3NQZA

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
175
Chain Sequence
ANKKYLNQQPTINNMVQSNSVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted metalloprotease Mcp02
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
total genus 41
structure length 175
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA01
1QAKA 1A2VA 1W5ZA 2D1WA 1IVWA 3PGBA 3KIIA 1IVUA 4BTYA 2YX9A 3AMOA 1W6GA 1RJOA 2CFKA 1W4NA 1DYUA 2WGQA 2CG0A 3LOYA 1QAFA 1WMPA 2C10A 4EXRA 3NBJA 3K5TA 4KFEA 3WA2X 1QALA 3KN4A 2OQEA 2ZL8A 2OOVA 2E2VA 1RKYA 3NQZA 1EKMA 2CFLA 1D6UA 3X42A 2CWUA 3NQYA 4K90B 1D6YA 4BTXA 1IVXA 1IU7A 1W7CA 2WOFA 1AVLA 3X40A 3ALAA 3MPHA 1WMNA 3X3XA 4KFFA 2OQEC 1JRQA 1UI7A 1IQXA 1SIIA 2OOVC 1US1A 2CG1A 2K0MA 2WOHA 1TU5A 4BTWA 3HIGA 2IA7A 1W2ZA 2GU3A 3X3ZA 1D6ZA 3AMOB 3X3YA 2E2UA 1PU4A 3HI7A 1OACA 1N9EA 1KSIA 3HIIA 2CFGA 2CFWA 2C11A 2CWVA 1IQYA 3N9HA 1WMOA 1IVVA 1AVKA 3SXXA 3T0UA 2CFDA 2W0QA 1SIHA 2Y73A 3WA3A 1UI8A 2Y74A 3NBBA 2BT3A 5IW9A 1AV4A 4KFDA 2PNCA 1LVNA 4EV5A 1W6CA 3SX1A 1SPUA 4EV2A 2E2TA 2WO0A 2CWTA 3X41A
chains in the Genus database with same CATH superfamily
3B4OA 1QMAA 2KRTA 1QAKA 3B8LA 1K9M4 5BU4A 1A2VA 2GBWB 2OTJ3 2IUJA 3T8UA 3G16A 3NV0A 4J8TA 3DGYA 2BNGA 1FUWA 3G8ZA 3CCL3 1HZ1A 1ULJB 3FZWA 3K9MC 2WGOA 3EF8A 3RNTA 4TX4A 2YFJB 2BHMA 1JB2A 1FGQA 1GS3A 1GY7A 5AIFA 4FMBA 1GY5A 4AKYA 2F99A 4HM3B 2IYJA 2CG0A 1BNIA 1QVF2 3Q90A 3Q3FA 1TP6A 3MWZA 1B2MA 2CIUA 3WHOA 3IJEB 3VF1A 3F8XA 1MWUA 3NBJA 4J5KA 4KFEA 1K734 3KN4A 2ZDJA 1A2KA 4N6LA 2W6JH 3EBTA 3D4AA 1CYVA 1RMSA 2Z7AA 3NUVA 4WYKB 2STDA 1NNVA 2OOVA 1B21A 3ZG0A 2E2VA 1D6UA 4J9AA 3S29A 3I563 1WNHA 6RNTA 1DVDA 1DMQA 1E3RA 1CEWI 3FF2A 3NBRA 1RGAA 1D6YA 2CHCA 1J2BA 1K28A 4BTXA 2CX0A 2HMJB 3N54B 1RN7A 7STDA 5G2GA 1YI23 4KT3B 1I0VA 2XRXB 2XSOB 1VQO3 3PZWA 5A0OB 1NDOB 3CMA3 5AEWB 5M18A 4OK0A 3N8BA 1DMNA 4CJNA 1I2EA 3GZRA 2ZA4A 5G1KA 4HVNA 2JQ5A 3NM2A 3X40A 3CCJ3 4FR9A 1RGEA 1ULIB 2KF4A 3MPHA 4GB5A 4XM4A 1YGEA 1LRAA 1MWTA 3RGAA 1B3SA 1UI7A 3D3LA 4ZM8A 1IQXA 1BU4A 3BIRA 3DXOA 3EQQB 3LTDA 3NHXA 4LMIA 2OOVC 1Q40B 2RCDA 2F5WA 2K0MA 2JDIH 5HGRA 1IT8A 4J5GA 2AAEA 5DREA 1EUIC 3S27A 3HIGA 4RNYA 1BVIA 1W2ZA 3J7Yd 1ZS7A 2K54A 1YNVX 5DRVA 1U8CB 1OHSA 4CCVA 2P38A 1T2HA 4FMDA 5RNTA 3WODG 1DE3A 4HYZA 1Q9EA 1D6ZA 1R4CA 3AMOB 4FCZA 4WYKA 3X3YA 3F9SA 3WOFB 4BL2A 4N6NB 3D5GA 2QGUA 2F5MA 3HI7A 3HIIA 3EBYA 4N6V0 4MMXB 2OCTA 3KE7A 1B2ZA 1JN5A 1BNRA 1SJWA 2AADA 2L4VA 3EX9A 1RCLA 5IG4A 1RNBA 2R4IA 3DY5A 5AYSC 1VQQA 2F98A 1UDII 2HMLB 2KF5A 1GMPA 3DM8A 1BRSA 2BMQB 1AVKA 4LYLB 1ZGXA 4XB5A 2CFDA 2W0QA 5AIHA 1JZDA 3SXXA 1LXEA 1BUQA 3OWSA 3A76A 1BRNL 1MNLA 1CYUA 3WA3A 4EW5A 1JBTA 1OCVA 2BT3A 4RNTA 5IW9A 3CPOA 2IY2A 2OTL3 3ROBA 2H0IA 5CF2A 3ECFA 1EEJA 5JPUA 2PNCA 1W6CA 4EV2A 1UGIA 2CWTA 2HMNB 5CXOA 1N5HA 1LOXA 1UUWB 3F8HA 3JUPA 3MSOA 1JKGB 3VGNA 1BNFA 3SEDA 1G96A 1HKXA 1LQGC 2KAAA 3L0RA 3LZAA 3MG3A 1VQ53 1IDPA 1A2PA 3MKIA 4HM5B 4BTYA 4CPKA 3GZXB 1IT7A 1RGFA 4L8PA 2F86B 3AMOA 3CCS3 1GYBA 4XDWA 4R9LA 1W6GA 4X2OA 1VQM3 2FXTA 1GOVA 1W00A 2Q07A 4JRFA 3FH1A 4OVMA 1NB5I 1RCKA 1C54A 1WTHA 4H3UA 3NM7A 3UJMA 1BNGA 1FUSA 2RSXA 4NREA 2CK3H 5KP3A 3WA2X 4GHOA 2OQEA 3CNMA 1BAOA 1X1WA 3FGYA 1C7HA 2YFLB 1HU9A 1VZZA 3B4PA 1RHLA 3K0ZA 1OF5B 1RGHA 1B2UA 3LXUX 1VQK3 1RLSA 1YJN3 3OX9A 1VQN3 1TJDA 2XR8B 1YHQ3 1RKYA 1B2SA 2W04A 3NQZA 1BSBA 3X42A 1B2XA 3JUOA 4O02B 2HOHA 3GZBA 4K90B 9RNTA 2A15A 2ML6A 2QIYA 1M904 4MMYB 1IVXA 1IU7A 1AY7A 3Q1CA 1HYFA 2KXGA 2XGLA 3HZPA 4MEIA 5AIGA 3FSDA 4AEQA 2B24B 1I3FA 4RBNA 1IV7A 1NWWA 1JNQA 3CPW2 2F4YA 4CDLA 1JKGA 3BB9A 3LMLA 4I4KA 4PEJA 1UUGB 5CF1A 1WMNA 3X3XA 3IPTA 4KFFA 3UL5A 2OQEC 3WR2A 4BL3A 4DKIA 4N6OB 1Z1SA 1OHOA 1SIIA 3G4S3 3JUNA 1GD3A 2RFRA 3DGOA 3MHEA 3O8YA 1N8R4 1GOUA 1TUHA 4O2HA 4EC6A 1JV2B 2H0HA 1TRPA 1L5GB 5EQLA 2QA43 2XSHB 5D83A 1BSDA 1RDSA 1WQLB 1IV9A 1FGRA 4XDVA 1X1UA 1W2B2 6GSPA 4R80A 2H0GA 3KSPA 4EBGA 1PY3A 4G1MB 4KZ1A 2IMJA 1RGCA 3H51A 1VQ83 1GMRA 1T3BA 1JBSA 2E2UA 3PXMA 1UCJA 1N9EA 1I8VA 1OACA 3EN8A 1RGLA 1I3IA 3FF0A 4WFOA 3CC43 2CFGA 5IEOA 3CD63 3V92A 4HM0B 2CWVA 3D5IA 1RN1A 1IQYA 2RNTA 2GU1A 1EA2A 4O8SA 1RN4A 3GZYB 2C4BA 5KP4A 1OGZA 4XBYA 1DMMA 3FG3A 1VQ43 4HBRA 1OH0A 5AIIA 4QWTA 1Q864 1A67A 1W02A 1YVBI 1EQKA 2XFSA 3LH4A 1SIHA 3CCQ3 3CU3A 2Y73A 1LNIA 4X2HA 2O3OA 1UUVB 2YFIB 4FCJA 1CQSA 1Q7HA 3V98A 3SOYA 3I0YA 4HM4B 1DETA 3VSYA 1X1YA 1QVG2 1NO3A 1W6YA 3DH2A 4KFDA 3OV4A 4L8OA 3PCSA 1MWSA 4OUQA 2UUGC 5GSPA 2E2TA 2WO0A 5HOHA 3V99A 3CCR3 4WHAA 2P09A 5JBSA 1FGOA 3TDGA 3OXAA 2CX1A 1GSPA 4HAAA 5CK6A 3WDGB 1PFPA 3MG2A 5D82A 4HOHA 2HMMB 3BLZA 1RRLA 3HK4A 3MG1A 2YX9A 3DGLA 1O7GB 2M7OA 1RJOA 2CFKA 1W4NA 1BRIA 5FW5A 1K8A4 1VQ93 3OW22 3SVAA 1DYUA 1RNTA 3M8CA 1JZOA 1GMQA 1QAFA 1WMPA 2IUKA 2C10A 4R4KA 1S723 1RGGA 1V74A 5AEUB 3K5TA 1QALA 3U1WA 1X1XA 4BU4A 5BXQA 3BNDA 3EE1A 2ZL8A 1Q40A 4L7KA 1JB5A 2W56B 3LT9A 2GXFA 3IMAB 4STDA 1M1K4 1TFKA 1MGWA 4MMZB 1EKMA 2CFLA 3A5EA 3QRDA 5D81A 5IF6A 4FCMA 4LZIA 1Q42A 3CCE3 1JB4A 3NQYA 1FA3A 4BIRA 2FGTA 3DUKA 1O7HB 1SARA 1R4YA 4ILFA 5AYRB 3CC73 1VQP3 1Q7Y4 1W7CA 3K7CA 2Z77A 1KC84 2BMOB 3CNXA 3OWYA 5IERA 3PYJA 1NB3I 1MOLA 4WP5A 7GSPA 3UNLA 4EYCA 4FMAA 4RNZA 1YJ93 5IEPA 1KQS2 2GBXB 2XFTA 3GRDA 4HM2B 1NU3A 3SYUA 1TIJA 1TFOA 3KSED 2BIRA 5KP1A 1BSAA 1E3VA 1ZO2A 1BUJA 5BIRA 3PCRA 1LQMB 3NX0A 1BGSA 1QJGA 1UCLA 2D42A 3ZFZA 1BNEA 2WOHA 3BNCA 1TU5A 1FW7A 3JUQA 3EC9A 1UCIA 2GEYA 2IA7A 1JBRA 2F56A 3F7XA 4Q53A 2RBIA 1MWRA 1ZX2A 4U13A 1BSCA 3I553 4O3VA 2GEXA 1I70A 3G0KA 3KCHA 1U5OA 2W56A 3S67A 3CC23 2MF7A 1GD4A 4RZMA 2LQVA 1GOYA 2L1SA 1KSIA 1S5AA 5CLKA 1OHPA 1OGXA 1BSEA 3WOEB 1AQZA 4K61A 2CFWA 4H61A 3U97A 4XBTA 2MC8A 3G6E3 1K41A 3H3HA 3N9HA 4N6TA 2KCDA 2W9QA 2KF3A 1WMOA 1Q824 3T0UA 1UW1A 1FGTA 1RTUA 1Y4KA 3GWRA 2R41A 4FMCA 1N9JA 1FZUA 1YGWA 3HOHA 1YIT3 3LTBA 3EB8A 3Q2PA 3NBBA 5JPPA 1DVCA 1AV4A 1YIJ3 1STFI 3B7CA 3CXC2 1I2FA 4EV5A 1V58A 1OF5A 1UCKA 4HM6B 7RNTA 3AHWA 5IENA 1BRGA 1LOWA 1LNHA 1W5ZA 5IG3A 2SARA 1OPYA 4N6UA 3T8NA 3QK9A 2D1WA 3FG1A 1IVWA 3EN1B 3KIIA 3PGBA 3E99A 4IPBA 1IVUA 3CCM3 1RGKA 3K63A 1EG9B 1JN5B 8RNTA 1IYYA 1B27A 1O7MB 4IT7A 1NJI4 5M1AA 3RDEA 5G1LA 1BRJA 3FCSB 3BNEA 2XF3A 3AHSA 1IQ8A 3PS8A 1AR0A 2ML5A 2WGQA 3GAXA 5EEOA 1F8NA 1STDA 3BNBA 3LOYA 3ZG5A 2FNQA 1VQ73 3NXJA 3LTCA 4EXRA 1ASKA 4GSPA 3STDA 1O7NB 4LSOA 2J8XB 4KVHA 5I97A 1ROAA 3RGRA 1CH0A 1M1XB 1RSNA 2HMOB 2BMRB 4WWUC 3S28A 4HM7B 2SBLA 1UGHI 2O9UX 1KWIA 1MGRA 4I5QA 2QEX3 3JUMA 1KD14 3KFQC 3UB1A 2CWUA 4MJDA 4N6MA 3CCU3 5FGOA 1ISKA 5STDA 5IG0A 1LOYA 1E97A 4JF8A 1N8QA 1ROVA 8CHOA 1LOVA 1G0TA 3SOAA 2WOFA 2INXA 1AVLA 4HZ9B 4R1KA 3CME3 4K1VA 1VQL3 1OUNA 1BRKA 2W9PA 1JJ22 6STDA 2BU4A 2PZVA 1W01A 2K3DA 3ALAA 4HZBB 1YJW3 3EHCA 2XGNA 3GSPA 1BOXA 1BNJA 1FUTA 2CH9A 3KZTA 3AGOA 1O7WB 1JRQA 3G713 3OWUA 4HJLB 3LT8A 1US1A 2CW9A 4NPBA 4XBXA 1G02A 2XH9A 5IG5A 2Z6BA 1TTOA 2KF6A 1TRQA 3CCV3 4R9KA 4BTWA 3NV0B 3WMDA 2GU3A 1I0XA 1B20A 1M9GA 2B1XB 1BNSA 1N5PA 2CKFB 2GSPA 5LC7A 1BRHA 4HKVB 3DMCA 3ER7A 1BANA 3F7SA 1FGMA 2XEPA 4LEHA 3X3ZA 1V57A 3FLJA 1SQWA 3KKGA 3BU4A 5ELUA 5BVBA 1PYLA 1VQ63 2UGIA 3LYGA 3HX8A 1BIRA 3FKAA 3JVCA 5ELJA 1O7PB 2P0XA 1PU4A 3AGNA 3D79A 2BO9B 3DGMA 1YVSA 3F14A 3F40A 5LC6A 2C11A 1T2IA 4GL6A 3UL6A 1I2GA 4IIAA 2RGQA 3LTAA 2W2CA 4ORLA 1T5YA 2P05A 2CC3A 3DZLA 1FYSA 1IVVA 1GY6A 4HM1B 2UX0A 5EVHA 5TGNA 2OWPA 5AI1A 2W03A 4K1UA 2I9WA 3FG4A 4LGQA 3SLUA 1A90A 1RRHA 1UI8A 2Z76A 2Y74A 3S5CA 4AKZA 5M19A 1Q814 4NHFA 2P0MA 2HMKB 4HM8B 2V1LA 2ZHXB 1LVNA 2LYXA 3URPA 4N3VA 3SX1A 1SPUA 3D9RA 3MYTA 1IK3A 3DGNA 2CG1A 3EJVA 3X41A
chains in the Genus database with same CATH topology
3B4OA 1QMAA 2KRTA 1QAKA 3B8LA 1K9M4 1A2VA 2GBWB 2OTJ3 2IUJA 3T8UA 3G16A 3NV0A 4J8TA 2BNGA 1FUWA 3G8ZA 3CCL3 1ULJB 3FZWA 3K9MC 2WGOA 3EF8A 4TX4A 2YFJB 2BHMA 1JB2A 1FGQA 1GS3A 1GY7A 5AIFA 4FMBA 1GY5A 4AKYA 2F99A 4HM3B 2CG0A 1QVF2 3Q90A 1TP6A 3MWZA 2CIUA 3IJEB 3VF1A 3F8XA 3NBJA 1K734 4KFEA 3KN4A 2ZDJA 1A2KA 4N6LA 2W6JH 3EBTA 3NUVA 1CYVA 2Z7AA 4WYKB 2STDA 2OOVA 2E2VA 1D6UA 4J9AA 3S29A 3I563 1WNHA 1DVDA 1DMQA 1E3RA 1CEWI 3FF2A 3NBRA 1D6YA 2CHCA 1J2BA 1K28A 4BTXA 2HMJB 3N54B 7STDA 1RN7A 1YI23 5G2GA 1VQO3 2XRXB 2XSOB 3PZWA 5A0OB 1NDOB 3CMA3 5AEWB 4OK0A 3N8BA 1DMNA 3GZRA 4HVNA 2JQ5A 3NM2A 3X40A 3CCJ3 4FR9A 3MPHA 1ULIB 4GB5A 4XM4A 1YGEA 3RGAA 1UI7A 3D3LA 4ZM8A 1IQXA 3DXOA 3EQQB 3LTDA 3NHXA 4LMIA 2OOVC 1Q40B 2RCDA 2K0MA 5HGRA 2JDIH 1IT8A 5DREA 3S27A 3HIGA 4RNYA 1W2ZA 3J7Yd 2K54A 5DRVA 1U8CB 1OHSA 4CCVA 2P38A 4FMDA 3WODG 4HYZA 1D6ZA 1R4CA 3AMOB 4FCZA 4WYKA 3X3YA 3F9SA 3WOFB 4N6NB 2QGUA 3HI7A 3HIIA 3EBYA 4N6V0 4MMXB 2OCTA 3KE7A 1JN5A 1SJWA 2L4VA 3EX9A 5IG4A 2R4IA 3DY5A 5AYSC 2F98A 2HMLB 3DM8A 2BMQB 1AVKA 4XB5A 3SXXA 2W0QA 2CFDA 5AIHA 1BUQA 1LXEA 3OWSA 3A76A 1MNLA 1CYUA 3WA3A 1OCVA 2BT3A 5IW9A 3CPOA 2OTL3 3ROBA 5CF2A 3ECFA 5JPUA 2PNCA 1W6CA 4EV2A 2HMNB 2CWTA 5CXOA 1N5HA 1LOXA 1UUWB 3F8HA 3JUPA 3MSOA 1JKGB 3VGNA 3SEDA 1G96A 1HKXA 3L0RA 3LZAA 3MG3A 1VQ53 1IDPA 3MKIA 4HM5B 4BTYA 3GZXB 1IT7A 4L8PA 2F86B 3AMOA 3CCS3 1GYBA 4XDWA 4R9LA 1W6GA 4X2OA 1VQM3 2FXTA 1W00A 2Q07A 4JRFA 3FH1A 4OVMA 1NB5I 1WTHA 4H3UA 3NM7A 3UJMA 4NREA 2RSXA 2CK3H 5KP3A 3WA2X 2OQEA 3CNMA 3FGYA 1C7HA 2YFLB 1HU9A 1VZZA 3B4PA 3K0ZA 1YJN3 1OF5B 1VQN3 1VQK3 3LXUX 3OX9A 2XR8B 1YHQ3 1RKYA 3NQZA 2W04A 3X42A 3JUOA 4O02B 3GZBA 4K90B 2A15A 2ML6A 2QIYA 1M904 4MMYB 1IVXA 1IU7A 3Q1CA 2XGLA 2KXGA 3HZPA 4MEIA 5AIGA 4AEQA 3FSDA 5IG3A 2B24B 4RBNA 1IV7A 1NWWA 1JNQA 3CPW2 4CDLA 1JKGA 3BB9A 3LMLA 4I4KA 4PEJA 5CF1A 1WMNA 3X3XA 3IPTA 4KFFA 3UL5A 2OQEC 4N6OB 1Z1SA 1OHOA 1SIIA 3G4S3 3JUNA 1GD3A 2RFRA 3DGOA 3MHEA 3O8YA 1N8R4 1TUHA 4O2HA 4EC6A 1JV2B 1L5GB 5EQLA 2QA43 2XSHB 5D83A 1WQLB 1IV9A 1FGRA 4XDVA 1W2B2 4R80A 4EBGA 3KSPA 4G1MB 4KZ1A 2IMJA 3H51A 1VQ83 2E2UA 3PXMA 1N9EA 1OACA 3EN8A 3FF0A 4WFOA 3CC43 2CFGA 5IEOA 3CD63 3V92A 4HM0B 2CWVA 3S5CA 1IQYA 2GU1A 1EA2A 4O8SA 3GZYB 5KP4A 1OGZA 4XBYA 1DMMA 3FG3A 1VQ43 4HBRA 1OH0A 5AIIA 4QWTA 1Q864 1A67A 1W02A 1YVBI 1EQKA 2XFSA 3LH4A 1SIHA 3CCQ3 3CU3A 2Y73A 4X2HA 2O3OA 1UUVB 2YFIB 4FCJA 1CQSA 3V98A 3SOYA 3I0YA 4HM4B 3VSYA 1QVG2 1NO3A 1W6YA 4KFDA 3OV4A 4L8OA 3PCSA 4OUQA 2E2TA 2WO0A 3V99A 3CCR3 4WHAA 2P09A 5JBSA 1FGOA 3TDGA 3OXAA 5CK6A 3WDGB 1PFPA 3MG2A 5D82A 2HMMB 3BLZA 1RRLA 3HK4A 3MG1A 2YX9A 3DGLA 1O7GB 2M7OA 1RJOA 2CFKA 1W4NA 5FW5A 1K8A4 1VQ93 3OW22 3SVAA 1DYUA 3M8CA 1QAFA 1WMPA 2IUKA 2C10A 4R4KA 1S723 5AEUB 1V74A 3K5TA 1QALA 3U1WA 5BXQA 3BNDA 3EE1A 2ZL8A 1Q40A 4L7KA 1JB5A 2W56B 3LT9A 2GXFA 3IMAB 4STDA 1M1K4 1TFKA 4MMZB 1EKMA 2CFLA 3QRDA 5D81A 5IF6A 4FCMA 4LZIA 1Q42A 3CCE3 1JB4A 3NQYA 1FA3A 2FGTA 3DUKA 1O7HB 1VQP3 5AYRB 3CC73 1Q7Y4 1W7CA 3K7CA 2Z77A 1KC84 2BMOB 3CNXA 3OWYA 5IERA 3PYJA 1NB3I 1MOLA 4WP5A 3UNLA 4EYCA 4FMAA 4RNZA 1YJ93 5IEPA 1KQS2 2GBXB 2XFTA 3GRDA 4HM2B 1NU3A 1TIJA 1TFOA 3KSED 5KP1A 1E3VA 1ZO2A 3PCRA 3NX0A 1QJGA 2D42A 2WOHA 3BNCA 1TU5A 3JUQA 3EC9A 2GEYA 2IA7A 3F7XA 4Q53A 1ZX2A 4U13A 3I553 4O3VA 2GEXA 3G0KA 1U5OA 2W56A 3S67A 3CC23 2MF7A 1GD4A 4RZMA 2LQVA 1KSIA 1S5AA 5CLKA 1OHPA 1OGXA 3WOEB 4K61A 2CFWA 4H61A 3U97A 4XBTA 2MC8A 3G6E3 1K41A 3H3HA 3N9HA 4N6TA 2KCDA 2W9QA 1WMOA 1Q824 3T0UA 1UW1A 1FGTA 1Y4KA 3GWRA 4FMCA 1N9JA 1YIT3 3LTBA 3EB8A 3Q2PA 3NBBA 5JPPA 1DVCA 1AV4A 1YIJ3 1STFI 3B7CA 3CXC2 4EV5A 1OF5A 4HM6B 5IENA 1LNHA 1W5ZA 1OPYA 4N6UA 3T8NA 3QK9A 2D1WA 3FG1A 1IVWA 3EN1B 3KIIA 3PGBA 3E99A 4IPBA 1IVUA 3CCM3 3K63A 1EG9B 1JN5B 1O7MB 4IT7A 1NJI4 3RDEA 3FCSB 3BNEA 2XF3A 1IQ8A 3PS8A 1AR0A 2ML5A 2WGQA 3GAXA 5EEOA 1F8NA 1STDA 3BNBA 3LOYA 2FNQA 1VQ73 3NXJA 3LTCA 4EXRA 1ASKA 3STDA 1O7NB 4LSOA 4KVHA 5I97A 1ROAA 3RGRA 1M1XB 2HMOB 2BMRB 4WWUC 3S28A 4HM7B 2SBLA 2O9UX 1KWIA 2QEX3 3JUMA 1KD14 3KFQC 3UB1A 2CWUA 4MJDA 4N6MA 3CCU3 5FGOA 1ISKA 5STDA 5IG0A 1E97A 4JF8A 1N8QA 1ROVA 8CHOA 3SOAA 2WOFA 2INXA 1AVLA 4HZ9B 4R1KA 3CME3 4K1VA 1VQL3 1OUNA 2W9PA 1JJ22 6STDA 2PZVA 1W01A 3ALAA 4HZBB 1YJW3 3EHCA 2XGNA 2CH9A 3KZTA 1O7WB 1JRQA 3G713 3OWUA 4HJLB 3LT8A 1US1A 2CW9A 4XBXA 2XH9A 5IG5A 2Z6BA 3CCV3 4R9KA 4BTWA 3NV0B 3WMDA 2GU3A 1M9GA 2B1XB 1N5PA 2CKFB 5LC7A 4HKVB 3DMCA 3ER7A 3F7SA 3X3ZA 1FGMA 2XEPA 4LEHA 3FLJA 1SQWA 3KKGA 5ELUA 5BVBA 1VQ63 3LYGA 3HX8A 3FKAA 3JVCA 5ELJA 1O7PB 2P0XA 1PU4A 2BO9B 3DGMA 3F40A 3F14A 5LC6A 2C11A 4GL6A 3UL6A 4IIAA 2RGQA 3LTAA 2W2CA 4ORLA 1T5YA 2P05A 2CC3A 3DZLA 1GY6A 1IVVA 4HM1B 2UX0A 5EVHA 5TGNA 2OWPA 5AI1A 2W03A 4K1UA 2I9WA 3FG4A 4LGQA 3SLUA 1A90A 1RRHA 1UI8A 2Z76A 2Y74A 4AKZA 1Q814 4NHFA 2P0MA 2HMKB 4HM8B 2V1LA 1LVNA 2LYXA 1IK3A 4N3VA 3SX1A 1SPUA 3D9RA 3MYTA 3DGNA 2CG1A 3EJVA 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAK A;  1A2V A;  1W5Z A;  2D1W A;  1IVW A;  3PGB A;  3KII A;  1IVU A;  4BTY A;  2YX9 A;  3AMO A;  1W6G A;  1RJO A;  2CFK A;  1W4N A;  1DYU A;  2WGQ A;  2CG0 A;  3LOY A;  1QAF A;  1WMP A;  2C10 A;  4EXR A;  3NBJ A;  3K5T A;  4KFE A;  3WA2 X;  1QAL A;  3KN4 A;  2OQE A;  2ZL8 A;  2OOV A;  2E2V A;  1RKY A;  3NQZ A;  1EKM A;  2CFL A;  1D6U A;  3X42 A;  2CWU A;  3NQY A;  4K90 B;  1D6Y A;  4BTX A;  1IVX A;  1IU7 A;  1W7C A;  2WOF A;  1AVL A;  3X40 A;  3ALA A;  3MPH A;  1WMN A;  3X3X A;  4KFF A;  2OQE C;  1JRQ A;  1UI7 A;  1IQX A;  1SII A;  2OOV C;  1US1 A;  2CG1 A;  2K0M A;  2WOH A;  1TU5 A;  4BTW A;  3HIG A;  2IA7 A;  1W2Z A;  2GU3 A;  3X3Z A;  1D6Z A;  3AMO B;  3X3Y A;  2E2U A;  1PU4 A;  3HI7 A;  1OAC A;  1N9E A;  1KSI A;  3HII A;  2CFG A;  2CFW A;  2C11 A;  2CWV A;  1IQY A;  3N9H A;  1WMO A;  1IVV A;  1AVK A;  3SXX A;  3T0U A;  2CFD A;  2W0Q A;  1SIH A;  2Y73 A;  3WA3 A;  1UI8 A;  2Y74 A;  3NBB A;  2BT3 A;  5IW9 A;  1AV4 A;  4KFD A;  2PNC A;  1LVN A;  4EV5 A;  1W6C A;  3SX1 A;  1SPU A;  4EV2 A;  2E2T A;  2WO0 A;  2CWT A;  3X41 A; 
#chains in the Genus database with same CATH topology
 3B4O A;  1QMA A;  2KRT A;  1QAK A;  3B8L A;  1K9M 4;  5BU4 A;  1A2V A;  2GBW B;  2OTJ 3;  2IUJ A;  3T8U A;  3G16 A;  3NV0 A;  4J8T A;  3DGY A;  2BNG A;  1FUW A;  3G8Z A;  3CCL 3;  1HZ1 A;  1ULJ B;  3FZW A;  3K9M C;  2WGO A;  3EF8 A;  3RNT A;  4TX4 A;  2YFJ B;  2BHM A;  1JB2 A;  1FGQ A;  1GS3 A;  1GY7 A;  5AIF A;  4FMB A;  1GY5 A;  4AKY A;  2F99 A;  4HM3 B;  2IYJ A;  2CG0 A;  1BNI A;  1QVF 2;  3Q90 A;  3Q3F A;  1TP6 A;  3MWZ A;  1B2M A;  2CIU A;  3WHO A;  3IJE B;  3VF1 A;  3F8X A;  1MWU A;  3NBJ A;  4J5K A;  4KFE A;  1K73 4;  3KN4 A;  2ZDJ A;  1A2K A;  4N6L A;  2W6J H;  3EBT A;  3D4A A;  1CYV A;  1RMS A;  2Z7A A;  3NUV A;  4WYK B;  2STD A;  1NNV A;  2OOV A;  1B21 A;  3ZG0 A;  2E2V A;  1D6U A;  4J9A A;  3S29 A;  3I56 3;  1WNH A;  6RNT A;  1DVD A;  1DMQ A;  1E3R A;  1CEW I;  3FF2 A;  3NBR A;  1RGA A;  1D6Y A;  2CHC A;  1J2B A;  1K28 A;  4BTX A;  2CX0 A;  2HMJ B;  3N54 B;  1RN7 A;  7STD A;  5G2G A;  1YI2 3;  4KT3 B;  1I0V A;  2XRX B;  2XSO B;  1VQO 3;  3PZW A;  5A0O B;  1NDO B;  3CMA 3;  5AEW B;  5M18 A;  4OK0 A;  3N8B A;  1DMN A;  4CJN A;  1I2E A;  3GZR A;  2ZA4 A;  5G1K A;  4HVN A;  2JQ5 A;  3NM2 A;  3X40 A;  3CCJ 3;  4FR9 A;  1RGE A;  1ULI B;  2KF4 A;  3MPH A;  4GB5 A;  4XM4 A;  1YGE A;  1LRA A;  1MWT A;  3RGA A;  1B3S A;  1UI7 A;  3D3L A;  4ZM8 A;  1IQX A;  1BU4 A;  3BIR A;  3DXO A;  3EQQ B;  3LTD A;  3NHX A;  4LMI A;  2OOV C;  1Q40 B;  2RCD A;  2F5W A;  2K0M A;  2JDI H;  5HGR A;  1IT8 A;  4J5G A;  2AAE A;  5DRE A;  1EUI C;  3S27 A;  3HIG A;  4RNY A;  1BVI A;  1W2Z A;  3J7Y d;  1ZS7 A;  2K54 A;  1YNV X;  5DRV A;  1U8C B;  1OHS A;  4CCV A;  2P38 A;  1T2H A;  4FMD A;  5RNT A;  3WOD G;  1DE3 A;  4HYZ A;  1Q9E A;  1D6Z A;  1R4C A;  3AMO B;  4FCZ A;  4WYK A;  3X3Y A;  3F9S A;  3WOF B;  4BL2 A;  4N6N B;  3D5G A;  2QGU A;  2F5M A;  3HI7 A;  3HII A;  3EBY A;  4N6V 0;  4MMX B;  2OCT A;  3KE7 A;  1B2Z A;  1JN5 A;  1BNR A;  1SJW A;  2AAD A;  2L4V A;  3EX9 A;  1RCL A;  5IG4 A;  1RNB A;  2R4I A;  3DY5 A;  5AYS C;  1VQQ A;  2F98 A;  1UDI I;  2HML B;  2KF5 A;  1GMP A;  3DM8 A;  1BRS A;  2BMQ B;  1AVK A;  4LYL B;  1ZGX A;  4XB5 A;  2CFD A;  2W0Q A;  5AIH A;  1JZD A;  3SXX A;  1LXE A;  1BUQ A;  3OWS A;  3A76 A;  1BRN L;  1MNL A;  1CYU A;  3WA3 A;  4EW5 A;  1JBT A;  1OCV A;  2BT3 A;  4RNT A;  5IW9 A;  3CPO A;  2IY2 A;  2OTL 3;  3ROB A;  2H0I A;  5CF2 A;  3ECF A;  1EEJ A;  5JPU A;  2PNC A;  1W6C A;  4EV2 A;  1UGI A;  2CWT A;  2HMN B;  5CXO A;  1N5H A;  1LOX A;  1UUW B;  3F8H A;  3JUP A;  3MSO A;  1JKG B;  3VGN A;  1BNF A;  3SED A;  1G96 A;  1HKX A;  1LQG C;  2KAA A;  3L0R A;  3LZA A;  3MG3 A;  1VQ5 3;  1IDP A;  1A2P A;  3MKI A;  4HM5 B;  4BTY A;  4CPK A;  3GZX B;  1IT7 A;  1RGF A;  4L8P A;  2F86 B;  3AMO A;  3CCS 3;  1GYB A;  4XDW A;  4R9L A;  1W6G A;  4X2O A;  1VQM 3;  2FXT A;  1GOV A;  1W00 A;  2Q07 A;  4JRF A;  3FH1 A;  4OVM A;  1NB5 I;  1RCK A;  1C54 A;  1WTH A;  4H3U A;  3NM7 A;  3UJM A;  1BNG A;  1FUS A;  2RSX A;  4NRE A;  2CK3 H;  5KP3 A;  3WA2 X;  4GHO A;  2OQE A;  3CNM A;  1BAO A;  1X1W A;  3FGY A;  1C7H A;  2YFL B;  1HU9 A;  1VZZ A;  3B4P A;  1RHL A;  3K0Z A;  1OF5 B;  1RGH A;  1B2U A;  3LXU X;  1VQK 3;  1RLS A;  1YJN 3;  3OX9 A;  1VQN 3;  1TJD A;  2XR8 B;  1YHQ 3;  1RKY A;  1B2S A;  2W04 A;  3NQZ A;  1BSB A;  3X42 A;  1B2X A;  3JUO A;  4O02 B;  2HOH A;  3GZB A;  4K90 B;  9RNT A;  2A15 A;  2ML6 A;  2QIY A;  1M90 4;  4MMY B;  1IVX A;  1IU7 A;  1AY7 A;  3Q1C A;  1HYF A;  2KXG A;  2XGL A;  3HZP A;  4MEI A;  5AIG A;  3FSD A;  4AEQ A;  2B24 B;  1I3F A;  4RBN A;  1IV7 A;  1NWW A;  1JNQ A;  3CPW 2;  2F4Y A;  4CDL A;  1JKG A;  3BB9 A;  3LML A;  4I4K A;  4PEJ A;  1UUG B;  5CF1 A;  1WMN A;  3X3X A;  3IPT A;  4KFF A;  3UL5 A;  2OQE C;  3WR2 A;  4BL3 A;  4DKI A;  4N6O B;  1Z1S A;  1OHO A;  1SII A;  3G4S 3;  3JUN A;  1GD3 A;  2RFR A;  3DGO A;  3MHE A;  3O8Y A;  1N8R 4;  1GOU A;  1TUH A;  4O2H A;  4EC6 A;  1JV2 B;  2H0H A;  1TRP A;  1L5G B;  5EQL A;  2QA4 3;  2XSH B;  5D83 A;  1BSD A;  1RDS A;  1WQL B;  1IV9 A;  1FGR A;  4XDV A;  1X1U A;  1W2B 2;  6GSP A;  4R80 A;  2H0G A;  3KSP A;  4EBG A;  1PY3 A;  4G1M B;  4KZ1 A;  2IMJ A;  1RGC A;  3H51 A;  1VQ8 3;  1GMR A;  1T3B A;  1JBS A;  2E2U A;  3PXM A;  1UCJ A;  1N9E A;  1I8V A;  1OAC A;  3EN8 A;  1RGL A;  1I3I A;  3FF0 A;  4WFO A;  3CC4 3;  2CFG A;  5IEO A;  3CD6 3;  3V92 A;  4HM0 B;  2CWV A;  3D5I A;  1RN1 A;  1IQY A;  2RNT A;  2GU1 A;  1EA2 A;  4O8S A;  1RN4 A;  3GZY B;  2C4B A;  5KP4 A;  1OGZ A;  4XBY A;  1DMM A;  3FG3 A;  1VQ4 3;  4HBR A;  1OH0 A;  5AII A;  4QWT A;  1Q86 4;  1A67 A;  1W02 A;  1YVB I;  1EQK A;  2XFS A;  3LH4 A;  1SIH A;  3CCQ 3;  3CU3 A;  2Y73 A;  1LNI A;  4X2H A;  2O3O A;  1UUV B;  2YFI B;  4FCJ A;  1CQS A;  1Q7H A;  3V98 A;  3SOY A;  3I0Y A;  4HM4 B;  1DET A;  3VSY A;  1X1Y A;  1QVG 2;  1NO3 A;  1W6Y A;  3DH2 A;  4KFD A;  3OV4 A;  4L8O A;  3PCS A;  1MWS A;  4OUQ A;  2UUG C;  5GSP A;  2E2T A;  2WO0 A;  5HOH A;  3V99 A;  3CCR 3;  4WHA A;  2P09 A;  5JBS A;  1FGO A;  3TDG A;  3OXA A;  2CX1 A;  1GSP A;  4HAA A;  5CK6 A;  3WDG B;  1PFP A;  3MG2 A;  5D82 A;  4HOH A;  2HMM B;  3BLZ A;  1RRL A;  3HK4 A;  3MG1 A;  2YX9 A;  3DGL A;  1O7G B;  2M7O A;  1RJO A;  2CFK A;  1W4N A;  1BRI A;  5FW5 A;  1K8A 4;  1VQ9 3;  3OW2 2;  3SVA A;  1DYU A;  1RNT A;  3M8C A;  1JZO A;  1GMQ A;  1QAF A;  1WMP A;  2IUK A;  2C10 A;  4R4K A;  1S72 3;  1RGG A;  1V74 A;  5AEU B;  3K5T A;  1QAL A;  3U1W A;  1X1X A;  4BU4 A;  5BXQ A;  3BND A;  3EE1 A;  2ZL8 A;  1Q40 A;  4L7K A;  1JB5 A;  2W56 B;  3LT9 A;  2GXF A;  3IMA B;  4STD A;  1M1K 4;  1TFK A;  1MGW A;  4MMZ B;  1EKM A;  2CFL A;  3A5E A;  3QRD A;  5D81 A;  5IF6 A;  4FCM A;  4LZI A;  1Q42 A;  3CCE 3;  1JB4 A;  3NQY A;  1FA3 A;  4BIR A;  2FGT A;  3DUK A;  1O7H B;  1SAR A;  1R4Y A;  4ILF A;  5AYR B;  3CC7 3;  1VQP 3;  1Q7Y 4;  1W7C A;  3K7C A;  2Z77 A;  1KC8 4;  2BMO B;  3CNX A;  3OWY A;  5IER A;  3PYJ A;  1NB3 I;  1MOL A;  4WP5 A;  7GSP A;  3UNL A;  4EYC A;  4FMA A;  4RNZ A;  1YJ9 3;  5IEP A;  1KQS 2;  2GBX B;  2XFT A;  3GRD A;  4HM2 B;  1NU3 A;  3SYU A;  1TIJ A;  1TFO A;  3KSE D;  2BIR A;  5KP1 A;  1BSA A;  1E3V A;  1ZO2 A;  1BUJ A;  5BIR A;  3PCR A;  1LQM B;  3NX0 A;  1BGS A;  1QJG A;  1UCL A;  2D42 A;  3ZFZ A;  1BNE A;  2WOH A;  3BNC A;  1TU5 A;  1FW7 A;  3JUQ A;  3EC9 A;  1UCI A;  2GEY A;  2IA7 A;  1JBR A;  2F56 A;  3F7X A;  4Q53 A;  2RBI A;  1MWR A;  1ZX2 A;  4U13 A;  1BSC A;  3I55 3;  4O3V A;  2GEX A;  1I70 A;  3G0K A;  3KCH A;  1U5O A;  2W56 A;  3S67 A;  3CC2 3;  2MF7 A;  1GD4 A;  4RZM A;  2LQV A;  1GOY A;  2L1S A;  1KSI A;  1S5A A;  5CLK A;  1OHP A;  1OGX A;  1BSE A;  3WOE B;  1AQZ A;  4K61 A;  2CFW A;  4H61 A;  3U97 A;  4XBT A;  2MC8 A;  3G6E 3;  1K41 A;  3H3H A;  3N9H A;  4N6T A;  2KCD A;  2W9Q A;  2KF3 A;  1WMO A;  1Q82 4;  3T0U A;  1UW1 A;  1FGT A;  1RTU A;  1Y4K A;  3GWR A;  2R41 A;  4FMC A;  1N9J A;  1FZU A;  1YGW A;  3HOH A;  1YIT 3;  3LTB A;  3EB8 A;  3Q2P A;  3NBB A;  5JPP A;  1DVC A;  1AV4 A;  1YIJ 3;  1STF I;  3B7C A;  3CXC 2;  1I2F A;  4EV5 A;  1V58 A;  1OF5 A;  1UCK A;  4HM6 B;  7RNT A;  3AHW A;  5IEN A;  1BRG A;  1LOW A;  1LNH A;  1W5Z A;  5IG3 A;  2SAR A;  1OPY A;  4N6U A;  3T8N A;  3QK9 A;  2D1W A;  3FG1 A;  1IVW A;  3EN1 B;  3KII A;  3PGB A;  3E99 A;  4IPB A;  1IVU A;  3CCM 3;  1RGK A;  3K63 A;  1EG9 B;  1JN5 B;  8RNT A;  1IYY A;  1B27 A;  1O7M B;  4IT7 A;  1NJI 4;  5M1A A;  3RDE A;  5G1L A;  1BRJ A;  3FCS B;  3BNE A;  2XF3 A;  3AHS A;  1IQ8 A;  3PS8 A;  1AR0 A;  2ML5 A;  2WGQ A;  3GAX A;  5EEO A;  1F8N A;  1STD A;  3BNB A;  3LOY A;  3ZG5 A;  2FNQ A;  1VQ7 3;  3NXJ A;  3LTC A;  4EXR A;  1ASK A;  4GSP A;  3STD A;  1O7N B;  4LSO A;  2J8X B;  4KVH A;  5I97 A;  1ROA A;  3RGR A;  1CH0 A;  1M1X B;  1RSN A;  2HMO B;  2BMR B;  4WWU C;  3S28 A;  4HM7 B;  2SBL A;  1UGH I;  2O9U X;  1KWI A;  1MGR A;  4I5Q A;  2QEX 3;  3JUM A;  1KD1 4;  3KFQ C;  3UB1 A;  2CWU A;  4MJD A;  4N6M A;  3CCU 3;  5FGO A;  1ISK A;  5STD A;  5IG0 A;  1LOY A;  1E97 A;  4JF8 A;  1N8Q A;  1ROV A;  8CHO A;  1LOV A;  1G0T A;  3SOA A;  2WOF A;  2INX A;  1AVL A;  4HZ9 B;  4R1K A;  3CME 3;  4K1V A;  1VQL 3;  1OUN A;  1BRK A;  2W9P A;  1JJ2 2;  6STD A;  2BU4 A;  2PZV A;  1W01 A;  2K3D A;  3ALA A;  4HZB B;  1YJW 3;  3EHC A;  2XGN A;  3GSP A;  1BOX A;  1BNJ A;  1FUT A;  2CH9 A;  3KZT A;  3AGO A;  1O7W B;  1JRQ A;  3G71 3;  3OWU A;  4HJL B;  3LT8 A;  1US1 A;  2CW9 A;  4NPB A;  4XBX A;  1G02 A;  2XH9 A;  5IG5 A;  2Z6B A;  1TTO A;  2KF6 A;  1TRQ A;  3CCV 3;  4R9K A;  4BTW A;  3NV0 B;  3WMD A;  2GU3 A;  1I0X A;  1B20 A;  1M9G A;  2B1X B;  1BNS A;  1N5P A;  2CKF B;  2GSP A;  5LC7 A;  1BRH A;  4HKV B;  3DMC A;  3ER7 A;  1BAN A;  3F7S A;  1FGM A;  2XEP A;  4LEH A;  3X3Z A;  1V57 A;  3FLJ A;  1SQW A;  3KKG A;  3BU4 A;  5ELU A;  5BVB A;  1PYL A;  1VQ6 3;  2UGI A;  3LYG A;  3HX8 A;  1BIR A;  3FKA A;  3JVC A;  5ELJ A;  1O7P B;  2P0X A;  1PU4 A;  3AGN A;  3D79 A;  2BO9 B;  3DGM A;  1YVS A;  3F14 A;  3F40 A;  5LC6 A;  2C11 A;  1T2I A;  4GL6 A;  3UL6 A;  1I2G A;  4IIA A;  2RGQ A;  3LTA A;  2W2C A;  4ORL A;  1T5Y A;  2P05 A;  2CC3 A;  3DZL A;  1FYS A;  1IVV A;  1GY6 A;  4HM1 B;  2UX0 A;  5EVH A;  5TGN A;  2OWP A;  5AI1 A;  2W03 A;  4K1U A;  2I9W A;  3FG4 A;  4LGQ A;  3SLU A;  1A90 A;  1RRH A;  1UI8 A;  2Z76 A;  2Y74 A;  3S5C A;  4AKZ A;  5M19 A;  1Q81 4;  4NHF A;  2P0M A;  2HMK B;  4HM8 B;  2V1L A;  2ZHX B;  1LVN A;  2LYX A;  3URP A;  4N3V A;  3SX1 A;  1SPU A;  3D9R A;  3MYT A;  1IK3 A;  3DGN A;  2CG1 A;  3EJV A;  3X41 A; 
#chains in the Genus database with same CATH homology
 3B4O A;  1QMA A;  2KRT A;  1QAK A;  3B8L A;  1K9M 4;  1A2V A;  2GBW B;  2OTJ 3;  2IUJ A;  3T8U A;  3G16 A;  3NV0 A;  4J8T A;  2BNG A;  1FUW A;  3G8Z A;  3CCL 3;  1ULJ B;  3FZW A;  3K9M C;  2WGO A;  3EF8 A;  4TX4 A;  2YFJ B;  2BHM A;  1JB2 A;  1FGQ A;  1GS3 A;  1GY7 A;  5AIF A;  4FMB A;  1GY5 A;  4AKY A;  2F99 A;  4HM3 B;  2CG0 A;  1QVF 2;  3Q90 A;  1TP6 A;  3MWZ A;  2CIU A;  3IJE B;  3VF1 A;  3F8X A;  3NBJ A;  1K73 4;  4KFE A;  3KN4 A;  2ZDJ A;  1A2K A;  4N6L A;  2W6J H;  3EBT A;  3NUV A;  1CYV A;  2Z7A A;  4WYK B;  2STD A;  2OOV A;  2E2V A;  1D6U A;  4J9A A;  3S29 A;  3I56 3;  1WNH A;  1DVD A;  1DMQ A;  1E3R A;  1CEW I;  3FF2 A;  3NBR A;  1D6Y A;  2CHC A;  1J2B A;  1K28 A;  4BTX A;  2HMJ B;  3N54 B;  7STD A;  1RN7 A;  1YI2 3;  5G2G A;  1VQO 3;  2XRX B;  2XSO B;  3PZW A;  5A0O B;  1NDO B;  3CMA 3;  5AEW B;  4OK0 A;  3N8B A;  1DMN A;  3GZR A;  4HVN A;  2JQ5 A;  3NM2 A;  3X40 A;  3CCJ 3;  4FR9 A;  3MPH A;  1ULI B;  4GB5 A;  4XM4 A;  1YGE A;  3RGA A;  1UI7 A;  3D3L A;  4ZM8 A;  1IQX A;  3DXO A;  3EQQ B;  3LTD A;  3NHX A;  4LMI A;  2OOV C;  1Q40 B;  2RCD A;  2K0M A;  5HGR A;  2JDI H;  1IT8 A;  5DRE A;  3S27 A;  3HIG A;  4RNY A;  1W2Z A;  3J7Y d;  2K54 A;  5DRV A;  1U8C B;  1OHS A;  4CCV A;  2P38 A;  4FMD A;  3WOD G;  4HYZ A;  1D6Z A;  1R4C A;  3AMO B;  4FCZ A;  4WYK A;  3X3Y A;  3F9S A;  3WOF B;  4N6N B;  2QGU A;  3HI7 A;  3HII A;  3EBY A;  4N6V 0;  4MMX B;  2OCT A;  3KE7 A;  1JN5 A;  1SJW A;  2L4V A;  3EX9 A;  5IG4 A;  2R4I A;  3DY5 A;  5AYS C;  2F98 A;  2HML B;  3DM8 A;  2BMQ B;  1AVK A;  4XB5 A;  3SXX A;  2W0Q A;  2CFD A;  5AIH A;  1BUQ A;  1LXE A;  3OWS A;  3A76 A;  1MNL A;  1CYU A;  3WA3 A;  1OCV A;  2BT3 A;  5IW9 A;  3CPO A;  2OTL 3;  3ROB A;  5CF2 A;  3ECF A;  5JPU A;  2PNC A;  1W6C A;  4EV2 A;  2HMN B;  2CWT A;  5CXO A;  1N5H A;  1LOX A;  1UUW B;  3F8H A;  3JUP A;  3MSO A;  1JKG B;  3VGN A;  3SED A;  1G96 A;  1HKX A;  3L0R A;  3LZA A;  3MG3 A;  1VQ5 3;  1IDP A;  3MKI A;  4HM5 B;  4BTY A;  3GZX B;  1IT7 A;  4L8P A;  2F86 B;  3AMO A;  3CCS 3;  1GYB A;  4XDW A;  4R9L A;  1W6G A;  4X2O A;  1VQM 3;  2FXT A;  1W00 A;  2Q07 A;  4JRF A;  3FH1 A;  4OVM A;  1NB5 I;  1WTH A;  4H3U A;  3NM7 A;  3UJM A;  4NRE A;  2RSX A;  2CK3 H;  5KP3 A;  3WA2 X;  2OQE A;  3CNM A;  3FGY A;  1C7H A;  2YFL B;  1HU9 A;  1VZZ A;  3B4P A;  3K0Z A;  1YJN 3;  1OF5 B;  1VQN 3;  1VQK 3;  3LXU X;  3OX9 A;  2XR8 B;  1YHQ 3;  1RKY A;  3NQZ A;  2W04 A;  3X42 A;  3JUO A;  4O02 B;  3GZB A;  4K90 B;  2A15 A;  2ML6 A;  2QIY A;  1M90 4;  4MMY B;  1IVX A;  1IU7 A;  3Q1C A;  2XGL A;  2KXG A;  3HZP A;  4MEI A;  5AIG A;  4AEQ A;  3FSD A;  5IG3 A;  2B24 B;  4RBN A;  1IV7 A;  1NWW A;  1JNQ A;  3CPW 2;  4CDL A;  1JKG A;  3BB9 A;  3LML A;  4I4K A;  4PEJ A;  5CF1 A;  1WMN A;  3X3X A;  3IPT A;  4KFF A;  3UL5 A;  2OQE C;  4N6O B;  1Z1S A;  1OHO A;  1SII A;  3G4S 3;  3JUN A;  1GD3 A;  2RFR A;  3DGO A;  3MHE A;  3O8Y A;  1N8R 4;  1TUH A;  4O2H A;  4EC6 A;  1JV2 B;  1L5G B;  5EQL A;  2QA4 3;  2XSH B;  5D83 A;  1WQL B;  1IV9 A;  1FGR A;  4XDV A;  1W2B 2;  4R80 A;  4EBG A;  3KSP A;  4G1M B;  4KZ1 A;  2IMJ A;  3H51 A;  1VQ8 3;  2E2U A;  3PXM A;  1N9E A;  1OAC A;  3EN8 A;  3FF0 A;  4WFO A;  3CC4 3;  2CFG A;  5IEO A;  3CD6 3;  3V92 A;  4HM0 B;  2CWV A;  3S5C A;  1IQY A;  2GU1 A;  1EA2 A;  4O8S A;  3GZY B;  5KP4 A;  1OGZ A;  4XBY A;  1DMM A;  3FG3 A;  1VQ4 3;  4HBR A;  1OH0 A;  5AII A;  4QWT A;  1Q86 4;  1A67 A;  1W02 A;  1YVB I;  1EQK A;  2XFS A;  3LH4 A;  1SIH A;  3CCQ 3;  3CU3 A;  2Y73 A;  4X2H A;  2O3O A;  1UUV B;  2YFI B;  4FCJ A;  1CQS A;  3V98 A;  3SOY A;  3I0Y A;  4HM4 B;  3VSY A;  1QVG 2;  1NO3 A;  1W6Y A;  4KFD A;  3OV4 A;  4L8O A;  3PCS A;  4OUQ A;  2E2T A;  2WO0 A;  3V99 A;  3CCR 3;  4WHA A;  2P09 A;  5JBS A;  1FGO A;  3TDG A;  3OXA A;  5CK6 A;  3WDG B;  1PFP A;  3MG2 A;  5D82 A;  2HMM B;  3BLZ A;  1RRL A;  3HK4 A;  3MG1 A;  2YX9 A;  3DGL A;  1O7G B;  2M7O A;  1RJO A;  2CFK A;  1W4N A;  5FW5 A;  1K8A 4;  1VQ9 3;  3OW2 2;  3SVA A;  1DYU A;  3M8C A;  1QAF A;  1WMP A;  2IUK A;  2C10 A;  4R4K A;  1S72 3;  5AEU B;  1V74 A;  3K5T A;  1QAL A;  3U1W A;  5BXQ A;  3BND A;  3EE1 A;  2ZL8 A;  1Q40 A;  4L7K A;  1JB5 A;  2W56 B;  3LT9 A;  2GXF A;  3IMA B;  4STD A;  1M1K 4;  1TFK A;  4MMZ B;  1EKM A;  2CFL A;  3QRD A;  5D81 A;  5IF6 A;  4FCM A;  4LZI A;  1Q42 A;  3CCE 3;  1JB4 A;  3NQY A;  1FA3 A;  2FGT A;  3DUK A;  1O7H B;  1VQP 3;  5AYR B;  3CC7 3;  1Q7Y 4;  1W7C A;  3K7C A;  2Z77 A;  1KC8 4;  2BMO B;  3CNX A;  3OWY A;  5IER A;  3PYJ A;  1NB3 I;  1MOL A;  4WP5 A;  3UNL A;  4EYC A;  4FMA A;  4RNZ A;  1YJ9 3;  5IEP A;  1KQS 2;  2GBX B;  2XFT A;  3GRD A;  4HM2 B;  1NU3 A;  1TIJ A;  1TFO A;  3KSE D;  5KP1 A;  1E3V A;  1ZO2 A;  3PCR A;  3NX0 A;  1QJG A;  2D42 A;  2WOH A;  3BNC A;  1TU5 A;  3JUQ A;  3EC9 A;  2GEY A;  2IA7 A;  3F7X A;  4Q53 A;  1ZX2 A;  4U13 A;  3I55 3;  4O3V A;  2GEX A;  3G0K A;  1U5O A;  2W56 A;  3S67 A;  3CC2 3;  2MF7 A;  1GD4 A;  4RZM A;  2LQV A;  1KSI A;  1S5A A;  5CLK A;  1OHP A;  1OGX A;  3WOE B;  4K61 A;  2CFW A;  4H61 A;  3U97 A;  4XBT A;  2MC8 A;  3G6E 3;  1K41 A;  3H3H A;  3N9H A;  4N6T A;  2KCD A;  2W9Q A;  1WMO A;  1Q82 4;  3T0U A;  1UW1 A;  1FGT A;  1Y4K A;  3GWR A;  4FMC A;  1N9J A;  1YIT 3;  3LTB A;  3EB8 A;  3Q2P A;  3NBB A;  5JPP A;  1DVC A;  1AV4 A;  1YIJ 3;  1STF I;  3B7C A;  3CXC 2;  4EV5 A;  1OF5 A;  4HM6 B;  5IEN A;  1LNH A;  1W5Z A;  1OPY A;  4N6U A;  3T8N A;  3QK9 A;  2D1W A;  3FG1 A;  1IVW A;  3EN1 B;  3KII A;  3PGB A;  3E99 A;  4IPB A;  1IVU A;  3CCM 3;  3K63 A;  1EG9 B;  1JN5 B;  1O7M B;  4IT7 A;  1NJI 4;  3RDE A;  3FCS B;  3BNE A;  2XF3 A;  1IQ8 A;  3PS8 A;  1AR0 A;  2ML5 A;  2WGQ A;  3GAX A;  5EEO A;  1F8N A;  1STD A;  3BNB A;  3LOY A;  2FNQ A;  1VQ7 3;  3NXJ A;  3LTC A;  4EXR A;  1ASK A;  3STD A;  1O7N B;  4LSO A;  4KVH A;  5I97 A;  1ROA A;  3RGR A;  1M1X B;  2HMO B;  2BMR B;  4WWU C;  3S28 A;  4HM7 B;  2SBL A;  2O9U X;  1KWI A;  2QEX 3;  3JUM A;  1KD1 4;  3KFQ C;  3UB1 A;  2CWU A;  4MJD A;  4N6M A;  3CCU 3;  5FGO A;  1ISK A;  5STD A;  5IG0 A;  1E97 A;  4JF8 A;  1N8Q A;  1ROV A;  8CHO A;  3SOA A;  2WOF A;  2INX A;  1AVL A;  4HZ9 B;  4R1K A;  3CME 3;  4K1V A;  1VQL 3;  1OUN A;  2W9P A;  1JJ2 2;  6STD A;  2PZV A;  1W01 A;  3ALA A;  4HZB B;  1YJW 3;  3EHC A;  2XGN A;  2CH9 A;  3KZT A;  1O7W B;  1JRQ A;  3G71 3;  3OWU A;  4HJL B;  3LT8 A;  1US1 A;  2CW9 A;  4XBX A;  2XH9 A;  5IG5 A;  2Z6B A;  3CCV 3;  4R9K A;  4BTW A;  3NV0 B;  3WMD A;  2GU3 A;  1M9G A;  2B1X B;  1N5P A;  2CKF B;  5LC7 A;  4HKV B;  3DMC A;  3ER7 A;  3F7S A;  3X3Z A;  1FGM A;  2XEP A;  4LEH A;  3FLJ A;  1SQW A;  3KKG A;  5ELU A;  5BVB A;  1VQ6 3;  3LYG A;  3HX8 A;  3FKA A;  3JVC A;  5ELJ A;  1O7P B;  2P0X A;  1PU4 A;  2BO9 B;  3DGM A;  3F40 A;  3F14 A;  5LC6 A;  2C11 A;  4GL6 A;  3UL6 A;  4IIA A;  2RGQ A;  3LTA A;  2W2C A;  4ORL A;  1T5Y A;  2P05 A;  2CC3 A;  3DZL A;  1GY6 A;  1IVV A;  4HM1 B;  2UX0 A;  5EVH A;  5TGN A;  2OWP A;  5AI1 A;  2W03 A;  4K1U A;  2I9W A;  3FG4 A;  4LGQ A;  3SLU A;  1A90 A;  1RRH A;  1UI8 A;  2Z76 A;  2Y74 A;  4AKZ A;  1Q81 4;  4NHF A;  2P0M A;  2HMK B;  4HM8 B;  2V1L A;  1LVN A;  2LYX A;  1IK3 A;  4N3V A;  3SX1 A;  1SPU A;  3D9R A;  3MYT A;  3DGN A;  2CG1 A;  3EJV A;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...