3NQZA

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
175
Chain Sequence
ANKKYLNQQPTINNMVQSNSVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
total genus 41
structure length 175
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA01
1AV4A 2OOVC 5IW9A 4EXRA 3X3YA 3PGBA 2CFKA 3X3XA 4BTWA 4KFFA 3KN4A 3WA3A 3AMOA 1IQXA 1QAKA 3AMOB 1US1A 3X42A 1QAFA 3HIGA 2C11A 2ZL8A 1JRQA 2OQEC 1PU4A 2CFGA 3HIIA 3MPHA 1SPUA 2CWUA 1LVNA 1UI7A 2OOVA 1WMOA 1QALA 3NBBA 1IQYA 3X40A 3HI7A 3SXXA 2BT3A 2WO0A 1IVWA 2WOFA 2CWVA 1IU7A 1UI8A 1W6GA 4EV2A 2PNCA 1EKMA 1WMPA 3X41A 3ALAA 2GU3A 3KIIA 2E2TA 1AVLA 1IVVA 1AVKA 1SIIA 2W0QA 3WA2X 2CFWA 2Y74A 2WGQA 1W2ZA 2E2VA 1KSIA 2CFLA 1DYUA 1SIHA 4BTYA 1IVUA 1WMNA 3NBJA 2OQEA 1D6UA 4KFDA 1OACA 2CG0A 1A2VA 2E2UA 2Y73A 1N9EA 1W6CA 3LOYA 3NQZA 1RJOA 2C10A 2WOHA 1D6YA 4BTXA 2D1WA 1D6ZA 2IA7A 3X3ZA 2CG1A 3N9HA 1IVXA 1W5ZA 3K5TA 1TU5A 2CWTA 3T0UA 1W4NA 4KFEA 4EV5A 3NQYA 2CFDA 4K90B 2K0MA 2YX9A 1RKYA 3SX1A 1W7CA
chains in the Genus database with same CATH superfamily
4WHAA 1AV4A 1BNIA 2P38A 3G6E3 1BUJA 1UCKA 8RNTA 3X3YA 1RHLA 2AADA 3PGBA 4HJLB 2FGTA 2W9QA 3LTCA 1BNEA 1Q824 4NREA 1G02A 3U97A 1FUWA 3DGMA 4CDLA 4Q53A 4N6OB 1JKGB 1TRPA 4WWUC 1B2MA 4WYKB 3KFQC 1BVIA 3UL6A 1B2UA 2JQ5A 3H3HA 1EUIC 3X42A 1DMMA 1OHOA 1VQ93 3HIGA 2HMOB 1IK3A 1RGGA 2R4IA 4HM5B 2UGIA 2O9UX 4LZIA 2PZVA 5EEOA 1B21A 1SARA 2IMJA 1T5YA 4HM4B 4L8PA 1NB5I 1RSNA 3A76A 5IG5A 2HOHA 1VQN3 2YFIB 1SPUA 3CC73 1UCJA 3EX9A 2B1XB 2CWUA 3O8YA 1LVNA 1WMOA 3Q3FA 2MC8A 4MJDA 2P09A 5FGOA 3F14A 5DREA 3BNCA 3FG4A 1STDA 1A90A 3BNBA 5M18A 2FXTA 2HMMB 2H0IA 1LNIA 3CNMA 5A0OB 4HM1B 3SOYA 2BMOB 2CWVA 4R9KA 3JVCA 1ASKA 1IU7A 1UI8A 3I0YA 3V98A 1BSAA 2XEPA 1EKMA 1GY7A 4EV2A 7STDA 3MG1A 1Q7Y4 1GSPA 8CHOA 4R9LA 1OGXA 2INXA 2BNGA 1FW7A 1BGSA 3HK4A 3ZG0A 1FGMA 1MOLA 1G96A 3B4OA 1CQSA 1YI23 1FUTA 3BNDA 1V58A 2Y74A 1T2HA 2RGQA 4WFOA 1BNGA 1W2ZA 3VSYA 1I8VA 4H3UA 1FGTA 5D82A 2HMKB 5AYSC 3MG3A 3GZRA 1RN4A 1NNVA 1OHSA 3NBJA 1CYUA 1YIJ3 1TRQA 3BIRA 5DRVA 2KF4A 3FG1A 3CME3 1O7NB 1IQ8A 1RGHA 2LYXA 1B2ZA 5KP4A 1ZGXA 1BOXA 3NUVA 3I553 3DXOA 5EVHA 2RFRA 1FYSA 2WOHA 4BL2A 5BVBA 1OPYA 5RNTA 1D6YA 5IEPA 2D1WA 1D6ZA 1OUNA 3IMAB 3Q2PA 1ROAA 2CH9A 4O2HA 3X3ZA 1MWUA 1MWSA 3LXUX 3DGYA 2W56A 4ILFA 1TU5A 1UGHI 5D81A 1VQM3 2XGLA 1W4NA 3CPW2 1OGZA 4EV5A 3NBRA 1A67A 3V92A 1BNRA 4LYLB 5KP3A 3GAXA 2RCDA 3H51A 5I97A 1JJ22 1JBSA 1KQS2 1WQLB 4HZBB 4EC6A 5IG0A 3VGNA 1RKYA 2L1SA 1LRAA 2CC3A 4QWTA 3CCS3 2IUJA 4CCVA 2LQVA 1HKXA 2YFLB 3FLJA 2OOVC 5AIFA 3RGRA 4H61A 1M904 1RGEA 1TFKA 1JB5A 2C4BA 3DGLA 1T2IA 4O8SA 3X3XA 1O7PB 1QJGA 3MWZA 5JBSA 1BSDA 4N6LA 3SVAA 1QVF2 2XF3A 1C7HA 3KN4A 1RGLA 1W2B2 1C54A 1JN5A 2W6JH 1BRSA 3QK9A 1MWTA 1EEJA 1I3IA 3TDGA 1M1K4 3NM7A 3PZWA 5M19A 3BU4A 7RNTA 3Q90A 1N5PA 3MSOA 1OF5A 1PYLA 1US1A 3EQQB 4KZ1A 1FGRA 2BIRA 5G1KA 1QAFA 1NB3I 1A2KA 6STDA 1WTHA 2C11A 4X2HA 2ZL8A 3WHOA 2Z6BA 4NPBA 5IERA 3OW22 1JRQA 1JV2B 2GEYA 4FCJA 4GSPA 4IPBA 2XH9A 2XSHB 3HIIA 2GSPA 1BANA 1N5HA 1GOVA 4AKZA 3SYUA 3SLUA 4EYCA 1IV9A 1L5GB 3CCQ3 2W04A 3UNLA 2OCTA 5CK6A 4OUQA 1UI7A 5ELJA 3KE7A 1UUVB 1YGWA 1TJDA 1I70A 1HZ1A 1RRHA 3X40A 3N54B 3HI7A 1ULIB 2Z7AA 4NHFA 1Q42A 1KC84 3EB8A 3OWUA 4KVHA 1VQ63 2WO0A 2IY2A 3M8CA 1OF5B 2GBWB 1IVWA 1RN1A 3FG3A 1FA3A 3PCSA 3PCRA 4FMAA 1V57A 3X41A 3FF2A 1BIRA 1W02A 3LYGA 3MG2A 2GU3A 2F5WA 1OCVA 1EQKA 3KIIA 1EG9B 1YNVX 4HM8B 3CD63 1J2BA 1M1XB 2CHCA 1I0VA 3NV0A 3WOEB 1IVVA 3EE1A 5IEOA 1Q814 1E3VA 1QMAA 2CFWA 1RNTA 3JUQA 4J5KA 1RGAA 5JPUA 3CCE3 2R41A 3PXMA 3CCU3 3KSED 4N6UA 4LEHA 4FR9A 5AIHA 1DYUA 5EQLA 1FZUA 1BNFA 4MMZB 2B24B 3VF1A 4FMBA 1YJ93 1RGKA 1LQGC 3G8ZA 3G4S3 5KP1A 2W03A 1A2VA 2E2UA 1VQ83 1JB4A 1N9EA 3LT9A 3D79A 1GMQA 1FGQA 1NU3A 4CJNA 1OH0A 1ZO2A 3ER7A 2RNTA 2UUGC 3K63A 4BIRA 1CEWI 3SOAA 1E3RA 1RJOA 1WNHA 1IT7A 2K54A 3S5CA 4BTXA 1K28A 1AR0A 2BHMA 2J8XB 1DMQA 1W00A 1NWWA 5G2GA 1IVXA 3FZWA 1N9JA 1YVSA 2KAAA 1ROVA 1CYVA 2ZA4A 1RCKA 1YIT3 2CX0A 3K9MC 2SBLA 5G1LA 3I563 2QA43 3DH2A 1RMSA 4KFEA 2I9WA 1HYFA 2Z76A 4RNTA 3CCM3 1DVCA 4HKVB 2P0XA 1B20A 1KWIA 2H0GA 2SARA 2P05A 2YFJB 2CFDA 3F40A 4MEIA 1GY5A 1ISKA 1IYYA 3GZXB 3LH4A 1Q40A 3HOHA 3D9RA 3AGOA 2CX1A 2KF5A 2F5MA 1W7CA 4ORLA 1I0XA 5JPPA 1JBTA 1VZZA 3GZBA 4EXRA 2BO9B 1O7MB 1AY7A 2IUKA 5AIIA 4XB5A 1LOYA 2CW9A 1MGRA 1UW1A 5GSPA 4N6NB 4TX4A 1YJN3 2BMQB 4KFFA 1X1YA 1JN5B 1O7WB 3A5EA 3OXAA 5FW5A 3FCSB 1QVG2 2MF7A 3AMOA 5CF2A 1IQXA 1BSCA 2W56B 5IG4A 4GL6A 1LOXA 2RSXA 3AMOB 4N3VA 4HYZA 3B8LA 3ROBA 4G1MB 5AI1A 1GD4A 2GEXA 5AEWB 3RNTA 4K61A 2STDA 1GOUA 1VQP3 1DETA 1NO3A 3S27A 2H0HA 1RGCA 1I2EA 4XBXA 1ZX2A 3PYJA 1PU4A 3RDEA 3CPOA 3DGNA 1B2SA 1MGWA 1B2XA 4K1UA 1N8QA 3D5GA 1UUGB 3S29A 3U1WA 5M1AA 4PEJA 3F9SA 3EBTA 2OOVA 3J7Yd 4RNZA 2P0MA 1ULJB 1QALA 4AEQA 1LXEA 3G713 1K9M4 3EJVA 3OX9A 1IQYA 2FNQA 3EN1B 1JB2A 3JUNA 5CF1A 3L0RA 4HM2B 3NV0B 1YVBI 3NM2A 2KXGA 3LTDA 3SXXA 2QEX3 4R4KA 1PY3A 2F86B 2XRXB 2BMRB 2K3DA 4J9AA 4OK0A 3ECFA 1RDSA 3LTAA 2KF3A 1JBRA 2PNCA 1VQ43 1WMPA 1X1UA 1BRGA 3ALAA 5LC6A 3AHWA 2F4YA 3URPA 1YHQ3 1T3BA 5IF6A 1BSEA 2GBXB 2XR8B 2D42A 2Z77A 3JUOA 4XDVA 3CMA3 3N8BA 4RZMA 2WGQA 1GOYA 4FCZA 4FMCA 3KSPA 5AYRB 1GMPA 4BL3A 1MNLA 3DM8A 2O3OA 1U5OA 1Q40B 2CFLA 2ZDJA 5TGNA 3E99A 1BRKA 3Q1CA 4IIAA 5CXOA 3V99A 4BTYA 1RNBA 1IVUA 3BLZA 1BUQA 1BU4A 2OQEA 1NJI4 1D6UA 1TFOA 3IJEB 2XFTA 4L8OA 2W9PA 2QIYA 1IDPA 1G0TA 2GU1A 3CU3A 3D4AA 3MKIA 1PFPA 3NQZA 1AQZA 5LC7A 4O02B 4XBTA 1RCLA 3T8UA 2OTL3 3FH1A 9RNTA 3DMCA 3CCV3 3GSPA 1I2GA 3PS8A 4N6MA 3OWYA 2V1LA 2ML6A 3DY5A 3OWSA 1BNJA 1LOWA 5IG3A 1RTUA 1BRHA 3MHEA 1JKGA 2KF6A 2CWTA 1O7HB 1LNHA 1YJW3 1GS3A 4DKIA 1DMNA 1S5AA 4MMYB 4X2OA 1RRLA 1A2PA 2KRTA 5STDA 3WODG 1SJWA 7GSPA 1N8R4 1BRJA 1V74A 5CLKA 4GHOA 4HBRA 2HMNB 5IENA 2K0MA 2YX9A 1UUWB 1B27A 4N6TA 4HVNA 3SX1A 5HGRA 3KKGA 3ZFZA 2A15A 3LMLA 4HM7B 5IW9A 2ML5A 1TUHA 1RGFA 4HM0B 2CFKA 1RLSA 2KCDA 3HZPA 4BTWA 1F8NA 3WMDA 3FGYA 3WA3A 2F56A 1JZDA 3STDA 3D3LA 3B7CA 1K41A 2W2CA 1QAKA 2RBIA 3KZTA 1M9GA 4BU4A 1LQMB 1GY6A 3FKAA 1TIJA 4O3VA 4N6V0 1GD3A 1FGOA 3GWRA 2UX0A 1OHPA 3K0ZA 3FF0A 4JRFA 1K734 2BU4A 4FCMA 3CXC2 3KCHA 1E97A 1R4YA 3D5IA 1Q864 3WOFB 3EBYA 2HMJB 1O7GB 4J8TA 2OQEC 5ELUA 2CFGA 2F98A 2M7OA 1SQWA 4U13A 3MPHA 1VQO3 3SEDA 4LSOA 3B4PA 4EW5A 1JZOA 4GB5A 3GRDA 2Q07A 1CH0A 4I5QA 4ZM8A 5HOHA 4IT7A 1HU9A 1JNQA 2CIUA 1Y4KA 1K8A4 1IV7A 1BSBA 1UGIA 1YGEA 1VQQA 1RN7A 1VQK3 2QGUA 4K1VA 1R4CA 3NBBA 4HM3B 4I4KA 1DVDA 6GSPA 2CKFB 4STDA 3AHSA 3T8NA 4EBGA 1TP6A 3EC9A 1B3SA 3FSDA 1TTOA 3NXJA 1EA2A 2BT3A 1VQL3 2L4VA 2XGNA 1W6YA 4OVMA 1MWRA 2WOFA 3MYTA 3EF8A 2WGOA 1W01A 3RGAA 1W6GA 3GZYB 2OTJ3 4WP5A 3HX8A 3LTBA 5D83A 2JDIH 1KD14 1AVLA 2E2TA 1GMRA 3BNEA 3NX0A 5BIRA 4JF8A 5AEUB 3JUPA 1AVKA 6RNTA 3CCJ3 1SIIA 2W0QA 2XSOB 1Z1SA 3WA2X 1S723 3LT8A 2IYJA 3AGNA 3F8HA 1VQ73 4LMIA 3DZLA 3S28A 3S67A 2E2VA 3IPTA 5BXQA 1LOVA 2CK3H 1KSIA 3JUMA 3OV4A 1SIHA 2GXFA 4HOHA 2F99A 1X1XA 1U8CB 3DUKA 3EN8A 3CC23 4AKYA 3K7CA 2ZHXB 4MMXB 1WMNA 5AIGA 3WR2A 3QRDA 4KFDA 1OACA 2CG0A 2Y73A 1UCIA 4XM4A 4CPKA 4R80A 4XDWA 3UB1A 4HZ9B 1W6CA 3LOYA 1NDOB 4KT3B 1GYBA 1ZS7A 3ZG5A 3WDGB 3CCL3 4J5GA 2C10A 3EHCA 2AAEA 4WYKA 2OWPA 3UJMA 1DE3A 2IA7A 4HAAA 1IT8A 1Q9EA 1FUSA 3BB9A 2CG1A 3N9HA 3F7XA 4HM6B 1X1WA 3CNXA 1UCLA 1W5ZA 3F7SA 3K5TA 3F8XA 3DGOA 3NHXA 1I2FA 4XBYA 4RNYA 4FMDA 3T0UA 5BU4A 3LZAA 4LGQA 3CCR3 1BRIA 1UDII 3G16A 2XFSA 3NQYA 4L7KA 4R1KA 1BNSA 1STFI 1BRNL 1BAOA 2HMLB 4K90B 3CC43 4RBNA 1Q7HA 1VQ53 3G0KA 1I3FA 3UL5A
chains in the Genus database with same CATH topology
4WHAA 1AV4A 2P38A 3G6E3 3X3YA 3PGBA 4HJLB 2FGTA 2W9QA 3LTCA 1Q824 4NREA 3U97A 1FUWA 3DGMA 4CDLA 4Q53A 4N6OB 1JKGB 4WWUC 4WYKB 3KFQC 3UL6A 2JQ5A 3H3HA 3X42A 1DMMA 1OHOA 1VQ93 3HIGA 2HMOB 1IK3A 2R4IA 4HM5B 2O9UX 4LZIA 2PZVA 5EEOA 2IMJA 1T5YA 4HM4B 4L8PA 1NB5I 3A76A 5IG5A 1VQN3 2YFIB 1SPUA 3CC73 3EX9A 2B1XB 2CWUA 3O8YA 1LVNA 1WMOA 2MC8A 4MJDA 2P09A 5FGOA 3F14A 5DREA 3BNCA 3FG4A 1STDA 1A90A 3BNBA 2FXTA 2HMMB 3CNMA 5A0OB 4HM1B 3SOYA 2BMOB 2CWVA 4R9KA 3JVCA 1ASKA 1IU7A 1UI8A 3I0YA 3V98A 4EV2A 2XEPA 1EKMA 1GY7A 7STDA 3MG1A 1Q7Y4 8CHOA 4R9LA 1OGXA 2INXA 2BNGA 3HK4A 1FGMA 1MOLA 1G96A 3B4OA 1CQSA 1YI23 3BNDA 2Y74A 2RGQA 4WFOA 1W2ZA 3VSYA 4H3UA 1FGTA 5D82A 2HMKB 5AYSC 3MG3A 3GZRA 1OHSA 3NBJA 1CYUA 1YIJ3 5DRVA 3FG1A 3CME3 1O7NB 2LYXA 5KP4A 3NUVA 3I553 3DXOA 5EVHA 2RFRA 5BVBA 2WOHA 1OPYA 1D6YA 5IEPA 2D1WA 1D6ZA 1OUNA 3IMAB 3Q2PA 1ROAA 2CH9A 4O2HA 3X3ZA 3LXUX 2W56A 1TU5A 5D81A 1VQM3 2XGLA 1W4NA 3CPW2 1OGZA 4EV5A 3NBRA 1A67A 3V92A 5KP3A 3GAXA 2RCDA 3H51A 5I97A 1JJ22 1KQS2 1WQLB 4HZBB 4EC6A 5IG0A 3VGNA 1RKYA 2CC3A 4QWTA 3CCS3 2IUJA 4CCVA 2LQVA 1HKXA 2YFLB 3FLJA 2OOVC 5AIFA 3RGRA 4H61A 1M904 1TFKA 1JB5A 3DGLA 4O8SA 3X3XA 1O7PB 1QJGA 3MWZA 5JBSA 3SVAA 4N6LA 1QVF2 2XF3A 1C7HA 3KN4A 1W2B2 1JN5A 2W6JH 3QK9A 3TDGA 1M1K4 3NM7A 3PZWA 3Q90A 1N5PA 3MSOA 1OF5A 1US1A 3EQQB 4KZ1A 1FGRA 1QAFA 1NB3I 1A2KA 6STDA 1WTHA 2C11A 4X2HA 2ZL8A 2Z6BA 5IERA 3OW22 1JRQA 1JV2B 2GEYA 4FCJA 4IPBA 2XH9A 2XSHB 3HIIA 1N5HA 4AKZA 3SLUA 4EYCA 1IV9A 1L5GB 3CCQ3 2W04A 3UNLA 2OCTA 5CK6A 4OUQA 1UI7A 5ELJA 3KE7A 1UUVB 1RRHA 3X40A 3N54B 3HI7A 1ULIB 2Z7AA 4NHFA 1Q42A 1KC84 3EB8A 3OWUA 4KVHA 1VQ63 2WO0A 3M8CA 1OF5B 2GBWB 1IVWA 3FG3A 1FA3A 3PCSA 3PCRA 4FMAA 3X41A 3FF2A 1W02A 3LYGA 3MG2A 1EQKA 2GU3A 1OCVA 3KIIA 1EG9B 4HM8B 3CD63 1J2BA 1M1XB 2CHCA 3NV0A 3WOEB 1IVVA 3EE1A 5IEOA 1Q814 1E3VA 1QMAA 2CFWA 3JUQA 5JPUA 3CCE3 3PXMA 3CCU3 3KSED 4N6UA 4LEHA 4FR9A 5AIHA 1DYUA 5EQLA 4MMZB 2B24B 3VF1A 4FMBA 1YJ93 3G8ZA 3G4S3 5KP1A 2W03A 1A2VA 2E2UA 1VQ83 1JB4A 1N9EA 3LT9A 1FGQA 1NU3A 1OH0A 1ZO2A 3ER7A 3K63A 1CEWI 3SOAA 1E3RA 1RJOA 1WNHA 1IT7A 2K54A 3S5CA 4BTXA 1K28A 1AR0A 2BHMA 1DMQA 1W00A 1NWWA 5G2GA 1IVXA 3FZWA 1N9JA 1ROVA 1CYVA 1YIT3 3K9MC 2SBLA 3I563 2QA43 4KFEA 2I9WA 2Z76A 3CCM3 1DVCA 4HKVB 2P0XA 1KWIA 2YFJB 4MEIA 2P05A 3F40A 2CFDA 1ISKA 1GY5A 3GZXB 3LH4A 1Q40A 3D9RA 1W7CA 4ORLA 5JPPA 1VZZA 3GZBA 4EXRA 2BO9B 1O7MB 2IUKA 5AIIA 4XB5A 2CW9A 1UW1A 4N6NB 4TX4A 1YJN3 2BMQB 4KFFA 1JN5B 1O7WB 3OXAA 5FW5A 3FCSB 1QVG2 2MF7A 3AMOA 5CF2A 1IQXA 2W56B 5IG4A 4GL6A 1LOXA 2RSXA 3AMOB 4N3VA 4HYZA 3B8LA 3ROBA 4G1MB 5AI1A 1GD4A 2GEXA 5AEWB 4K61A 2STDA 1VQP3 1NO3A 3S27A 4XBXA 1ZX2A 3PYJA 1PU4A 3RDEA 3CPOA 3DGNA 4K1UA 1N8QA 3S29A 3U1WA 4PEJA 3F9SA 3EBTA 2OOVA 3J7Yd 4RNZA 2P0MA 1ULJB 1QALA 4AEQA 1LXEA 3G713 1K9M4 3EJVA 3OX9A 1IQYA 2FNQA 3EN1B 1JB2A 3JUNA 5CF1A 3L0RA 4HM2B 3NV0B 1YVBI 3NM2A 2KXGA 3LTDA 3SXXA 2QEX3 4R4KA 2F86B 2XRXB 2BMRB 4J9AA 4OK0A 3ECFA 3LTAA 2PNCA 1VQ43 1WMPA 3ALAA 5LC6A 1YHQ3 5IF6A 2GBXB 2XR8B 2D42A 2Z77A 3JUOA 4XDVA 3CMA3 3N8BA 4RZMA 2WGQA 4FMCA 4FCZA 3KSPA 5AYRB 1MNLA 3DM8A 2O3OA 1U5OA 1Q40B 2CFLA 2ZDJA 5TGNA 3E99A 3Q1CA 4IIAA 5CXOA 3V99A 4BTYA 1IVUA 3BLZA 1BUQA 2OQEA 1NJI4 1D6UA 1TFOA 3IJEB 2XFTA 4L8OA 2W9PA 2QIYA 1IDPA 2GU1A 3CU3A 3MKIA 1PFPA 3NQZA 5LC7A 4O02B 4XBTA 3T8UA 2OTL3 3FH1A 3DMCA 3CCV3 3PS8A 4N6MA 3OWYA 2V1LA 2ML6A 3DY5A 3OWSA 5IG3A 3MHEA 1JKGA 2CWTA 1O7HB 1LNHA 1YJW3 1GS3A 1DMNA 1S5AA 4MMYB 4X2OA 1RRLA 2KRTA 5STDA 3WODG 1SJWA 1N8R4 1V74A 5CLKA 4HBRA 2HMNB 5IENA 2K0MA 2YX9A 1UUWB 4N6TA 4HVNA 3SX1A 5HGRA 3KKGA 2A15A 3LMLA 4HM7B 5IW9A 2ML5A 1TUHA 4HM0B 2CFKA 2KCDA 3HZPA 4BTWA 1F8NA 3WMDA 3FGYA 3WA3A 3STDA 3D3LA 3B7CA 1K41A 2W2CA 1QAKA 3KZTA 1M9GA 1GY6A 3FKAA 1TIJA 4O3VA 4N6V0 1GD3A 1FGOA 3GWRA 2UX0A 1OHPA 3K0ZA 3FF0A 4JRFA 1K734 4FCMA 3CXC2 1E97A 1Q864 3WOFB 3EBYA 2HMJB 1O7GB 4J8TA 2OQEC 5ELUA 2CFGA 2F98A 2M7OA 1SQWA 4U13A 3MPHA 1VQO3 3SEDA 4LSOA 3B4PA 4GB5A 3GRDA 2Q07A 4ZM8A 4IT7A 1HU9A 1JNQA 2CIUA 1Y4KA 1K8A4 1IV7A 1YGEA 1RN7A 1VQK3 2QGUA 4K1VA 1R4CA 3NBBA 4HM3B 4I4KA 1DVDA 2CKFB 4STDA 3T8NA 4EBGA 1TP6A 3EC9A 3FSDA 3NXJA 1VQL3 1EA2A 2BT3A 2L4VA 2XGNA 1W6YA 4OVMA 2WOFA 3MYTA 3EF8A 2WGOA 1W01A 3RGAA 1W6GA 3GZYB 2OTJ3 4WP5A 3HX8A 3LTBA 5D83A 2JDIH 1KD14 1AVLA 2E2TA 3BNEA 3NX0A 4JF8A 5AEUB 3JUPA 1AVKA 3CCJ3 1SIIA 2W0QA 2XSOB 1Z1SA 3WA2X 1S723 3LT8A 3F8HA 1VQ73 4LMIA 3DZLA 3S28A 3S67A 2E2VA 3IPTA 5BXQA 2CK3H 3JUMA 1KSIA 3OV4A 1SIHA 2GXFA 2F99A 1U8CB 3DUKA 3EN8A 3CC23 4AKYA 3K7CA 4MMXB 5AIGA 1WMNA 3QRDA 4KFDA 1OACA 2CG0A 2Y73A 4XM4A 4R80A 4XDWA 3UB1A 4HZ9B 1W6CA 3LOYA 1NDOB 1GYBA 3CCL3 3WDGB 2C10A 3EHCA 4WYKA 2OWPA 3UJMA 2IA7A 1IT8A 3BB9A 2CG1A 3N9HA 3F7XA 4HM6B 3CNXA 1W5ZA 3F7SA 3K5TA 3F8XA 3DGOA 3NHXA 4XBYA 4RNYA 4FMDA 3T0UA 3LZAA 4LGQA 3CCR3 3G16A 2XFSA 3NQYA 4L7KA 4R1KA 1STFI 3CC43 2HMLB 4K90B 4RBNA 1VQ53 3G0KA 1IQ8A 3UL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AV4 A;  2OOV C;  5IW9 A;  4EXR A;  3X3Y A;  3PGB A;  2CFK A;  3X3X A;  4BTW A;  4KFF A;  3KN4 A;  3WA3 A;  3AMO A;  1IQX A;  1QAK A;  3AMO B;  1US1 A;  3X42 A;  1QAF A;  3HIG A;  2C11 A;  2ZL8 A;  1JRQ A;  2OQE C;  1PU4 A;  2CFG A;  3HII A;  3MPH A;  1SPU A;  2CWU A;  1LVN A;  1UI7 A;  2OOV A;  1WMO A;  1QAL A;  3NBB A;  1IQY A;  3X40 A;  3HI7 A;  3SXX A;  2BT3 A;  2WO0 A;  1IVW A;  2WOF A;  2CWV A;  1IU7 A;  1UI8 A;  1W6G A;  4EV2 A;  2PNC A;  1EKM A;  1WMP A;  3X41 A;  3ALA A;  2GU3 A;  3KII A;  2E2T A;  1AVL A;  1IVV A;  1AVK A;  1SII A;  2W0Q A;  3WA2 X;  2CFW A;  2Y74 A;  2WGQ A;  1W2Z A;  2E2V A;  1KSI A;  2CFL A;  1DYU A;  1SIH A;  4BTY A;  1IVU A;  1WMN A;  3NBJ A;  2OQE A;  1D6U A;  4KFD A;  1OAC A;  2CG0 A;  1A2V A;  2E2U A;  2Y73 A;  1N9E A;  1W6C A;  3LOY A;  3NQZ A;  1RJO A;  2C10 A;  2WOH A;  1D6Y A;  4BTX A;  2D1W A;  1D6Z A;  2IA7 A;  3X3Z A;  2CG1 A;  3N9H A;  1IVX A;  1W5Z A;  3K5T A;  1TU5 A;  2CWT A;  3T0U A;  1W4N A;  4KFE A;  4EV5 A;  3NQY A;  2CFD A;  4K90 B;  2K0M A;  2YX9 A;  1RKY A;  3SX1 A;  1W7C A; 
#chains in the Genus database with same CATH topology
 4WHA A;  1AV4 A;  1BNI A;  2P38 A;  3G6E 3;  1BUJ A;  1UCK A;  8RNT A;  3X3Y A;  1RHL A;  2AAD A;  3PGB A;  4HJL B;  2FGT A;  2W9Q A;  3LTC A;  1BNE A;  1Q82 4;  4NRE A;  1G02 A;  3U97 A;  1FUW A;  3DGM A;  4CDL A;  4Q53 A;  4N6O B;  1JKG B;  1TRP A;  4WWU C;  1B2M A;  4WYK B;  3KFQ C;  1BVI A;  3UL6 A;  1B2U A;  2JQ5 A;  3H3H A;  1EUI C;  3X42 A;  1DMM A;  1OHO A;  1VQ9 3;  3HIG A;  2HMO B;  1IK3 A;  1RGG A;  2R4I A;  4HM5 B;  2UGI A;  2O9U X;  4LZI A;  2PZV A;  5EEO A;  1B21 A;  1SAR A;  2IMJ A;  1T5Y A;  4HM4 B;  4L8P A;  1NB5 I;  1RSN A;  3A76 A;  5IG5 A;  2HOH A;  1VQN 3;  2YFI B;  1SPU A;  3CC7 3;  1UCJ A;  3EX9 A;  2B1X B;  2CWU A;  3O8Y A;  1LVN A;  1WMO A;  3Q3F A;  2MC8 A;  4MJD A;  2P09 A;  5FGO A;  3F14 A;  5DRE A;  3BNC A;  3FG4 A;  1STD A;  1A90 A;  3BNB A;  5M18 A;  2FXT A;  2HMM B;  2H0I A;  1LNI A;  3CNM A;  5A0O B;  4HM1 B;  3SOY A;  2BMO B;  2CWV A;  4R9K A;  3JVC A;  1ASK A;  1IU7 A;  1UI8 A;  3I0Y A;  3V98 A;  1BSA A;  2XEP A;  1EKM A;  1GY7 A;  4EV2 A;  7STD A;  3MG1 A;  1Q7Y 4;  1GSP A;  8CHO A;  4R9L A;  1OGX A;  2INX A;  2BNG A;  1FW7 A;  1BGS A;  3HK4 A;  3ZG0 A;  1FGM A;  1MOL A;  1G96 A;  3B4O A;  1CQS A;  1YI2 3;  1FUT A;  3BND A;  1V58 A;  2Y74 A;  1T2H A;  2RGQ A;  4WFO A;  1BNG A;  1W2Z A;  3VSY A;  1I8V A;  4H3U A;  1FGT A;  5D82 A;  2HMK B;  5AYS C;  3MG3 A;  3GZR A;  1RN4 A;  1NNV A;  1OHS A;  3NBJ A;  1CYU A;  1YIJ 3;  1TRQ A;  3BIR A;  5DRV A;  2KF4 A;  3FG1 A;  3CME 3;  1O7N B;  1IQ8 A;  1RGH A;  2LYX A;  1B2Z A;  5KP4 A;  1ZGX A;  1BOX A;  3NUV A;  3I55 3;  3DXO A;  5EVH A;  2RFR A;  1FYS A;  2WOH A;  4BL2 A;  5BVB A;  1OPY A;  5RNT A;  1D6Y A;  5IEP A;  2D1W A;  1D6Z A;  1OUN A;  3IMA B;  3Q2P A;  1ROA A;  2CH9 A;  4O2H A;  3X3Z A;  1MWU A;  1MWS A;  3LXU X;  3DGY A;  2W56 A;  4ILF A;  1TU5 A;  1UGH I;  5D81 A;  1VQM 3;  2XGL A;  1W4N A;  3CPW 2;  1OGZ A;  4EV5 A;  3NBR A;  1A67 A;  3V92 A;  1BNR A;  4LYL B;  5KP3 A;  3GAX A;  2RCD A;  3H51 A;  5I97 A;  1JJ2 2;  1JBS A;  1KQS 2;  1WQL B;  4HZB B;  4EC6 A;  5IG0 A;  3VGN A;  1RKY A;  2L1S A;  1LRA A;  2CC3 A;  4QWT A;  3CCS 3;  2IUJ A;  4CCV A;  2LQV A;  1HKX A;  2YFL B;  3FLJ A;  2OOV C;  5AIF A;  3RGR A;  4H61 A;  1M90 4;  1RGE A;  1TFK A;  1JB5 A;  2C4B A;  3DGL A;  1T2I A;  4O8S A;  3X3X A;  1O7P B;  1QJG A;  3MWZ A;  5JBS A;  1BSD A;  4N6L A;  3SVA A;  1QVF 2;  2XF3 A;  1C7H A;  3KN4 A;  1RGL A;  1W2B 2;  1C54 A;  1JN5 A;  2W6J H;  1BRS A;  3QK9 A;  1MWT A;  1EEJ A;  1I3I A;  3TDG A;  1M1K 4;  3NM7 A;  3PZW A;  5M19 A;  3BU4 A;  7RNT A;  3Q90 A;  1N5P A;  3MSO A;  1OF5 A;  1PYL A;  1US1 A;  3EQQ B;  4KZ1 A;  1FGR A;  2BIR A;  5G1K A;  1QAF A;  1NB3 I;  1A2K A;  6STD A;  1WTH A;  2C11 A;  4X2H A;  2ZL8 A;  3WHO A;  2Z6B A;  4NPB A;  5IER A;  3OW2 2;  1JRQ A;  1JV2 B;  2GEY A;  4FCJ A;  4GSP A;  4IPB A;  2XH9 A;  2XSH B;  3HII A;  2GSP A;  1BAN A;  1N5H A;  1GOV A;  4AKZ A;  3SYU A;  3SLU A;  4EYC A;  1IV9 A;  1L5G B;  3CCQ 3;  2W04 A;  3UNL A;  2OCT A;  5CK6 A;  4OUQ A;  1UI7 A;  5ELJ A;  3KE7 A;  1UUV B;  1YGW A;  1TJD A;  1I70 A;  1HZ1 A;  1RRH A;  3X40 A;  3N54 B;  3HI7 A;  1ULI B;  2Z7A A;  4NHF A;  1Q42 A;  1KC8 4;  3EB8 A;  3OWU A;  4KVH A;  1VQ6 3;  2WO0 A;  2IY2 A;  3M8C A;  1OF5 B;  2GBW B;  1IVW A;  1RN1 A;  3FG3 A;  1FA3 A;  3PCS A;  3PCR A;  4FMA A;  1V57 A;  3X41 A;  3FF2 A;  1BIR A;  1W02 A;  3LYG A;  3MG2 A;  2GU3 A;  2F5W A;  1OCV A;  1EQK A;  3KII A;  1EG9 B;  1YNV X;  4HM8 B;  3CD6 3;  1J2B A;  1M1X B;  2CHC A;  1I0V A;  3NV0 A;  3WOE B;  1IVV A;  3EE1 A;  5IEO A;  1Q81 4;  1E3V A;  1QMA A;  2CFW A;  1RNT A;  3JUQ A;  4J5K A;  1RGA A;  5JPU A;  3CCE 3;  2R41 A;  3PXM A;  3CCU 3;  3KSE D;  4N6U A;  4LEH A;  4FR9 A;  5AIH A;  1DYU A;  5EQL A;  1FZU A;  1BNF A;  4MMZ B;  2B24 B;  3VF1 A;  4FMB A;  1YJ9 3;  1RGK A;  1LQG C;  3G8Z A;  3G4S 3;  5KP1 A;  2W03 A;  1A2V A;  2E2U A;  1VQ8 3;  1JB4 A;  1N9E A;  3LT9 A;  3D79 A;  1GMQ A;  1FGQ A;  1NU3 A;  4CJN A;  1OH0 A;  1ZO2 A;  3ER7 A;  2RNT A;  2UUG C;  3K63 A;  4BIR A;  1CEW I;  3SOA A;  1E3R A;  1RJO A;  1WNH A;  1IT7 A;  2K54 A;  3S5C A;  4BTX A;  1K28 A;  1AR0 A;  2BHM A;  2J8X B;  1DMQ A;  1W00 A;  1NWW A;  5G2G A;  1IVX A;  3FZW A;  1N9J A;  1YVS A;  2KAA A;  1ROV A;  1CYV A;  2ZA4 A;  1RCK A;  1YIT 3;  2CX0 A;  3K9M C;  2SBL A;  5G1L A;  3I56 3;  2QA4 3;  3DH2 A;  1RMS A;  4KFE A;  2I9W A;  1HYF A;  2Z76 A;  4RNT A;  3CCM 3;  1DVC A;  4HKV B;  2P0X A;  1B20 A;  1KWI A;  2H0G A;  2SAR A;  2P05 A;  2YFJ B;  2CFD A;  3F40 A;  4MEI A;  1GY5 A;  1ISK A;  1IYY A;  3GZX B;  3LH4 A;  1Q40 A;  3HOH A;  3D9R A;  3AGO A;  2CX1 A;  2KF5 A;  2F5M A;  1W7C A;  4ORL A;  1I0X A;  5JPP A;  1JBT A;  1VZZ A;  3GZB A;  4EXR A;  2BO9 B;  1O7M B;  1AY7 A;  2IUK A;  5AII A;  4XB5 A;  1LOY A;  2CW9 A;  1MGR A;  1UW1 A;  5GSP A;  4N6N B;  4TX4 A;  1YJN 3;  2BMQ B;  4KFF A;  1X1Y A;  1JN5 B;  1O7W B;  3A5E A;  3OXA A;  5FW5 A;  3FCS B;  1QVG 2;  2MF7 A;  3AMO A;  5CF2 A;  1IQX A;  1BSC A;  2W56 B;  5IG4 A;  4GL6 A;  1LOX A;  2RSX A;  3AMO B;  4N3V A;  4HYZ A;  3B8L A;  3ROB A;  4G1M B;  5AI1 A;  1GD4 A;  2GEX A;  5AEW B;  3RNT A;  4K61 A;  2STD A;  1GOU A;  1VQP 3;  1DET A;  1NO3 A;  3S27 A;  2H0H A;  1RGC A;  1I2E A;  4XBX A;  1ZX2 A;  3PYJ A;  1PU4 A;  3RDE A;  3CPO A;  3DGN A;  1B2S A;  1MGW A;  1B2X A;  4K1U A;  1N8Q A;  3D5G A;  1UUG B;  3S29 A;  3U1W A;  5M1A A;  4PEJ A;  3F9S A;  3EBT A;  2OOV A;  3J7Y d;  4RNZ A;  2P0M A;  1ULJ B;  1QAL A;  4AEQ A;  1LXE A;  3G71 3;  1K9M 4;  3EJV A;  3OX9 A;  1IQY A;  2FNQ A;  3EN1 B;  1JB2 A;  3JUN A;  5CF1 A;  3L0R A;  4HM2 B;  3NV0 B;  1YVB I;  3NM2 A;  2KXG A;  3LTD A;  3SXX A;  2QEX 3;  4R4K A;  1PY3 A;  2F86 B;  2XRX B;  2BMR B;  2K3D A;  4J9A A;  4OK0 A;  3ECF A;  1RDS A;  3LTA A;  2KF3 A;  1JBR A;  2PNC A;  1VQ4 3;  1WMP A;  1X1U A;  1BRG A;  3ALA A;  5LC6 A;  3AHW A;  2F4Y A;  3URP A;  1YHQ 3;  1T3B A;  5IF6 A;  1BSE A;  2GBX B;  2XR8 B;  2D42 A;  2Z77 A;  3JUO A;  4XDV A;  3CMA 3;  3N8B A;  4RZM A;  2WGQ A;  1GOY A;  4FCZ A;  4FMC A;  3KSP A;  5AYR B;  1GMP A;  4BL3 A;  1MNL A;  3DM8 A;  2O3O A;  1U5O A;  1Q40 B;  2CFL A;  2ZDJ A;  5TGN A;  3E99 A;  1BRK A;  3Q1C A;  4IIA A;  5CXO A;  3V99 A;  4BTY A;  1RNB A;  1IVU A;  3BLZ A;  1BUQ A;  1BU4 A;  2OQE A;  1NJI 4;  1D6U A;  1TFO A;  3IJE B;  2XFT A;  4L8O A;  2W9P A;  2QIY A;  1IDP A;  1G0T A;  2GU1 A;  3CU3 A;  3D4A A;  3MKI A;  1PFP A;  3NQZ A;  1AQZ A;  5LC7 A;  4O02 B;  4XBT A;  1RCL A;  3T8U A;  2OTL 3;  3FH1 A;  9RNT A;  3DMC A;  3CCV 3;  3GSP A;  1I2G A;  3PS8 A;  4N6M A;  3OWY A;  2V1L A;  2ML6 A;  3DY5 A;  3OWS A;  1BNJ A;  1LOW A;  5IG3 A;  1RTU A;  1BRH A;  3MHE A;  1JKG A;  2KF6 A;  2CWT A;  1O7H B;  1LNH A;  1YJW 3;  1GS3 A;  4DKI A;  1DMN A;  1S5A A;  4MMY B;  4X2O A;  1RRL A;  1A2P A;  2KRT A;  5STD A;  3WOD G;  1SJW A;  7GSP A;  1N8R 4;  1BRJ A;  1V74 A;  5CLK A;  4GHO A;  4HBR A;  2HMN B;  5IEN A;  2K0M A;  2YX9 A;  1UUW B;  1B27 A;  4N6T A;  4HVN A;  3SX1 A;  5HGR A;  3KKG A;  3ZFZ A;  2A15 A;  3LML A;  4HM7 B;  5IW9 A;  2ML5 A;  1TUH A;  1RGF A;  4HM0 B;  2CFK A;  1RLS A;  2KCD A;  3HZP A;  4BTW A;  1F8N A;  3WMD A;  3FGY A;  3WA3 A;  2F56 A;  1JZD A;  3STD A;  3D3L A;  3B7C A;  1K41 A;  2W2C A;  1QAK A;  2RBI A;  3KZT A;  1M9G A;  4BU4 A;  1LQM B;  1GY6 A;  3FKA A;  1TIJ A;  4O3V A;  4N6V 0;  1GD3 A;  1FGO A;  3GWR A;  2UX0 A;  1OHP A;  3K0Z A;  3FF0 A;  4JRF A;  1K73 4;  2BU4 A;  4FCM A;  3CXC 2;  3KCH A;  1E97 A;  1R4Y A;  3D5I A;  1Q86 4;  3WOF B;  3EBY A;  2HMJ B;  1O7G B;  4J8T A;  2OQE C;  5ELU A;  2CFG A;  2F98 A;  2M7O A;  1SQW A;  4U13 A;  3MPH A;  1VQO 3;  3SED A;  4LSO A;  3B4P A;  4EW5 A;  1JZO A;  4GB5 A;  3GRD A;  2Q07 A;  1CH0 A;  4I5Q A;  4ZM8 A;  5HOH A;  4IT7 A;  1HU9 A;  1JNQ A;  2CIU A;  1Y4K A;  1K8A 4;  1IV7 A;  1BSB A;  1UGI A;  1YGE A;  1VQQ A;  1RN7 A;  1VQK 3;  2QGU A;  4K1V A;  1R4C A;  3NBB A;  4HM3 B;  4I4K A;  1DVD A;  6GSP A;  2CKF B;  4STD A;  3AHS A;  3T8N A;  4EBG A;  1TP6 A;  3EC9 A;  1B3S A;  3FSD A;  1TTO A;  3NXJ A;  1EA2 A;  2BT3 A;  1VQL 3;  2L4V A;  2XGN A;  1W6Y A;  4OVM A;  1MWR A;  2WOF A;  3MYT A;  3EF8 A;  2WGO A;  1W01 A;  3RGA A;  1W6G A;  3GZY B;  2OTJ 3;  4WP5 A;  3HX8 A;  3LTB A;  5D83 A;  2JDI H;  1KD1 4;  1AVL A;  2E2T A;  1GMR A;  3BNE A;  3NX0 A;  5BIR A;  4JF8 A;  5AEU B;  3JUP A;  1AVK A;  6RNT A;  3CCJ 3;  1SII A;  2W0Q A;  2XSO B;  1Z1S A;  3WA2 X;  1S72 3;  3LT8 A;  2IYJ A;  3AGN A;  3F8H A;  1VQ7 3;  4LMI A;  3DZL A;  3S28 A;  3S67 A;  2E2V A;  3IPT A;  5BXQ A;  1LOV A;  2CK3 H;  1KSI A;  3JUM A;  3OV4 A;  1SIH A;  2GXF A;  4HOH A;  2F99 A;  1X1X A;  1U8C B;  3DUK A;  3EN8 A;  3CC2 3;  4AKY A;  3K7C A;  2ZHX B;  4MMX B;  1WMN A;  5AIG A;  3WR2 A;  3QRD A;  4KFD A;  1OAC A;  2CG0 A;  2Y73 A;  1UCI A;  4XM4 A;  4CPK A;  4R80 A;  4XDW A;  3UB1 A;  4HZ9 B;  1W6C A;  3LOY A;  1NDO B;  4KT3 B;  1GYB A;  1ZS7 A;  3ZG5 A;  3WDG B;  3CCL 3;  4J5G A;  2C10 A;  3EHC A;  2AAE A;  4WYK A;  2OWP A;  3UJM A;  1DE3 A;  2IA7 A;  4HAA A;  1IT8 A;  1Q9E A;  1FUS A;  3BB9 A;  2CG1 A;  3N9H A;  3F7X A;  4HM6 B;  1X1W A;  3CNX A;  1UCL A;  1W5Z A;  3F7S A;  3K5T A;  3F8X A;  3DGO A;  3NHX A;  1I2F A;  4XBY A;  4RNY A;  4FMD A;  3T0U A;  5BU4 A;  3LZA A;  4LGQ A;  3CCR 3;  1BRI A;  1UDI I;  3G16 A;  2XFS A;  3NQY A;  4L7K A;  4R1K A;  1BNS A;  1STF I;  1BRN L;  1BAO A;  2HML B;  4K90 B;  3CC4 3;  4RBN A;  1Q7H A;  1VQ5 3;  3G0K A;  1I3F A;  3UL5 A; 
#chains in the Genus database with same CATH homology
 4WHA A;  1AV4 A;  2P38 A;  3G6E 3;  3X3Y A;  3PGB A;  4HJL B;  2FGT A;  2W9Q A;  3LTC A;  1Q82 4;  4NRE A;  3U97 A;  1FUW A;  3DGM A;  4CDL A;  4Q53 A;  4N6O B;  1JKG B;  4WWU C;  4WYK B;  3KFQ C;  3UL6 A;  2JQ5 A;  3H3H A;  3X42 A;  1DMM A;  1OHO A;  1VQ9 3;  3HIG A;  2HMO B;  1IK3 A;  2R4I A;  4HM5 B;  2O9U X;  4LZI A;  2PZV A;  5EEO A;  2IMJ A;  1T5Y A;  4HM4 B;  4L8P A;  1NB5 I;  3A76 A;  5IG5 A;  1VQN 3;  2YFI B;  1SPU A;  3CC7 3;  3EX9 A;  2B1X B;  2CWU A;  3O8Y A;  1LVN A;  1WMO A;  2MC8 A;  4MJD A;  2P09 A;  5FGO A;  3F14 A;  5DRE A;  3BNC A;  3FG4 A;  1STD A;  1A90 A;  3BNB A;  2FXT A;  2HMM B;  3CNM A;  5A0O B;  4HM1 B;  3SOY A;  2BMO B;  2CWV A;  4R9K A;  3JVC A;  1ASK A;  1IU7 A;  1UI8 A;  3I0Y A;  3V98 A;  4EV2 A;  2XEP A;  1EKM A;  1GY7 A;  7STD A;  3MG1 A;  1Q7Y 4;  8CHO A;  4R9L A;  1OGX A;  2INX A;  2BNG A;  3HK4 A;  1FGM A;  1MOL A;  1G96 A;  3B4O A;  1CQS A;  1YI2 3;  3BND A;  2Y74 A;  2RGQ A;  4WFO A;  1W2Z A;  3VSY A;  4H3U A;  1FGT A;  5D82 A;  2HMK B;  5AYS C;  3MG3 A;  3GZR A;  1OHS A;  3NBJ A;  1CYU A;  1YIJ 3;  5DRV A;  3FG1 A;  3CME 3;  1O7N B;  2LYX A;  5KP4 A;  3NUV A;  3I55 3;  3DXO A;  5EVH A;  2RFR A;  5BVB A;  2WOH A;  1OPY A;  1D6Y A;  5IEP A;  2D1W A;  1D6Z A;  1OUN A;  3IMA B;  3Q2P A;  1ROA A;  2CH9 A;  4O2H A;  3X3Z A;  3LXU X;  2W56 A;  1TU5 A;  5D81 A;  1VQM 3;  2XGL A;  1W4N A;  3CPW 2;  1OGZ A;  4EV5 A;  3NBR A;  1A67 A;  3V92 A;  5KP3 A;  3GAX A;  2RCD A;  3H51 A;  5I97 A;  1JJ2 2;  1KQS 2;  1WQL B;  4HZB B;  4EC6 A;  5IG0 A;  3VGN A;  1RKY A;  2CC3 A;  4QWT A;  3CCS 3;  2IUJ A;  4CCV A;  2LQV A;  1HKX A;  2YFL B;  3FLJ A;  2OOV C;  5AIF A;  3RGR A;  4H61 A;  1M90 4;  1TFK A;  1JB5 A;  3DGL A;  4O8S A;  3X3X A;  1O7P B;  1QJG A;  3MWZ A;  5JBS A;  3SVA A;  4N6L A;  1QVF 2;  2XF3 A;  1C7H A;  3KN4 A;  1W2B 2;  1JN5 A;  2W6J H;  3QK9 A;  3TDG A;  1M1K 4;  3NM7 A;  3PZW A;  3Q90 A;  1N5P A;  3MSO A;  1OF5 A;  1US1 A;  3EQQ B;  4KZ1 A;  1FGR A;  1QAF A;  1NB3 I;  1A2K A;  6STD A;  1WTH A;  2C11 A;  4X2H A;  2ZL8 A;  2Z6B A;  5IER A;  3OW2 2;  1JRQ A;  1JV2 B;  2GEY A;  4FCJ A;  4IPB A;  2XH9 A;  2XSH B;  3HII A;  1N5H A;  4AKZ A;  3SLU A;  4EYC A;  1IV9 A;  1L5G B;  3CCQ 3;  2W04 A;  3UNL A;  2OCT A;  5CK6 A;  4OUQ A;  1UI7 A;  5ELJ A;  3KE7 A;  1UUV B;  1RRH A;  3X40 A;  3N54 B;  3HI7 A;  1ULI B;  2Z7A A;  4NHF A;  1Q42 A;  1KC8 4;  3EB8 A;  3OWU A;  4KVH A;  1VQ6 3;  2WO0 A;  3M8C A;  1OF5 B;  2GBW B;  1IVW A;  3FG3 A;  1FA3 A;  3PCS A;  3PCR A;  4FMA A;  3X41 A;  3FF2 A;  1W02 A;  3LYG A;  3MG2 A;  1EQK A;  2GU3 A;  1OCV A;  3KII A;  1EG9 B;  4HM8 B;  3CD6 3;  1J2B A;  1M1X B;  2CHC A;  3NV0 A;  3WOE B;  1IVV A;  3EE1 A;  5IEO A;  1Q81 4;  1E3V A;  1QMA A;  2CFW A;  3JUQ A;  5JPU A;  3CCE 3;  3PXM A;  3CCU 3;  3KSE D;  4N6U A;  4LEH A;  4FR9 A;  5AIH A;  1DYU A;  5EQL A;  4MMZ B;  2B24 B;  3VF1 A;  4FMB A;  1YJ9 3;  3G8Z A;  3G4S 3;  5KP1 A;  2W03 A;  1A2V A;  2E2U A;  1VQ8 3;  1JB4 A;  1N9E A;  3LT9 A;  1FGQ A;  1NU3 A;  1OH0 A;  1ZO2 A;  3ER7 A;  3K63 A;  1CEW I;  3SOA A;  1E3R A;  1RJO A;  1WNH A;  1IT7 A;  2K54 A;  3S5C A;  4BTX A;  1K28 A;  1AR0 A;  2BHM A;  1DMQ A;  1W00 A;  1NWW A;  5G2G A;  1IVX A;  3FZW A;  1N9J A;  1ROV A;  1CYV A;  1YIT 3;  3K9M C;  2SBL A;  3I56 3;  2QA4 3;  4KFE A;  2I9W A;  2Z76 A;  3CCM 3;  1DVC A;  4HKV B;  2P0X A;  1KWI A;  2YFJ B;  4MEI A;  2P05 A;  3F40 A;  2CFD A;  1ISK A;  1GY5 A;  3GZX B;  3LH4 A;  1Q40 A;  3D9R A;  1W7C A;  4ORL A;  5JPP A;  1VZZ A;  3GZB A;  4EXR A;  2BO9 B;  1O7M B;  2IUK A;  5AII A;  4XB5 A;  2CW9 A;  1UW1 A;  4N6N B;  4TX4 A;  1YJN 3;  2BMQ B;  4KFF A;  1JN5 B;  1O7W B;  3OXA A;  5FW5 A;  3FCS B;  1QVG 2;  2MF7 A;  3AMO A;  5CF2 A;  1IQX A;  2W56 B;  5IG4 A;  4GL6 A;  1LOX A;  2RSX A;  3AMO B;  4N3V A;  4HYZ A;  3B8L A;  3ROB A;  4G1M B;  5AI1 A;  1GD4 A;  2GEX A;  5AEW B;  4K61 A;  2STD A;  1VQP 3;  1NO3 A;  3S27 A;  4XBX A;  1ZX2 A;  3PYJ A;  1PU4 A;  3RDE A;  3CPO A;  3DGN A;  4K1U A;  1N8Q A;  3S29 A;  3U1W A;  4PEJ A;  3F9S A;  3EBT A;  2OOV A;  3J7Y d;  4RNZ A;  2P0M A;  1ULJ B;  1QAL A;  4AEQ A;  1LXE A;  3G71 3;  1K9M 4;  3EJV A;  3OX9 A;  1IQY A;  2FNQ A;  3EN1 B;  1JB2 A;  3JUN A;  5CF1 A;  3L0R A;  4HM2 B;  3NV0 B;  1YVB I;  3NM2 A;  2KXG A;  3LTD A;  3SXX A;  2QEX 3;  4R4K A;  2F86 B;  2XRX B;  2BMR B;  4J9A A;  4OK0 A;  3ECF A;  3LTA A;  2PNC A;  1VQ4 3;  1WMP A;  3ALA A;  5LC6 A;  1YHQ 3;  5IF6 A;  2GBX B;  2XR8 B;  2D42 A;  2Z77 A;  3JUO A;  4XDV A;  3CMA 3;  3N8B A;  4RZM A;  2WGQ A;  4FMC A;  4FCZ A;  3KSP A;  5AYR B;  1MNL A;  3DM8 A;  2O3O A;  1U5O A;  1Q40 B;  2CFL A;  2ZDJ A;  5TGN A;  3E99 A;  3Q1C A;  4IIA A;  5CXO A;  3V99 A;  4BTY A;  1IVU A;  3BLZ A;  1BUQ A;  2OQE A;  1NJI 4;  1D6U A;  1TFO A;  3IJE B;  2XFT A;  4L8O A;  2W9P A;  2QIY A;  1IDP A;  2GU1 A;  3CU3 A;  3MKI A;  1PFP A;  3NQZ A;  5LC7 A;  4O02 B;  4XBT A;  3T8U A;  2OTL 3;  3FH1 A;  3DMC A;  3CCV 3;  3PS8 A;  4N6M A;  3OWY A;  2V1L A;  2ML6 A;  3DY5 A;  3OWS A;  5IG3 A;  3MHE A;  1JKG A;  2CWT A;  1O7H B;  1LNH A;  1YJW 3;  1GS3 A;  1DMN A;  1S5A A;  4MMY B;  4X2O A;  1RRL A;  2KRT A;  5STD A;  3WOD G;  1SJW A;  1N8R 4;  1V74 A;  5CLK A;  4HBR A;  2HMN B;  5IEN A;  2K0M A;  2YX9 A;  1UUW B;  4N6T A;  4HVN A;  3SX1 A;  5HGR A;  3KKG A;  2A15 A;  3LML A;  4HM7 B;  5IW9 A;  2ML5 A;  1TUH A;  4HM0 B;  2CFK A;  2KCD A;  3HZP A;  4BTW A;  1F8N A;  3WMD A;  3FGY A;  3WA3 A;  3STD A;  3D3L A;  3B7C A;  1K41 A;  2W2C A;  1QAK A;  3KZT A;  1M9G A;  1GY6 A;  3FKA A;  1TIJ A;  4O3V A;  4N6V 0;  1GD3 A;  1FGO A;  3GWR A;  2UX0 A;  1OHP A;  3K0Z A;  3FF0 A;  4JRF A;  1K73 4;  4FCM A;  3CXC 2;  1E97 A;  1Q86 4;  3WOF B;  3EBY A;  2HMJ B;  1O7G B;  4J8T A;  2OQE C;  5ELU A;  2CFG A;  2F98 A;  2M7O A;  1SQW A;  4U13 A;  3MPH A;  1VQO 3;  3SED A;  4LSO A;  3B4P A;  4GB5 A;  3GRD A;  2Q07 A;  4ZM8 A;  4IT7 A;  1HU9 A;  1JNQ A;  2CIU A;  1Y4K A;  1K8A 4;  1IV7 A;  1YGE A;  1RN7 A;  1VQK 3;  2QGU A;  4K1V A;  1R4C A;  3NBB A;  4HM3 B;  4I4K A;  1DVD A;  2CKF B;  4STD A;  3T8N A;  4EBG A;  1TP6 A;  3EC9 A;  3FSD A;  3NXJ A;  1VQL 3;  1EA2 A;  2BT3 A;  2L4V A;  2XGN A;  1W6Y A;  4OVM A;  2WOF A;  3MYT A;  3EF8 A;  2WGO A;  1W01 A;  3RGA A;  1W6G A;  3GZY B;  2OTJ 3;  4WP5 A;  3HX8 A;  3LTB A;  5D83 A;  2JDI H;  1KD1 4;  1AVL A;  2E2T A;  3BNE A;  3NX0 A;  4JF8 A;  5AEU B;  3JUP A;  1AVK A;  3CCJ 3;  1SII A;  2W0Q A;  2XSO B;  1Z1S A;  3WA2 X;  1S72 3;  3LT8 A;  3F8H A;  1VQ7 3;  4LMI A;  3DZL A;  3S28 A;  3S67 A;  2E2V A;  3IPT A;  5BXQ A;  2CK3 H;  3JUM A;  1KSI A;  3OV4 A;  1SIH A;  2GXF A;  2F99 A;  1U8C B;  3DUK A;  3EN8 A;  3CC2 3;  4AKY A;  3K7C A;  4MMX B;  5AIG A;  1WMN A;  3QRD A;  4KFD A;  1OAC A;  2CG0 A;  2Y73 A;  4XM4 A;  4R80 A;  4XDW A;  3UB1 A;  4HZ9 B;  1W6C A;  3LOY A;  1NDO B;  1GYB A;  3CCL 3;  3WDG B;  2C10 A;  3EHC A;  4WYK A;  2OWP A;  3UJM A;  2IA7 A;  1IT8 A;  3BB9 A;  2CG1 A;  3N9H A;  3F7X A;  4HM6 B;  3CNX A;  1W5Z A;  3F7S A;  3K5T A;  3F8X A;  3DGO A;  3NHX A;  4XBY A;  4RNY A;  4FMD A;  3T0U A;  3LZA A;  4LGQ A;  3CCR 3;  3G16 A;  2XFS A;  3NQY A;  4L7K A;  4R1K A;  1STF I;  3CC4 3;  2HML B;  4K90 B;  4RBN A;  1VQ5 3;  3G0K A;  1IQ8 A;  3UL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...