3NQZA

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
175
Chain Sequence
b'ANKKYLNQQPTINNMVQSNSVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 41
structure length 175
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA01
2C10A 2IA7A 2CFLA 1IVUA 1W5ZA 3NBJA 3K5TA 3N9HA 3X40A 5IW9A 1SIHA 1WMPA 1W4NA 1W6GA 4KFDA 1AV4A 1IVXA 1IVWA 1IVVA 4EXRA 2CFWA 1AVKA 1TU5A 1JRQA 3X3YA 1AVLA 2OOVA 3NQYA 1D6UA 1OACA 2Y74A 4EV2A 1UI7A 4EV5A 1W7CA 2E2TA 4K90B 2E2VA 2GU3A 1A2VA 2OOVC 3SXXA 3NQZA 3LOYA 3WA2X 1DYUA 2WGQA 1SIIA 2ZL8A 3NBBA 2PNCA 3X3XA 2BT3A 1EKMA 1RJOA 4BTWA 3KIIA 2Y73A 2OQEA 3AMOA 2CWVA 3MPHA 2C11A 3KN4A 1IQXA 2WOHA 2OQEC 3ALAA 1D6YA 4BTYA 1IQYA 2CG1A 1N9EA 1LVNA 2CFGA 1W2ZA 1IU7A 1RKYA 1US1A 3X42A 2WO0A 1WMNA 3SX1A 1W6CA 2K0MA 1QAKA 2CWUA 3X41A 1QAFA 2CWTA 2WOFA 2CG0A 3T0UA 3WA3A 2W0QA 3HIGA 4KFEA 1QALA 1PU4A 4KFFA 2YX9A 2D1WA 1SPUA 3HI7A 2CFDA 3AMOB 1WMOA 2CFKA 1D6ZA 3PGBA 4BTXA 3X3ZA 3HIIA 1KSIA 2E2UA 1UI8A
chains in the Genus database with same CATH superfamily
1UUVB 5IG4A 4HYZA 3T8UA 1G02A 4HKVB 1ULJB 3F7XA 2IYJA 2KF4A 5KP1A 1Y4KA 4HM5B 1FUSA 1EQKA 1VQ43 1BSDA 3RGAA 1B2MA 2FXTA 3CCU3 4HOHA 4XDWA 3BNBA 3D9RA 5IG3A 3HZPA 2GU1A 4ORLA 5BIRA 1NWWA 1UW1A 2CKFB 3I0YA 1VZZA 1NDOB 3E99A 1TRPA 4K1VA 2BHMA 1KWIA 1W6GA 1Q40A 3PZWA 1TJDA 2I9WA 3VGNA 1O7GB 5G1KA 1IVWA 3KSED 2K54A 1IV7A 3FZWA 2H0GA 3D5IA 3Q2PA 2KXGA 1BNIA 1GSPA 3ER7A 1QVF2 1OACA 2XR8B 6STDA 1NNVA 4GSPA 1JZOA 3RDEA 3PXMA 1I2GA 5IF6A 1CYVA 2E2TA 1OF5A 1TRQA 1X1UA 4GL6A 2OOVC 4WHAA 5DREA 3RNTA 5AYSC 3Q1CA 4KZ1A 1LXEA 3CCE3 3FLJA 1SIIA 1QVG2 3G713 2PNCA 5STDA 4CPKA 4AKZA 4FMAA 1RDSA 1JKGA 1EUIC 1ROVA 1F8NA 3CXC2 5HGRA 1PFPA 1FGTA 1Q824 3TDGA 2XSOB 1W2B2 2RGQA 1O7NB 1DVCA 3AMOA 3LTCA 1W6YA 2Z6BA 3EN1B 3OX9A 1K28A 5EEOA 2YFIB 3H51A 2BMOB 3AHSA 1X1XA 1NJI4 5JPUA 1X1YA 1L5GB 5D83A 1N8R4 2KF5A 1VQK3 6GSPA 2CX0A 3CCM3 3CC73 1YJN3 1W01A 1BUJA 1UGIA 3JUQA 3G0KA 4J5KA 4LYLB 1K9M4 2HMKB 4HZ9B 1N9EA 4XBYA 4EBGA 1MNLA 2CFGA 1BSBA 1JB2A 2XH9A 2ZA4A 3DY5A 3WODG 1IK3A 1MOLA 3IPTA 3AGOA 1B2ZA 1MGRA 4HM0B 3X42A 2P05A 3EQQB 3UNLA 2CWUA 1RGEA 1OF5B 3K63A 3KCHA 1B2XA 5KP3A 2HMOB 2CWTA 2YFLB 1X1WA 1FUTA 3H3HA 2P09A 1YIJ3 3NX0A 5CK6A 1NU3A 3WA3A 1YI23 3CNMA 2JDIH 1PU4A 1IT8A 3D4AA 1FW7A 1Q42A 4LMIA 1DMQA 4IIAA 1WTHA 2OTL3 2OCTA 3ECFA 2CH9A 1JB4A 3AMOB 4LZIA 4HM1B 3PYJA 1M9GA 4X2HA 3NHXA 1D6ZA 3MHEA 3NM2A 1S723 6RNTA 3WOFB 3CU3A 4L8OA 1AQZA 5FW5A 4O8SA 4LEHA 8CHOA 1HKXA 1UI8A 2MF7A 4MMYB 1Q7HA 2F5WA 3T8NA 2XF3A 3CCL3 1W5ZA 1RN4A 1IDPA 4N3VA 3G16A 1YJW3 1N9JA 1I2EA 3NBJA 3SOAA 5IERA 2CC3A 2W9QA 1R4YA 1RCLA 1CEWI 3X40A 8RNTA 5TGNA 2RCDA 3F8XA 3FF2A 1GY5A 1W4NA 1EEJA 3G8ZA 1M1K4 5M18A 2O9UX 1E3VA 2AADA 3STDA 1A90A 1Q7Y4 1BAOA 4K61A 1W00A 1BANA 5AI1A 4CJNA 1AV4A 2UUGC 2V1LA 3DZLA 2JQ5A 1RRHA 2CFWA 1GD4A 3NXJA 1IV9A 4J9AA 1JRQA 4RZMA 2P0MA 1TU5A 1RGKA 1K41A 2P0XA 3WR2A 3A76A 2A15A 1D6UA 4RNTA 3MYTA 1UUWB 2ZHXB 3DGNA 5ELJA 1ZX2A 2Y74A 1C54A 1BNEA 1UI7A 3JUNA 4EV5A 5KP4A 1YVBI 2OTJ3 1Q9EA 3CMA3 4AKYA 1RGHA 2D42A 2F4YA 3DM8A 3SXXA 1VQL3 4HBRA 3LOYA 7GSPA 1FA3A 3MSOA 1VQ63 2WGQA 1SQWA 1CYUA 1VQP3 1K734 3N54B 1V74A 2KAAA 4NREA 1IT7A 1UCJA 3X3XA 4TX4A 1EKMA 3B4PA 3FF0A 2GEXA 2P38A 4BTWA 4XM4A 3KKGA 1B27A 4Q53A 1C7HA 1RN1A 1VQO3 1GS3A 4FCJA 2R4IA 1OGZA 2C4BA 2OQEA 2ML5A 1B20A 1U8CB 3LMLA 3CNXA 4K1UA 1UDII 5AEWB 2CWVA 1RHLA 3MPHA 4L8PA 3KN4A 3FSDA 3CCV3 2LQVA 1EG9B 1O7HB 2WOHA 1RSNA 3DGMA 3KFQC 4PEJA 4LGQA 4QWTA 1UCIA 3CCS3 1BRNL 2CHCA 3EBTA 3ALAA 1D6YA 2UX0A 3HOHA 3FG4A 5ELUA 1LVNA 1Q40B 4J8TA 4CDLA 5G2GA 1W2ZA 2FNQA 1IU7A 1OHOA 2KF3A 2QIYA 3F7SA 1VQ53 3LYGA 1LNIA 3LT9A 1NB3I 2L4VA 5LC7A 4HM3B 1WNHA 2XFSA 1I3IA 2WO0A 2F99A 1WMNA 5CF2A 9RNTA 2QA43 2K0MA 1ASKA 1G0TA 2XFTA 1T3BA 3S67A 1BRSA 1QAFA 2STDA 1SJWA 3LZAA 2IMJA 2WOFA 3I553 1JBSA 2KF6A 3GSPA 3GWRA 2AAEA 1A67A 2CG0A 5A0OB 5BU4A 3S28A 3CD63 3F40A 1FGMA 3HIGA 3SVAA 1O7MB 1BVIA 1YHQ3 3I563 1V57A 2MC8A 1FUWA 2YX9A 3BNDA 1SPUA 5AEUB 1GMRA 1YJ93 4JRFA 1STFI 4XB5A 3Q90A 2CIUA 3EHCA 2CFKA 1NO3A 3IJEB 2IUKA 3FCSB 3PGBA 1AY7A 5AIIA 1ISKA 2W9PA 1YIT3 1N8QA 2B1XB 3HIIA 4K90B 1I8VA 1FGRA 2E2UA 2LYXA 2Z7AA 1GOUA 1BRHA 1A2PA 2IA7A 2QGUA 3F8HA 3GZXB 5IEOA 3UJMA 1HZ1A 2GBXB 3AGNA 1YVSA 3F9SA 4HM4B 1LOYA 4N6V0 5BXQA 1BIRA 5M19A 2BMRB 1VQ73 4GB5A 4NPBA 1PY3A 3N9HA 3WMDA 3V98A 2RNTA 3O8YA 4MEIA 1JV2B 1STDA 1BNFA 1VQM3 1JKGB 1SIHA 4IPBA 4KVHA 4RNYA 4N6NB 2QEX3 4RBNA 1TFKA 1YGEA 3LTDA 1O7PB 3UB1A 2GBWB 3DGOA 4KFDA 1DETA 3EE1A 3WOEB 1VQQA 3NM7A 1IVXA 4OK0A 1I3FA 3JUMA 1HYFA 4ZM8A 1IVVA 3CPOA 4N6OB 1V58A 2SARA 3NV0A 4XBTA 1JN5A 1AVKA 4I5QA 2F5MA 2XSHB 4L7KA 3X3YA 1ZO2A 2OOVA 5FGOA 2INXA 3UL6A 4AEQA 1LOWA 3G4S3 1K8A4 1KD14 3CCJ3 3K0ZA 5AIGA 3OV4A 2Z76A 5DRVA 2F98A 3A5EA 2IUJA 2CW9A 5AIFA 2GU3A 3EJVA 4KT3B 4EW5A 2PZVA 3CPW2 3NQZA 1BNRA 1M1XB 4HZBB 2BNGA 1I2FA 1GOYA 3MG3A 2ZL8A 2L1SA 2W04A 1WQLB 1BRGA 3K7CA 4WYKA 2BT3A 4N6MA 3K9MC 1SARA 4WWUC 3ZG0A 2IY2A 1UUGB 4H61A 5JPPA 1OHPA 1RLSA 1UGHI 1IQ8A 3PCRA 4BL3A 1HU9A 3L0RA 3B8LA 1B2UA 2RSXA 2Q07A 1MWSA 3BIRA 3OXAA 2HOHA 3PCSA 3CC23 1N5HA 4R80A 1JNQA 1TIJA 1RNBA 3SEDA 3CC43 1FZUA 4FCMA 3G6E3 1OCVA 4CCVA 1BRIA 4EC6A 1IQXA 1BNSA 4FMDA 1MWTA 1TTOA 3LT8A 4HAAA 3WHOA 3DMCA 2K3DA 3HK4A 3NV0B 2F86B 2OWPA 4X2OA 1KQS2 1JJ22 3D5GA 1PYLA 2XRXB 1Z1SA 5GSPA 3GZBA 1BU4A 3JUPA 3BLZA 2XEPA 2CX1A 4R9LA 2O3OA 3SX1A 4G1MB 1W6CA 3URPA 1A2KA 1JB5A 1LQMB 2BMQB 4NHFA 3LXUX 3X41A 3VF1A 5AIHA 4WP5A 2W56A 4N6UA 5BVBA 1GOVA 1RTUA 1YGWA 4R9KA 4XBXA 3KZTA 1CH0A 3SOYA 1I70A 3PS8A 4N6LA 3BU4A 3MKIA 1ZS7A 4KFEA 3JVCA 4O02B 1DMMA 4WYKB 5G1LA 5IEPA 4KFFA 3D79A 3B4OA 2D1WA 3HI7A 2CFDA 3DH2A 1Q814 1RGLA 1O7WB 1WMOA 4I4KA 4U13A 5D82A 5IG5A 4GHOA 1J2BA 4BTXA 1BNGA 3BNCA 1I0XA 5LC6A 1GYBA 2F56A 3NUVA 3X3ZA 1BNJA 1UCLA 3OWUA 4EYCA 1DVDA 5AYRB 2C10A 1RGFA 1IVUA 2CFLA 3DUKA 1OH0A 4ILFA 3EBYA 1EA2A 2UGIA 3QRDA 3SYUA 3WDGB 4IT7A 3K5TA 4HM8B 1VQN3 3EC9A 1U5OA 5M1AA 1BUQA 5RNTA 5IW9A 1LQGC 2B24B 2Z77A 3Q3FA 1JZDA 1WMPA 1FGOA 4R1KA 5CF1A 3EF8A 2KCDA 3ROBA 3GRDA 3V92A 3J7Yd 1GY6A 4OUQA 2XGNA 2W56B 3JUOA 1NB5I 3FH1A 3S27A 1MGWA 3AHWA 1JBTA 2ML6A 3BB9A 4EXRA 1RGGA 3UL5A 2HMMB 1UCKA 1TUHA 2GSPA 3DGYA 1AVLA 3NQYA 3EN8A 4RNZA 4STDA 1RGCA 2M7OA 1FGQA 1B3SA 5IG0A 3CCR3 3GZYB 1IYYA 3GAXA 1T2HA 4EV2A 1ROAA 2RFRA 4FMBA 4XDVA 4HM6B 3EX9A 3U97A 3U1WA 1W7CA 3MG2A 7STDA 2E2VA 1VQ83 1ZGXA 1A2VA 1RNTA 3EB8A 3WA2X 1DYUA 3LTAA 1RN7A 1W02A 3FG1A 2HMNB 3NBBA 1LNHA 3OWSA 1DMNA 1LRAA 1DE3A 3HX8A 3OW22 3DGLA 3FG3A 5CLKA 1RRLA 1I0VA 1OPYA 1RJOA 3CCQ3 3KIIA 1OUNA 1B21A 3ZG5A 5CXOA 3D3LA 5EQLA 5I97A 2Y73A 1BOXA 1ULIB 3QK9A 1RGAA 3B7CA 4FMCA 3F14A 1BRKA 4MJDA 7RNTA 1YNVX 4HVNA 1GD3A 1TP6A 4BL2A 2W2CA 2C11A 1OGXA 1T2IA 4J5GA 1T5YA 3VSYA 3KSPA 3MWZA 2OQEC 3LTBA 3KE7A 1R4CA 3NBRA 4DKIA 1BRJA 3BNEA 1IQYA 2CG1A 4BTYA 4WFOA 2KRTA 1VQ93 2HMJB 4MMZB 1E97A 1GMPA 2YFJB 4OVMA 3RGRA 1RKYA 1Q864 4H3UA 1OHSA 2BO9B 3LH4A 2BIRA 2R41A 1QJGA 3IMAB 1FYSA 1LOVA 1US1A 3CME3 5JBSA 1RMSA 1JBRA 1BGSA 1QAKA 1G96A 3V99A 1TFOA 1MWUA 1S5AA 2HMLB 2SBLA 3FGYA 3FKAA 1AR0A 2FGTA 2GXFA 4MMXB 3DXOA 4N6TA 4BU4A 5IENA 2W03A 4JF8A 3T0UA 1GY7A 2CK3H 2W0QA 1RCKA 1BSCA 2GEYA 1LOXA 4FCZA 1E3RA 4HM2B 1KC84 1QALA 2H0HA 2RBIA 3N8BA 4O2HA 1M904 2J8XB 2ZDJA 1N5PA 1B2SA 4O3VA 5EVHA 1CQSA 1GMQA 3GZRA 4HM7B 5D81A 2W6JH 3OWYA 1JN5B 1BSAA 4BIRA 3SLUA 3ZFZA 1QMAA 4R4KA 2H0IA 4LSOA 2BU4A 3MG1A 3S5CA 3S29A 4FR9A 1BSEA 1KSIA 3M8CA 1MWRA 4HJLB 2WGOA 2XGLA 5HOHA
chains in the Genus database with same CATH topology
1UUVB 5IG4A 4HYZA 3T8UA 4HKVB 1ULJB 3F7XA 5KP1A 1Y4KA 4HM5B 1EQKA 1VQ43 3RGAA 2FXTA 3CCU3 4XDWA 3BNBA 3D9RA 5IG3A 3HZPA 2GU1A 4ORLA 1NWWA 1UW1A 2CKFB 3I0YA 1VZZA 1NDOB 3E99A 4K1VA 2BHMA 1KWIA 1W6GA 1Q40A 3PZWA 2I9WA 3VGNA 1O7GB 1IVWA 3KSED 2K54A 1IV7A 3FZWA 3Q2PA 2KXGA 3ER7A 1QVF2 1OACA 2XR8B 6STDA 3RDEA 3PXMA 5IF6A 1CYVA 2E2TA 1OF5A 4GL6A 4WHAA 5DREA 2OOVC 5AYSC 3Q1CA 4KZ1A 1LXEA 3CCE3 3FLJA 1SIIA 1QVG2 3G713 2PNCA 5STDA 4AKZA 4FMAA 1JKGA 1ROVA 1F8NA 3CXC2 5HGRA 1PFPA 1FGTA 1Q824 3TDGA 2XSOB 1W2B2 2RGQA 1O7NB 1DVCA 3AMOA 3LTCA 1W6YA 2Z6BA 3EN1B 3OX9A 1K28A 5EEOA 2YFIB 3H51A 2BMOB 1NJI4 5JPUA 1L5GB 5D83A 1N8R4 1VQK3 3CCM3 1YJN3 3CC73 1W01A 3JUQA 3G0KA 1K9M4 2HMKB 4HZ9B 1N9EA 4XBYA 4EBGA 1MNLA 2CFGA 1JB2A 2XH9A 3DY5A 3WODG 1IK3A 1MOLA 3IPTA 4HM0B 3X42A 2P05A 3EQQB 3UNLA 2CWUA 3K63A 1OF5B 5KP3A 2HMOB 2CWTA 2YFLB 3H3HA 2P09A 1YIJ3 3NX0A 5CK6A 1NU3A 3WA3A 1YI23 3CNMA 2JDIH 1PU4A 1IT8A 1Q42A 4LMIA 1DMQA 4IIAA 1WTHA 2OTL3 2OCTA 3ECFA 2CH9A 1JB4A 3AMOB 4LZIA 4HM1B 3PYJA 1M9GA 4X2HA 3NHXA 1D6ZA 3MHEA 3NM2A 1S723 3WOFB 3CU3A 4L8OA 5FW5A 4O8SA 4LEHA 8CHOA 1HKXA 1UI8A 2MF7A 4MMYB 3T8NA 2XF3A 3CCL3 1W5ZA 1IDPA 4N3VA 3G16A 1YJW3 1N9JA 3NBJA 3SOAA 5IERA 2CC3A 2W9QA 3X40A 1CEWI 5TGNA 2RCDA 3F8XA 3FF2A 1GY5A 1W4NA 3G8ZA 1M1K4 2O9UX 1E3VA 3STDA 1A90A 1Q7Y4 4K61A 1W00A 5AI1A 1AV4A 2V1LA 3DZLA 2JQ5A 1RRHA 2CFWA 1GD4A 3NXJA 1IV9A 4J9AA 1JRQA 4RZMA 2P0MA 1TU5A 2P0XA 1K41A 3A76A 2A15A 1D6UA 3MYTA 1UUWB 3DGNA 5ELJA 1ZX2A 2Y74A 1UI7A 3JUNA 4EV5A 5KP4A 1YVBI 2OTJ3 3CMA3 4AKYA 2D42A 3SXXA 3DM8A 1VQL3 4HBRA 3LOYA 1FA3A 3MSOA 1VQ63 2WGQA 1SQWA 1CYUA 1VQP3 1K734 3N54B 1V74A 4NREA 1IT7A 3X3XA 4TX4A 1EKMA 3B4PA 3FF0A 2GEXA 2P38A 4BTWA 4XM4A 3KKGA 4Q53A 1VQO3 1C7HA 1GS3A 4FCJA 2R4IA 1OGZA 2OQEA 2ML5A 1U8CB 3LMLA 3CNXA 4K1UA 5AEWB 2CWVA 3MPHA 4L8PA 3CCV3 3KN4A 3FSDA 2LQVA 1EG9B 1O7HB 2WOHA 3DGMA 3KFQC 4PEJA 4LGQA 4QWTA 3CCS3 2CHCA 3EBTA 3ALAA 1D6YA 2UX0A 3FG4A 5ELUA 1LVNA 1Q40B 4J8TA 4CDLA 5G2GA 1W2ZA 2FNQA 1IU7A 1OHOA 2QIYA 3F7SA 1VQ53 3LYGA 3LT9A 1NB3I 2L4VA 5LC7A 4HM3B 1WNHA 2XFSA 2WO0A 2F99A 1WMNA 5CF2A 2QA43 2K0MA 1ASKA 2XFTA 3S67A 1QAFA 2STDA 1SJWA 3LZAA 2IMJA 2WOFA 3I553 3GWRA 1A67A 2CG0A 5A0OB 3S28A 3CD63 3F40A 1FGMA 3HIGA 3SVAA 1O7MB 1YHQ3 3I563 2MC8A 1FUWA 2YX9A 3BNDA 1SPUA 5AEUB 1YJ93 4JRFA 1STFI 4XB5A 3Q90A 2CIUA 3EHCA 2CFKA 1NO3A 3IJEB 2IUKA 3FCSB 3PGBA 5AIIA 1ISKA 2W9PA 1YIT3 1N8QA 2B1XB 3HIIA 4K90B 2E2UA 1FGRA 2LYXA 2Z7AA 2QGUA 2IA7A 3F8HA 3GZXB 5IEOA 3UJMA 2GBXB 3F9SA 4HM4B 1VQ73 4N6V0 5BXQA 2BMRB 4GB5A 3N9HA 3WMDA 3V98A 3O8YA 4MEIA 1JV2B 1STDA 1VQM3 1JKGB 1SIHA 4IPBA 4KVHA 4RNYA 4N6NB 2QEX3 4RBNA 1TFKA 1YGEA 3LTDA 1O7PB 3UB1A 2GBWB 3DGOA 4KFDA 3EE1A 3WOEB 3NM7A 1IVXA 4OK0A 4ZM8A 3JUMA 1IVVA 3CPOA 4N6OB 3NV0A 4XBTA 1JN5A 1AVKA 2XSHB 4L7KA 3X3YA 1ZO2A 2OOVA 5FGOA 2INXA 3UL6A 4AEQA 1K8A4 3G4S3 1KD14 3CCJ3 3K0ZA 5AIGA 3OV4A 2Z76A 5DRVA 2F98A 2IUJA 2CW9A 5AIFA 2GU3A 3EJVA 2PZVA 3CPW2 3NQZA 1M1XB 4HZBB 2BNGA 3MG3A 2ZL8A 2W04A 1WQLB 3K7CA 4WYKA 2BT3A 4N6MA 3K9MC 4WWUC 4H61A 5JPPA 1OHPA 3PCRA 1IQ8A 1HU9A 3L0RA 3B8LA 2RSXA 2Q07A 3OXAA 3CC23 3PCSA 1N5HA 4R80A 1JNQA 1TIJA 3SEDA 3CC43 4FCMA 3G6E3 1OCVA 4CCVA 4EC6A 1IQXA 4FMDA 3LT8A 3DMCA 3HK4A 3NV0B 2F86B 2OWPA 4X2OA 1KQS2 1JJ22 2XRXB 1Z1SA 3GZBA 3JUPA 3BLZA 2XEPA 4R9LA 2O3OA 3SX1A 4G1MB 1W6CA 1A2KA 1JB5A 2BMQB 4NHFA 3LXUX 3X41A 3VF1A 5AIHA 4WP5A 2W56A 4N6UA 5BVBA 4R9KA 4XBXA 3KZTA 3SOYA 3PS8A 4N6LA 4KFEA 3MKIA 4WYKB 3JVCA 4O02B 1DMMA 5IEPA 4KFFA 3B4OA 2D1WA 3HI7A 2CFDA 1Q814 1WMOA 1O7WB 4I4KA 4U13A 5IG5A 5D82A 1J2BA 4BTXA 3BNCA 5LC6A 1GYBA 3NUVA 3X3ZA 3OWUA 4EYCA 1DVDA 5AYRB 2C10A 2CFLA 1IVUA 3DUKA 1OH0A 3EBYA 1EA2A 3QRDA 3WDGB 4IT7A 3K5TA 4HM8B 1VQN3 3EC9A 1U5OA 1BUQA 5IW9A 2B24B 2Z77A 1WMPA 1FGOA 4R1KA 5CF1A 3EF8A 2KCDA 3ROBA 3GRDA 3V92A 3J7Yd 1GY6A 4OUQA 2XGNA 2W56B 3JUOA 1NB5I 3FH1A 3S27A 2ML6A 3BB9A 4EXRA 3UL5A 2HMMB 1TUHA 1AVLA 3NQYA 3EN8A 4RNZA 4STDA 2M7OA 1FGQA 5IG0A 3CCR3 3GZYB 3GAXA 4EV2A 1ROAA 2RFRA 4FMBA 4XDVA 4HM6B 3EX9A 3U97A 3U1WA 1W7CA 3MG2A 7STDA 2E2VA 1VQ83 1A2VA 3EB8A 3WA2X 1DYUA 3LTAA 1RN7A 1W02A 3FG1A 2HMNB 3NBBA 1LNHA 3OWSA 1DMNA 3HX8A 3OW22 3DGLA 3FG3A 5CLKA 1RRLA 1OPYA 1RJOA 3CCQ3 3KIIA 1OUNA 5CXOA 3D3LA 5EQLA 5I97A 2Y73A 1ULIB 3QK9A 3B7CA 4FMCA 3F14A 4MJDA 4HVNA 1GD3A 1TP6A 2W2CA 2C11A 1OGXA 1T5YA 3VSYA 3KSPA 3MWZA 2OQEC 3LTBA 3KE7A 1R4CA 3NBRA 3BNEA 1IQYA 2CG1A 4BTYA 4WFOA 2KRTA 1VQ93 2HMJB 4MMZB 1E97A 2YFJB 4OVMA 3RGRA 1RKYA 1Q864 4H3UA 1OHSA 3LH4A 3IMAB 1QJGA 1US1A 3CME3 5JBSA 1QAKA 1G96A 3V99A 1TFOA 1S5AA 2HMLB 2SBLA 3FGYA 3FKAA 1AR0A 2FGTA 2GXFA 4MMXB 3DXOA 4N6TA 5IENA 2W03A 4JF8A 3T0UA 1GY7A 2CK3H 2W0QA 2GEYA 1LOXA 4FCZA 1E3RA 4HM2B 1KC84 1QALA 3N8BA 4O2HA 1M904 2ZDJA 1N5PA 4O3VA 5EVHA 1CQSA 4HM7B 3GZRA 5D81A 2W6JH 3OWYA 1JN5B 3SLUA 1QMAA 4R4KA 4LSOA 3MG1A 3S5CA 3S29A 4FR9A 3M8CA 1KSIA 2BO9B 4HJLB 2WGOA 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C10 A;  2IA7 A;  2CFL A;  1IVU A;  1W5Z A;  3NBJ A;  3K5T A;  3N9H A;  3X40 A;  5IW9 A;  1SIH A;  1WMP A;  1W4N A;  1W6G A;  4KFD A;  1AV4 A;  1IVX A;  1IVW A;  1IVV A;  4EXR A;  2CFW A;  1AVK A;  1TU5 A;  1JRQ A;  3X3Y A;  1AVL A;  2OOV A;  3NQY A;  1D6U A;  1OAC A;  2Y74 A;  4EV2 A;  1UI7 A;  4EV5 A;  1W7C A;  2E2T A;  4K90 B;  2E2V A;  2GU3 A;  1A2V A;  2OOV C;  3SXX A;  3NQZ A;  3LOY A;  3WA2 X;  1DYU A;  2WGQ A;  1SII A;  2ZL8 A;  3NBB A;  2PNC A;  3X3X A;  2BT3 A;  1EKM A;  1RJO A;  4BTW A;  3KII A;  2Y73 A;  2OQE A;  3AMO A;  2CWV A;  3MPH A;  2C11 A;  3KN4 A;  1IQX A;  2WOH A;  2OQE C;  3ALA A;  1D6Y A;  4BTY A;  1IQY A;  2CG1 A;  1N9E A;  1LVN A;  2CFG A;  1W2Z A;  1IU7 A;  1RKY A;  1US1 A;  3X42 A;  2WO0 A;  1WMN A;  3SX1 A;  1W6C A;  2K0M A;  1QAK A;  2CWU A;  3X41 A;  1QAF A;  2CWT A;  2WOF A;  2CG0 A;  3T0U A;  3WA3 A;  2W0Q A;  3HIG A;  4KFE A;  1QAL A;  1PU4 A;  4KFF A;  2YX9 A;  2D1W A;  1SPU A;  3HI7 A;  2CFD A;  3AMO B;  1WMO A;  2CFK A;  1D6Z A;  3PGB A;  4BTX A;  3X3Z A;  3HII A;  1KSI A;  2E2U A;  1UI8 A; 
#chains in the Genus database with same CATH topology
 1UUV B;  5IG4 A;  4HYZ A;  3T8U A;  1G02 A;  4HKV B;  1ULJ B;  3F7X A;  2IYJ A;  2KF4 A;  5KP1 A;  1Y4K A;  4HM5 B;  1FUS A;  1EQK A;  1VQ4 3;  1BSD A;  3RGA A;  1B2M A;  2FXT A;  3CCU 3;  4HOH A;  4XDW A;  3BNB A;  3D9R A;  5IG3 A;  3HZP A;  2GU1 A;  4ORL A;  5BIR A;  1NWW A;  1UW1 A;  2CKF B;  3I0Y A;  1VZZ A;  1NDO B;  3E99 A;  1TRP A;  4K1V A;  2BHM A;  1KWI A;  1W6G A;  1Q40 A;  3PZW A;  1TJD A;  2I9W A;  3VGN A;  1O7G B;  5G1K A;  1IVW A;  3KSE D;  2K54 A;  1IV7 A;  3FZW A;  2H0G A;  3D5I A;  3Q2P A;  2KXG A;  1BNI A;  1GSP A;  3ER7 A;  1QVF 2;  1OAC A;  2XR8 B;  6STD A;  1NNV A;  4GSP A;  1JZO A;  3RDE A;  3PXM A;  1I2G A;  5IF6 A;  1CYV A;  2E2T A;  1OF5 A;  1TRQ A;  1X1U A;  4GL6 A;  2OOV C;  4WHA A;  5DRE A;  3RNT A;  5AYS C;  3Q1C A;  4KZ1 A;  1LXE A;  3CCE 3;  3FLJ A;  1SII A;  1QVG 2;  3G71 3;  2PNC A;  5STD A;  4CPK A;  4AKZ A;  4FMA A;  1RDS A;  1JKG A;  1EUI C;  1ROV A;  1F8N A;  3CXC 2;  5HGR A;  1PFP A;  1FGT A;  1Q82 4;  3TDG A;  2XSO B;  1W2B 2;  2RGQ A;  1O7N B;  1DVC A;  3AMO A;  3LTC A;  1W6Y A;  2Z6B A;  3EN1 B;  3OX9 A;  1K28 A;  5EEO A;  2YFI B;  3H51 A;  2BMO B;  3AHS A;  1X1X A;  1NJI 4;  5JPU A;  1X1Y A;  1L5G B;  5D83 A;  1N8R 4;  2KF5 A;  1VQK 3;  6GSP A;  2CX0 A;  3CCM 3;  3CC7 3;  1YJN 3;  1W01 A;  1BUJ A;  1UGI A;  3JUQ A;  3G0K A;  4J5K A;  4LYL B;  1K9M 4;  2HMK B;  4HZ9 B;  1N9E A;  4XBY A;  4EBG A;  1MNL A;  2CFG A;  1BSB A;  1JB2 A;  2XH9 A;  2ZA4 A;  3DY5 A;  3WOD G;  1IK3 A;  1MOL A;  3IPT A;  3AGO A;  1B2Z A;  1MGR A;  4HM0 B;  3X42 A;  2P05 A;  3EQQ B;  3UNL A;  2CWU A;  1RGE A;  1OF5 B;  3K63 A;  3KCH A;  1B2X A;  5KP3 A;  2HMO B;  2CWT A;  2YFL B;  1X1W A;  1FUT A;  3H3H A;  2P09 A;  1YIJ 3;  3NX0 A;  5CK6 A;  1NU3 A;  3WA3 A;  1YI2 3;  3CNM A;  2JDI H;  1PU4 A;  1IT8 A;  3D4A A;  1FW7 A;  1Q42 A;  4LMI A;  1DMQ A;  4IIA A;  1WTH A;  2OTL 3;  2OCT A;  3ECF A;  2CH9 A;  1JB4 A;  3AMO B;  4LZI A;  4HM1 B;  3PYJ A;  1M9G A;  4X2H A;  3NHX A;  1D6Z A;  3MHE A;  3NM2 A;  1S72 3;  6RNT A;  3WOF B;  3CU3 A;  4L8O A;  1AQZ A;  5FW5 A;  4O8S A;  4LEH A;  8CHO A;  1HKX A;  1UI8 A;  2MF7 A;  4MMY B;  1Q7H A;  2F5W A;  3T8N A;  2XF3 A;  3CCL 3;  1W5Z A;  1RN4 A;  1IDP A;  4N3V A;  3G16 A;  1YJW 3;  1N9J A;  1I2E A;  3NBJ A;  3SOA A;  5IER A;  2CC3 A;  2W9Q A;  1R4Y A;  1RCL A;  1CEW I;  3X40 A;  8RNT A;  5TGN A;  2RCD A;  3F8X A;  3FF2 A;  1GY5 A;  1W4N A;  1EEJ A;  3G8Z A;  1M1K 4;  5M18 A;  2O9U X;  1E3V A;  2AAD A;  3STD A;  1A90 A;  1Q7Y 4;  1BAO A;  4K61 A;  1W00 A;  1BAN A;  5AI1 A;  4CJN A;  1AV4 A;  2UUG C;  2V1L A;  3DZL A;  2JQ5 A;  1RRH A;  2CFW A;  1GD4 A;  3NXJ A;  1IV9 A;  4J9A A;  1JRQ A;  4RZM A;  2P0M A;  1TU5 A;  1RGK A;  1K41 A;  2P0X A;  3WR2 A;  3A76 A;  2A15 A;  1D6U A;  4RNT A;  3MYT A;  1UUW B;  2ZHX B;  3DGN A;  5ELJ A;  1ZX2 A;  2Y74 A;  1C54 A;  1BNE A;  1UI7 A;  3JUN A;  4EV5 A;  5KP4 A;  1YVB I;  2OTJ 3;  1Q9E A;  3CMA 3;  4AKY A;  1RGH A;  2D42 A;  2F4Y A;  3DM8 A;  3SXX A;  1VQL 3;  4HBR A;  3LOY A;  7GSP A;  1FA3 A;  3MSO A;  1VQ6 3;  2WGQ A;  1SQW A;  1CYU A;  1VQP 3;  1K73 4;  3N54 B;  1V74 A;  2KAA A;  4NRE A;  1IT7 A;  1UCJ A;  3X3X A;  4TX4 A;  1EKM A;  3B4P A;  3FF0 A;  2GEX A;  2P38 A;  4BTW A;  4XM4 A;  3KKG A;  1B27 A;  4Q53 A;  1C7H A;  1RN1 A;  1VQO 3;  1GS3 A;  4FCJ A;  2R4I A;  1OGZ A;  2C4B A;  2OQE A;  2ML5 A;  1B20 A;  1U8C B;  3LML A;  3CNX A;  4K1U A;  1UDI I;  5AEW B;  2CWV A;  1RHL A;  3MPH A;  4L8P A;  3KN4 A;  3FSD A;  3CCV 3;  2LQV A;  1EG9 B;  1O7H B;  2WOH A;  1RSN A;  3DGM A;  3KFQ C;  4PEJ A;  4LGQ A;  4QWT A;  1UCI A;  3CCS 3;  1BRN L;  2CHC A;  3EBT A;  3ALA A;  1D6Y A;  2UX0 A;  3HOH A;  3FG4 A;  5ELU A;  1LVN A;  1Q40 B;  4J8T A;  4CDL A;  5G2G A;  1W2Z A;  2FNQ A;  1IU7 A;  1OHO A;  2KF3 A;  2QIY A;  3F7S A;  1VQ5 3;  3LYG A;  1LNI A;  3LT9 A;  1NB3 I;  2L4V A;  5LC7 A;  4HM3 B;  1WNH A;  2XFS A;  1I3I A;  2WO0 A;  2F99 A;  1WMN A;  5CF2 A;  9RNT A;  2QA4 3;  2K0M A;  1ASK A;  1G0T A;  2XFT A;  1T3B A;  3S67 A;  1BRS A;  1QAF A;  2STD A;  1SJW A;  3LZA A;  2IMJ A;  2WOF A;  3I55 3;  1JBS A;  2KF6 A;  3GSP A;  3GWR A;  2AAE A;  1A67 A;  2CG0 A;  5A0O B;  5BU4 A;  3S28 A;  3CD6 3;  3F40 A;  1FGM A;  3HIG A;  3SVA A;  1O7M B;  1BVI A;  1YHQ 3;  3I56 3;  1V57 A;  2MC8 A;  1FUW A;  2YX9 A;  3BND A;  1SPU A;  5AEU B;  1GMR A;  1YJ9 3;  4JRF A;  1STF I;  4XB5 A;  3Q90 A;  2CIU A;  3EHC A;  2CFK A;  1NO3 A;  3IJE B;  2IUK A;  3FCS B;  3PGB A;  1AY7 A;  5AII A;  1ISK A;  2W9P A;  1YIT 3;  1N8Q A;  2B1X B;  3HII A;  4K90 B;  1I8V A;  1FGR A;  2E2U A;  2LYX A;  2Z7A A;  1GOU A;  1BRH A;  1A2P A;  2IA7 A;  2QGU A;  3F8H A;  3GZX B;  5IEO A;  3UJM A;  1HZ1 A;  2GBX B;  3AGN A;  1YVS A;  3F9S A;  4HM4 B;  1LOY A;  4N6V 0;  5BXQ A;  1BIR A;  5M19 A;  2BMR B;  1VQ7 3;  4GB5 A;  4NPB A;  1PY3 A;  3N9H A;  3WMD A;  3V98 A;  2RNT A;  3O8Y A;  4MEI A;  1JV2 B;  1STD A;  1BNF A;  1VQM 3;  1JKG B;  1SIH A;  4IPB A;  4KVH A;  4RNY A;  4N6N B;  2QEX 3;  4RBN A;  1TFK A;  1YGE A;  3LTD A;  1O7P B;  3UB1 A;  2GBW B;  3DGO A;  4KFD A;  1DET A;  3EE1 A;  3WOE B;  1VQQ A;  3NM7 A;  1IVX A;  4OK0 A;  1I3F A;  3JUM A;  1HYF A;  4ZM8 A;  1IVV A;  3CPO A;  4N6O B;  1V58 A;  2SAR A;  3NV0 A;  4XBT A;  1JN5 A;  1AVK A;  4I5Q A;  2F5M A;  2XSH B;  4L7K A;  3X3Y A;  1ZO2 A;  2OOV A;  5FGO A;  2INX A;  3UL6 A;  4AEQ A;  1LOW A;  3G4S 3;  1K8A 4;  1KD1 4;  3CCJ 3;  3K0Z A;  5AIG A;  3OV4 A;  2Z76 A;  5DRV A;  2F98 A;  3A5E A;  2IUJ A;  2CW9 A;  5AIF A;  2GU3 A;  3EJV A;  4KT3 B;  4EW5 A;  2PZV A;  3CPW 2;  3NQZ A;  1BNR A;  1M1X B;  4HZB B;  2BNG A;  1I2F A;  1GOY A;  3MG3 A;  2ZL8 A;  2L1S A;  2W04 A;  1WQL B;  1BRG A;  3K7C A;  4WYK A;  2BT3 A;  4N6M A;  3K9M C;  1SAR A;  4WWU C;  3ZG0 A;  2IY2 A;  1UUG B;  4H61 A;  5JPP A;  1OHP A;  1RLS A;  1UGH I;  1IQ8 A;  3PCR A;  4BL3 A;  1HU9 A;  3L0R A;  3B8L A;  1B2U A;  2RSX A;  2Q07 A;  1MWS A;  3BIR A;  3OXA A;  2HOH A;  3PCS A;  3CC2 3;  1N5H A;  4R80 A;  1JNQ A;  1TIJ A;  1RNB A;  3SED A;  3CC4 3;  1FZU A;  4FCM A;  3G6E 3;  1OCV A;  4CCV A;  1BRI A;  4EC6 A;  1IQX A;  1BNS A;  4FMD A;  1MWT A;  1TTO A;  3LT8 A;  4HAA A;  3WHO A;  3DMC A;  2K3D A;  3HK4 A;  3NV0 B;  2F86 B;  2OWP A;  4X2O A;  1KQS 2;  1JJ2 2;  3D5G A;  1PYL A;  2XRX B;  1Z1S A;  5GSP A;  3GZB A;  1BU4 A;  3JUP A;  3BLZ A;  2XEP A;  2CX1 A;  4R9L A;  2O3O A;  3SX1 A;  4G1M B;  1W6C A;  3URP A;  1A2K A;  1JB5 A;  1LQM B;  2BMQ B;  4NHF A;  3LXU X;  3X41 A;  3VF1 A;  5AIH A;  4WP5 A;  2W56 A;  4N6U A;  5BVB A;  1GOV A;  1RTU A;  1YGW A;  4R9K A;  4XBX A;  3KZT A;  1CH0 A;  3SOY A;  1I70 A;  3PS8 A;  4N6L A;  3BU4 A;  3MKI A;  1ZS7 A;  4KFE A;  3JVC A;  4O02 B;  1DMM A;  4WYK B;  5G1L A;  5IEP A;  4KFF A;  3D79 A;  3B4O A;  2D1W A;  3HI7 A;  2CFD A;  3DH2 A;  1Q81 4;  1RGL A;  1O7W B;  1WMO A;  4I4K A;  4U13 A;  5D82 A;  5IG5 A;  4GHO A;  1J2B A;  4BTX A;  1BNG A;  3BNC A;  1I0X A;  5LC6 A;  1GYB A;  2F56 A;  3NUV A;  3X3Z A;  1BNJ A;  1UCL A;  3OWU A;  4EYC A;  1DVD A;  5AYR B;  2C10 A;  1RGF A;  1IVU A;  2CFL A;  3DUK A;  1OH0 A;  4ILF A;  3EBY A;  1EA2 A;  2UGI A;  3QRD A;  3SYU A;  3WDG B;  4IT7 A;  3K5T A;  4HM8 B;  1VQN 3;  3EC9 A;  1U5O A;  5M1A A;  1BUQ A;  5RNT A;  5IW9 A;  1LQG C;  2B24 B;  2Z77 A;  3Q3F A;  1JZD A;  1WMP A;  1FGO A;  4R1K A;  5CF1 A;  3EF8 A;  2KCD A;  3ROB A;  3GRD A;  3V92 A;  3J7Y d;  1GY6 A;  4OUQ A;  2XGN A;  2W56 B;  3JUO A;  1NB5 I;  3FH1 A;  3S27 A;  1MGW A;  3AHW A;  1JBT A;  2ML6 A;  3BB9 A;  4EXR A;  1RGG A;  3UL5 A;  2HMM B;  1UCK A;  1TUH A;  2GSP A;  3DGY A;  1AVL A;  3NQY A;  3EN8 A;  4RNZ A;  4STD A;  1RGC A;  2M7O A;  1FGQ A;  1B3S A;  5IG0 A;  3CCR 3;  3GZY B;  1IYY A;  3GAX A;  1T2H A;  4EV2 A;  1ROA A;  2RFR A;  4FMB A;  4XDV A;  4HM6 B;  3EX9 A;  3U97 A;  3U1W A;  1W7C A;  3MG2 A;  7STD A;  2E2V A;  1VQ8 3;  1ZGX A;  1A2V A;  1RNT A;  3EB8 A;  3WA2 X;  1DYU A;  3LTA A;  1RN7 A;  1W02 A;  3FG1 A;  2HMN B;  3NBB A;  1LNH A;  3OWS A;  1DMN A;  1LRA A;  1DE3 A;  3HX8 A;  3OW2 2;  3DGL A;  3FG3 A;  5CLK A;  1RRL A;  1I0V A;  1OPY A;  1RJO A;  3CCQ 3;  3KII A;  1OUN A;  1B21 A;  3ZG5 A;  5CXO A;  3D3L A;  5EQL A;  5I97 A;  2Y73 A;  1BOX A;  1ULI B;  3QK9 A;  1RGA A;  3B7C A;  4FMC A;  3F14 A;  1BRK A;  4MJD A;  7RNT A;  1YNV X;  4HVN A;  1GD3 A;  1TP6 A;  4BL2 A;  2W2C A;  2C11 A;  1OGX A;  1T2I A;  4J5G A;  1T5Y A;  3VSY A;  3KSP A;  3MWZ A;  2OQE C;  3LTB A;  3KE7 A;  1R4C A;  3NBR A;  4DKI A;  1BRJ A;  3BNE A;  1IQY A;  2CG1 A;  4BTY A;  4WFO A;  2KRT A;  1VQ9 3;  2HMJ B;  4MMZ B;  1E97 A;  1GMP A;  2YFJ B;  4OVM A;  3RGR A;  1RKY A;  1Q86 4;  4H3U A;  1OHS A;  2BO9 B;  3LH4 A;  2BIR A;  2R41 A;  1QJG A;  3IMA B;  1FYS A;  1LOV A;  1US1 A;  3CME 3;  5JBS A;  1RMS A;  1JBR A;  1BGS A;  1QAK A;  1G96 A;  3V99 A;  1TFO A;  1MWU A;  1S5A A;  2HML B;  2SBL A;  3FGY A;  3FKA A;  1AR0 A;  2FGT A;  2GXF A;  4MMX B;  3DXO A;  4N6T A;  4BU4 A;  5IEN A;  2W03 A;  4JF8 A;  3T0U A;  1GY7 A;  2CK3 H;  2W0Q A;  1RCK A;  1BSC A;  2GEY A;  1LOX A;  4FCZ A;  1E3R A;  4HM2 B;  1KC8 4;  1QAL A;  2H0H A;  2RBI A;  3N8B A;  4O2H A;  1M90 4;  2J8X B;  2ZDJ A;  1N5P A;  1B2S A;  4O3V A;  5EVH A;  1CQS A;  1GMQ A;  3GZR A;  4HM7 B;  5D81 A;  2W6J H;  3OWY A;  1JN5 B;  1BSA A;  4BIR A;  3SLU A;  3ZFZ A;  1QMA A;  4R4K A;  2H0I A;  4LSO A;  2BU4 A;  3MG1 A;  3S5C A;  3S29 A;  4FR9 A;  1BSE A;  1KSI A;  3M8C A;  1MWR A;  4HJL B;  2WGO A;  2XGL A;  5HOH A; 
#chains in the Genus database with same CATH homology
 1UUV B;  5IG4 A;  4HYZ A;  3T8U A;  4HKV B;  1ULJ B;  3F7X A;  5KP1 A;  1Y4K A;  4HM5 B;  1EQK A;  1VQ4 3;  3RGA A;  2FXT A;  3CCU 3;  4XDW A;  3BNB A;  3D9R A;  5IG3 A;  3HZP A;  2GU1 A;  4ORL A;  1NWW A;  1UW1 A;  2CKF B;  3I0Y A;  1VZZ A;  1NDO B;  3E99 A;  4K1V A;  2BHM A;  1KWI A;  1W6G A;  1Q40 A;  3PZW A;  2I9W A;  3VGN A;  1O7G B;  1IVW A;  3KSE D;  2K54 A;  1IV7 A;  3FZW A;  3Q2P A;  2KXG A;  3ER7 A;  1QVF 2;  1OAC A;  2XR8 B;  6STD A;  3RDE A;  3PXM A;  5IF6 A;  1CYV A;  2E2T A;  1OF5 A;  4GL6 A;  4WHA A;  5DRE A;  2OOV C;  5AYS C;  3Q1C A;  4KZ1 A;  1LXE A;  3CCE 3;  3FLJ A;  1SII A;  1QVG 2;  3G71 3;  2PNC A;  5STD A;  4AKZ A;  4FMA A;  1JKG A;  1ROV A;  1F8N A;  3CXC 2;  5HGR A;  1PFP A;  1FGT A;  1Q82 4;  3TDG A;  2XSO B;  1W2B 2;  2RGQ A;  1O7N B;  1DVC A;  3AMO A;  3LTC A;  1W6Y A;  2Z6B A;  3EN1 B;  3OX9 A;  1K28 A;  5EEO A;  2YFI B;  3H51 A;  2BMO B;  1NJI 4;  5JPU A;  1L5G B;  5D83 A;  1N8R 4;  1VQK 3;  3CCM 3;  1YJN 3;  3CC7 3;  1W01 A;  3JUQ A;  3G0K A;  1K9M 4;  2HMK B;  4HZ9 B;  1N9E A;  4XBY A;  4EBG A;  1MNL A;  2CFG A;  1JB2 A;  2XH9 A;  3DY5 A;  3WOD G;  1IK3 A;  1MOL A;  3IPT A;  4HM0 B;  3X42 A;  2P05 A;  3EQQ B;  3UNL A;  2CWU A;  3K63 A;  1OF5 B;  5KP3 A;  2HMO B;  2CWT A;  2YFL B;  3H3H A;  2P09 A;  1YIJ 3;  3NX0 A;  5CK6 A;  1NU3 A;  3WA3 A;  1YI2 3;  3CNM A;  2JDI H;  1PU4 A;  1IT8 A;  1Q42 A;  4LMI A;  1DMQ A;  4IIA A;  1WTH A;  2OTL 3;  2OCT A;  3ECF A;  2CH9 A;  1JB4 A;  3AMO B;  4LZI A;  4HM1 B;  3PYJ A;  1M9G A;  4X2H A;  3NHX A;  1D6Z A;  3MHE A;  3NM2 A;  1S72 3;  3WOF B;  3CU3 A;  4L8O A;  5FW5 A;  4O8S A;  4LEH A;  8CHO A;  1HKX A;  1UI8 A;  2MF7 A;  4MMY B;  3T8N A;  2XF3 A;  3CCL 3;  1W5Z A;  1IDP A;  4N3V A;  3G16 A;  1YJW 3;  1N9J A;  3NBJ A;  3SOA A;  5IER A;  2CC3 A;  2W9Q A;  3X40 A;  1CEW I;  5TGN A;  2RCD A;  3F8X A;  3FF2 A;  1GY5 A;  1W4N A;  3G8Z A;  1M1K 4;  2O9U X;  1E3V A;  3STD A;  1A90 A;  1Q7Y 4;  4K61 A;  1W00 A;  5AI1 A;  1AV4 A;  2V1L A;  3DZL A;  2JQ5 A;  1RRH A;  2CFW A;  1GD4 A;  3NXJ A;  1IV9 A;  4J9A A;  1JRQ A;  4RZM A;  2P0M A;  1TU5 A;  2P0X A;  1K41 A;  3A76 A;  2A15 A;  1D6U A;  3MYT A;  1UUW B;  3DGN A;  5ELJ A;  1ZX2 A;  2Y74 A;  1UI7 A;  3JUN A;  4EV5 A;  5KP4 A;  1YVB I;  2OTJ 3;  3CMA 3;  4AKY A;  2D42 A;  3SXX A;  3DM8 A;  1VQL 3;  4HBR A;  3LOY A;  1FA3 A;  3MSO A;  1VQ6 3;  2WGQ A;  1SQW A;  1CYU A;  1VQP 3;  1K73 4;  3N54 B;  1V74 A;  4NRE A;  1IT7 A;  3X3X A;  4TX4 A;  1EKM A;  3B4P A;  3FF0 A;  2GEX A;  2P38 A;  4BTW A;  4XM4 A;  3KKG A;  4Q53 A;  1VQO 3;  1C7H A;  1GS3 A;  4FCJ A;  2R4I A;  1OGZ A;  2OQE A;  2ML5 A;  1U8C B;  3LML A;  3CNX A;  4K1U A;  5AEW B;  2CWV A;  3MPH A;  4L8P A;  3CCV 3;  3KN4 A;  3FSD A;  2LQV A;  1EG9 B;  1O7H B;  2WOH A;  3DGM A;  3KFQ C;  4PEJ A;  4LGQ A;  4QWT A;  3CCS 3;  2CHC A;  3EBT A;  3ALA A;  1D6Y A;  2UX0 A;  3FG4 A;  5ELU A;  1LVN A;  1Q40 B;  4J8T A;  4CDL A;  5G2G A;  1W2Z A;  2FNQ A;  1IU7 A;  1OHO A;  2QIY A;  3F7S A;  1VQ5 3;  3LYG A;  3LT9 A;  1NB3 I;  2L4V A;  5LC7 A;  4HM3 B;  1WNH A;  2XFS A;  2WO0 A;  2F99 A;  1WMN A;  5CF2 A;  2QA4 3;  2K0M A;  1ASK A;  2XFT A;  3S67 A;  1QAF A;  2STD A;  1SJW A;  3LZA A;  2IMJ A;  2WOF A;  3I55 3;  3GWR A;  1A67 A;  2CG0 A;  5A0O B;  3S28 A;  3CD6 3;  3F40 A;  1FGM A;  3HIG A;  3SVA A;  1O7M B;  1YHQ 3;  3I56 3;  2MC8 A;  1FUW A;  2YX9 A;  3BND A;  1SPU A;  5AEU B;  1YJ9 3;  4JRF A;  1STF I;  4XB5 A;  3Q90 A;  2CIU A;  3EHC A;  2CFK A;  1NO3 A;  3IJE B;  2IUK A;  3FCS B;  3PGB A;  5AII A;  1ISK A;  2W9P A;  1YIT 3;  1N8Q A;  2B1X B;  3HII A;  4K90 B;  2E2U A;  1FGR A;  2LYX A;  2Z7A A;  2QGU A;  2IA7 A;  3F8H A;  3GZX B;  5IEO A;  3UJM A;  2GBX B;  3F9S A;  4HM4 B;  1VQ7 3;  4N6V 0;  5BXQ A;  2BMR B;  4GB5 A;  3N9H A;  3WMD A;  3V98 A;  3O8Y A;  4MEI A;  1JV2 B;  1STD A;  1VQM 3;  1JKG B;  1SIH A;  4IPB A;  4KVH A;  4RNY A;  4N6N B;  2QEX 3;  4RBN A;  1TFK A;  1YGE A;  3LTD A;  1O7P B;  3UB1 A;  2GBW B;  3DGO A;  4KFD A;  3EE1 A;  3WOE B;  3NM7 A;  1IVX A;  4OK0 A;  4ZM8 A;  3JUM A;  1IVV A;  3CPO A;  4N6O B;  3NV0 A;  4XBT A;  1JN5 A;  1AVK A;  2XSH B;  4L7K A;  3X3Y A;  1ZO2 A;  2OOV A;  5FGO A;  2INX A;  3UL6 A;  4AEQ A;  1K8A 4;  3G4S 3;  1KD1 4;  3CCJ 3;  3K0Z A;  5AIG A;  3OV4 A;  2Z76 A;  5DRV A;  2F98 A;  2IUJ A;  2CW9 A;  5AIF A;  2GU3 A;  3EJV A;  2PZV A;  3CPW 2;  3NQZ A;  1M1X B;  4HZB B;  2BNG A;  3MG3 A;  2ZL8 A;  2W04 A;  1WQL B;  3K7C A;  4WYK A;  2BT3 A;  4N6M A;  3K9M C;  4WWU C;  4H61 A;  5JPP A;  1OHP A;  3PCR A;  1IQ8 A;  1HU9 A;  3L0R A;  3B8L A;  2RSX A;  2Q07 A;  3OXA A;  3CC2 3;  3PCS A;  1N5H A;  4R80 A;  1JNQ A;  1TIJ A;  3SED A;  3CC4 3;  4FCM A;  3G6E 3;  1OCV A;  4CCV A;  4EC6 A;  1IQX A;  4FMD A;  3LT8 A;  3DMC A;  3HK4 A;  3NV0 B;  2F86 B;  2OWP A;  4X2O A;  1KQS 2;  1JJ2 2;  2XRX B;  1Z1S A;  3GZB A;  3JUP A;  3BLZ A;  2XEP A;  4R9L A;  2O3O A;  3SX1 A;  4G1M B;  1W6C A;  1A2K A;  1JB5 A;  2BMQ B;  4NHF A;  3LXU X;  3X41 A;  3VF1 A;  5AIH A;  4WP5 A;  2W56 A;  4N6U A;  5BVB A;  4R9K A;  4XBX A;  3KZT A;  3SOY A;  3PS8 A;  4N6L A;  4KFE A;  3MKI A;  4WYK B;  3JVC A;  4O02 B;  1DMM A;  5IEP A;  4KFF A;  3B4O A;  2D1W A;  3HI7 A;  2CFD A;  1Q81 4;  1WMO A;  1O7W B;  4I4K A;  4U13 A;  5IG5 A;  5D82 A;  1J2B A;  4BTX A;  3BNC A;  5LC6 A;  1GYB A;  3NUV A;  3X3Z A;  3OWU A;  4EYC A;  1DVD A;  5AYR B;  2C10 A;  2CFL A;  1IVU A;  3DUK A;  1OH0 A;  3EBY A;  1EA2 A;  3QRD A;  3WDG B;  4IT7 A;  3K5T A;  4HM8 B;  1VQN 3;  3EC9 A;  1U5O A;  1BUQ A;  5IW9 A;  2B24 B;  2Z77 A;  1WMP A;  1FGO A;  4R1K A;  5CF1 A;  3EF8 A;  2KCD A;  3ROB A;  3GRD A;  3V92 A;  3J7Y d;  1GY6 A;  4OUQ A;  2XGN A;  2W56 B;  3JUO A;  1NB5 I;  3FH1 A;  3S27 A;  2ML6 A;  3BB9 A;  4EXR A;  3UL5 A;  2HMM B;  1TUH A;  1AVL A;  3NQY A;  3EN8 A;  4RNZ A;  4STD A;  2M7O A;  1FGQ A;  5IG0 A;  3CCR 3;  3GZY B;  3GAX A;  4EV2 A;  1ROA A;  2RFR A;  4FMB A;  4XDV A;  4HM6 B;  3EX9 A;  3U97 A;  3U1W A;  1W7C A;  3MG2 A;  7STD A;  2E2V A;  1VQ8 3;  1A2V A;  3EB8 A;  3WA2 X;  1DYU A;  3LTA A;  1RN7 A;  1W02 A;  3FG1 A;  2HMN B;  3NBB A;  1LNH A;  3OWS A;  1DMN A;  3HX8 A;  3OW2 2;  3DGL A;  3FG3 A;  5CLK A;  1RRL A;  1OPY A;  1RJO A;  3CCQ 3;  3KII A;  1OUN A;  5CXO A;  3D3L A;  5EQL A;  5I97 A;  2Y73 A;  1ULI B;  3QK9 A;  3B7C A;  4FMC A;  3F14 A;  4MJD A;  4HVN A;  1GD3 A;  1TP6 A;  2W2C A;  2C11 A;  1OGX A;  1T5Y A;  3VSY A;  3KSP A;  3MWZ A;  2OQE C;  3LTB A;  3KE7 A;  1R4C A;  3NBR A;  3BNE A;  1IQY A;  2CG1 A;  4BTY A;  4WFO A;  2KRT A;  1VQ9 3;  2HMJ B;  4MMZ B;  1E97 A;  2YFJ B;  4OVM A;  3RGR A;  1RKY A;  1Q86 4;  4H3U A;  1OHS A;  3LH4 A;  3IMA B;  1QJG A;  1US1 A;  3CME 3;  5JBS A;  1QAK A;  1G96 A;  3V99 A;  1TFO A;  1S5A A;  2HML B;  2SBL A;  3FGY A;  3FKA A;  1AR0 A;  2FGT A;  2GXF A;  4MMX B;  3DXO A;  4N6T A;  5IEN A;  2W03 A;  4JF8 A;  3T0U A;  1GY7 A;  2CK3 H;  2W0Q A;  2GEY A;  1LOX A;  4FCZ A;  1E3R A;  4HM2 B;  1KC8 4;  1QAL A;  3N8B A;  4O2H A;  1M90 4;  2ZDJ A;  1N5P A;  4O3V A;  5EVH A;  1CQS A;  4HM7 B;  3GZR A;  5D81 A;  2W6J H;  3OWY A;  1JN5 B;  3SLU A;  1QMA A;  4R4K A;  4LSO A;  3MG1 A;  3S5C A;  3S29 A;  4FR9 A;  3M8C A;  1KSI A;  2BO9 B;  4HJL B;  2WGO A;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...