 4FF7A 4DQWA 1F76A 3W75A 3IV3A 1TPEA 3FYOA 3F4WA 5G2IA 4CCEA 1W5PA 3TQ0A 1KW1A 2Y88A 1UASA 2FFCA 3TK7A 2ZZ3A 3C2VA 1FWSA 2VKZG 1QWGA 4CQAA 2RDTA 4FNTA 2QCDA 1I2OA 2Y7FA 3DGRA 3NQ6A 1GVSA 1C8VA 2CLLA 3DU0A 4NJGA 3KVLA 1EUNA 3W1PA 1H63A 2WV8A 4NJJA 1W1ZA 3S5NA 4AHOA 1TPC1 2B7NA 4JTIA 3CC1A 4R34A 1FDZA 2RDUA 3B03A 5FF7A 3AJXA 3GNNA 2CZFA 1PIIA 2DZSA 4LUJA 1SW3A 1YXCA 2A7PA 1AW1A 2RH9A 6TIMA 3T40A 4QSHA 1FWWA 4XZ9A 3KHJA 3C2FA 1N7KA 4HPJA 5D05A 4Y8FA 1R2SA 1WA3A 2IQTA 3T7VA 3S9YA 1ZAHA 5F4XA 3EXRA 5LZLA 3QSTA 1Q6RA 1FBAA 4NJHA 3W73A 3HG4A 3ZR4A 1OFAA 3TC6A 3MP3A 3SFKA 1O4UA 1JJKA 3EWYA 5DXXA 3TMQA 3QYQA 4N9DA 5HUOA 1XBXA 2Z2UA 4E2BA 1WBHA 4JEQA 2YW3A 2Y70A 1DL3A 3M5YA 4FB7A 4QITA 4GXMA 4C1LA 1XI3A 4UMBA 3GNDA 5TIMA 2NV1A 2I9EA 4MOZA 3NZ1A 4M5PA 3VE9A 3DXIA 5K4ZA 3LTYA 1Z44A 3L5LA 3L9CA 1GT8A 2VC6A 1OYCA 2CLMA 1OHLA 4M6QA 2BZNA 3O15A 2C1HA 1SW7A 4CCCA 1RQHA 3CWNA 4AVFA 5LHFA 3W2UA 3M5VA 3HO8A 5A8GA 3PB0A 3W1LA 1DORA 3IRDA 1JRBA 1JUEA 3NQCA 3CPRA 4NUWA 3V1PA 3T55A 4FNUA 4RJEA 5D04C 4WOQA 5AOUA 3SZ8A 2QUTA 1SO5A 1TB3A 1BEUA 1AL8A 3QFEA 4HNUA 4MY8A 2E6YA 3PR2A 4I7UA 3N19B 3JS3A 2ZBTA 5AHIA 1L6YA 4Q32A 5EY5A 4QIUA 2FB2A 5D09A 2HS8A 1YTEA 2A7RA 4BR1A 4DPQA 3HPSA 3W85A 3S6DA 3HBLA 4UXDA 5KSWA 1FWNA 2PE4A 4XKYA 2A1YA 4ZVJA 3TCEA 1GQNA 2QCHA 1XBVA 4LVFA 4O1AA 4X9SA 5CGQA 1FQ0A 1OFRA 4H6KA 1KM3A 1W0MA 2EPHA 1P5BA 1KA9F 3QMSA 4YCOA 3MI6A 1JUKA 3W2MA 4O0KA 2DU2A 4NNAA 1AMKA 1FCUA 3IGSA 2V2DA 3NPXA 1SO4A 3DI0A 4EWND 1AL7A 3P60A 1G69A 5FEPA 2ZZ5A 2GQ9A 2HSAA 1H1YA 1VYPX 3GLCA 4WY0A 1X6UA 2RHGA 3TAKA 3A23A 3TDFA 3E49A 3L2IA 3MI3A 5AHLA 5G2HA 1KTCA 3P5ZA 4ADTA 3JR2A 4HSNA 5J5DA 1KBIA 1WBJA 2YSWA 1HG3A 1JQVA 3LRMA 5FF2A 3MWAA 4UTTC 2E5BA 1TSIA 3GK0A 1A5AA 3N73A 3QRHA 4UFLA 5TBOA 5KZEA 1SZGA 4AWUA 4P61A 4UFIA 1LTDA 1TMHA 2QEZA 3UWYA 3BVJA 3CHVA 3NO5A 2F84A 3GB6A 3M9YA 1ZFJA 1H61A 1G6CA 3ZFHA 2GUUA 2WNNA 2Y89A 1H51A 1VCFA 3PVFA 5C54A 3SI9A 2J24A 4GUFA 2QF7A 4LWWA 3SGZA 1P4CA 2CZ5A 4G1KA 4IQLA 3FLUA 4LS2A 3L5MA 2ZZ1A 1C9DA 3THAA 3W07A 3WK3A 3UD6A 5CPMA 2B0MA 5HWJA 3TXVA 1FY6A 2QCCA 4QQ3A 1HO1A 2P1FA 3IVUA 3DZ1A 3IGXA 3SR7A 3P8IA 4NNCA 2BTMA 3NQ2A 3CTLA 1BWLA 1JVNA 3T44A 5DBUA 3RFAA 1KFCA 1GYNA 5AYZA 4UTHA 3Q94A 1QMLA 1FDYA 2ZRWA 2JK2A 2E5CA 1GPWA 1H50A 4W9TA 5AHFA 4DEFA 4A29A 1G7UA 5FEXA 1MEHA 2QDGA 3M41A 2C14A 3KVMA 5A5WA 2A6NA 4JY8A 5K9CA 2E09A 4X2RA 1ZNNA 3W7DA 3LTPA 2VFFA 3IEBA 4GUIA 3NPVA 2QR6A 4S2BA 1QNVA 1FUYA 1QPOA 3LOTA 3W7LA 5E93A 5L9FA 2YX0A 3ATYA 3CIXA 3OVPA 1R30A 4NU7A 4POCA 3WK1A 5DY2A 1XBYA 4BK9A 3THQA 2NX3A 3QM3A 4JYFA 4MLJA 3LV5A 4O57A 1VPXA 4UR8A 1EPXA 3BW4A 1RZMA 5F4WA 5K9DA 3M5XA 3U6WA 4MY1A 7TIMA 1EEPA 3PS7A 2YZRA 3FFSA 1Y0EA 4S1FA 3DFSA 2CLHA 3DFOA 3N2XA 3CIWA 4MLRA 3W7IA 4JGDA 4FIQA 3CEPA 3W22A 4GE8A 1KM6A 5G1YA 2DZPA 4FIRA 1WQ5A 4MZ1A 3PBYA 5DCBA 3B0UX 3GIYA 4HIBA 1QPRA 1P1XA 4ADUA 5F2MA 4PFMA 3DBPA 1KLZA 6ALDA 5IM51 1ME8A 4KFNA 3TU9A 1YLVA 3NPWA 5EA9A 1FCVA 3LCGA 3STGA 1TRDA 2C15A 1XFBA 3H54A 3LHVA 1F7BA 3O63A 2FJKA 3LERA 3G1DA 4WQ6A 1YYAA 3LI0A 4O1BA 5D38A 2ISSA 2A5HA 1XXXA 1PHWA 5BRBA 4A22A 4FX7A 5H91A 1C29A 1VCVA 3FIGA 2NUWA 2C13A 3NA8A 4NVTA 1OX4A 3HGJA 3NQDA 1QOQA 2A21A 4WXZA 1CX9A 4O50A 3W2KA 3C52A 1VZWA 3C4UA 4XTDA 4S2CA 2WSYA 1TTQA 3W2LA 4FNRA 4NXKA 3O07A 3M43A 3WFAA 1VHNA 2F7FA 1ICQA 4DO6A 3NXFA 3R2GA 1FWTA 2DORA 1LCOA 2G95A 3MI2A 5I3HA 1BTMA 2VEPA 1KTBA 3VI2A 4K37A 1UJPA 4LRSA 1SUXA 3W1TA 4O11A 2B4GA 1WYIA 3I68A 1XKYA 2VFGA 2WPBA 5LGXA 1RD5A 4JXCA 4TX9A 1SO6A 3KFTA 1N55A 3HJZA 5T26A 4UIOA 1D9EA 3O05A 3NM1A 1TYGA 3EKLA 1O5KA 3UQNA 4Y90A 2ALDA 2H90A 5D2VA 1QCWA 4YLWA 2YR1A 3TA6A 3A22A 1B57A 1LM1A 1LRNA 1W3IA 2Y85A 1LROA 3CB8A 2QJHA 2C3ZA 4RCXA 4WX2A 1WOBA 1PCKA 4EIVA 3MBFA 3ZS4A 4AWTA 1D3HA 1G67A 1FCQA 4PL1A 4O13A 4Z1BA 2ZRUA 2G97A 1OX4B 1W5NA 4UFKA 3GZ3A 4IX0A 4LUIA 4Y9AA 2X1UA 5CSSA 1VS1A 1L6SA 2C6QA 3GDKA 1OJXA 3H55A 3GXPA 1EWDA 1VHCA 2PRMA 3HOJA 4AH7A 1Q45A 3MMTA 4PCFA 4ADSA 3SSJA 3UYCA 5G2WA 4N9BA 5F4SA 1LOQA 3C2OA 1SR9A 2VEKA 2FLIA 3GKAA 1S5WA 3I7RA 1VCGA 2YXGA 3G1YA 1UUMA 1XUUA 5BW6A 3M16A 1S3HA 4I7WA 2VEMA 4PL2A 1UB3A 2TRSA 4JTSA 2FDSA 3ZWSA 1QPNA 2DZVA 4JTTA 1P0NA 2CLOA 3DFTA 3HGOA 2QAFA 1L2UA 3C56A 4BFAA 5AC8A 4OE7A 1TV5A 1KFKA 3P7YA 3HMJG 4JR5A 3HPZA 4IXXA 3GDLA 3STCA 3TXZA 4OV4A 2LLEA 1GVOA 2VXNA 3LHUA 1Z42A 2QKFA 5BMWA 2WOQA 4Z08A 3TFCA 4IPIA 4LC6A 5I3KA 1YXDA 5LHEA 4LVAA 4IJBA 1W31A 3OBKA 4HNNA 4Z1AA 1ZY9A 3TSBA 4WY0F 4LOCA 1JCLA 1TV7A 5CPNA 4JIPA 2W79A 5ABTA 1DBTA 3FJ6A 5D2XA 1EP1A 1V5XA 4EF9A 5C55A 3M5ZA 2ZZ7A 1TPVA 3MYPA 4CCDA 3G22A 2BX7A 5CZTA 3S0CA 2ZA2A 2NXHA 3BLFA 4LS0A 1H1ZA 3EKZA 3PB2A 1TPFA 4RKAA 2NX1A 4LVBA 5I3FA 2ZDRA 2V5LA 2Z1BA 4LS1A 2XFWA 3O6YX 4U4MA 3VCRA 4PC8A 4FHAA 3TX9A 1EP3A 3ABOA 2BWGA 3B05A 4IX2A 5HJLA 4AXKA 4J9JA 5L6UA 1WV2A 5D2YA 4NNBA 1G4PA 4MY9A 2H8ZA 5AHNA 3NQMA 1VRDA 2C16A 4JTGA 2V81A 1LOLA 2Q3OA 2RDWA 3ANYA 3LRKA 1ADOA 4QJ1A 1MXSA 1DQWA 3AO0A 4O53A 5LNSA 4OGZA 1VYSX 2QCNA 3EXSA 2ATMA 1R46A 1I2NA 4UTLA 2WNQA 3Q58A 5AYYA 1GZGA 1ZJIA 1KM5A 1B4EA 1WAUA 3W7RA 1H62A 4ZQPA 1YDVA 1XCFA 4HNTA 5U4NA 4UMAA 1OFBA 3EEGA 2C19A 3G18A 2R94A 5D30A 3KRSA 4JTFA 4UFHA 5F2GA 1ZAJA 4DF0A 2VFDA 3MP5A 4HHPA 4ORMA 5SWUA 4JTHA 3MP4A 2VENA 2XN0A 3N34A 1TPB1 4LC8A 1KFLA 2NZLA 3YPIA 4XUGA 3L68A 4GUGA 4ZQOA 4IPJA 1K7FA 3S1XA 2FPYA 1R47A 5KZMA 3U2OA 4MPQA 4OT7A 2ZTKA 3ZWTA 2VOMA 3B0PA 3PBVA 2H8XA 4OU1A 4KFPA 4HPXA 1F74A 1DVJA 4O15A 3F03K 3NQEA 3HGSA 3M0ZA 4PTNA 3MBDA 2CFFA 4TMBA 5C5YA 1K3UA 3P8JA 1LLWA 4FEZA 3NL6A 4MIMA 1YDOA 3L65A 2ISVA 3W86A 4NX5A 3R12A 3B0VC 5FF3A 4K8EA 1ML1A 4IMFA 5LKYA 4L4MA 4TMCA 3IIPA 2FQIA 3UPWA 1HTIA 3NQAA 5IBXA 1OFPA 4O18A 2TYSA 2VFIA 4K7YA 2DZXA 4ICNA 1TO3A 3LHZA 3N9SA 1Q6OA 2NUXA 3PUEA 1UUOA 1D3GA 3FJLA 3GX9A 3E0IA 4PEKA 1ONRA 4FXSA 2V2HA 2WKJA 1F2JA 3P62A 1X1OA 3LXAA 2WQPA 4LVGA 3W74A 2H6RA 3LCFA 4BI6A 3O16A 5DLCA 1ZENA 3ABQA 4O12A 5AB3A 2NLIA 4GNJA 3NYZA 2AAMA 1A5CA 3S8HA 3GXTA 3D0CA 5AC7A 1W5OA 2CLIA 4JN6A 1A53A 3LM7A 1PL9A 4IMGA 5K2ZA 3BG9A 3LDVA 5BNKA 1NFBA 1ALDA 1F6KA 3TKFA 2ZRYA 2PRHA 1Q6LA 1CI1A 4Z1CA 1AW5A 4ZL1A 2Y61A 4DO5A 3BW3A 3N9RA 2JGQA 1YTKA 1L9WA 1YDNA 3ELFA 2E6FA 4A2SA 4JS3A 1BWKA 4ONVA 2VEIA 1W3TA 3LHTA 4DBEA 4CLMA 5EMUA 3KVJA 4RZ4A 3BK0A 4BF9A 3B4UA 3TV8A 2ZRXA 3UWZA 3VKJA 1OX5A 2EAWA 5CZSA 4JX5A 1LRTA 4JY9A 4O52A 3EWZA 3PBWA 3OVRA 1W5MA 5D03A 4UC5A 1SZEA 1LBLA 3W7HA 3TFXA 3RLVA 2V0TA 4K36A 1VYRA 1I8JA 4JYEA 3G1HA 3W7JA 1GVFA 3BPWA 4QM1A 3EWBX 4LNYA 1I2RA 1XL9A 2Y7EA 1NEYA 3GXNA 2J9XA 1TIMA 3M44A 2Y63A 1QDSA 3B8DA 1XM3A 3BLEA 3PC0A 1J4EA 4BWLC 4K8HA 4FNQA 1RQEA 3PBUA 4R33A 2CWNA 2QCEA 1IIGA 2ZA1A 3KVKA 5DN1A 3NG3A 1MZHA 4LV4A 2GVLA 3HIJA 4UFMA 3NQ7A 3L0NA 4AEOA 3W7CA 1KM0A 3R13A 2AQWA 2JKEA 1MO0A 2Y7DA 1T99A 4LVDA 2QJIA 3TNOA 4DELA 5HINA 4DF2A 1ZAIA 3NVTA 4TO8A 1VGAA 3A5FA 2ZZ6A 3CT7A 3E12A 1DOSA 1SZNA 3DI1A 4MFDA 2QJGA 2ZZ2A 4JTKA 1OK6A 4EF8A 4NX0A 5K7JA 3B04A 3QPZA 3NR0A 1XDMA 3TUUA 5LNWA 4LW7A 3G0UA 1QO5A 5HNRA 1SZFA 4EOUA 1I2PA 2OX1A 3WJXA 3G1VA 3INPA 4L4LA 2DJLA 2Q8ZA 1DV7A 4DO4A 3TSDA 3PWAA 5BMXA 4OQVA 3B06A 3QJAA 1NF0A 4RLIA 2A2IA 1A5SA 3P67A 3W83A 4N4QA 3NL5A 2OZ0A 2R14A 3W71A 3CU2A 1PVNA 1K03A 2V9DA 4NJKA 1KFJA 3W1MA 1F73A 3FA5A 3H53A 4TR9A 3W7NA 1XUZA 5D02A 4O54A 1VQTA 3L0GA 4IXHA 2ZFAA 5FEWA 5LGZA 3P80A 1MEIA 3NQFA 4KWVA 1TJPA 4FX8A 1K7EA 5KMYA 2CU0A 1I4NA 2TPSA 4NJIA 1AG1O 1L6WA 4UTTA 2GOUA 4AHPA 2OT1A 4UTMA 1TPUA 1TQXA 2DZTA 3NL2A 5F2IA 4QNWA 4JIQA 1P0KA 2ZZ4A 5J5RA 1SQ7A 2E6AA 2V5BA 3EB2A 4UTKA 3TH6A 2EF9A 4HN4A 3WJWA 3BGJA 1QFEA 2J9ZA 3N14A 4H4IA 4OBTA 1IXOA 5DELA 2ZYFA 2ZTJA 3P81A 3GDMA 4Z0SA 1HUVA 1H7RA 2VFEA 3TIMA 3UWWA 1JCJA 1QOPA 3W6YA 4XTIA 3PF3A 3MW7A 1Z48A 2WSRA 1SU5A 3HB9A 1TPWA 2E77A 4KKXA 4R53A 3CLMA 4DPPA 1R2TA 2B7QA 4O28A 5U7SA 3QF0A 2GVJA 2X2GA 4LV9A 2JKPA 3EX2A 2OMAA 4EVZA 3NM3A 3EWXA 4WUIA 1KV8A 1GOXA 2PRLA 3STEA 3WJYA 3QQ0A 3S1VA 4UFJA 2Q8LA 3G0XA 2G5WA 4GRSA 3S5ZA 1S5VA 3LHWA 2A7NA 5AFDA 1TTPA 3LV6A 3C61A 4JICA 4E38A 1FWRA 4KFOA 3PG8A 3DFQA 1IGSA 3W1AA 4PA8A 2X1SA 2Y62A 1G7VA 3W87A 3C2EA 3DHDA 3G1AA 1GG1A 4MUZA 1JCXA 4RZ6A 1GJPA 2WNZA 1W37A 2E68A 3QPYA 3NQVA 4P2VA 2CZDA 1EA0A 5E0KA 3DH7A 4QAIA 3W1UA 1X7FA 2X1RA 5EYWA 4ZQNA 5AC6A 3IIOA 3LBMA 2YDAA 4TIMA 2B7PA 4OV9A 1K8ZA 4AHQA 2H3DA 4N9EA 2YW4A 4RXFA 1W8SA 1KTNA 4DXVA 4RZ5A 4ZQRA 2YGYA 2PCQA 4Y96A 3WK2A 1TQJA 3W72A 1U5JA 3GAKA 5F2LA 2CLEA 2CW6A 2PURA 3CEUA 4MFEA 1M6JA 3E9AA 4MYXA 5AHMA 3BG3A 4YXGA 1ICSA 1YXYA 1Q6QA 1PHQA 1SW0A 1QO2A 4A3UA 3TQVA 1T8XA 1M7OA 4XKYB 1XDLA 1ZCOA 3I7SA 3G8RA 1VJIA 1YTDA 2ATSA 2PC4A 2QCGA 3NPUA 1X1ZA 1I45A 2QCFA 3I6RA 4X22A 3KAOA 2WJZA 1R2RA 3LCWA 5EBUA 3QQ1A 1ME9A 3TW6A 2FPVA 1OVDA 5LNVA 1TTJA 3KOFA 2NWSA 1SSDA 3IGUA 2FPTA 1MSSA 3QC3A 3RF9A 2X1TA 3A24A 1OF6A 3MUXA 4WOZA 5TQLA 1IIHA 4DBDA 1S5TA 2FB3A 1LYXA 4N6EA 4K7VA 1J2WA 2CLKA 3QEZA 4R7JA 3LI1A 3KRZA 1GVRA 3UY7A 4ZQMA 5AYXA 5AHEA 4ALDA 3PULA 8TIMA 5G1TA 1KV5A 1K8YA 2CZEA 1BKSA 2KZHA 2QAPA 3C0JA 2BSLA 1JULA 3HQ1A 3SJ3A 3FKKA 3HGRA 3A21A 4X3ZA 4O1DA 1EUAA 5BOOA 5EKYA 2YCEA 1LBMA 1V7YA 3W7GA 4U28A 1NF7A 3W3OA 1YPIA 2YYTA 3C8FA 1MEWA 2RFGA 3S1UA 5CPOA 1GVQA 3LTSA 1RR2A 2EGZA 5HWNA 3W1XA 5HR6A 2ABAA 3W1QA 5IBXC 1LBFA 5DCDA 1GWJA 4GUHA 3UWQA 5H2ZA 3W23A 3O6CA 3IVSA 2NUYA 4N2YA 3A5VA 1OG0A 3MJYA 2E5DA 2X16A 2ZCGA 2V2CA 5D33A 3MYOA 4JTLA 3S5OA 4Y6GA 2A6LA 2AGKA 3RK8A 3G1SA 2Y7GA 2OT0A 4IOTA 5D2TA 2YFNA 1ZHAA 5CPLA 3TSMA 4M19A 2NX9A 3EX6A 2RKXA 2ZRZA 4LU0A 1DQXA 1ZALA 3MHFA 4BWLA 3USBA 1KFEA 4Z0JA 4GWEA 3IIZA 3EX1A 2YPIA 4RR4A 3NZRA 1NVMA 2W0UA 2QCDB 3GDRA 2OJPA 4RK8A 2JBMA 4PH6A 3VE7A 3TROA 1F6PA 3BG5A 4YL2A 4UNLA 1W5QA 4H3DA 4OHQA 5FEZA 5K9XA 4BI7A 3HG5A 4UTWA 1OABA 1CW2A 3L0KA 3BV4A 4JTUA 1A50A 2GVGA 5G4WA 4LY8A 3UXAA 1KM1A 1H7OA 1EB3A 3JRKA 2WSQA 2NXGA 3EXTA 4Z1DA 4I7VA 3S5YA 1M5WA 1B3OA 4JTEA 3F4NA 1Q3NA 3SY5A 1TCDA 1SPQA 3PAJA 3LHYA 3QZEA 3VNDA 1VH7A 3TR2A 1WDWA 3IVTA 4I9AA 4QISA 4GUJA 2DZWA 4M6VA 1QPQA 3M6YA 5HMSA 2A0NA 4N9CA 1LOSA 3UPBA 4CNNA 3LLDA 5K3VA 1TPDA 3ATZA 3UWVA 1H7NA 5D37A 5C6MA 4ZMGA 3FYPA 3LCXA 3STFA 2ABBA 3W7EA 3EWWA 2WO5A 3Q37A 4HT3A 4GC4A 3QH2A 3C6CA 1RVGA 4XBSA 2J27A 1OFDA 1OFOA 2R8WA 1JQXA 2W6RA 4XWUA 3G1XA 4FO4A 3O06A 5CKSA 1OX6A 2A85A 1VLWA 1RV8A 1T0OA 2EHHA 3NL3A 1XC4A 1FX6A 4HSOA 2ISWA 3TW7A 4WXYA 5FESA 3PY2A 5LNRA 1PE1A 1B9BA 1KM4A 2CLFA 2NV2A 4JDYA 4K38A 5G4EA 3BARA 3W9ZA 3M7WA 4CNOA 4ZZ9A 1SFJA 3GAYA 3OHIA 5HQEA 1ICPA 1W3NA 4MKNA 3LB0A 1TREA 5DY3A 3LLFA 3GYEA 2Z0IA 1FCBA 1W56A 4JTJA 4MZ8A 3F1QA 3NOEA 2E1DA 2Q3RA 2DZUA 4NZFA 3LCHA 4O16A 1K8XA 2GPTA 4AWSA 4GFSA
chains in the Genus database with same CATH superfamily
1R3SA 3EX4A 1A0CA 1DHPA 1F5ZA 3HM7A 1XLHA 2VWTA 1IV8A 3PG9A 3SRDA 3T4CA 3JUGA 4IIFA 3V75A 3UXDA 3GG1A 3DENA 3G2GA 3T0BA 7REQB 2AMGA 3KX6A 4IG2A 1TZ7A 3MDUA 5K4XA 2NSXA 2OLAA 1A80A 1UYQA 1CYGA 4PULA 4AD3A 3LCIA 1U83A 4IWWA 2AMXA 2P5NA 4N4PA 3BMWA 2GJXB 1QHPA 3TQKA 4N02A 2Z4GA 4B5VA 1TMQA 3F5KA 2RJHA 3QV8A 1EWEA 2OG9A 1XG3A 4O14A 1VFOA 2FTPA 2BLEA 3QY7A 1IXQA 4ZOEA 4FXRA 3TQPA 3QMRA 5E5CA 4IGHA 2VEFA 1AFSA 4LF2A 2PDXA 1OFQA 3VM7A 4J3SA 3DHFA 4GH1A 4L6HA 4DY1A 1YQ2A 3C2RA 5I79A 3N4AA 2VYOA 3G24A 3W7OA 4LRTA 4J3ZA 4CNSA 2NT0A 4DRSA 4F0LA 1O5XA 2W4XA 3GDTA 3I3BA 3LU2A 1OCBA 3HF3A 1I0DA 3M0XA 1JXKA 3KLLA 5FF4A 3ZLGA 3UERA 4EKJA 3DAQA 3STPA 3VOFA 4DO7A 3KCLA 1OY0A 1WE5A 5I7GA 1G4SA 2CHOA 4WIWA 2YCJA 2WMJA 2Z25A 3ITTA 1M9HA 4CD8A 4XBKA 1GOWA 4I9JA 2BGSA 3OIXA 4JDBA 5A94A 4W85A 1GPFA 4Z2GA 1WKYA 4RDZA 1UR8A 4EXBA 1ME7A 2WCGA 1MMFA 4UTWC 3OEXA 3DKJA 3NNTA 4PN2A 3SJNA 3WJSA 1KBJA 3PZUA 4UUIA 3TAOA 3VYLA 4CD4A 4DJFD 1YPFA 2NQHA 4QE1A 1NSJA 4XG1A 3PSWA 3BH4A 3R25A 2WWDA 2P0OA 1DKWA 4AF0A 1A5NC 3P5YA 1N8FA 4RV8A 4UCGA 3AMCA 3SY1A 3VOIA 1GYLA 4FLSA 4B5UA 3DYOA 5DX7A 3TYAA 3RPMA 2WMFA 2ZICA 2G96A 1OM0A 3WQ8A 1FWDC 1EP2A 4BQ2A 2CPUA 2YL8A 1KCLA 1KBLA 3WN6A 4KESA 3N3MA 1BG4A 3EB4A 1K02A 5HWMA 3ANUA 2QDDA 5F1VA 1W9BM 4FAMA 2Z29A 2VRKA 2DFAA 2Z6IA 3ARYA 2J88A 3EBVA 4XB3A 4FALA 5HULA 1XICA 3ITVA 3N15A 4N42A 1XD0A 2VFHA 4L9ZA 2O56A 1XBZA 5BOFA 4J28A 3BLIA 1CGYA 3E5PA 2ZX7A 4Z42C 4C6LA 1JR1A 5BU6A 4O0ZA 3WK0A 1PCWA 2D73A 3G3DA 1VC4A 1BHGA 3PWGA 2YL9A 1TIWA 2R1PA 2BP1A 1I9CB 3BANA 1XX1A 4GMEA 3UF9A 3WSUA 2BY1A 3MUAA 1WDSA 3S2CA 3E2SA 1BXCA 4MZYA 4Q8UA 2EKCA 2QGHA 1H7WA 1WKFA 3NDOA 3NGJA 1LT8A 4WZHA 1BAGA 3W7MA 4HK7A 5GJMA 3GHUA 4LH8A 1WX0A 1L2QA 2YLLA 1ZJHA 5B80A 1EC7A 1Z32X 4KETA 5BWAA 2VVSA 4E4PA 1ZPTA 2Y6ZA 2O9PA 2INZA 4ZEPA 5FF0A 3DIPA 1WXJA 3H7UA 2VCCA 3T6CA 3W88A 4IUOA 1LLZA 4JTRA 3QVQA 1T7LA 1FA2A 2YXOA 2V8ZA 4AB4A 1OFEA 4ES4A 4V15A 3HA1A 5CJNA 3VOCA 1YNPA 4FNPA 1QTWA 2RJGA 4K6AA 2GQ3A 2OZ3A 5I24A 5HDRA 4G7FA 4L1GA 2XZ9A 2UY4A 3G0SA 4GOAA 1RAKA 1WOAA 4V1YA 2HNHA 2Q09A 1BSLA 3C86A 4IPNB 4PBEA 4TUFA 4DQWA 2QPXA 4AUBA 5E9XA 1PB0A 1TPEA 3A4WA 1J9YA 4CCEA 1KW1A 2X0YA 3C2VA 2VKZG 3UYIA 4GI9A 2Y7FA 3P14A 4WLCA 2BY3A 3NQ6A 1J2BA 2CLLA 4M1BA 3W1PA 2V63A 4NJJA 3HFYA 3ICJA 4PMQA 2B7NA 4JTIA 4LANA 1FDZA 3GNNA 9XIAA 4GGHA 2BFGA 4FZIA 3BJSA 4HYWA 4Z1YA 4MAVA 1P43A 3EOOA 7ENLA 3C2FA 2OQYA 5LZLA 1S2TA 3WH7A 1Q6RA 3EA1A 3HG4A 3ZR4A 4R9OA 3KBJA 3Q45A 1FWAC 4LSBA 2ZUWA 4I6VA 3QYQA 1ESWA 4GD0A 4KCWA 4F8XA 4YYCA 3MMWA 2Q6ZA 4H8VA 3LK6A 2FKPA 3DESA 5HBFA 4LBUA 4FB7A 3MPGA 3RXZA 5TIMA 4N0RA 4INFA 3VE9A 3W29A 3LPOA 4H04A 1XLIA 2XH7A 3GSMA 3SCSA 3L5LA 3R8HA 2PDFA 2VC6A 4W7WA 2CLMA 1OHLA 3SRFA 2BZNA 1UOKA 3W2UA 3M5VA 3SIMA 3PB0A 4C91A 3KS6A 1Q6EA 4NUWA 5JQ9A 3ARXA 4JCMA 4WOQA 5AOUA 2QIIA 2QUTA 4XO7A 3H2AA 3MO4A 3QFEA 5A6LA 4MY8A 4I7UA 3JS3A 2XVPA 2WCAA 1HJSA 1BXBA 3SCUA 4AZIA 4Q32A 4QIUA 5ABFA 1I75A 1ITUA 4I5XA 4RW3A 4IIBA 4DPQA 3KWXA 4GQRA 4F2BA 5CSUA 3S6DA 3S5SA 3VPLA 5TNVA 5KSWA 1EIBA 1YNQA 2BVTA 3TCEA 1GQNA 3OJGA 4MGGA 2V3EA 4LVFA 3VNJA 1MVYA 4X9SA 5CGQA 3N2OA 4GACA 2DT3A 1W0MA 4LJ3A 3QMSA 3MI6A 1JUKA 3W2MA 4O0KA 5CBJA 3DI0A 4Q7IA 1AL7A 3P60A 3SN4A 3GR4A 5FJUA 4AEFA 3A23A 1OT2A 3TDFA 1H2JA 3QR0A 2P3EA 3GG7A 3KE0A 3IJ7A 2J78A 2PBOA 1KBIA 4B91A 1ODUA 1UD3A 2GL5A 1CXEA 1NWUA 3CWHA 2WB5A 1LTDA 4CU6A 3WENA 3PZVA 2VGBA 2F84A 4MPKA 4PSPA 2ZUNA 5M03A 1ZFJA 3BZJA 4IL0A 2VQTA 1G6CA 4JZ5A 2Y89A 4Q7NA 2BNJA 2ASHA 1VCFA 2F6UA 1MWOA 5D9OA 1B5TA 3GNOA 4LWWA 4U3AA 3FLUA 2NQZA 2YDRA 5DMNA 2ZZ1A 3WK3A 2AAAA 3W24A 2FVLA 3CUXA 4FA3A 1MDRA 3QKZA 4XKMA 2VT0A 5FJIA 1PDZA 1HO1A 1EZWA 1BSIA 1GHSA 3AISA 2Z1KA 3P8IA 2BTMA 3CTLA 1R3QA 1HF6A 2W62A 3RFAA 1X38A 1KFCA 1GYNA 2AL2A 5CC5A 4JNZA 1DJIA 2YBUA 2PWHA 3M0HA 4H6RA 2TAAA 4ROQA 5AHFA 3OOQA 3CMFA 1UR2A 1TUXA 2P3ZA 1F3TA 3QHMA 3UCQA 4KRZA 4H9YA 5A5WA 2OWCA 3W7DA 1A3HA 1XIGA 1R38A 1QNVA 1FUYA 3HURA 4DBWA 2YX0A 3WK1A 5DY2A 4BK9A 2NX3A 3QM3A 3N18A 4GZEA 5ABFB 2DDXA 4JYFA 4PMRA 3KUMA 2ODOA 1RZMA 5F4WA 1C92A 2CIPA 4HZ6A 1UD5A 4PCNA 5A8OA 4MY1A 1KKOA 2B31A 1V03A 1NOFA 1WCGA 1XYBA 3DFSA 1G9HA 3CUGA 3CIWA 3AHYA 4LNCA 1E9YB 4LY4A 5G1YA 2DZPA 2OYLA 3VAVA 1JZ7A 4ZO8A 1D7KA 2QHAA 1UWIA 3G6LA 3BXWA 4HIBA 1QPRA 1ZZMA 5F2MA 3H23A 6ALDA 1M41A 1T6MA 1ME8A 2IKGA 3O7UA 5EA9A 4D6EA 1TELA 5D8ZA 3LCGA 3STGA 3G77A 1QU4A 2QJMA 3MUY1 3H54A 3LHVA 4E4UA 3O63A 1TWIA 3WO8A 3LUTA 3U0HA 1OGBA 2WHLA 4IGSA 3QQWA 2OKOA 5D38A 5CAHA 2ISSA 3UPMA 1XXXA 3A47A 1UQYA 1YDYA 5BRBA 4A22A 3M64A 3MVIA 2NUWA 3NA8A 1OX4A 3HGJA 2GUBA 2WVVB 1UH2A 1TVPA 3GVWA 4XTDA 5HJYA 2WSYA 4K8GA 1K6WA 3O07A 1BYAA 3WFAA 1F8IA 1ICQA 2G8ZA 3ARQA 1HKKA 3AZRA 4HJWA 2EJ1A 1CLVA 1KTBA 1FP9A 3VI2A 5BZAA 1EEXA 3SCRA 1EQCA 2B4GA 1VBRA 1XKYA 2VFGA 3DGBA 4TX9A 3KFTA 1UPPA 3UJEA 3C3UA 4UIOA 3QPEA 3NM1A 2PSNA 1CXIA 3O05A 3U2EA 3DBNA 4J35A 4B3KA 3UQNA 2W63A 2YBTA 1LQ0A 5D2VA 4YLWA 5EMJA 3W37A 2OODA 3CH0A 4TVDA 3BTNA 4JTAA 2Y85A 5FSDC 2QJHA 1P7TA 3E0WA 4U5IA 3FCPA 1K9EA 4ERAA 4EIVA 3M0MA 3ZS4A 4AWTA 4Z17A 3KZSA 1G67A 3DHPA 4PL1A 4EXAA 9XIMA 3GTHA 1LQAA 4LBRA 4DJDD 3TN3A 4Y9AA 1Q63A 1XRVA 4KEVA 2PRMA 5EMMA 4JTCA 1Q45A 4PCFA 3RYSA 3SSJA 5IFPA 5F4SA 1JAKA 1UD2A 1Q6DA 2I5QA 1A0DA 1YMYA 3RO6A 3GIPA 1CGVA 3LEPA 3I7RA 3WLIA 4M3PA 1EPVA 1UUMA 3GVVA 3LZ3A 3PTDA 2XM2A 3WLSA 3CLWA 1A49A 2YA0A 3AHXA 2TRSA 4JTSA 1BQGA 1QPNA 4LCRA 3GUWA 2X0SA 2QAFA 4NAFB 4EE9A 1J0JA 1KFKA 4C6CA 1F4HA 3GDLA 1VFSA 3STCA 4OV4A 4AU0A 4GIEA 1GVOA 1JD7A 1HP5A 4JOMA 2QKFA 1H3GA 3BSHA 4Z08A 1UP2A 2PP3A 4IPIA 4LC6A 5I3KA 3T8QA 5A6BA 3ITGA 4W8LA 4AG0A 1JDAA 1CZ1A 3OBKA 1Y65A 2VP8A 3GXDA 2Q01A 4WY0F 1R3RA 1TV7A 4JN8A 2GYIA 5CPNA 3TJIA 2BGNE 2GSHA 1XSKA 2V38A 4P8VA 1XIEA 3FJ6A 5HQLA 5BROA 1EP1A 2FDMA 1V5XA 1XR2A 2V6AA 3GU9A 1W8GA 2J7BA 2ZZ7A 1TPVA 4H41A 3PPFA 4CCDA 2FFIA 1HIZA 4HP5A 1GQLA 4JQ4A 5REQB 1RP8A 2G3JA 4KCUA 3O6YX 4D9PA 4FHAA 1Q8AA 3ZM8A 2E7FA 1Y5XA 2EKGA 3ABOA 2ZUVA 2BWGA 2PUZA 4CN6A 1Z69A 2CESA 1J8VA 4D8ZA 4PCPA 4J9JA 3K2GA 2VDGA 4RW5A 1G4PA 3NQMA 2DV0A 2C16A 3KCJA 1LOLA 1ZBCA 3I3EA 4S3CA 4Y7EA 3LRKA 1TV3A 1DE6A 1R85A 1UBPC 1DQWA 1WDQA 3AO0A 4U3CA 2WNQA 4K2SA 5REQA 1V0LA 3CQIA 1QNQA 4DI8A 5C9ZA 4HOWA 1YDVA 9CGTA 1XCFA 5C2GA 1D3CA 5A8PA 2C19A 2YA2A 4C1NA 3F2DA 5D30A 1GYMA 2FMOA 4DF0A 2CBJA 4JFSA 1PKNA 1KNWA 1SJAA 1GZ1A 4F2UA 1TCMA 4ATDA 4AIOA 4R88A 4NI8A 2XN0A 4LB3A 1VFMA 1KFLA 2PGWA 2FJUB 2E8ZA 2VCBA 2ZUUA 1VIWA 3TCSA 1HX0A 2C8NA 4GUGA 2FPYA 1QW9A 2OQHA 2JF6A 3MV11 2AKZA 3FHAA 4D1IA 2ZX6A 4KBXA 4PTNA 4TMBA 1GVYA 1K3UA 4IHCA 4MIMA 2HROA 6REQB 3CV2A 5CBBA 4DXXA 2ISVA 2JEQA 3B0YA 1I1XA 3AYVA 1M3UA 3R12A 3NGFA 3R7MA 1A5MC 5FF3A 5LA0A 4RDYA 5F7UA 1MRQA 1X97A 2ZVRA 4F0HA 4W7UA 4QS6A 4AD1A 3RIKA 4HA3A 4K7YA 4E8CA 4DZHA 3P3BA 2YCIX 3FJLA 3THUA 3VGFA 2WKJA 1F2JA 2ACUA 2QYGA 3KM8A 2C71A 1A47A 4LVGA 3RM8A 2DIEA 1EA9C 4AIEA 1K77A 2GJXA 3R4IA 4REQA 4FOJA 3PTQA 5AC7A 4JN6A 3NQBA 1SMAA 4IMGA 3BG9A 4PFHA 3BLOA 4F0SA 2PRHA 3MWCA 4GINA 7REQA 4HJFA 1PTDA 4DO5A 1REQB 2GDVA 1T41A 2NQJA 3N9RA 3TOPA 1YTKA 1L9WA 3NXLA 1QI5A 4A2SA 4NASA 4RE3A 2ON3A 4DBEA 2QQ6A 2NT1A 4QS5A 3G5EA 3AS2A 2ZRXA 3UWZA 2NLYA 5I23A 3VABA 3GTXA 1EJXC 1JGIA 3AYRA 1GOKA 1JPIA 4XIAA 3PBWA 1PTAA 3H22A 3SCTA 4UC5A 1LBLA 2V0TA 2WVVA 3I4KA 4HZMA 3W7JA 3GBDA 4LNYA 2YA1A 4W89A 1L0PA 3UZWA 2H9AA 2J9XA 1J96A 3M44A 4X0NA 5E0FA 3PFRA 3HV9A 3VKDA 1ZCCA 2CWNA 5EFDA 2QCEA 5AC4A 3RILA 1F61A 4J3WA 4UQ9A 5DN1A 1MZHA 2GVLA 7CGTA 5A6AA 2FVMA 3AI0A 2ZIDA 3E2QA 4LVDA 1YE4A 1XLLA 4AX7A 5HINA 1KR1A 4TO8A 4C5ZA 3OZPA 1DOSA 2GFTA 5PTDA 1TMLA 3OU8A 3OYZA 2ZZ2A 1OK6A 2OLSA 5E9AA 4NX0A 3E0FA 4AWEA 1XDMA 3NURA 3PP7A 1LL4A 1J11A 4LW7A 4E3TA 3WD2A 3WJXA 3G1VA 3INPA 4BF7A 4CVUA 6XIAA 1PBGA 3ARSA 2DJLA 5DANA 4I90A 2HISA 5BMXA 9RUBA 1R0MA 3RM4A 5HMDA 1A5SA 1GW9A 3NL5A 2OZ0A 1TR1A 3VMNA 3W6MA 2R14A 3W71A 2NW0A 2V9DA 5FACA 4QG6A 1VQTA 3L0GA 2ZFAA 1XIMA 1DPMA 5LGZA 4TX6A 3ITYA 3P80A 4MSSA 4KWVA 4CVWA 5KMYA 5H6HA 2GZXA 3ITXA 1IR1A 1K9FA 1I4NA 2ACSA 2TPSA 4NJIA 2ISFA 3QOKA 1L6WA 2GOUA 4AHPA 4AZGA 2ZOXA 3ENLA 3NL2A 4L6DA 4QNWA 1P0KA 5J5RA 2V5BA 3WJWA 1QFEA 5DRIA 1QI3A 3APGA 2J9ZA 3OQEA 1JD9A 4H4IA 1TWDA 4OBTA 1HT6A 2WW5A 1IXOA 4WJXA 2ZYFA 2IPFA 3EDKA 4B3ZA 1HUVA 3UWWA 5C7HA 3W6YA 3ZLHA 3N9KA 1CLKA 2FZNA 2WZMA 3MW7A 2WSRA 1TPWA 4KKXA 5H8MA 1GCYA 2VZOA 4RNHA 2DGAA 4MWAB 1R2TA 3ARWA 2XVKA 1IZCA 3I4EA 1Q5MA 1MQQA 1ZP3A 5HQMA 4M56A 3NM3A 3TLLA 3WJYA 1VBJA 1W1A1 4QG8A 2Q8LA 4TQTA 3LLXA 1P0BA 3G0XA 4S38A 4GRSA 3WEMA 3S5ZA 3LHWA 1TTPA 5HK4A 3C61A 2QZRA 1O5RA 1ZU8A 4KGLA 4HA4A 4FOUA 1IGSA 3W1AA 3WD0A 3A13A 1E4MM 1XKJA 2Y62A 4QDPA 1F07A 1G7VA 3V16A 1WZMA 4QLKA 4Q6XA 5EU9A 3CQKA 3DHDA 4MUZA 1OCNA 3AS3A 4WRHA 2DSKA 5BCAA 1EYEA 4M1RA 1EA0A 3DH7A 2JF7A 1TWZA 2I7GA 4ZQNA 3BOXA 3E2RA 2YDAA 1XH2A 3MTWA 1NTHA 1KTNA 4DXVA 4RZ5A 3ABZA 3UJSA 1C7TA 4ZQRA 3WK2A 5LXXA 1B31A 3QGKC 1FFQA 1DTNA 1IEQA 2CLEA 4OUIA 1QI4A 1ZTVA 2XIOA 4GY7A 2PURA 5AHMA 4L4PA 2CWXA 4P7NA 2J75A 3WLLA 1WP6A 3G6MA 1LJYA 1PHQA 4PR4A 3OLIA 4HNLA 3WMSA 2ZXAA 1PX8A 1E73M 1WPCA 1X1ZA 1OCQA 4C7GA 1W1PA 3I6RA 2WJDA 2I9UA 3LGGA 2Z27A 3GG0A 5IDZA 1OVDA 2XH4A 1C8YA 1TTJA 3KOFA 3KLKA 2FPTA 1MSSA 1O68A 3FA3A 4WOZA 3H24A 4M24A 4ATWA 2JIWA 3LI1A 3MY9A 5AYXA 5AHEA 1RUSA 4IZGA 3PULA 3KTSA 1FFRA 8TIMA 1VBUA 1XLAA 1BKSA 2QAPA 4QROA 3SJ3A 1TWSA 1BLIA 1H5VA 3URAA 4X3ZA 1EUAA 4OTKA 2YCEA 2PWVA 1LBMA 2HNEA 4Z2LA 4L64A 5HNNA 2PDCA 3LTSA 5HWNA 3LPPA 3IGHX 3U7BA 1AD1A 3H4WA 3WUBA 5HR6A 5GQBA 4YNGA 4W8BA 2UY5A 1KR0A 1JYVA 3AIEA 4GUHA 5H2ZA 5DFAA 3ALFA 3W23A 4HA1A 2OLHA 3CNYA 2X16A 3CYJA 4C6IA 3MYOA 3S5OA 6XIMA 4M6UA 4ZGYA 5D2TA 2YFNA 1YNYA 3EX6A 1ZSXA 3VZXA 4H8NA 4PB3A 1XLKA 4J2PA 3MHFA 3USBA 4PCSA 4HZ8A 3K4AA 5DEZA 3VD9A 4G9PA 2OJPA 2JBMA 1Q6CA 4Y9NA 3WMLA 1PYMA 3WELA 4UNLA 3XINA 1W5QA 5FEZA 4L4OA 1HJVA 3WQ4A 4BI7A 4F0KA 3S3GA 3CV6A 1SGJA 3W25A 3L0KA 3WUFA 4H7ZA 5G4WA 2RAGA 3U9IA 3UXAA 1H7OA 3ONCA 4Q8TA 4H8HA 4Z1DA 5FAJA 5FCZA 4WF7A 2YL6A 1U30A 3F4NA 3SY5A 2VRJA 1SPQA 3LHYA 3TYBA 1ZP4A 3TR2A 2DZWA 4M6VA 1QPQA 2PFHA 1XJBA 4N9CA 4W8AA 5C2CA 1FRBA 4DM2A 3QN3A 3LLDA 5JUVA 4ZB0A 3M0IA 1BPLB 3LQGA 5T91A 5CAKA 4GQ0A 4RV3A 2PDNA 3DFHA 2WO5A 4J5NA 3ITOA 3SCPA 4DWSD 1WKDA 1PKLA 1JQXA 2IXUA 1M1BA 5CKSA 3N11A 1OX6A 1VLWA 2WKLA 1H11A 4J40A 2DW7A 1XRTA 4HSOA 4WXYA 1XISA 3PY2A 5FL0A 1B9BA 3A4XA 2NV2A 4YPJA 5JBDA 3TA9A 3EKGA 5BXPA 1ITCA 3BARA 3W9ZA 3M7WA 3WQ5A 1ICPA 1NOUA 3OIHA 5DY3A 4ZSTA 4GIYA 2Z0IA 4JTJA 3SEPA 3FHQA 2DZUA 1K8XA 4GFSA 2VGFA 3U4AA 3RU6A 4C6QA 4BCEA 4NY2A 2CBUA 2XSAA 1YADA 4MJMA 1OK4A 1O60A 2CCRA 3PZNA 5HJXA 3WH8A 1HN1A 3R43A 3BAJA 4GA8A 3GR8A 3VDCA 1UZ4A 1XSJA 3CWOX 1E0TA 3II1A 3N2MA 4CQ8A 3CUHA 2GQ8A 4ZQCA 1UCWA 5HPOA 3QW3A 4NKCA 4BI5A 5HUPA 4C6OA 3BGGA 4MJZA 4QNEA 1SJBA 3V5OA 2UY2A 4J3UA 3H8AA 3LX9A 3ZVIA 1XIFA 3E38A 1JDDA 1H5YA 2QV5A 1B4KA 1EDTA 4R85A 1S38A 3NDYA 1HVXA 1EXBA 3L5AA 3C3NA 1TV8A 2X09A 3VIIA 3ARUA 3UZJA 2R82A 3EOLA 4DYKA 1JDFA 1ONEA 5D2WA 3S1WA 1KFWA 5DXYA 4AF0B 3O8AA 3DC8A 2C0AA 3I10A 3VIHA 2TSYA 2FGLA 1V6UA 3TW9A 1H7XA 2R91A 4B5NA 5LXEA 3CQ0A 2OKTA 4S3EA 3L4UA 3WEOA 1MNSA 4ORIA 3APYA 3L67A 3MSDA 5CZ0A 4M6PA 4P8XA 1XIJA 1O66A 2Y1HA 1BGGA 3PZQA 2PWUA 1IR2A 3FJ4A 5JIWA 1EDQA 3M1ZA 1ITQA 3SCNA 3SB0A 3RGTA 2E6DA 4B92A 1RH9A 4NZ1A 4YN5A 8CGTA 3G1FA 1PSCA 1G4EA 2ZRVA 2PDGA 3L21A 2BHYA 3DFPA 3FS2A 2GJLA 5KITA 3BW2A 1OB0A 1XYLA 3L66A 5DF0A 1AW2A 3R8RA 4O4WA 3O1NA 5A8QA 2J8GA 3EA2A 3PM6A 4MDPA 3DDMA 4JHMA 1XLGA 3VMOA 3W2NA 5LIUX 1ISYA 1KO0A 1PTGA 2R6OA 1HGYA 2P10A 4P8WA 3ABRA 3UT0A 4BQ4A 4WJEA 3CAQA 5BOEA 2F38A 4LFYA 4DWDA 3BO9A 4HU0A 3N13A 3GC5A 1PWLA 2X8RA 3EGJA 4B5XA 4WSJA 4PODA 3IJIA 5LIWX 3OODA 1GQJA 4HNOA 4JAWA 5EL1A 1G4TA 2FIQA 1PPIA 4NXSA 2D69A 2VZTA 2J66A 4FI4A 1FWGC 2HS6A 3PSVA 5DQPA 4YWIA 1AH0A 1E4LA 4KWUA 4XZWA 2PF8A 2W66A 1GONA 4HN8A 2YIHA 3A4JA 3RDKA 3W70A 4CN1A 1MFVA 2PB1A 4DLMA 1TPH1 5C70A 1IXNA 4F0RA 4YTRA 3TMLA 1IZKA 5HMEA 4GXPA 1TX0A 2F8QA 4OOUA 3UGRA 4GKTA 2V68A 1GEQA 1EBGA 3GNXA 2WZIA 4GCXA 3WNPA 1YEYA 2X30A 3ZXWA 4LTSA 4GBDA 4HNCA 4JX6A 2V30A 4RX0A 1K7XA 5DBTA 4N6FA 3ZT6A 3IWPA 2J9YA 3OBEA 5LA1A 1HO4A 1UBSA 1RCXB 4QP0A 4UQAA 5E1QA 4U10A 2J8FA 3VU2A 5D8WA 3VA8A 4ECLA 1XHGA 3PUOA 1J18A 5GVJA 4PUMA 2WC7A 3POHA 1RPKA 2E40A 3GVGA 2VRQA 1ADSA 3HQOA 4EANA 2VD9A 1AH3A 1FWJC 2Z2BA 3B9OA 4I6KA 3UNTA 3MZNA 4Q6JA 2NWRA 2G4FA 1SSGA 1IHIA 3LGEA 2DUXA 3RR4A 3O6DA 4A2RA 3H2CA 4M8UA 1EC9A 1DJYA 3W7KA 1RD6A 4UTJA 4WDTA 3EAUA 3MMUA 4RDVA 4RXGA 2YYUA 4UZSA 5I3JA 1JF6A 3E02A 4AD0A 2QDHA 1MNZA 3P82A 2PLMA 3W1RA 4AC1X 2C79A 3RCNA 4MYAA 3VX1A 3SIZA 3RO8A 3OG3A 4JNMA 3LSBA 4HMDA 1SZRA 1X6LA 3TJXA 3I7QA 1IF2A 1LWJA 2Z26A 4ZO9A 1KXHA 4ZTYA 2DVTA 3VINA 4KMQA 3CBWA 1YX1A 2QUVA 3COTA 4NT0A 1CPUA 3O9NA 3SECA 3P61A 4AD5A 3KRUA 4XAPA 3SGUA 3WQEA 5FAGA 3PAOA 3NQ8A 4FF7A 1V0KA 1F76A 3WNKA 3L7RA 5G2IA 2OU4A 3F4WA 3TQ0A 4YTSA 4MG4A 2QMJA 3EZ4A 1REQA 3TP4A 2RDTA 1I2OA 3WLKX 4ZENA 3KVLA 3MDWA 1EUNA 3SQMA 5IRPA 1H63A 3VGGA 3S5NA 4A3HA 4DWSC 1D7FA 2D0GA 3WF0A 4ZSUA 3B03A 2DZSA 2D2OA 5EFFA 4H2CA 2A7PA 4DZ5A 3T40A 1FWWA 5D9MA 1H4PA 4HQVA 5D05A 4HPNA 5RUBA 4Y8FA 2DSVA 4HHLA 5I2UA 5F4XA 4JL2A 3BUVA 3H2NA 4XIMA 1FBAA 4NJHA 3W38A 3TC6A 4Q3MA 5DXXA 1JJKA 1LWHA 1Z89A 3FGCA 1TUFA 4GABA 3TMQA 4Y9MA 4N9DA 5HUOA 1DWHM 1UKPA 2Z2UA 4E2BA 4JEQA 2Y70A 5KETA 2ZKMX 1DL3A 3M5YA 3OGVA 1XI3A 2I9EA 4MOZA 1A5OC 1TWWA 4QBXA 4QCEA 4M5PA 3DXIA 5CGTA 2OOGA 1YW1A 2XIQA 3BDKA 1GT8A 3PJWA 1SW7A 4CCCA 3A3HA 3R11A 2HVNA 1PKMA 3VMPA 1VF8A 2GJRA 3NTYA 2PDPA 3MA8A 3ES7A 3CPRA 1Q4NX 5D04C 1RP9A 4CEXC 2YXXA 1E5NA 3ARRA 3NZPA 3N19B 5AHIA 4DVOA 3GU2A 3UJ2A 1DHKA 2C1GA 5DMYA 1U33A 5KEZA 2MUCA 1TKKA 3Q67A 1E0XA 1YTEA 3N6JA 4PMDA 3HPSA 3UP8A 2PE4A 1ITXA 4XKYA 4ZVJA 2OZ8A 1Z3NA 3VGEA 2QT3A 3AMDA 1VPYA 3AOFA 3T2PA 4O1AA 4UCFA 2PPGA 4H6KA 1VFTA 1P5BA 4YCOA 3EB3A 3H70A 1VPQA 1AMKA 1FCUA 1O5QA 3IGSA 3VD7A 3NPXA 3ZO9A 2E9BA 4GYFA 1XRSA 3CO4A 2HSAA 2VJXA 1VYPX 3GLCA 1X6UA 2BHUA 4JFVA 3E49A 3MI3A 5AHLA 1TV4A 1CGUA 5G2HA 2D24A 4QEHA 1WBJA 2YSWA 1JQVA 3LRMA 4K1GA 1IGWA 2INFA 5LIYX 3MWAA 4UTTC 2E5BA 4F40A 3GK0A 3TWBA 1EGVA 4XSMA 4UFLA 5TBOA 1MW0A 5KZEA 1SZGA 2QEZA 5A6MA 4EPKA 3BURA 4KEUA 3PBGA 3CHVA 3NO5A 3GB6A 4ZO7A 4DB7A 3SRKA 2WNNA 1F4AA 2XGIA 3WD3A 1EOKA 1G01A 1JZ3A 3HTWA 2QF7A 3WG6A 3SGZA 1D2KA 2PTZA 4LS2A 1DXIA 5CPMA 3CMGA 1JI1A 2PGFA 1FY6A 2QCCA 3EA3A 3IVUA 3DZ1A 3VKBA 4XVDA 4NNCA 2PD5A 1JVNA 5DBUA 5GNZA 1X8CA 4YTUA 5AYZA 2Y5JA 1QMLA 4C6FA 1FDYA 1AH4A 3E0VA 4MJ4A 3SRHA 2FHFA 1DE5A 4WSKA 2A3BA 3S2LA 4AVOA 4YS1A 1MEHA 1ISWA 2QDGA 3AC0A 2C14A 5JBEA 1UKSA 2XFYA 2CKRA 5ECVA 3WUGA 1ZNNA 3TR9A 4Z2IA 3VC6A 4DI9A 2QXWA 4FLQA 4IFKB 1E6RA 1JFHA 4GUIA 1NWTA 4ZTXA 3OBAA 4C6KA 3LOTA 4M51A 2VM8A 1J12A 3OVPA 1XBYA 4QJ3B 1EXPA 3ID7A 4GVIA 4MLJA 1K9TA 2I57A 1VPXA 4UR8A 2PDMA 1EPXA 3BW4A 4LCQA 4IMAA 2HCVA 3A64A 3RUBL 2WMGA 4RPPA 2NSOA 2QVNA 4D6GA 1Y0EA 4S1FA 4V2XA 4UQDA 4DJFC 2BVWA 3WH5A 1B1YA 2CLHA 2F9RA 3FEQA 3UG8A 1E55A 4G1NA 4MLRA 3W7IA 1HKWA 2W67A 3CHFA 2XWDA 1V3KA 4IQEA 3MKCA 3L2LA 6A3HA 2EXOA 2DT0A 1WQ5A 4O1EA 3H2EA 4PE8A 5DCBA 3B0UX 3GIYA 1NH6A 4J7RA 4PFMA 3DBPA 2EG7A 5IM51 3TU9A 1UH4A 3OO2A 1TRDA 4KEMA 4LUTB 1XFBA 1IWBA 4W84A 3RHGA 1ZJAA 4ZE5A 3LERA 3DN5A 4BQ5A 1FWIC 1YYAA 2WYSA 4ATLA 2FVKA 1PHWA 1CNVA 1UWAA 4FX7A 1C29A 1VCVA 3FIGA 2YZ5A 4XSLA 4L80A 5DO8A 1CX9A 4O50A 3MUCA 4PB5A 3C52A 3C4UA 4FPSA 1G94A 4S2CA 5I78A 4ZO6A 1TTQA 5HANA 2J25A 3W2LA 4FNRA 4NXKA 1MW1A 3M43A 1VHNA 4GI6A 2EO7A 4HBKA 4DO6A 3FDKA 3R2GA 4HHMA 3RMEA 1LCOA 1V4YA 1GZJA 2DSZA 3RX4A 2FHCA 1FWEC 4LRSA 4URIA 1TE1A 1SUXA 3LNMA 1JYWA 3RJXA 2VURA 4KCVA 3F4DA 4JXCA 2OQLA 4UTFA 1N55A 3HJZA 1D9EA 4AD2A 2BG5A 3EKLA 3B0XA 2OGJA 1QCWA 3SADA 3UEQA 1LRNA 1SJDA 2DSWA 4IQDA 3CB8A 3XISA 6PTDA 2C3ZA 4WX2A 1PCKA 4YYFA 4C90A 2VR2A 3MBFA 2ZRUA 4LYPA 4US5D 1E6NA 1VRXA 1W5NA 2R24A 4UFKA 4ZE4A 4WGHA 4FXJA 1KXQA 2C6QA 1OJXA 4PUDA 4DBUA 3MMTA 3MKKA 4E6MA 3ZVHB 4ADSA 5C9XA 1OGGA 2GGJA 1EJ7L 3C2OA 1RY8A 1SR9A 2VEKA 3GXIA 1S5WA 2OOFA 1UZ1A 3VIOA 3OW1A 1G5AA 3A9BA 1VCGA 4ERIA 4GXWA 3G1YA 2IS7A 3LM3A 1S3HA 4I7WA 5ECUA 4BY3A 4PL2A 2ZE0A 1UB3A 1F3WA 2PTXA 3ZWSA 2DZVA 2HVMA 1P0NA 2CLOA 3DFTA 4IFRA 2QV4A 2VHLA 3C56A 2PDIA 2XSBA 1TV5A 3P7YA 3EPOA 4PEEA 1GORA 3HMJG 3HPZA 3K1GA 1PAMA 4MWAD 3TXZA 3LA4A 1MXGA 3AAMA 1Q2SA 4FLRA 3LMYA 1Z42A 5BMWA 2AL2B 2JE8A 3UWEA 3TFCA 4UNIA 5T9BG 4NRRA 3N3TA 4MKSA 4LVAA 1KQZA 3VDHA 1NDVA 2A3AA 2G0WA 3R10A 2KX9A 1V0MA 1JXJA 4WCJA 3P6LA 1VD6A 1ZY9A 1L6GA 4LOCA 3AIVA 3R8GA 1B9ZA 4W5UA 1AD4A 2ADAA 2GGEA 1NARA 4I5UA 4EF9A 4NHVA 1IT8A 5EBAA 3LYEA 4WSHA 3MYPA 3CGTA 3G22A 2WPGA 2BX7A 2EPKX 4OJYA 5CZTA 3SDOA 3S0CA 3KOYA 4NYYA 3BLFA 4MAZA 4N7QA 1TPFA 2NV9A 2NX1A 4H7VA 2IPWA 2GDQA 2X7VA 1XRFA 2V5LA 1EO5A 4U4MA 1S2WA 1XCWA 4P7OA 1EP3A 4V33A 2PTYA 8RUCA 4RE4A 5GNXA 1KGUA 3UU0A 2XIIA 1WV2A 4AVNA 5D2YA 2VWSA 3WEZA 5AHNA 1UIPA 3VD4A 2V81A 1VJZA 2Q3OA 4LGXA 1V79A 4YVVA 3AS0A 4O53A 2FZBA 2CC0A 2QCNA 1PYFA 3EXSA 2ATMA 1C3FA 1R46A 2PWDA 4H2HA 4FS9A 4Q4RA 3KW3A 4MM1A 5AYYA 1GZGA 4QGCA 2PBGA 3RJYA 4ZQPA 1GOOA 4Q8OA 5JMUA 5U4NA 1OFBA 3RLHA 4Y8EA 3ARZA 2R94A 3BL3A 4PMNA 1C91A 1SJCA 3CZLA 3L4WA 3XIMA 5F2GA 3MP5A 4KEZA 4XAFA 2EPOA 3T42A 5SWUA 1Q7MA 2JEPA 4QG9A 3FSTA 4IFOA 3YPIA 3L68A 3JVAA 4IPJA 4ML4A 1K7FA 4EWJA 4IIGA 3TONA 4LPCA 3BCJA 3WLPA 2POZA 2VEGA 4NI3A 2V67A 3PBVA 2F2HA 2H8XA 2QW5A 4OU1A 2RGMA 2VDIA 4KFPA 3V4BA 3WF3A 1DVJA 3UBPC 3NQEA 3HGSA 2CFFA 1W2VA 3CYVA 3H2FA 1DJHA 3NL6A 4HTYA 4ZFCA 4GPNA 1A5KC 2XUCA 1YDOA 3W86A 4NX5A 2PI6A 3B0VC 3VOGA 4EAMA 1DJXA 4M0XA 4K8EA 5BU9A 1ML1A 5LKYA 3ZOAA 4TMCA 2FQIA 2PDYA 4O18A 2TYSA 3FAXA 2VFIA 3WF1A 1TO3A 1XLEA 2NUXA 4PEKA 4ZXLA 2V2HA 3VDGA 1X1OA 1QI0A 4EX4A 1EF3A 5EB8A 3W74A 1BTCA 4BI6A 1GKPA 3ZT7A 5DLCA 1ZENA 4LEQA 3N6QA 4ACZB 4HB7A 3GH4A 4GNJA 3NYZA 2AAMA 1OSEA 3UZXA 4NAFA 3AYTA 3S8HA 3AIUA 2J13A 1WZAA 1UWQA 2GSEA 3BSGA 3LM7A 4AY7A 4UR9A 2V3DA 5K2ZA 1E70M 1DEDA 4B90A 1IE7C 1NFBA 5AY7A 4ZXOA 1F6KA 3VILA 4Z1CA 4BJHA 1AW5A 5BRQA 3WLRA 2WSKA 5M5DA 3ARVA 2HXTA 3IK4A 1JIBA 3CQJA 3SQLA 3VM5A 3MU7A 4ONVA 3LY0A 2VEIA 2WLYA 3FGCB 3KVJA 4XO6A 4RZ4A 3BK0A 4BF9A 3UJRA 4A8LA 3VKJA 1EL3A 1FH7A 1OX5A 3KTXA 5CZSA 4JX5A 1JPMA 1ZUAX 4O52A 1UR1A 3W01A 5D03A 3GD6A 1SZEA 1Q7QA 3RLVA 1BF2A 3G1HA 1GVFA 3BPWA 4XISA 3EWBX 1BYDA 1TV2A 2OWWA 1KWGA 1NDYA 1V51A 1TVLA 3CIVA 1QDSA 4UWMA 1SYTA 2FHBA 4RDWA 1XM3A 3O0KA 4UOQA 1IEXA 4DNMA 1J4EA 4K8HA 4DHGA 3N2CA 3IJDA 2HDJA 3PBUA 4R33A 2XVGA 4F79A 2ZA1A 3HU7A 3KVKA 3HIJA 3NQ7A 3L0NA 5CXPA 2AQWA 3CO8A 2JKEA 4AY1A 3GWQA 1T99A 3IJ6A 4DELA 4DF2A 1H1NA 4IT1A 3NVTA 2WC3A 1VGAA 3B9AA 1SZNA 1C90A 2QJGA 4JTKA 4EF8A 1XGZA 2GGIA 1O1ZA 3G0UA 2OX1A 3KBMA 2BVYA 1E9LA 4DO4A 3TSDA 3PWAA 5EMYA 4L65A 3B40A 4AZ5A 3P67A 3W83A 1QBAA 2DH2A 1OWQA 3CU2A 1V02A 2VTFA 4NJKA 3W1MA 3H53A 5A2CA 1POJA 2PLCA 2OPJA 3A4AA 1QXLA 1MEIA 3NQFA 5CZKA 1R86A 3F2BA 3BMVA 5DT5A 1HJWA 1TJPA 4HVXA 4RPQA 5CLTA 1EH9A 1W9DM 4XAGA 1VJSA 4WKAA 1T40A 2J7HA 1OGSA 4KQNA 4UTTA 2OEKA 1VEMA 3M6DA 3E0LA 1TPUA 2DZTA 2TODA 2D0FA 4JIQA 2ZZ4A 3UZYA 3IARA 1SQ7A 2J6VA 4H9UA 4AY8A 2HRWA 4UTKA 4OVXA 2EF9A 5A95A 3BGJA 1YRRA 1J0YA 3N14A 4JQ3A 5DELA 5CGMA 2ZTJA 1Z7AA 1H7RA 1XH1A 1JCJA 1VKFA 3BQ6A 2XIJA 1US0A 1SU5A 1S2AA 3HB9A 3OLDA 1W2PA 3DOPA 4A35A 2NVCA 4DPPA 3QF0A 2E8YA 2FTYA 4C6DA 2CLPA 4LV9A 1N82A 2JKPA 1UWRA 3EX2A 2DZBA 4MF4A 4EVZA 3KTCA 4WUIA 3BJTA 4KH2A 3L4TA 2YCLA 4UFJA 2UZ9A 3ITCA 1AUSL 2XPKA 2BOEX 3AMLA 2OO0A 2VOTA 1S5VA 4P8UA 2A7NA 1X96A 2WWCA 3B8IA 2QNEA 3SSZA 3PNUA 3DFQA 3WUEA 1PUDA 4Y9PA 6TAAA 1VBHA 1UUQA 1V8EA 2F61A 5A2BA 1GG1A 1JCXA 1E0WA 1GJPA 2WNZA 3QPYA 1TR9A 2GK1A 4HSHA 4P2VA 2CZDA 2X40A 4QAIA 3W1UA 4WR3A 4P5UA 1CENA 3IIOA 1GQIA 4QHRA 1D8CA 4ZOBA 1FWBC 3VIMA 2YGYA 1GJWA 3M0KA 2PCQA 1TQJA 4XBJA 3W72A 4G5DA 4C6JA 3KBWA 3VNKA 3MCNA 4Q4MA 3E9AA 4BS0A 4MYXA 4F0MA 5IXEA 1QNOA 1RLDA 3P93A 1ICSA 1YXYA 3NEHA 1ZGDA 1Q6QA 2HK1A 1QO2A 2ISDA 1AA1B 1EJVC 3ZT5A 1UA7A 1Q6GA 3DYPA 2PC4A 1I45A 3B8UA 1RBLA 1VFFA 3H7VA 3W26A 4F3HA 3CK5A 3WBAA 4S3KA 4B5WA 3UW6A 1TA3B 2Y4SA 1R2RA 1S1RA 5EBUA 2E3ZA 3UZZA 1K8CA 2FPVA 4B4HA 1S39A 4JKKA 3GHSA 2IXVA 1SSDA 2PDHA 1E3ZA 3QC3A 1S2VA 1OF6A 1V0NA 3MUXA 5TQLA 3KOWA 4DBDA 1S5TA 1NDWA 2FB3A 1LYXA 4K7VA 3V5FA 2CLKA 1DWFM 2WVSA 3DG3A 2NVAA 2VCAA 1GVRA 3S46A 3UY7A 3SCWA 3TN5A 4HOZA 5MF5A 4Q4SA 3L4XA 2CZEA 4YVPA 2KZHA 3C0JA 2BSLA 1XYFA 3FKKA 3HGRA 1NELA 3EOUA 3IK2A 3W27A 4RE0A 1U5VA 5BOOA 5EKYA 3B8VA 1WAWA 1K6AA 4MNMA 3CTTA 1EJUC 2UWFA 1YPIA 2YYTA 4IGNA 1MEWA 2RFGA 1ISVA 5CPOA 2PEVA 5A2AA 1RR2A 4H9XA 2NQLA 2D3NA 3W1XA 1V08A 2ABAA 3M7SA 1EDGA 1IEWA 5IBXC 1VBGA 1QNPA 5DCDA 2HQAA 4NL1A 3BAKA 3VGHA 3GH7A 1CB7B 3VKCA 1QW8A 2ANUA 4YWSA 2IMRA 2V2CA 2VZSA 4LUSA 4JTLA 3PZOA 3CT2A 5ABGA 1DWJM 2Y7GA 4QLLA 2OT0A 4JIIX 1E6PA 1ZHAA 5CPLA 3L2MA 2NX9A 2GUYA 4BEQA 4AZBA 1I60A 1DQXA 4TVUA 3TWAA 1DP0A 2YPIA 1W6TA 1NVMA 2QCDB 3GDRA 3UG5A 4YL2A 4S3AA 5K9XA 2PZNA 1ELSA 1YBQB 2OFJA 1JNDA 1OABA 3RR1A 2OELA 1A50A 1JZ8A 3SURA 2CYGA 1LQ2A 3WDRA 3D47A 2PS2A 2H9AB 1KCKA 4LY8A 1RXOB 4H9ZA 2NXGA 3EXTA 4WKHA 3RU8X 1B3OA 3GVRA 4JTEA 2J62A 4IP5A 5I00A 2ACRA 2FZ9A 3V18A 3ZLFA 3VNDA 1VH7A 4JHZA 1JYXA 2J74A 2WQDA 4GUJA 3GHTA 3WL1A 1EX1A 2PLJA 5HMSA 2OSWA 2EG6A 1BRLB 1WKEA 3B8TA 4GYJA 4CNNA 4L1XA 2XM1A 5K3VA 1H7NA 3EPNA 2YDSA 5D37A 4ZMGA 4B4FA 2ABBA 1OIMA 3AHZA 3Q37A 3QH2A 4LYQA 1RVGA 4XBSA 1EGMA 5HXMA 2J27A 1OFDA 4I8YA 1XW8A 2CEQA 3MMDA 3ZJ6A 2A85A 1KKRA 1VFUA 4JBRA 3S9IA 2EHHA 2ACQA 3NO3A 5FESA 1PE1A 1TVNA 3C2YA 2ONEA 3LNPA 5G4EA 3VX0A 3OHIA 5HQEA 3I6TA 2Y8UA 3LB0A 4MKNA 6ENLA 3WF4A 5A3HA 3FSUA 4MZ8A 3F1QA 5BXRA 2E1DA 1UWTA 3LENA 4O16A 2WXDM 2GPTA 2G3MA 4YMZA 2QCLA 1UJQA 3IIXA 3MHGA 4HK6A 3M47A 3T81A 3PPHA 4D2JA 1LDCA 4XQ6A 1OZQA 2DJXA 4CN4A 4ROPA 1QW7A 4NAEB 4R27A 5A8MA 2TMDA 3DKLA 6REQA 1B30A 5CG7A 3W7PA 2BS9A 1JDCA 2J6XA 4D6CA 1E0UA 1JNEA 2PDKA 2DP3A 3VFLA 2PDUA 1JCMP 3A9IA 4IMDA 1GEHA 2AKMA 4ZA0A 4H83A 2XFFA 1E51A 3R5EA 3T07A 4WD0A 3GTIA 3R94A 2PGEA 5EPDA 3MHUA 3BAXA 3LRLA 1AJZA 1KXVA 5HR7A 3AUJA 1VLIA 2V82A 3LCLA 1XLJA 2Z6JA 5ABHA 1H7PA 3AUOA 2YOCA 1L8NA 4AW7A 1ECQA 3QBUA 2PA6A 1FHLA 2BXZA 3LXBA 1WDPA 3SUVA 3W76A 2VUYA 4C1NB 3SQSA 1JFXA 2PDLA 1Z6KA 2JGYA 5A6JA 1VR6A 3S9ZA 3U8GA 2HBXA 1JCYA 4TV5A 3T4WA 1QAPA 3LPFA 2Z1SA 1FXQA 4IJRA 4JTDA 2C18A 1T8QA 4X61A 3GHRA 3AMGA 2O7QA 1JPKA 3G3MA 1E9IA 1SFLA 4OBSA 4AC7C 2I17A 1BD0A 1KD0A 1KGWA 2I14A 1Q8JA 4DZAA 3WQOA 5KINA 3EWUA 3UY8A 4A8NA 1KFBA 4XZIA 4FXFA 1QR7A 3BLLA 5C2XA 1UKTA 3K8LA 2VELA 1XIDA 2HTMA 2ZWZA 1SO3A 4GI4A 2HWGA 2Q02A 3W2JA 4O8AA 4JEJA 1MYRA 4DF1A 1UW9A 1MFUA 2DW6A 4UR7A 4D6IA 1FDJA 4WY0B 2WAGA 4PMOA 2ICSA 3T78A 3E96A 1UA3A 1NIUA 5EMKA 2VR5A 4IH3A 3RX3A 3QV6A 4Q33A 3TTEA 4CQDA 5I3IA 4O17A 1W54A 3UNDA 1TTIA 4ICMA 3U4FA 5H8PA 1WB0A 3S42A 2YKKA 2OO6A 4FNSA 2KAUC 2OCZA 3CB3A 2FH6A 1R7OA 3KL5A 1B3WA 3WD1A 2XJ7A 3ZIZA 3GKFA 4O19A 3KL0A 4Y9OA 3S83A 4JYDA 1OC5A 4HMEA 1Y7VA 2QUNA 1BYCA 3P84A 2XN1A 4GK8A 3QSRA 3CV7A 3ABXA 4Q8NA 4GVGA 5MKGA 4QRNA 5GNYA 4PUKA 4NIRA 5D9PA 4OWGA 1EX5A 3PZ9A 1KBBA 3IPWA 3OZYA 4AAJA 2WHKA 4GNKB 1M03A 3G8EA 2PGRA 4MNJA 3C0LA 3LBCA 4JFTA 1VEOA 4WDXA 4OOZA 2OWXA 2P53A 3VIFA 2FYMA 1OYBA 4IF2A 4OFCA 4M7SA 1K9DA 1POKA 1G1YA 2I5IA 3PJTA 3VKAA 4GFIA 3SW6A 3FDGA 1NM9A 3UZ5A 1PV8A 4FR6A 3BOFA 3MS8A 5FA5A 5LSMA 1M7XA 3OLGA 1OYAA 1ISZA 5G5IA 1UR3M 4O1CA 1RK6A 4GQGA 4OUEA 3AXHA 1LF1A 5C71A 1IWAA 1DJNA 1ODZA 3WBEA 1E6QM 2XN2A 2ZA3A 1HGWA 3OVQA 4JQ1A 2QJJA 5XIMA 3I65A 1H60A 4C7FA 1AJ0A 3ZSTA 3SO7A 3GQYA 3UCCA 1AZ1A 1EJTC 1HL2A 4W7VA 2EQDA 2W9MA 3NAVA 2ZQ0A 4CQ9A 4Q8VA 4DZIA 3T8LA 3SN1A 3H7RA 3V3WA 4JX4A 3FN9A 4W88A 1HJXA 4LUYA 3K30A 3WQCA 5I3GA 1EF2A 3HPXA 4YHEA 3WIJA 3S2MA 1KWKA 4JL1A 1CTNA 5JU6A 4I9TA 1CGTA 1I6NA 1E56A 5CPQA 1GVEA 4AIUA 2WM1A 4NILA 4I3GA 2W91A 5CC6A 3GR7A 5AN7A 4KRUA 1GUVA 1F8MA 3WX7A 5DMLA 1YE6A 3B4YA 3KRBA 4JNYA 3N25A 1UH3A 3WQDA 4BHYA 3IV3A 3FYOA 2DT1A 1UR4A 1W5PA 1ZBWA 2WZHA 2QMKA 1UASA 2ZZ3A 3WY1A 1HNYA 4FNTA 4QAWA 5A69A 1RA5A 4BEUA 3DU0A 1LL7A 3H4GA 8A3HA 2WV8A 3KZPA 1US2A 1W1ZA 2GOKA 3NOYA 4PRWA 1TPC1 5E6YA 3U57A 4DJFA 3CC1A 3H6OA 5FF7A 3AJXA 2CZFA 5I3DA 1SW3A 3E2VA 3ZR6A 2RH9A 4QSHA 1SMDA 3KHJA 4H8UA 1B90A 4HPJA 1WA3A 2IQTA 3T7VA 2VC7A 1ZAHA 3EXRA 3QSTA 3TZFA 4W87A 4GLEA 5FJOA 3W73A 3PNZA 4B9YA 1B3YA 1OFAA 3SFKA 1O4UA 1N8WA 3W28A 1VEPA 4D1JA 4QEEA 1UG6A 4GXMA 2G3FA 4UMBA 3GNDA 4AYGA 2NV1A 4XV0A 3FK4A 4B5SA 1EYWA 4Q8QA 3VK5A 4FF5A 1QK0A 4L6OA 3VC5A 3LTYA 4M82A 4WGXA 1S2UA 1OYCA 3EOSA 4M6QA 2DH3A 1UROA 4REQB 3O15A 4QXIA 2C1HA 1RQHA 1R3YA 3CWNA 4AVFA 5LHFA 4TX8A 4GKLA 5A8GA 3MZ2A 5CH9A 3K4WA 5B7YA 1PIFA 3T55A 4RJEA 1QATA 2ZUMA 5AVHA 3SZ8A 1SO5A 4QR6A 1BEUA 1AL8A 3D46A 5M1TA 4DUXA 4FR1A 5JXQA 2E6YA 3URBA 3PR2A 4KIRA 2ZBTA 4UOJA 1L6YA 3UA4A 5EY5A 3AJ7A 3H2MA 2FB2A 4QE4A 2HS8A 2A7RA 3AWNA 1JL8A 4UXDA 4AZCA 4GVHA 2A1YA 2QCHA 3IAQA 4US6A 1XYAA 1FQ0A 4MB1A 1KM3A 3NDZA 3IS4A 1ZBKA 4IUGA 4NNAA 1SO4A 2VMFA 4LXFA 1G69A 5FEPA 2GQ9A 3P0WA 2VVNA 1H1YA 4WY0A 2OEMA 3TAKA 1R3VA 2EBNA 3WDIA 4GZIA 3KS5A 3VNZA 1KTCA 1F3EA 4ADTA 4HSNA 2DSUA 1Y8BA 1C8XA 3IJLA 4G6CA 4L61A 3T9PA 1ONXA 3J7HA 3P0XA 2BDQA 1A5AA 3N73A 2DQWA 3IRSA 1FWFC 4W5ZA 4P61A 4EPBC 1TMHA 2QGYA 4EXQA 1AVAA 3VDBA 2OYKA 4W4QA 5AVNA 3K1DA 4DXKA 3M9YA 3IUHA 1H61A 3A3XA 2GUUA 5BYWA 1NWRA 1H51A 1OEPA 1VENA 4HYRA 3VZYA 3DHUA 3PVFA 5C54A 1RCOB 2J24A 1A5UA 4EAYA 3DCPA 3L5MA 3ITLA 1C9DA 3W07A 3QKEA 3AQUA 3HN3A 1JYNA 2HBVA 5CSYA 3TXVA 4O0QA 3LZ5A 2AL1A 1OC7A 4GJJA 4QQ3A 4DN1A 3GFZA 4J4KA 4YTTA 4JIEA 3SR7A 4D71A 3W02A 4PMXA 1X1NA 3CV1A 1MI3A 3NQ2A 1EJWC 1PIGA 2R1LA 1XYZA 1BWLA 1BKHA 4NZCA 3VUSA 4UTHA 1V6WA 4H19A 3Q94A 2ZRWA 4W93A 4BF5A 2E5CA 1LL6A 3CUZA 4A29A 5AZ0A 4W86A 3M0LA 3DG7A 2EPLX 3M41A 3KVMA 1UQZA 5K9CA 4X2RA 1MXDA 3LTPA 4WK9A 2XGZA 3CAKA 1R3WA 2VFFA 3IEBA 1VFHA 1R9ZA 1E1CA 5GJPA 4E3VA 3W7LA 5E93A 3CIXA 1DYSA 3THQA 3DC0A 3L4YA 1DWGM 1S1PA 2VX6A 1W1IE 4O57A 3CUIA 2QULA 1CXHA 3ZJ8A 5IHSA 1AZ2A 4D72A 2BVDA 3M5XA 1EHNA 2ALRA 3PS7A 4HK5A 2YZRA 4HA0A 4PCTA 3DFOA 3N2XA 1CT5A 4JKLA 4KRTA 3VNIA 2ZVIA 1MQPA 4FIQA 3CEPA 3PJXA 4GE8A 1KM6A 2EPNA 4IPPA 4S3JA 1V6YA 4E2VA 1DXFA 3PBYA 2E67A 4MB5A 1RJRA 1M01A 4NRSA 3OGSA 3SGGA 1KLZA 1K4GA 7A3HA 4PUUA 4FLOA 1YLVA 3NPWA 4D6FA 1QBBA 1F7BA 2I16A 3IUIA 3PZGA 5CCZA 3WNOA 4JHOA 3WF2A 1ONWA 3G1DA 2HJPA 3LI0A 3CAWA 1JCTA 3RN6A 3N17A 1FHDA 2J79A 4NVTA 1K70A 3NQDA 2A21A 2I5GA 4WXZA 3MCMA 4B15A 2BOGX 3W2KA 1QPKA 1VZWA 3GTNA 3QZ6A 2XINA 3AU2A 1FWHC 1WNOA 4H9MA 2BASA 4CD6A 1TZZA 3PTKA 3NXFA 3U5UA 3RM9A 1AJ2A 2P8BA 2C7FA 1W1B1 3EEZA 2G95A 5A6KA 3MI2A 4DYJA 4Z2JA 1BTMA 2VEPA 1YBQA 1MQRA 3GXFA 4K37A 1UJPA 3OP2A 4O11A 2XTKA 1WYIA 5HNTA 4WVXA 5LGXA 1RD5A 2CITA 2BGQA 5T26A 4NG3A 3GW3A 4YTQA 1EQPA 2Y8VA 3GO2A 1W3JA 2YR1A 4H01A 3TA6A 2GWGA