3NQZA

Crystal structure of the autoprocessed vibriolysin mcp-02 with e369a mutation
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
175
Chain Sequence
ANKKYLNQQPTINNMVQSNSVSPNQLIGLSVGNELVVLKEFTSNNGEVTRRYQQTYQGIPVIGDTVSLTFNNGMLKKAHGAAVYNIDEDLSDVSAKLTKKDAILKGSKTGIAAKSVGLKKHNEQSRLAIWVDDQNKAHLVYEVSYVTYGKSPSRPYLIIDANTGEVLLSYDNLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the autoprocessing of zinc metalloproteases in the thermolysin family
pubmed doi rcsb
source organism Pseudoalteromonas sp.
molecule tags Hydrolase
molecule keywords Secreted metalloprotease Mcp02
total genus 41
structure length 175
sequence length 180
ec nomenclature ec 3.4.24.25: Vibriolysin.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03413 PepSY Peptidase propeptide and YPEB domain
A PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.40 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA02
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nqzA01
1IVVA 3X3YA 1RKYA 2OQEA 1IQXA 3HIGA 2OQEC 2CFGA 1OACA 4EXRA 2D1WA 2GU3A 1IVUA 2WOFA 2CG0A 1AVKA 3HIIA 2CWVA 3WA3A 1IQYA 1EKMA 1IVXA 4BTWA 1QALA 2WO0A 3ALAA 4KFEA 2OOVA 1DYUA 3K5TA 1LVNA 2CG1A 1N9EA 2CWTA 1PU4A 1A2VA 4KFFA 3KN4A 3HI7A 5IW9A 2IA7A 4BTXA 2E2TA 1W5ZA 2CFDA 4KFDA 3X40A 3X42A 2K0MA 1WMOA 3KIIA 3NBJA 3MPHA 3PGBA 3SX1A 1W2ZA 2E2UA 4K90B 1US1A 1WMNA 3SXXA 2OOVC 3X41A 2CFWA 2Y74A 3AMOB 1D6YA 1WMPA 1AV4A 3X3XA 1SIHA 2BT3A 1W6CA 1UI7A 3NQYA 2YX9A 3LOYA 4EV5A 2Y73A 1IVWA 1W4NA 2W0QA 1JRQA 1TU5A 1KSIA 3X3ZA 1SIIA 3AMOA 2C11A 2CFKA 1RJOA 2E2VA 1D6UA 1D6ZA 1SPUA 3WA2X 1W7CA 2WOHA 2ZL8A 1QAFA 2PNCA 1UI8A 4BTYA 1QAKA 3T0UA 1W6GA 2C10A 3NQZA 4EV2A 1IU7A 2CFLA 3N9HA 2CWUA 1AVLA 2WGQA 3NBBA
chains in the Genus database with same CATH superfamily
1IVVA 2Z76A 3LZAA 2B1XB 1DVCA 2CC3A 2GXFA 1I3IA 3F7SA 3QK9A 1QJGA 3FG1A 2HMMB 2OWPA 4LYLB 2W9PA 1OACA 1BRHA 2ZA4A 3CCM3 2D1WA 2WOFA 1X1XA 2CWVA 3HIIA 3VSYA 1IQYA 3FF2A 2QA43 3PYJA 4MMZB 2IMJA 1ISKA 2FGTA 1X1WA 2O3OA 1Q814 4N6LA 1IQ8A 2CK3H 3DGYA 3CCV3 3FLJA 4RNZA 3PZWA 4KZ1A 7GSPA 3PS8A 1M9GA 3Q3FA 1MWRA 4HM2B 1GSPA 2UUGC 2HMNB 1KWIA 4O2HA 3LTDA 3ROBA 4FR9A 1J2BA 1DVDA 4XBXA 2CG1A 1CYVA 1DETA 2CWTA 3B4PA 1UDII 3KFQC 1I2GA 1IDPA 5RNTA 4IIAA 1FGRA 2LYXA 4KT3B 5FGOA 4BIRA 1UUGB 4WP5A 1IT7A 3URPA 1CQSA 3B7CA 3EQQB 1TRPA 3KE7A 2K0MA 1WMOA 3PXMA 5KP4A 1EQKA 3F40A 3KIIA 5ELUA 1NNVA 5IG4A 2W9QA 3D79A 1YJN3 3S29A 1BNSA 1VQK3 1BNJA 3JUMA 1NO3A 3LH4A 1DMMA 3GRDA 5ELJA 2HMKB 1UGIA 4J9AA 3WDGB 2F5MA 1WMNA 3BLZA 1Q824 1E97A 1W2B2 2W04A 4HAAA 3KSED 4TX4A 2Y74A 3CCR3 2W6JH 1KD14 1D6YA 3MG2A 3BU4A 1CEWI 1RTUA 3DMCA 3OWSA 5AIHA 4LMIA 3DGNA 3K7CA 2BT3A 3BNEA 1A2PA 1UI7A 3G713 1FA3A 3NQYA 2F56A 3FG3A 1YIT3 5FW5A 1K28A 2ML6A 1IVWA 1N8R4 1GS3A 4WYKA 3ZG0A 1GY5A 2HOHA 1LXEA 4HM1B 1TU5A 1BIRA 2BMRB 2GEYA 5G1KA 3RGAA 3WR2A 3X3ZA 1G96A 1MNLA 1STDA 2RFRA 4ORLA 1SQWA 3IPTA 5CF1A 1RGLA 1VZZA 4HKVB 4JF8A 4HBRA 1VQ43 1LOXA 5GSPA 1T2IA 4FMCA 1OHSA 3NX0A 1D6UA 1A2KA 1D6ZA 2ZHXB 1W01A 1SPUA 4XDWA 1FYSA 2YFJB 3WODG 3WA2X 2WOHA 3OX9A 1QAFA 4HM3B 1K9M4 4QWTA 2GBWB 4XBTA 1RRHA 1Y4KA 1ROVA 3MG3A 3SOYA 1O7MB 3F14A 1BSDA 1TP6A 3EBYA 1W6GA 3G6E3 1G0TA 2CW9A 3O8YA 1EEJA 2BHMA 3NM2A 2F99A 1NU3A 2B24B 2AAEA 1RLSA 1BRGA 2BNGA 4CDLA 3GZYB 4O02B 3CC73 4R4KA 1MWSA 2RNTA 3GZRA 4EBGA 3K63A 1M1XB 5AIIA 2F4YA 2WGQA 4N6MA 1VQ83 1YVBI 4HM6B 3TDGA 2HMJB 3DH2A 3E99A 4MMYB 1LQGC 2BU4A 2CH9A 1IQXA 2YFIB 4HJLB 1EUIC 5AYSC 2CFGA 5HGRA 3CC43 1BNIA 1MGRA 4I4KA 3UL5A 4NPBA 1O7PB 4L8OA 2OTJ3 3WA3A 3HOHA 3A76A 1TTOA 1UCIA 1PY3A 3GAXA 4GHOA 1KC84 1RSNA 2XF3A 2J8XB 1QVF2 2KF6A 3QRDA 1IV7A 3PCSA 3DGLA 3G16A 1UGHI 1B2SA 1X1UA 4HOHA 3I553 1I2FA 4EC6A 1FGQA 1M1K4 1HYFA 3CPW2 4N6TA 3OV4A 4RBNA 1CYUA 3K5TA 4N6V0 5JPPA 3U1WA 1GY7A 3V92A 5M1AA 1LVNA 1V57A 3CCQ3 1RGHA 1JZDA 2H0IA 1N8QA 1UCLA 4KFFA 2MC8A 2L4VA 3KZTA 1W02A 1PU4A 3G4S3 1VQ63 1TJDA 3HI7A 3DGMA 5M19A 1N5HA 1V74A 2Z77A 2BIRA 3CCL3 1STFI 3D9RA 4FCJA 2K3DA 1W5ZA 2R41A 4XBYA 4LEHA 2KF4A 3X40A 5IEOA 3SVAA 1ASKA 1BOXA 1B20A 1PYLA 1OUNA 4JRFA 1MWTA 3NBJA 4N6NB 4HM4B 3MPHA 3OWUA 1QMAA 2K54A 3V98A 1B3SA 1JNQA 5DREA 4BU4A 2GEXA 2LQVA 2E2UA 3EN1B 3KSPA 3U97A 2XEPA 1LOWA 4OUQA 5JBSA 2R4IA 3CXC2 1AY7A 2XSHB 1EA2A 6STDA 1FGOA 1TUHA 1BUJA 5AEUB 3AMOB 1O7NB 3CCS3 2KF5A 1I0VA 3EBTA 1WMPA 3NXJA 2KCDA 4N3VA 3FH1A 4EW5A 5IENA 3A5EA 3X3XA 1BRSA 5KP3A 1OGZA 3KCHA 1YIJ3 5AEWB 1JJ22 1BNGA 2BMQB 3JUQA 3H3HA 4K1UA 1JB2A 3GWRA 4XB5A 1W6YA 3LTCA 2F5WA 3PCRA 3UL6A 1ZO2A 3N8BA 2INXA 3FF0A 5AIFA 2IUJA 5AI1A 3L0RA 4NREA 3K9MC 1NJI4 3LYGA 1GD4A 3AHWA 1SIIA 2KRTA 1V58A 2C11A 1TIJA 1E3VA 2XR8B 1GYBA 3DUKA 4RNTA 2E2VA 3G8ZA 1T3BA 5LC7A 3EX9A 2H0HA 1O7HB 1JBRA 3S27A 3I0YA 3V99A 3SOAA 3UB1A 1UI8A 3MKIA 2PZVA 1RGCA 3WOEB 4GSPA 4L8PA 3S67A 5BIRA 1BU4A 3F8HA 3T0UA 2ZDJA 5IERA 1VQP3 1Q42A 3OWYA 4FMDA 4HVNA 1VQO3 1JB4A 4R80A 1Q7HA 2V1LA 1ULIB 4EYCA 8RNTA 4L7KA 1B21A 4IPBA 2ML5A 4CCVA 2P0MA 3N9HA 3CNXA 1YNVX 4GL6A 5M18A 1BAOA 3B4OA 3MYTA 1WQLB 1I2EA 1QVG2 1KQS2 3Q1CA 3NBBA 4HM0B 3X3YA 9RNTA 3I563 2Z6BA 4AKZA 3NBRA 3VF1A 1RN1A 2FXTA 1FGTA 1HKXA 2OQEC 4WFOA 2GU1A 1JKGB 1R4CA 2XRXB 4NHFA 4OK0A 6GSPA 3DM8A 2GU3A 1IVUA 2XFSA 1I70A 1FZUA 3SYUA 4N6OB 4AKYA 1TRQA 1OHPA 1DMQA 4RNYA 1EG9B 1RGAA 1ULJB 3LMLA 4FMBA 1R4YA 3Q2PA 1C54A 1IVXA 1OH0A 1RGKA 2IUKA 3MHEA 1NDOB 3EE1A 1BNRA 1T5YA 1QALA 5IF6A 3J7Yd 1VQ93 2OOVA 2XH9A 3ECFA 2OTL3 5TGNA 3UJMA 3Q90A 2W2CA 1FW7A 2CX1A 4XDVA 1I8VA 1BNFA 3F7XA 3WOFB 5AYRB 3M8CA 2KXGA 1N9EA 1UUWB 2RBIA 1K734 1I0XA 4R9KA 4FCMA 1TFKA 3KN4A 1YJ93 5D83A 4O3VA 1M904 5IW9A 3D5GA 2IA7A 3T8UA 4BTXA 3FZWA 3WMDA 3ZFZA 3JUOA 2E2TA 2P0XA 1DMNA 3HZPA 3UNLA 4KFDA 1JBTA 1B2UA 1GMPA 3CME3 3BNBA 3ZG5A 1GY6A 1BRJA 5IG3A 1BUQA 1BNEA 5IG0A 3JUPA 4BL3A 1Q864 3PGBA 5EQLA 3SX1A 2GBXB 1VQ53 5CF2A 2QIYA 4R9LA 1GMRA 4K90B 1WNHA 1US1A 3NV0B 2F98A 4R1KA 1CH0A 5AIGA 1YHQ3 2CFWA 3EHCA 3DY5A 3CCU3 2C4BA 5EEOA 4G1MB 2RSXA 1G02A 5CXOA 1MOLA 1SIHA 1RCLA 3KKGA 4J5GA 1BRKA 1BRIA 1W6CA 1GOUA 1JN5A 1O7WB 2P09A 2XSOB 2YX9A 3LOYA 4OVMA 2XGLA 5G1LA 3BNCA 2GSPA 3CU3A 1UW1A 1L5GB 3FG4A 1HU9A 1W4NA 3LTBA 3S28A 3CCE3 3CD63 3FKAA 2IY2A 2P05A 2XGNA 3T8NA 1JRQA 2QEX3 1VQL3 1KSIA 3K0ZA 4BL2A 1UCKA 3BIRA 2Z7AA 4MJDA 5JPUA 1B2MA 3RDEA 3FGYA 1MGWA 3AMOA 1VQQA 2CFKA 2H0GA 1K41A 4RZMA 4XM4A 3RNTA 1DE3A 1AR0A 2UX0A 1OCVA 1UUVB 4CJNA 2ZL8A 1E3RA 2CKFB 1O7GB 3B8LA 3JVCA 4HZ9B 2BO9B 4K1VA 1NWWA 4HYZA 1QAKA 3HK4A 3MSOA 3S5CA 2L1SA 2KAAA 4H61A 2C10A 3LTAA 1YJW3 4U13A 2W03A 3H51A 1BSAA 5EVHA 4EV2A 1JB5A 1ZS7A 1AQZA 4H3UA 1JZOA 3HX8A 3SEDA 4HM7B 1HZ1A 1LNHA 1N5PA 2W56B 4K61A 1YGEA 5BXQA 1S5AA 1Q40A 1AVLA 1BVIA 1OF5B 1SJWA 1OHOA 3D5IA 6RNTA 1RCKA 3EF8A 3D4AA 3AGNA 3NV0A 3RGRA 1RKYA 2OQEA 4Q53A 5D81A 4WHAA 5LC6A 5IEPA 3HIGA 1VQM3 3EC9A 1RRLA 4EXRA 3FSDA 3JUNA 1JV2B 3LT8A 1FGMA 1BRNL 3GSPA 2CG0A 1AVKA 3F8XA 4CPKA 4GB5A 4MMXB 3VGNA 3WHOA 3N54B 5BU4A 1W00A 4PEJA 5BVBA 1EKMA 1LNIA 4BTWA 1UCJA 2SARA 1C7HA 2HMLB 2Q07A 1FUWA 2AADA 2KF3A 2WO0A 3G0KA 4LSOA 3ALAA 4KFEA 3AGOA 4X2HA 3CC23 3IJEB 1LQMB 2BMOB 4AEQA 1DYUA 5I97A 3MWZA 3BNDA 1IYYA 1GD3A 1JN5B 1TFOA 1Q40B 5IG5A 1Z1SA 1YGWA 1NB3I 1A2VA 3IMAB 1A90A 4MEIA 1BSBA 1LRAA 1RMSA 1RNTA 2A15A 2YFLB 7RNTA 2UGIA 1U8CB 1RNBA 1LOVA 3EN8A 2CFDA 3X42A 3D3LA 4WWUC 1RGGA 5KP1A 1NB5I 1ZX2A 1K8A4 4ILFA 1YVSA 4FCZA 4O8SA 3DXOA 1OPYA 1GOVA 4J5KA 1S723 1A67A 3OW22 1OGXA 1IK3A 4STDA 1W2ZA 5CK6A 1B2ZA 1MWUA 1RGEA 4LZIA 2JDIH 3SXXA 2OOVC 3X41A 3CMA3 2O9UX 1VQN3 1GOYA 2HMOB 7STDA 1JBSA 1X1YA 1IT8A 1VQ73 1RGFA 3NHXA 1N9JA 1AV4A 1Q9EA 3DZLA 4LGQA 1PFPA 4N6UA 4X2OA 3OXAA 4HM5B 2OCTA 5DRVA 3EB8A 2QGUA 1Q7Y4 1BSCA 2D42A 2RGQA 3NUVA 2CHCA 4EV5A 3STDA 2Y73A 1RN4A 1B2XA 4KVHA 2P38A 4DKIA 3BB9A 4HM8B 2W0QA 4FMAA 3DGOA 3CCJ3 1BGSA 1I3FA 8CHOA 2XFTA 1RDSA 3CNMA 3CPOA 4WYKB 1BANA 2SBLA 2WGOA 3NM7A 1B27A 2M7OA 2RCDA 5D82A 1GMQA 3GZXB 1WTHA 1RJOA 2F86B 4I5QA 3SLUA 4HZBB 3F9SA 3EJVA 1BSEA 1W7CA 1FUSA 2PNCA 3AHSA 3GZBA 2MF7A 1YI23 1SARA 1T2HA 4BTYA 5A0OB 1ROAA 3LXUX 2IYJA 4IT7A 4J8TA 2JQ5A 3FCSB 1RN7A 1OF5A 3NQZA 1IV9A 1FUTA 5CLKA 1ZGXA 1RHLA 2I9WA 1JKGA 2FNQA 3ER7A 2W56A 3MG1A 5G2GA 2CX0A 2CIUA 1IU7A 2STDA 4ZM8A 1U5OA 1F8NA 2CFLA 3LT9A 5STDA 1LOYA 5HOHA 2CWUA
chains in the Genus database with same CATH topology
1IVVA 2Z76A 3LZAA 2B1XB 1DVCA 2CC3A 2GXFA 3F7SA 3QK9A 1QJGA 3FG1A 2HMMB 2OWPA 2W9PA 1OACA 3CCM3 2D1WA 2WOFA 3HIIA 2CWVA 3VSYA 1IQYA 3FF2A 2QA43 3PYJA 4MMZB 2IMJA 1ISKA 2FGTA 2O3OA 1Q814 4N6LA 1IQ8A 2CK3H 3CCV3 3FLJA 4RNZA 3PZWA 4KZ1A 3PS8A 1M9GA 4HM2B 4O2HA 2HMNB 1KWIA 3LTDA 3ROBA 4FR9A 1J2BA 1DVDA 4XBXA 2CG1A 1CYVA 2CWTA 3B4PA 3KFQC 1IDPA 4IIAA 1FGRA 2LYXA 5FGOA 4WP5A 1IT7A 1CQSA 3B7CA 3EQQB 3KE7A 2K0MA 1WMOA 3PXMA 5KP4A 1EQKA 3F40A 3KIIA 5ELUA 5IG4A 2W9QA 1YJN3 3S29A 1VQK3 3JUMA 3LH4A 1NO3A 1DMMA 3GRDA 5ELJA 2HMKB 4J9AA 3WDGB 1WMNA 3BLZA 1Q824 1E97A 1W2B2 2W04A 3KSED 4TX4A 2Y74A 3CCR3 2W6JH 1KD14 1D6YA 3MG2A 1CEWI 3OWSA 3DMCA 5AIHA 4LMIA 3DGNA 3K7CA 2BT3A 3BNEA 1FA3A 1UI7A 3G713 3NQYA 3FG3A 1YIT3 5FW5A 1K28A 2ML6A 1IVWA 1N8R4 1GS3A 4WYKA 1GY5A 1LXEA 4HM1B 1TU5A 2BMRB 2GEYA 3RGAA 3X3ZA 1G96A 1MNLA 1STDA 2RFRA 4ORLA 1SQWA 3IPTA 5CF1A 1VZZA 4HKVB 4JF8A 4HBRA 1VQ43 1LOXA 4FMCA 1OHSA 3NX0A 1D6UA 1A2KA 1D6ZA 4XDWA 1W01A 1SPUA 2YFJB 3WODG 3WA2X 2WOHA 3OX9A 1QAFA 4HM3B 1K9M4 4QWTA 2GBWB 4XBTA 1RRHA 1Y4KA 1ROVA 3MG3A 3SOYA 1O7MB 3F14A 1TP6A 3EBYA 1W6GA 3G6E3 3O8YA 2CW9A 2BHMA 3NM2A 2F99A 1NU3A 2B24B 4CDLA 2BNGA 3CC73 3GZYB 4O02B 4R4KA 3GZRA 4EBGA 3K63A 1M1XB 5AIIA 2WGQA 4N6MA 1VQ83 1YVBI 4HM6B 3TDGA 2HMJB 3E99A 4MMYB 2CH9A 2YFIB 4HJLB 1IQXA 5AYSC 5HGRA 3CC43 2CFGA 4I4KA 3UL5A 1O7PB 4L8OA 2OTJ3 3WA3A 3A76A 3GAXA 1KC84 2XF3A 1QVF2 3QRDA 1IV7A 3PCSA 3DGLA 3G16A 3I553 4EC6A 1FGQA 1M1K4 3CPW2 4N6TA 3OV4A 4RBNA 1CYUA 3K5TA 4N6V0 5JPPA 3U1WA 1GY7A 3V92A 1LVNA 3CCQ3 1N8QA 1PU4A 4KFFA 2MC8A 2L4VA 3KZTA 1W02A 3G4S3 1VQ63 3HI7A 3DGMA 1N5HA 1V74A 2Z77A 3CCL3 1STFI 3D9RA 4FCJA 1W5ZA 4XBYA 4LEHA 3X40A 5IEOA 3SVAA 1ASKA 1OUNA 4JRFA 3NBJA 4N6NB 4HM4B 3MPHA 3OWUA 1QMAA 2K54A 3V98A 1JNQA 5DREA 2GEXA 2LQVA 2E2UA 3EN1B 3KSPA 3U97A 2XEPA 4OUQA 5JBSA 2R4IA 3CXC2 2XSHB 1EA2A 6STDA 1FGOA 1TUHA 5AEUB 3AMOB 1O7NB 3CCS3 3EBTA 1WMPA 3NXJA 2KCDA 4N3VA 3FH1A 5IENA 3X3XA 5KP3A 1YIJ3 1OGZA 5AEWB 1JJ22 3JUQA 2BMQB 3H3HA 4K1UA 1JB2A 3GWRA 4XB5A 1W6YA 3LTCA 3PCRA 3UL6A 1ZO2A 3N8BA 2INXA 3FF0A 5AIFA 2IUJA 5AI1A 3L0RA 4NREA 3K9MC 1NJI4 3LYGA 1GD4A 1SIIA 2KRTA 2C11A 1TIJA 1E3VA 2XR8B 1GYBA 3DUKA 2E2VA 3G8ZA 5LC7A 3EX9A 1O7HB 3S27A 3I0YA 3V99A 3SOAA 3UB1A 1UI8A 3MKIA 2PZVA 3WOEB 4L8PA 3S67A 3F8HA 3T0UA 2ZDJA 5IERA 1VQP3 1Q42A 3OWYA 4FMDA 4HVNA 1VQO3 1JB4A 4R80A 2V1LA 4EYCA 1ULIB 4L7KA 4IPBA 2ML5A 4CCVA 2P0MA 3N9HA 3CNXA 4GL6A 3B4OA 3MYTA 1KQS2 1WQLB 1QVG2 3Q1CA 3NBBA 4HM0B 3X3YA 3I563 2Z6BA 4AKZA 3NBRA 3VF1A 2FXTA 1FGTA 1HKXA 2OQEC 4WFOA 2GU1A 1JKGB 1R4CA 2XRXB 4NHFA 4OK0A 3DM8A 2GU3A 1IVUA 2XFSA 4N6OB 4AKYA 1OHPA 1DMQA 4RNYA 1EG9B 1ULJB 4FMBA 3LMLA 3Q2PA 1IVXA 1OH0A 2IUKA 3MHEA 1NDOB 3EE1A 1T5YA 1QALA 5IF6A 3J7Yd 1VQ93 2OOVA 2XH9A 3ECFA 2OTL3 5TGNA 3UJMA 3Q90A 2W2CA 4XDVA 3F7XA 3WOFB 5AYRB 3M8CA 2KXGA 1N9EA 1UUWB 1K734 4R9KA 4FCMA 1TFKA 3KN4A 1YJ93 5D83A 4O3VA 1M904 5IW9A 3T8UA 2IA7A 4BTXA 3FZWA 3WMDA 3JUOA 2E2TA 2P0XA 1DMNA 3HZPA 3UNLA 4KFDA 3CME3 3BNBA 1GY6A 5IG3A 1BUQA 5IG0A 3JUPA 1Q864 3PGBA 5EQLA 3SX1A 2GBXB 1VQ53 5CF2A 2QIYA 4R9LA 4K90B 1WNHA 1US1A 3NV0B 2F98A 4R1KA 5AIGA 1YHQ3 2CFWA 3EHCA 3DY5A 3CCU3 5EEOA 4G1MB 2RSXA 5CXOA 1MOLA 1SIHA 3KKGA 1W6CA 2XSOB 1JN5A 1O7WB 2P09A 2YX9A 3LOYA 4OVMA 2XGLA 1L5GB 3BNCA 3CU3A 1UW1A 3FG4A 1HU9A 1W4NA 3LTBA 3S28A 3CCE3 3CD63 3FKAA 2QEX3 2P05A 2XGNA 3T8NA 1JRQA 1VQL3 1KSIA 3K0ZA 2Z7AA 4MJDA 5JPUA 3RDEA 3FGYA 3AMOA 2CFKA 1K41A 4RZMA 4XM4A 1AR0A 2UX0A 1OCVA 1UUVB 2ZL8A 1E3RA 2CKFB 1O7GB 3B8LA 3JVCA 4HZ9B 2BO9B 4K1VA 1NWWA 4HYZA 1QAKA 3HK4A 3MSOA 3S5CA 4H61A 2C10A 3LTAA 1YJW3 4U13A 2W03A 3H51A 5EVHA 4EV2A 1JB5A 4H3UA 3HX8A 3SEDA 4HM7B 2W56B 1N5PA 1LNHA 4K61A 5BXQA 1YGEA 1S5AA 1Q40A 1AVLA 1OF5B 1SJWA 1OHOA 3EF8A 3NV0A 3RGRA 1RKYA 2OQEA 4Q53A 5D81A 4WHAA 5LC6A 5IEPA 3HIGA 1VQM3 3EC9A 1RRLA 4EXRA 3FSDA 3JUNA 1JV2B 3LT8A 1FGMA 2CG0A 1AVKA 3F8XA 4GB5A 4MMXB 3VGNA 3N54B 1W00A 4PEJA 5BVBA 1EKMA 4BTWA 1C7HA 2HMLB 2Q07A 1FUWA 3G0KA 2WO0A 4LSOA 3ALAA 4KFEA 4X2HA 3CC23 3IJEB 2BMOB 4AEQA 1DYUA 5I97A 3MWZA 3BNDA 1GD3A 1JN5B 1TFOA 1Q40B 5IG5A 1Z1SA 1A90A 1NB3I 1A2VA 3IMAB 4MEIA 2YFLB 2A15A 1U8CB 3EN8A 2CFDA 3X42A 3D3LA 4WWUC 5KP1A 1NB5I 1ZX2A 1K8A4 4FCZA 4O8SA 3DXOA 1OPYA 1S723 1A67A 3OW22 1OGXA 1IK3A 4STDA 1W2ZA 5CK6A 4LZIA 2JDIH 3SXXA 2OOVC 3X41A 3CMA3 2O9UX 1VQN3 2HMOB 7STDA 1VQ73 1IT8A 3NHXA 1N9JA 1AV4A 3DZLA 4LGQA 1PFPA 4N6UA 4X2OA 3OXAA 4HM5B 2OCTA 5DRVA 3EB8A 2QGUA 1Q7Y4 2D42A 2RGQA 3NUVA 2CHCA 4EV5A 3STDA 2Y73A 4KVHA 2P38A 3BB9A 4HM8B 2W0QA 4FMAA 3DGOA 3CCJ3 8CHOA 2XFTA 3CNMA 3CPOA 4WYKB 2SBLA 2WGOA 3NM7A 2RCDA 2M7OA 5D82A 3GZXB 1WTHA 1RJOA 2F86B 3SLUA 4HZBB 3F9SA 3EJVA 1W7CA 2PNCA 3GZBA 2MF7A 1YI23 4BTYA 5A0OB 1ROAA 3LXUX 4IT7A 4J8TA 2JQ5A 3FCSB 1RN7A 1OF5A 3NQZA 1IV9A 5CLKA 2I9WA 1JKGA 2FNQA 3ER7A 2W56A 3MG1A 5G2GA 2CIUA 2STDA 1IU7A 4ZM8A 1U5OA 1F8NA 2CFLA 3LT9A 5STDA 2CWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IVV A;  3X3Y A;  1RKY A;  2OQE A;  1IQX A;  3HIG A;  2OQE C;  2CFG A;  1OAC A;  4EXR A;  2D1W A;  2GU3 A;  1IVU A;  2WOF A;  2CG0 A;  1AVK A;  3HII A;  2CWV A;  3WA3 A;  1IQY A;  1EKM A;  1IVX A;  4BTW A;  1QAL A;  2WO0 A;  3ALA A;  4KFE A;  2OOV A;  1DYU A;  3K5T A;  1LVN A;  2CG1 A;  1N9E A;  2CWT A;  1PU4 A;  1A2V A;  4KFF A;  3KN4 A;  3HI7 A;  5IW9 A;  2IA7 A;  4BTX A;  2E2T A;  1W5Z A;  2CFD A;  4KFD A;  3X40 A;  3X42 A;  2K0M A;  1WMO A;  3KII A;  3NBJ A;  3MPH A;  3PGB A;  3SX1 A;  1W2Z A;  2E2U A;  4K90 B;  1US1 A;  1WMN A;  3SXX A;  2OOV C;  3X41 A;  2CFW A;  2Y74 A;  3AMO B;  1D6Y A;  1WMP A;  1AV4 A;  3X3X A;  1SIH A;  2BT3 A;  1W6C A;  1UI7 A;  3NQY A;  2YX9 A;  3LOY A;  4EV5 A;  2Y73 A;  1IVW A;  1W4N A;  2W0Q A;  1JRQ A;  1TU5 A;  1KSI A;  3X3Z A;  1SII A;  3AMO A;  2C11 A;  2CFK A;  1RJO A;  2E2V A;  1D6U A;  1D6Z A;  1SPU A;  3WA2 X;  1W7C A;  2WOH A;  2ZL8 A;  1QAF A;  2PNC A;  1UI8 A;  4BTY A;  1QAK A;  3T0U A;  1W6G A;  2C10 A;  3NQZ A;  4EV2 A;  1IU7 A;  2CFL A;  3N9H A;  2CWU A;  1AVL A;  2WGQ A;  3NBB A; 
#chains in the Genus database with same CATH topology
 1IVV A;  2Z76 A;  3LZA A;  2B1X B;  1DVC A;  2CC3 A;  2GXF A;  1I3I A;  3F7S A;  3QK9 A;  1QJG A;  3FG1 A;  2HMM B;  2OWP A;  4LYL B;  2W9P A;  1OAC A;  1BRH A;  2ZA4 A;  3CCM 3;  2D1W A;  2WOF A;  1X1X A;  2CWV A;  3HII A;  3VSY A;  1IQY A;  3FF2 A;  2QA4 3;  3PYJ A;  4MMZ B;  2IMJ A;  1ISK A;  2FGT A;  1X1W A;  2O3O A;  1Q81 4;  4N6L A;  1IQ8 A;  2CK3 H;  3DGY A;  3CCV 3;  3FLJ A;  4RNZ A;  3PZW A;  4KZ1 A;  7GSP A;  3PS8 A;  1M9G A;  3Q3F A;  1MWR A;  4HM2 B;  1GSP A;  2UUG C;  2HMN B;  1KWI A;  4O2H A;  3LTD A;  3ROB A;  4FR9 A;  1J2B A;  1DVD A;  4XBX A;  2CG1 A;  1CYV A;  1DET A;  2CWT A;  3B4P A;  1UDI I;  3KFQ C;  1I2G A;  1IDP A;  5RNT A;  4IIA A;  1FGR A;  2LYX A;  4KT3 B;  5FGO A;  4BIR A;  1UUG B;  4WP5 A;  1IT7 A;  3URP A;  1CQS A;  3B7C A;  3EQQ B;  1TRP A;  3KE7 A;  2K0M A;  1WMO A;  3PXM A;  5KP4 A;  1EQK A;  3F40 A;  3KII A;  5ELU A;  1NNV A;  5IG4 A;  2W9Q A;  3D79 A;  1YJN 3;  3S29 A;  1BNS A;  1VQK 3;  1BNJ A;  3JUM A;  1NO3 A;  3LH4 A;  1DMM A;  3GRD A;  5ELJ A;  2HMK B;  1UGI A;  4J9A A;  3WDG B;  2F5M A;  1WMN A;  3BLZ A;  1Q82 4;  1E97 A;  1W2B 2;  2W04 A;  4HAA A;  3KSE D;  4TX4 A;  2Y74 A;  3CCR 3;  2W6J H;  1KD1 4;  1D6Y A;  3MG2 A;  3BU4 A;  1CEW I;  1RTU A;  3DMC A;  3OWS A;  5AIH A;  4LMI A;  3DGN A;  3K7C A;  2BT3 A;  3BNE A;  1A2P A;  1UI7 A;  3G71 3;  1FA3 A;  3NQY A;  2F56 A;  3FG3 A;  1YIT 3;  5FW5 A;  1K28 A;  2ML6 A;  1IVW A;  1N8R 4;  1GS3 A;  4WYK A;  3ZG0 A;  1GY5 A;  2HOH A;  1LXE A;  4HM1 B;  1TU5 A;  1BIR A;  2BMR B;  2GEY A;  5G1K A;  3RGA A;  3WR2 A;  3X3Z A;  1G96 A;  1MNL A;  1STD A;  2RFR A;  4ORL A;  1SQW A;  3IPT A;  5CF1 A;  1RGL A;  1VZZ A;  4HKV B;  4JF8 A;  4HBR A;  1VQ4 3;  1LOX A;  5GSP A;  1T2I A;  4FMC A;  1OHS A;  3NX0 A;  1D6U A;  1A2K A;  1D6Z A;  2ZHX B;  1W01 A;  1SPU A;  4XDW A;  1FYS A;  2YFJ B;  3WOD G;  3WA2 X;  2WOH A;  3OX9 A;  1QAF A;  4HM3 B;  1K9M 4;  4QWT A;  2GBW B;  4XBT A;  1RRH A;  1Y4K A;  1ROV A;  3MG3 A;  3SOY A;  1O7M B;  3F14 A;  1BSD A;  1TP6 A;  3EBY A;  1W6G A;  3G6E 3;  1G0T A;  2CW9 A;  3O8Y A;  1EEJ A;  2BHM A;  3NM2 A;  2F99 A;  1NU3 A;  2B24 B;  2AAE A;  1RLS A;  1BRG A;  2BNG A;  4CDL A;  3GZY B;  4O02 B;  3CC7 3;  4R4K A;  1MWS A;  2RNT A;  3GZR A;  4EBG A;  3K63 A;  1M1X B;  5AII A;  2F4Y A;  2WGQ A;  4N6M A;  1VQ8 3;  1YVB I;  4HM6 B;  3TDG A;  2HMJ B;  3DH2 A;  3E99 A;  4MMY B;  1LQG C;  2BU4 A;  2CH9 A;  1IQX A;  2YFI B;  4HJL B;  1EUI C;  5AYS C;  2CFG A;  5HGR A;  3CC4 3;  1BNI A;  1MGR A;  4I4K A;  3UL5 A;  4NPB A;  1O7P B;  4L8O A;  2OTJ 3;  3WA3 A;  3HOH A;  3A76 A;  1TTO A;  1UCI A;  1PY3 A;  3GAX A;  4GHO A;  1KC8 4;  1RSN A;  2XF3 A;  2J8X B;  1QVF 2;  2KF6 A;  3QRD A;  1IV7 A;  3PCS A;  3DGL A;  3G16 A;  1UGH I;  1B2S A;  1X1U A;  4HOH A;  3I55 3;  1I2F A;  4EC6 A;  1FGQ A;  1M1K 4;  1HYF A;  3CPW 2;  4N6T A;  3OV4 A;  4RBN A;  1CYU A;  3K5T A;  4N6V 0;  5JPP A;  3U1W A;  1GY7 A;  3V92 A;  5M1A A;  1LVN A;  1V57 A;  3CCQ 3;  1RGH A;  1JZD A;  2H0I A;  1N8Q A;  1UCL A;  4KFF A;  2MC8 A;  2L4V A;  3KZT A;  1W02 A;  1PU4 A;  3G4S 3;  1VQ6 3;  1TJD A;  3HI7 A;  3DGM A;  5M19 A;  1N5H A;  1V74 A;  2Z77 A;  2BIR A;  3CCL 3;  1STF I;  3D9R A;  4FCJ A;  2K3D A;  1W5Z A;  2R41 A;  4XBY A;  4LEH A;  2KF4 A;  3X40 A;  5IEO A;  3SVA A;  1ASK A;  1BOX A;  1B20 A;  1PYL A;  1OUN A;  4JRF A;  1MWT A;  3NBJ A;  4N6N B;  4HM4 B;  3MPH A;  3OWU A;  1QMA A;  2K54 A;  3V98 A;  1B3S A;  1JNQ A;  5DRE A;  4BU4 A;  2GEX A;  2LQV A;  2E2U A;  3EN1 B;  3KSP A;  3U97 A;  2XEP A;  1LOW A;  4OUQ A;  5JBS A;  2R4I A;  3CXC 2;  1AY7 A;  2XSH B;  1EA2 A;  6STD A;  1FGO A;  1TUH A;  1BUJ A;  5AEU B;  3AMO B;  1O7N B;  3CCS 3;  2KF5 A;  1I0V A;  3EBT A;  1WMP A;  3NXJ A;  2KCD A;  4N3V A;  3FH1 A;  4EW5 A;  5IEN A;  3A5E A;  3X3X A;  1BRS A;  5KP3 A;  1OGZ A;  3KCH A;  1YIJ 3;  5AEW B;  1JJ2 2;  1BNG A;  2BMQ B;  3JUQ A;  3H3H A;  4K1U A;  1JB2 A;  3GWR A;  4XB5 A;  1W6Y A;  3LTC A;  2F5W A;  3PCR A;  3UL6 A;  1ZO2 A;  3N8B A;  2INX A;  3FF0 A;  5AIF A;  2IUJ A;  5AI1 A;  3L0R A;  4NRE A;  3K9M C;  1NJI 4;  3LYG A;  1GD4 A;  3AHW A;  1SII A;  2KRT A;  1V58 A;  2C11 A;  1TIJ A;  1E3V A;  2XR8 B;  1GYB A;  3DUK A;  4RNT A;  2E2V A;  3G8Z A;  1T3B A;  5LC7 A;  3EX9 A;  2H0H A;  1O7H B;  1JBR A;  3S27 A;  3I0Y A;  3V99 A;  3SOA A;  3UB1 A;  1UI8 A;  3MKI A;  2PZV A;  1RGC A;  3WOE B;  4GSP A;  4L8P A;  3S67 A;  5BIR A;  1BU4 A;  3F8H A;  3T0U A;  2ZDJ A;  5IER A;  1VQP 3;  1Q42 A;  3OWY A;  4FMD A;  4HVN A;  1VQO 3;  1JB4 A;  4R80 A;  1Q7H A;  2V1L A;  1ULI B;  4EYC A;  8RNT A;  4L7K A;  1B21 A;  4IPB A;  2ML5 A;  4CCV A;  2P0M A;  3N9H A;  3CNX A;  1YNV X;  4GL6 A;  5M18 A;  1BAO A;  3B4O A;  3MYT A;  1WQL B;  1I2E A;  1QVG 2;  1KQS 2;  3Q1C A;  3NBB A;  4HM0 B;  3X3Y A;  9RNT A;  3I56 3;  2Z6B A;  4AKZ A;  3NBR A;  3VF1 A;  1RN1 A;  2FXT A;  1FGT A;  1HKX A;  2OQE C;  4WFO A;  2GU1 A;  1JKG B;  1R4C A;  2XRX B;  4NHF A;  4OK0 A;  6GSP A;  3DM8 A;  2GU3 A;  1IVU A;  2XFS A;  1I70 A;  1FZU A;  3SYU A;  4N6O B;  4AKY A;  1TRQ A;  1OHP A;  1DMQ A;  4RNY A;  1EG9 B;  1RGA A;  1ULJ B;  3LML A;  4FMB A;  1R4Y A;  3Q2P A;  1C54 A;  1IVX A;  1OH0 A;  1RGK A;  2IUK A;  3MHE A;  1NDO B;  3EE1 A;  1BNR A;  1T5Y A;  1QAL A;  5IF6 A;  3J7Y d;  1VQ9 3;  2OOV A;  2XH9 A;  3ECF A;  2OTL 3;  5TGN A;  3UJM A;  3Q90 A;  2W2C A;  1FW7 A;  2CX1 A;  4XDV A;  1I8V A;  1BNF A;  3F7X A;  3WOF B;  5AYR B;  3M8C A;  2KXG A;  1N9E A;  1UUW B;  2RBI A;  1K73 4;  1I0X A;  4R9K A;  4FCM A;  1TFK A;  3KN4 A;  1YJ9 3;  5D83 A;  4O3V A;  1M90 4;  5IW9 A;  3D5G A;  2IA7 A;  3T8U A;  4BTX A;  3FZW A;  3WMD A;  3ZFZ A;  3JUO A;  2E2T A;  2P0X A;  1DMN A;  3HZP A;  3UNL A;  4KFD A;  1JBT A;  1B2U A;  1GMP A;  3CME 3;  3BNB A;  3ZG5 A;  1GY6 A;  1BRJ A;  5IG3 A;  1BUQ A;  1BNE A;  5IG0 A;  3JUP A;  4BL3 A;  1Q86 4;  3PGB A;  5EQL A;  3SX1 A;  2GBX B;  1VQ5 3;  5CF2 A;  2QIY A;  4R9L A;  1GMR A;  4K90 B;  1WNH A;  1US1 A;  3NV0 B;  2F98 A;  4R1K A;  1CH0 A;  5AIG A;  1YHQ 3;  2CFW A;  3EHC A;  3DY5 A;  3CCU 3;  2C4B A;  5EEO A;  4G1M B;  2RSX A;  1G02 A;  5CXO A;  1MOL A;  1SIH A;  1RCL A;  3KKG A;  4J5G A;  1BRK A;  1BRI A;  1W6C A;  1GOU A;  1JN5 A;  1O7W B;  2P09 A;  2XSO B;  2YX9 A;  3LOY A;  4OVM A;  2XGL A;  5G1L A;  3BNC A;  2GSP A;  3CU3 A;  1UW1 A;  1L5G B;  3FG4 A;  1HU9 A;  1W4N A;  3LTB A;  3S28 A;  3CCE 3;  3CD6 3;  3FKA A;  2IY2 A;  2P05 A;  2XGN A;  3T8N A;  1JRQ A;  2QEX 3;  1VQL 3;  1KSI A;  3K0Z A;  4BL2 A;  1UCK A;  3BIR A;  2Z7A A;  4MJD A;  5JPU A;  1B2M A;  3RDE A;  3FGY A;  1MGW A;  3AMO A;  1VQQ A;  2CFK A;  2H0G A;  1K41 A;  4RZM A;  4XM4 A;  3RNT A;  1DE3 A;  1AR0 A;  2UX0 A;  1OCV A;  1UUV B;  4CJN A;  2ZL8 A;  1E3R A;  2CKF B;  1O7G B;  3B8L A;  3JVC A;  4HZ9 B;  2BO9 B;  4K1V A;  1NWW A;  4HYZ A;  1QAK A;  3HK4 A;  3MSO A;  3S5C A;  2L1S A;  2KAA A;  4H61 A;  2C10 A;  3LTA A;  1YJW 3;  4U13 A;  2W03 A;  3H51 A;  1BSA A;  5EVH A;  4EV2 A;  1JB5 A;  1ZS7 A;  1AQZ A;  4H3U A;  1JZO A;  3HX8 A;  3SED A;  4HM7 B;  1HZ1 A;  1LNH A;  1N5P A;  2W56 B;  4K61 A;  1YGE A;  5BXQ A;  1S5A A;  1Q40 A;  1AVL A;  1BVI A;  1OF5 B;  1SJW A;  1OHO A;  3D5I A;  6RNT A;  1RCK A;  3EF8 A;  3D4A A;  3AGN A;  3NV0 A;  3RGR A;  1RKY A;  2OQE A;  4Q53 A;  5D81 A;  4WHA A;  5LC6 A;  5IEP A;  3HIG A;  1VQM 3;  3EC9 A;  1RRL A;  4EXR A;  3FSD A;  3JUN A;  1JV2 B;  3LT8 A;  1FGM A;  1BRN L;  3GSP A;  2CG0 A;  1AVK A;  3F8X A;  4CPK A;  4GB5 A;  4MMX B;  3VGN A;  3WHO A;  3N54 B;  5BU4 A;  1W00 A;  4PEJ A;  5BVB A;  1EKM A;  1LNI A;  4BTW A;  1UCJ A;  2SAR A;  1C7H A;  2HML B;  2Q07 A;  1FUW A;  2AAD A;  2KF3 A;  2WO0 A;  3G0K A;  4LSO A;  3ALA A;  4KFE A;  3AGO A;  4X2H A;  3CC2 3;  3IJE B;  1LQM B;  2BMO B;  4AEQ A;  1DYU A;  5I97 A;  3MWZ A;  3BND A;  1IYY A;  1GD3 A;  1JN5 B;  1TFO A;  1Q40 B;  5IG5 A;  1Z1S A;  1YGW A;  1NB3 I;  1A2V A;  3IMA B;  1A90 A;  4MEI A;  1BSB A;  1LRA A;  1RMS A;  1RNT A;  2A15 A;  2YFL B;  7RNT A;  2UGI A;  1U8C B;  1RNB A;  1LOV A;  3EN8 A;  2CFD A;  3X42 A;  3D3L A;  4WWU C;  1RGG A;  5KP1 A;  1NB5 I;  1ZX2 A;  1K8A 4;  4ILF A;  1YVS A;  4FCZ A;  4O8S A;  3DXO A;  1OPY A;  1GOV A;  4J5K A;  1S72 3;  1A67 A;  3OW2 2;  1OGX A;  1IK3 A;  4STD A;  1W2Z A;  5CK6 A;  1B2Z A;  1MWU A;  1RGE A;  4LZI A;  2JDI H;  3SXX A;  2OOV C;  3X41 A;  3CMA 3;  2O9U X;  1VQN 3;  1GOY A;  2HMO B;  7STD A;  1JBS A;  1X1Y A;  1IT8 A;  1VQ7 3;  1RGF A;  3NHX A;  1N9J A;  1AV4 A;  1Q9E A;  3DZL A;  4LGQ A;  1PFP A;  4N6U A;  4X2O A;  3OXA A;  4HM5 B;  2OCT A;  5DRV A;  3EB8 A;  2QGU A;  1Q7Y 4;  1BSC A;  2D42 A;  2RGQ A;  3NUV A;  2CHC A;  4EV5 A;  3STD A;  2Y73 A;  1RN4 A;  1B2X A;  4KVH A;  2P38 A;  4DKI A;  3BB9 A;  4HM8 B;  2W0Q A;  4FMA A;  3DGO A;  3CCJ 3;  1BGS A;  1I3F A;  8CHO A;  2XFT A;  1RDS A;  3CNM A;  3CPO A;  4WYK B;  1BAN A;  2SBL A;  2WGO A;  3NM7 A;  1B27 A;  2M7O A;  2RCD A;  5D82 A;  1GMQ A;  3GZX B;  1WTH A;  1RJO A;  2F86 B;  4I5Q A;  3SLU A;  4HZB B;  3F9S A;  3EJV A;  1BSE A;  1W7C A;  1FUS A;  2PNC A;  3AHS A;  3GZB A;  2MF7 A;  1YI2 3;  1SAR A;  1T2H A;  4BTY A;  5A0O B;  1ROA A;  3LXU X;  2IYJ A;  4IT7 A;  4J8T A;  2JQ5 A;  3FCS B;  1RN7 A;  1OF5 A;  3NQZ A;  1IV9 A;  1FUT A;  5CLK A;  1ZGX A;  1RHL A;  2I9W A;  1JKG A;  2FNQ A;  3ER7 A;  2W56 A;  3MG1 A;  5G2G A;  2CX0 A;  2CIU A;  1IU7 A;  2STD A;  4ZM8 A;  1U5O A;  1F8N A;  2CFL A;  3LT9 A;  5STD A;  1LOY A;  5HOH A;  2CWU A; 
#chains in the Genus database with same CATH homology
 1IVV A;  2Z76 A;  3LZA A;  2B1X B;  1DVC A;  2CC3 A;  2GXF A;  3F7S A;  3QK9 A;  1QJG A;  3FG1 A;  2HMM B;  2OWP A;  2W9P A;  1OAC A;  3CCM 3;  2D1W A;  2WOF A;  3HII A;  2CWV A;  3VSY A;  1IQY A;  3FF2 A;  2QA4 3;  3PYJ A;  4MMZ B;  2IMJ A;  1ISK A;  2FGT A;  2O3O A;  1Q81 4;  4N6L A;  1IQ8 A;  2CK3 H;  3CCV 3;  3FLJ A;  4RNZ A;  3PZW A;  4KZ1 A;  3PS8 A;  1M9G A;  4HM2 B;  4O2H A;  2HMN B;  1KWI A;  3LTD A;  3ROB A;  4FR9 A;  1J2B A;  1DVD A;  4XBX A;  2CG1 A;  1CYV A;  2CWT A;  3B4P A;  3KFQ C;  1IDP A;  4IIA A;  1FGR A;  2LYX A;  5FGO A;  4WP5 A;  1IT7 A;  1CQS A;  3B7C A;  3EQQ B;  3KE7 A;  2K0M A;  1WMO A;  3PXM A;  5KP4 A;  1EQK A;  3F40 A;  3KII A;  5ELU A;  5IG4 A;  2W9Q A;  1YJN 3;  3S29 A;  1VQK 3;  3JUM A;  3LH4 A;  1NO3 A;  1DMM A;  3GRD A;  5ELJ A;  2HMK B;  4J9A A;  3WDG B;  1WMN A;  3BLZ A;  1Q82 4;  1E97 A;  1W2B 2;  2W04 A;  3KSE D;  4TX4 A;  2Y74 A;  3CCR 3;  2W6J H;  1KD1 4;  1D6Y A;  3MG2 A;  1CEW I;  3OWS A;  3DMC A;  5AIH A;  4LMI A;  3DGN A;  3K7C A;  2BT3 A;  3BNE A;  1FA3 A;  1UI7 A;  3G71 3;  3NQY A;  3FG3 A;  1YIT 3;  5FW5 A;  1K28 A;  2ML6 A;  1IVW A;  1N8R 4;  1GS3 A;  4WYK A;  1GY5 A;  1LXE A;  4HM1 B;  1TU5 A;  2BMR B;  2GEY A;  3RGA A;  3X3Z A;  1G96 A;  1MNL A;  1STD A;  2RFR A;  4ORL A;  1SQW A;  3IPT A;  5CF1 A;  1VZZ A;  4HKV B;  4JF8 A;  4HBR A;  1VQ4 3;  1LOX A;  4FMC A;  1OHS A;  3NX0 A;  1D6U A;  1A2K A;  1D6Z A;  4XDW A;  1W01 A;  1SPU A;  2YFJ B;  3WOD G;  3WA2 X;  2WOH A;  3OX9 A;  1QAF A;  4HM3 B;  1K9M 4;  4QWT A;  2GBW B;  4XBT A;  1RRH A;  1Y4K A;  1ROV A;  3MG3 A;  3SOY A;  1O7M B;  3F14 A;  1TP6 A;  3EBY A;  1W6G A;  3G6E 3;  3O8Y A;  2CW9 A;  2BHM A;  3NM2 A;  2F99 A;  1NU3 A;  2B24 B;  4CDL A;  2BNG A;  3CC7 3;  3GZY B;  4O02 B;  4R4K A;  3GZR A;  4EBG A;  3K63 A;  1M1X B;  5AII A;  2WGQ A;  4N6M A;  1VQ8 3;  1YVB I;  4HM6 B;  3TDG A;  2HMJ B;  3E99 A;  4MMY B;  2CH9 A;  2YFI B;  4HJL B;  1IQX A;  5AYS C;  5HGR A;  3CC4 3;  2CFG A;  4I4K A;  3UL5 A;  1O7P B;  4L8O A;  2OTJ 3;  3WA3 A;  3A76 A;  3GAX A;  1KC8 4;  2XF3 A;  1QVF 2;  3QRD A;  1IV7 A;  3PCS A;  3DGL A;  3G16 A;  3I55 3;  4EC6 A;  1FGQ A;  1M1K 4;  3CPW 2;  4N6T A;  3OV4 A;  4RBN A;  1CYU A;  3K5T A;  4N6V 0;  5JPP A;  3U1W A;  1GY7 A;  3V92 A;  1LVN A;  3CCQ 3;  1N8Q A;  1PU4 A;  4KFF A;  2MC8 A;  2L4V A;  3KZT A;  1W02 A;  3G4S 3;  1VQ6 3;  3HI7 A;  3DGM A;  1N5H A;  1V74 A;  2Z77 A;  3CCL 3;  1STF I;  3D9R A;  4FCJ A;  1W5Z A;  4XBY A;  4LEH A;  3X40 A;  5IEO A;  3SVA A;  1ASK A;  1OUN A;  4JRF A;  3NBJ A;  4N6N B;  4HM4 B;  3MPH A;  3OWU A;  1QMA A;  2K54 A;  3V98 A;  1JNQ A;  5DRE A;  2GEX A;  2LQV A;  2E2U A;  3EN1 B;  3KSP A;  3U97 A;  2XEP A;  4OUQ A;  5JBS A;  2R4I A;  3CXC 2;  2XSH B;  1EA2 A;  6STD A;  1FGO A;  1TUH A;  5AEU B;  3AMO B;  1O7N B;  3CCS 3;  3EBT A;  1WMP A;  3NXJ A;  2KCD A;  4N3V A;  3FH1 A;  5IEN A;  3X3X A;  5KP3 A;  1YIJ 3;  1OGZ A;  5AEW B;  1JJ2 2;  3JUQ A;  2BMQ B;  3H3H A;  4K1U A;  1JB2 A;  3GWR A;  4XB5 A;  1W6Y A;  3LTC A;  3PCR A;  3UL6 A;  1ZO2 A;  3N8B A;  2INX A;  3FF0 A;  5AIF A;  2IUJ A;  5AI1 A;  3L0R A;  4NRE A;  3K9M C;  1NJI 4;  3LYG A;  1GD4 A;  1SII A;  2KRT A;  2C11 A;  1TIJ A;  1E3V A;  2XR8 B;  1GYB A;  3DUK A;  2E2V A;  3G8Z A;  5LC7 A;  3EX9 A;  1O7H B;  3S27 A;  3I0Y A;  3V99 A;  3SOA A;  3UB1 A;  1UI8 A;  3MKI A;  2PZV A;  3WOE B;  4L8P A;  3S67 A;  3F8H A;  3T0U A;  2ZDJ A;  5IER A;  1VQP 3;  1Q42 A;  3OWY A;  4FMD A;  4HVN A;  1VQO 3;  1JB4 A;  4R80 A;  2V1L A;  4EYC A;  1ULI B;  4L7K A;  4IPB A;  2ML5 A;  4CCV A;  2P0M A;  3N9H A;  3CNX A;  4GL6 A;  3B4O A;  3MYT A;  1KQS 2;  1WQL B;  1QVG 2;  3Q1C A;  3NBB A;  4HM0 B;  3X3Y A;  3I56 3;  2Z6B A;  4AKZ A;  3NBR A;  3VF1 A;  2FXT A;  1FGT A;  1HKX A;  2OQE C;  4WFO A;  2GU1 A;  1JKG B;  1R4C A;  2XRX B;  4NHF A;  4OK0 A;  3DM8 A;  2GU3 A;  1IVU A;  2XFS A;  4N6O B;  4AKY A;  1OHP A;  1DMQ A;  4RNY A;  1EG9 B;  1ULJ B;  4FMB A;  3LML A;  3Q2P A;  1IVX A;  1OH0 A;  2IUK A;  3MHE A;  1NDO B;  3EE1 A;  1T5Y A;  1QAL A;  5IF6 A;  3J7Y d;  1VQ9 3;  2OOV A;  2XH9 A;  3ECF A;  2OTL 3;  5TGN A;  3UJM A;  3Q90 A;  2W2C A;  4XDV A;  3F7X A;  3WOF B;  5AYR B;  3M8C A;  2KXG A;  1N9E A;  1UUW B;  1K73 4;  4R9K A;  4FCM A;  1TFK A;  3KN4 A;  1YJ9 3;  5D83 A;  4O3V A;  1M90 4;  5IW9 A;  3T8U A;  2IA7 A;  4BTX A;  3FZW A;  3WMD A;  3JUO A;  2E2T A;  2P0X A;  1DMN A;  3HZP A;  3UNL A;  4KFD A;  3CME 3;  3BNB A;  1GY6 A;  5IG3 A;  1BUQ A;  5IG0 A;  3JUP A;  1Q86 4;  3PGB A;  5EQL A;  3SX1 A;  2GBX B;  1VQ5 3;  5CF2 A;  2QIY A;  4R9L A;  4K90 B;  1WNH A;  1US1 A;  3NV0 B;  2F98 A;  4R1K A;  5AIG A;  1YHQ 3;  2CFW A;  3EHC A;  3DY5 A;  3CCU 3;  5EEO A;  4G1M B;  2RSX A;  5CXO A;  1MOL A;  1SIH A;  3KKG A;  1W6C A;  2XSO B;  1JN5 A;  1O7W B;  2P09 A;  2YX9 A;  3LOY A;  4OVM A;  2XGL A;  1L5G B;  3BNC A;  3CU3 A;  1UW1 A;  3FG4 A;  1HU9 A;  1W4N A;  3LTB A;  3S28 A;  3CCE 3;  3CD6 3;  3FKA A;  2QEX 3;  2P05 A;  2XGN A;  3T8N A;  1JRQ A;  1VQL 3;  1KSI A;  3K0Z A;  2Z7A A;  4MJD A;  5JPU A;  3RDE A;  3FGY A;  3AMO A;  2CFK A;  1K41 A;  4RZM A;  4XM4 A;  1AR0 A;  2UX0 A;  1OCV A;  1UUV B;  2ZL8 A;  1E3R A;  2CKF B;  1O7G B;  3B8L A;  3JVC A;  4HZ9 B;  2BO9 B;  4K1V A;  1NWW A;  4HYZ A;  1QAK A;  3HK4 A;  3MSO A;  3S5C A;  4H61 A;  2C10 A;  3LTA A;  1YJW 3;  4U13 A;  2W03 A;  3H51 A;  5EVH A;  4EV2 A;  1JB5 A;  4H3U A;  3HX8 A;  3SED A;  4HM7 B;  2W56 B;  1N5P A;  1LNH A;  4K61 A;  5BXQ A;  1YGE A;  1S5A A;  1Q40 A;  1AVL A;  1OF5 B;  1SJW A;  1OHO A;  3EF8 A;  3NV0 A;  3RGR A;  1RKY A;  2OQE A;  4Q53 A;  5D81 A;  4WHA A;  5LC6 A;  5IEP A;  3HIG A;  1VQM 3;  3EC9 A;  1RRL A;  4EXR A;  3FSD A;  3JUN A;  1JV2 B;  3LT8 A;  1FGM A;  2CG0 A;  1AVK A;  3F8X A;  4GB5 A;  4MMX B;  3VGN A;  3N54 B;  1W00 A;  4PEJ A;  5BVB A;  1EKM A;  4BTW A;  1C7H A;  2HML B;  2Q07 A;  1FUW A;  3G0K A;  2WO0 A;  4LSO A;  3ALA A;  4KFE A;  4X2H A;  3CC2 3;  3IJE B;  2BMO B;  4AEQ A;  1DYU A;  5I97 A;  3MWZ A;  3BND A;  1GD3 A;  1JN5 B;  1TFO A;  1Q40 B;  5IG5 A;  1Z1S A;  1A90 A;  1NB3 I;  1A2V A;  3IMA B;  4MEI A;  2YFL B;  2A15 A;  1U8C B;  3EN8 A;  2CFD A;  3X42 A;  3D3L A;  4WWU C;  5KP1 A;  1NB5 I;  1ZX2 A;  1K8A 4;  4FCZ A;  4O8S A;  3DXO A;  1OPY A;  1S72 3;  1A67 A;  3OW2 2;  1OGX A;  1IK3 A;  4STD A;  1W2Z A;  5CK6 A;  4LZI A;  2JDI H;  3SXX A;  2OOV C;  3X41 A;  3CMA 3;  2O9U X;  1VQN 3;  2HMO B;  7STD A;  1VQ7 3;  1IT8 A;  3NHX A;  1N9J A;  1AV4 A;  3DZL A;  4LGQ A;  1PFP A;  4N6U A;  4X2O A;  3OXA A;  4HM5 B;  2OCT A;  5DRV A;  3EB8 A;  2QGU A;  1Q7Y 4;  2D42 A;  2RGQ A;  3NUV A;  2CHC A;  4EV5 A;  3STD A;  2Y73 A;  4KVH A;  2P38 A;  3BB9 A;  4HM8 B;  2W0Q A;  4FMA A;  3DGO A;  3CCJ 3;  8CHO A;  2XFT A;  3CNM A;  3CPO A;  4WYK B;  2SBL A;  2WGO A;  3NM7 A;  2RCD A;  2M7O A;  5D82 A;  3GZX B;  1WTH A;  1RJO A;  2F86 B;  3SLU A;  4HZB B;  3F9S A;  3EJV A;  1W7C A;  2PNC A;  3GZB A;  2MF7 A;  1YI2 3;  4BTY A;  5A0O B;  1ROA A;  3LXU X;  4IT7 A;  4J8T A;  2JQ5 A;  3FCS B;  1RN7 A;  1OF5 A;  3NQZ A;  1IV9 A;  5CLK A;  2I9W A;  1JKG A;  2FNQ A;  3ER7 A;  2W56 A;  3MG1 A;  5G2G A;  2CIU A;  2STD A;  1IU7 A;  4ZM8 A;  1U5O A;  1F8N A;  2CFL A;  3LT9 A;  5STD A;  2CWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...