3NR0A

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r6 6/10a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
245
Chain Sequence
ATLKASSLRALKLMHLATTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASASLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
molecule keywords deoxyribose phosphate aldolase
molecule tags Lyase
source organism Escherichia coli
total genus 92
structure length 245
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nr0A00
5D33A 1G7VA 4UTTA 3DHFA 2NXHA 3DU0A 3O16A 4WXZA 3V75A 1W37A 1IXOA 1FWWA 5IBXA 4MY8A 3GXPA 2C3ZA 4HN4A 3N2XA 1XBXA 3USBA 4IMGA 1BKSA 2A4AA 3P8IA 3S1UA 3Q94A 3PR2A 4NU7A 1JQVA 3MO7A 1PL9A 3CB8A 2VFEA 5K3VA 4A2SA 2H8ZA 4R33A 3M5VA 3P82A 3A24A 3A5FA 5D30A 4UFMA 3EWZA 2E5DA 1FDYA 2G97A 2KZHA 3P5YA 4U28A 3B4UA 1ZJIA 1NF0A 3IEBA 2FB3A 3HBLA 2YR1A 5G2IA 2OJPA 1S3HA 5G4EA 4MZ8A 3W22A 5LGZA 1EP3A 1GWJA 3DKLA 1U5JA 5K4ZA 2C1HA 3LHZA 1SW0A 4EWND 2CLHA 2FB2A 3NPXA 3DI1A 5K4XA 4UR7A 2CLLA 1LCOA 3EX1A 3BLIA 5LNUA 2JKPA 4ZQCA 4PEKA 4DO4A 3UPWA 2ZZ7A 3RF9A 2TPSA 1MEWA 4M7SA 1ALDA 5HR6A 4PL1A 4UTTC 4TMBA 5EBUA 4O11A 1D3GA 3NM1A 2QCDA 3F1QA 4LT9A 2AAMA 5IBXC 4JXCA 2ZYFA 1IXNA 1KFKA 1W1ZA 3G1AA 1RQHA 4N4PA 1FCQA 3W7EA 1RV8A 3DFOA 4GUFA 1EUNA 1RR2A 3LCIA 1SW3A 2E6DA 1OX5A 1VRDA 1FXPA 3PM6A 2OX1A 3W84A 3M43A 4LS2A 3PY2A 3L66A 3L2IA 3WFAA 4A22A 2VC6A 5U7SA 3STEA 1X1ZA 5F4WA 1JRCA 1Z41A 3KHJA 3A9IA 1ZFJA 5D02A 2TMDA 2CLEA 2QCMA 3W1MA 3UWWA 2RDTA 5CZJA 2OZ0A 2JK2A 1YDNA 2J88A 4NJGA 1O94A 3B0PA 4RZ6A 4EOUA 1LP6A 1J5TA 4CQ8A 1PCWA 1H7NA 1BTMA 2DZPA 2GQ9A 1T99A 3BK0A 1FCUA 3T40A 2GOUA 4HSOA 4QSHA 2E6AA 2JGQA 4TX9A 1DQWA 3O8AA 5F1UA 3OVRA 2YW3A 1IF2A 3DGRA 1YYAA 4K36A 1ZHAA 2YFNA 5AC6A 5AN7A 3NXFA 2P0OA 3O1NA 4IPIA 2Z2UA 2Y88A 3UZ5A 3UWVA 1K3UA 1VR6A 3DHDA 4XTDA 2Q3RA 3SSJA 4AMAA 3STGA 3ABRA 3GAYA 1E51A 3FYPA 4YLWA 4JD4A 1L2UA 2X1RA 1W5MA 1NVMA 3QYQA 4GE8A 1JCXA 2ZA1A 1H61A 2QJHA 3GDMA 1EWEA 1NF7A 3FKKA 5CZ0A 4N6EA 3U2OA 1QR7A 4E2BA 3NL5A 4POCA 5DCBA 2NZLA 4WUIA 3DENA 3CQ0A 5SWUA 1RQBA 3EKLA 1X6UA 2D73A 3EX6A 1OF8A 2NV2A 1ICQA 2TRSA 4O19A 4LS1A 3TSMA 3NPUA 1R47A 1H7RA 5AC8A 3OVQA 2E5BA 1F76A 2HS8A 2XFWA 3MJYA 3N19B 3C61A 4QISA 3QMRA 2VEPA 1F05A 4ZQMA 1LYXA 5FF0A 1I2NA 3P67A 5D09A 1SQ7A 1OG0A 3SW6A 3G1XA 3TXVA 2VEMA 1EP1A 2J27A 1FY6A 2ZRWA 3W7OA 1C8VA 2W6RA 3LLFA 2C18A 1TRIA 3M5YA 1FWSA 3KFTA 3VFLA 2V5LA 3FFSA 1ADOA 4MUZA 3C0JA 3GR8A 3CIXA 1F2JA 2AGKA 1XBYA 3W74A 1GPWA 1O95A 3FOKA 1UB3A 2CZFA 2NLIA 3SGZA 1FDZA 2Z1BA 3W72A 3TR2A 4WOZA 1F73A 1DV7A 2X16A 3NYZA 1OFDA 1JJKA 4MLRA 3UY8A 2Z6IA 1LLZA 1WV2A 2B4GA 4EVZA 4BF9A 4P2VA 3KX6A 1GT8A 2GPTA 3MMTA 1V7YA 5TBOA 1JCNA 3GNNA 4LC6A 3TDFA 4DBEA 1JUEA 3LCGA 1Q6OA 4PFMA 3W2UA 3W73A 1VCGA 2V8ZA 5D2VA 5G2WA 1Z48A 2ZRZA 3AO0A 5AHEA 3PAJA 3NNTA 2EGZA 3CWOX 5AHLA 3LHYA 3V1PA 3BLFA 4M5PA 4NUWA 1K02A 4R34A 1LOLA 5LNSA 1I2RA 1YDVA 5I3GA 1N55A 4HT3A 1J4EA 3MHGA 2V9DA 2GVJA 4ZVJA 2GJNA 1TSIA 4AH7A 1KBJA 5FI8A 4I7UA 4O0ZA 3G1FA 5KMYA 3VI2A 2YPIA 2Y7EA 4NNAA 3QW3A 4RR4A 3M9YA 4Y8FA 2QCEA 3LI0A 4XWUA 3O6CA 1XI3A 2WV8A 3LV6A 4WJEA 3HG2A 2ZTJA 2FLIA 1Q6LA 3PB2A 3M5ZA 5HJLA 1KFBA 4JYFA 1TMHA 3HGJA 3S5YA 1L6WA 3DFSA 4MYAA 4NX5A 4D2JA 5BOOA 1R30A 4M7TA 2QF7A 2NUWA 1H7OA 1ZY9A 2WNZA 4IOTA 4LOCA 2V82A 4DXVA 2ZQ0A 3UYCA 4O13A 1UUMA 1JULA 4RK8A 5D2WA 1I4NA 2GVLA 1HL2A 4GJ1A 3DFTA 3C2RA 4UTHA 3N2MA 3P74A 2RDUA 3EWWA 4Q33A 5KITA 3W1RA 4TIMA 3S6DA 3U8GA 3TFCA 2QCFA 2QCDB 4JTHA 1GVOA 4N9BA 5F1VA 1JCLA 4QITA 2ZRUA 4S2BA 1SZEA 1DHPA 3UXAA 2CU0A 2BWGA 3W2LA 1S5WA 3EX2A 3CLMA 1V5XA 1H1ZA 1VHNA 3RLUA 1UBSA 1KA9F 3PBYA 1TYGA 4FF7A 3PG8A 3NQFA 4QIUA 4XTIA 3NQGA 3LI1A 1SPQA 2NUYA 4KFPA 1HO1A 5AFDA 4PTNA 4MVAA 1ICPA 2QJIA 4FNUA 3TIMA 4AHOA 3B05A 4IWWA 4O28A 4DO6A 4N6FA 1HUVA 3PULA 2GUUA 2Z6JA 1ME7A 5FEPA 1I8JA 5AC7A 3L0KA 4WXYA 1LROA 2GQAA 4O4WA 3QRHA 1LBFA 2Y7GA 1DBTA 1Q45A 4UTLA 3DKJA 4FNRA 5I3JA 4CNPA 4RXFA 3S9YA 1LOQA 4GUGA 5LHFA 2TSYA 2YYUA 5I3HA 1AL8A 4MZYA 4NT0A 1A5SA 4O14A 3HB9A 5HULA 4BI7A 4NVTA 1JR1A 3NL6A 4I7WA 3FLUA 3RK8A 3QQ1A 5AYYA 1VS1A 1MXSA 4N9EA 1LBLA 3GK0A 1EP2A 3HMJG 2H90A 2P1FA 3LCFA 3GKFA 4UFHA 4CQAA 1PIIA 3KOFA 5CKSA 3IV3A 3NQ2A 2EKCA 2Y6ZA 1GTEA 3EWBX 5FEXA 4JTIA 1TTQA 4IMEA 1XUZA 3NR0A 4WD0A 4CNOA 1F5ZA 5K2ZA 3TK7A 3L5MA 1W8SA 4RXGA 3SGUA 4DQWA 3CWNA 4K8EA 4K7VA 1VYPX 2QCCA 3S1XA 2ATSA 2G95A 4KWVA 1WOBA 2X1UA 3G0SA 3O05A 2DP3A 3C8FA 3TX9A 3BARA 4X2RA 2PC4A 3NQDA 4AWSA 2E68A 5HNRA 3CC1A 4O0KA 3W71A 1JCYA 5D2YA 3CEPA 4LV4A 1RD5A 3TMQA 3W2MA 1MZHA 4KFNA 6ALDA 2E1DA 1VH7A 3OA3A 4O52A 1B3OA 1TV7A 4MJZA 4MIMA 3KVLA 4UNKA 1QOQA 2EPHA 3W7CA 1I2OA 5BW6A 4AXKA 1HTIA 1NEYA 5L9FA 1TJRA 2V5BA 4RX0A 3G8RA 4QAIA 4Z1BA 1H7PA 3UPBA 1G69A 3L5AA 3NQ8A 1BWLA 3N3MA 3M47A 2A5HA 2R91A 4GRSA 3S5ZA 5GVJA 4MOZA 4O54A 2YGYA 5G1TA 1WYIA 4AEOA 3P5ZA 5C5YA 2C19A 1IIHA 3LTSA 2OCZA 5DXXA 1PV8A 1P0NA 2BX7A 4PC8A 3M7WA 4X22A 3UY7A 3W7MA 3VCRA 4OV9A 4FIRA 3KRUA 1AW2A 1XUUA 3C2EA 4Z1DA 4GXMA 1LLWA 1M6JA 2VEKA 3TAKA 4KWWA 3IVUA 3G22A 1PVNA 4CNNA 3TFXA 2ZZ4A 1KFEA 2ALDA 3NQVA 1M7OA 1OFEA 1OVDA 1EWDA 2PRLA 5G5IA 4JTEA 3NQEA 4FO4A 1FWTA 1FWNA 4UFJA 3A21A 4M19A 2B7QA 3TNOA 3C3NA 5T26A 4GC4A 5EA9A 3B0VC 3GDKA 1HO4A 4LTSA 5E1QA 3B04A 2GQ8A 5F4SA 3ZFHA 2VOMA 1D3HA 5KZDA 1YADA 5K9CA 4FXRA 3FJLA 4ADSA 1FXQA 4B5NA 1PHQA 3I7RA 4OWGA 3R8RA 2VKZG 4XQ6A 5D05A 3G3DA 3OEXA 4ZQNA 3NZRA 1CI1A 3NPVA 3DFPA 4JX5A 3T4CA 1O5KA 1BEUA 3EXSA 4GUHA 3IGUA 1QPNA 5L6UA 1SO5A 5K7JA 4E38A 3S0CA 1VYSX 1AL7A 2BSLA 3KRSA 1LZOA 3LXCA 3GXTA 4ADTA 1A53A 2NXIA 1R2RA 4DF2A 1G7UA 3QC3A 3OIXA 4X3ZA 5HINA 3UWZA 5KSWA 5D04C 1WAUA 2Q8LA 3PBVA 1X8FA 2NV1A 4KFOA 4ICNA 3WK0A 4UMAA 1TPFA 4O1AA 2WNQA 3W75A 5FF3A 1GEQA 3H55A 3STFA 2A85A 3AJXA 4IUOA 1DJQA 4FNPA 4DEFA 1TV8A 2FQIA 1WX0A 3LCWA 1H60A 3THAA 5A5WA 3W1QA 1G4PA 1F6PA 2H8XA 3SI9A 2DU2A 5AYZA 4UMCA 1N8FA 1PCKA 4ORIA 1CX9A 1W5OA 3MWAA 3NQ7A 2V2DA 5LHEA 1AG1O 3TKFA 3GDRA 4QM1A 5H91A 4C1LA 2FIQA 1JUBA 4HNUA 1G4SA 1MEIA 4JTSA 3L0GA 3O06A 4UTWA 4IPJA 1TPC1 3MBDA 3TC7A 2DZUA 3ANYA 2QCNA 3OHIA 3LV5A 3TH6A 3RFAA 3O6YX 3C2VA 3PB0A 5DBUA 5I3IA 3I68A 4CLMA 1XDLA 2A0NA 4OV4A 3PG9A 2QUVA 3CIWA 4YWIA 4LVBA 4OE7A 2NWSA 3W85A 1KFJA 2J9XA 4JIPA 4WY0A 4FB7A 4NZFA 3MW7A 1TPDA 3TQVA 4AHPA 4WZHA 3KRZA 4O15A 3LHWA 4HKPA 1K7FA 4IX0A 3QSRA 2ATMA 1QPRA 3EX4A 3HJZA 1MEHA 1DKWA 4LUJA 3M1ZA 2JGYA 1OYAA 3W3OA 1W56A 3GKAA 4Y9AA 4JYDA 4K8HA 3LM7A 4IJBA 3WJWA 2QR6A 1GVQA 1J2WA 1TO3A 1LRNA 3TV8A 3O07A 2PURA 2ABAA 3GDTA 4BFAA 2H3BA 5BMXA 4GNJA 4RV8A 1W3TA 4UFIA 2HTMA 2W79A 4Y96A 2F7FA 4ML9A 3I7SA 1FX6A 3L68A 1VGAA 1DORA 4FX7A 4R7JA 4MLJA 3THQA 1QNVA 5CPNA 4DELA 3W1LA 4JTJA 3W7IA 4UFLA 1OX6A 2LLEA 4OT7A 1TPVA 4WQ6A 1WDWA 4Z1AA 4N4QA 2ZRXA 3VE9A 5F4XA 2E6FA 3GB6A 3LCLA 4UR8A 3P8JA 2Y7FA 1TREA 3GR7A 3NVTA 1SO6A 1GZGA 2YX0A 1YXYA 3FJ6A 3L67A 1RZMA 1QMLA 3KAOA 4JGDA 4MFDA 4HIBA 4UTUA 1K7XA 2V2CA 1UASA 1VLIA 1RVGA 2E77A 1TPB1 1OFPA 2VEIA 1XKYA 2GJLA 1NAL1 4YCOA 1RQEA 1YTDA 4LC8A 1SU5A 5F2LA 2QEZA 3HF3A 3WJYA 4QNEA 1OFQA 1DJNA 1F6KA 4LRTA 3UQNA 2Y62A 2C0AA 4C1KA 3F03K 4IX2A 1UCWA 3KVKA 3W86A 5HWJA 3RLVA 4ALDA 5FESA 4IMCA 3I6RA 3HPSA 2X1TA 3TA6A 3DXIA 3E9AA 2NWRA 4UCGA 2QJGA 1G4TA 3W7LA 1F7BA 5DCDA 2ZA2A 2NX3A 3P7YA 2C15A 1TTJA 1H7XA 1OK6A 2XN1A 3SY5A 4NQ1A 4ZQRA 3RMJA 3SFKA 1G6CA 4IXXA 2PCQA 3WJXA 5AHNA 1NFBA 5LNWA 3DAQA 1JCMP 1OJXA 1GYLA 2FDSA 1GVSA 3L21A 3O63A 4P61A 1OABA 2ZZ5A 3G1SA 4GUIA 3EXTA 5DBTA 3NOEA 1XL9A 2XN2A 1PS9A 3E0IA 3VKJA 4RKAA 1T96A 1YLVA 2ZA3A 3HGOA 1R2TA 4LV9A 3NM3A 1W31A 2Y70A 3FA5A 1Q3NA 3SECA 1GTHA 4O18A 4O12A 4MY9A 4XBKA 3HG3A 4Q4KA 5LNVA 3LOTA 4IMDA 1W54A 5J5DA 1WQ5A 3E96A 3PSWA 4JTLA 1TPEA 1YPFA 3G8EA 1ZAIA 4PODA 3IVSA 2FPTA 4MFEA 3CEUA 1EX5A 1GVRA 3PBWA 1HFBA 3PUDA 3NAVA 3E12A 1ZCOA 4HPXA 3S8HA 3D0CA 4Y6GA 2ZDRA 3W7KA 2VXNA 4TR9A 3PS7A 4FIQA 1K8YA 1XDMA 1WA3A 3W1UA 3P80A 1OK4A 4JTGA 3MUXA 5G4WA 1IIGA 4EIVA 5DCEA 2G5WA 2J6XA 1AMKA 5HMSA 4DO5A 5H2ZA 3S1WA 1QAPA 5HUPA 2YDAA 3NDOA 1OX4A 2E09A 4Z0SA 3MBFA 2BTMA 4WOQA 4N9DA 3PSVA 2GVGA 2DJLA 3G3MA 4TO8A 1LRTA 1YDOA 1GVFA 3TUUA 5HWMA 4EF8A 2PRMA 1DL3A 3UNDA 4M6PA 3WJZA 1ZNNA 1VPXA 2WNNA 1TQJA 3W7QA 3L0NA 1W5NA 4PCFA 1C9DA 2A21A 1OFAA 3NL2A 1W3IA 5FF7A 4JIQA 1ZAJA 2ZBTA 1IGSA 4O17A 1LM1A 1B9BA 2WSYA 5DLCA 1Z44A 4HNTA 1ME9A 2CLMA 1KM3A 1FCVA 5A8GA 1R46A 2QCGA 4LVDA 2JKAA 8TIMA 2Y89A 4UUIA 1NSJA 2IQTA 2VFIA 4JYEA 1I45A 2B7NA 2YSWA 1I2QA 2DZXA 4BWLA 3EEGA 1SZNA 1FQ0A 3DBPA 4ORMA 1FDJA 3E02A 4M6VA 5CSSA 3R5EA 4FNSA 2X2GA 3HQ1A 5CPOA 3QSTA 4OQVA 1LBMA 4WX2A 3LCXA 3NZ1A 2YXGA 2YYTA 4WY0B 3W7HA 4O16A 3WK1A 4K39A 5F2IA 4A2RA 3IVTA 2ZFAA 3CM4A 1UUOA 1QO5A 3IIXA 3WJSA 4XKYA 2FJKA 2Q8ZA 2B7OA 4YXGA 2I1OA 1VJIA 3C2OA 3EB2A 3M44A 1TV5A 3W7PA 5CPLA 3G1VA 4LVAA 4UC5A 5F2GA 2Y7DA 4ZL1A 1PHWA 2CLOA 4NJJA 1KM0A 2FTPA 1OFRA 4TU1A 2NX9A 1FBAA 3LTPA 1XFBA 1JQXA 4M6QA 3HGRA 2ZTKA 3RU6A 3EWYA 2HSAA 3QZEA 4O8RA 3E49A 5D03A 3NQMA 2YZRA 4QNWA 1VCVA 3TCEA 3LBMA 5LNRA 3IIOA 4DF0A 4LWWA 2VFGA 3ABQA 4MY1A 4WY0F 3N9RA 2CLKA 3HIJA 3W83A 1SSGA 2QDHA 3N14A 1IXQA 2R94A 3QMSA 2ZZ1A 2FPVA 2X1SA 5KINA 2R8WA 4JTFA 5FEWA 4R53A 2DORA 3IGXA 2ISVA 4O10A 3MI3A 4NNBA 5I3KA 4DF1A 4ONVA 1QPQA 1H5YA 3A23A 2ISWA 4DBDA 3G24A 4MPQA 4QQ3A 4NJHA 1AW1A 5DY3A 4HPJA 2ABBA 3I7QA 1EUAA 1W5PA 3DI0A 2VENA 5MHBA 3LDVA 4NZJA 3LHUA 2OT1A 4JDYA 3MP5A 5AB3A 1W0MA 3SJ3A 2WO5A 4RJEA 1TRDA 2J24A 5TIMA 1FUYA 3GNDA 1QO2A 2J9ZA 3BW3A 3P84A 4YCPA 1B4EA 5CSRA 3R2GA 3HG5A 4A3UA 3FS2A 2ZRVA 3OG3A 4J9JA 1SSDA 1XCFA 3ZWSA 1MSSA 3T55A 1KM2A 3Q37A 4H4IA 2FPYA 1XM3A 2EF9A 1KLYA 3WK3A 2H6RA 3LRLA 2WSQA 1WXJA 1G67A 3W23A 2R14A 2WOQA 1SO3A 3UXDA 1SZGA 1ZAHA 2CZ5A 3G0UA 4LUIA 4CCDA 5FF4A 3M0ZA 1RPXA 2HS6A 1ICSA 4Z0JA 3R89A 1W5QA 5DXYA 1XC4A 4NJIA 5C6MA 3LTYA 2V30A 4DPQA 3EKZA 3RNDA 1WBHA 1EIXA 3P60A 1H63A 2Y63A 2V2HA 3BVJA 5KTLA 1TIMA 3P81A 4HNNA 3NG3A 4LU0A 5EYWA 3TSDA 5BMWA 2PRHA 4UTMA 4MZ1A 1A50A 1DQXA 3BG3A 3FIGA 3IRDA 2A7NA 5J5RA 1O4UA 3STCA 1KBIA 1KW1A 3QQ0A 2CLIA 5CPMA 2ZCGA 3QPZA 4I9AA 3R12A 3UD6A 3W1PA 4AF0A 2C16A 3UWUA 1OFBA 4N2YA 4A29A 1ONRA 1GG1A 1LORA 1Z42A 4A21A 4FNQA 3W7NA 1KTBA 4TMCA 4FNTA 1GJPA 1QOPA 3INPA 4DPPA 5HQEA 5EMUA 3QMTA 2ZZ3A 4Q32A 4K38A 2QAPA 4MKNA 3PWAA 3I65A 1H1YA 3GAKA 1P4CA 1OX4B 3OBKA 3L65A 1TCDA 1QDSA 2A2IA 2BXVA 2DZVA 4YMZA 3LHTA 4IGHA 2WSRA 2DZTA 2QUUA 4YL2A 1H51A 4UNLA 3HG4A 4FEZA 3ZWTA 3HPXA 3W76A 1QWGA 3ATYA 3C4UA 2W0UA 3C6CA 5AOUA 3JRKA 3N9SA 3LRKA 1GOXA 4AHQA 3LRMA 2NX1A 2H3DA 3QM3A 3BGJA 5BNKA 3BGGA 3GLCA 1PE1A 5EKYA 1TB3A 2CZEA 2EAWA 3O6DA 5EL1A 3TQKA 4JX6A 3SZ8A 3TMLA 2V81A 4RCXA 1JVNA 2QKFA 4XUGA 3MI6A 3NL3A 3LCHA 3ATZA 4ZZ9A 1SW7A 4O53A 2QDGA 1FCBA 2RH9A 1YTKA 1K8ZA 1XBVA 3QH2A 1SUXA 4Y90A 5LZLA 2WKJA 1T0OA 3PUOA 3L5LA 1L6YA 2WQPA 3G18A 2EHHA 4RZ4A 3W1XA 1KTCA 4JTTA 3W7DA 3LXBA 3NQ6A 3W87A 3IIPA 1K7EA 3QW4B 3W7GA 1D9EA 2OMAA 1YPIA 3T7VA 1UJPA 2G96A 3N34A 5FF2A 3F4NA 3G1HA 2ZRYA 3W2NA 1QFEA 2CZDA 3HO8A 1AW5A 3JS3A 3K30A 3W1TA 1ML1A 5AHMA 4U4MA 4XKYB 2ISSA 2QAFA 4UTWC 3MP3A 5IM51 2CW6A 3M16A 1Y0EA 3MHUA 1TPUA 4S2CA 1SR9A 1SZFA 1VQTA 2VFDA 1TQXA 1X1OA 2B7PA 3HPZA 1C29A 4UTJA 5C54A 1Q6RA 3T44A 3C2FA 3W2KA 3M6YA 2F84A 4JY8A 5LKYA 1KFCA 3W9ZA 5HUOA 4AAJA 3W1NA 3JR2A 4GBUA 3W2JA 4N02A 1X7FA 3VE7A 4I7VA 4OGZA 1HG3A 1LOSA 1TPWA 4AWTA 2QUTA 5DY2A 3IGSA 1GG0A 1VYRA 2C13A 3BW4A 4RLIA 3TSBA 2FFCA 1VC4A 3NPWA 4GFSA 3B06A 1MO0A 2O7QA 4JR5A 3MI2A 4JTUA 3UWQA 3T78A 1SFJA 4N9CA 1YXCA 1A5AA 2B0MA 3KXQA 5U4NA 4E0CA 3W70A 4JS3A 3S5NA 2QCLA 1SFLA 1GQNA 3S1VA 3W6YA 1KV5A 1VLWA 3ELFA 3TXZA 5KZMA 1P0KA 2RHGA 1FWRA 3CU2A 3MHFA 1SO4A 3KVMA 4HNVA 3W1AA 3NA8A 5I3FA 5CGQA 1YXDA 3SIZA 1T8XA 2VFHA 4O50A 3CTLA 1IXPA 3EX3A 2I14A 3PC0A 1WOAA 4JN6A 1EPXA 1EA0A 1G4EA 4G1KA 5FEZA 4MYXA 3TJLA 5DN1A 5EPDA 1VCFA 3O15A 1VZWA 3GX9A 3MYPA 4OU1A 1TPH1 3M41A 4ZQOA 3IIVA 1H50A 3Q58A 2A6NA 3G0XA 3LERA 2YCEA 3M5XA 4JX4A 3B03A 2Q3OA 2V0TA 3LB0A 5ABTA 4UTIA 4CCCA 5LSMA 3W07A 3OVPA 1A5CA 3EXRA 3GYEA 1ZALA 3HGSA 2E6YA 2O7SA 3P62A 5BRBA 4BR1A 3MP4A 3P61A 3NO5A 4PA8A 2A6LA 4JY9A 1EEPA 3ZS4A 1KFLA 1JUKA 4O1DA 5LGXA 4L4LA 3FYOA 2BLEA 1WBJA 3CHVA 3TE9A 3ZR4A 4IMFA 4UIOA 1M7PA 1OYCA 3GXNA 4UTKA 4IQLA 5D38A 2J9YA 4IXHA 3W7JA 3MYOA 1KTNA 2OT0A 3DZ1A 4AB4A 3WK2A 1OHLA 3QJAA 1P5BA 1GYNA 2XN0A 3YPIA 3G1YA 5C2XA 3TQ0A 3TW7A 4BK9A 2Y61A 4X9SA 3GDLA 3TAOA 1KM6A 2P10A 2CFFA 4JICA 4AF0B 3B0UX 2Y85A 2AQWA 3C52A 2JKEA 3LX9A 3TC6A 4H3DA 5CZSA 2UV8G 3W88A 4HHPA 1KM4A 4AVFA 1VHCA 2YFOA 5D32A 5C55A 1I2PA 4CQ9A 4LS0A 3CT7A 2RFGA 2Z0IA 3QFEA 2A1YA 1EB3A 1H62A 3HOJA 4ZQPA 4ADUA 3BLEA 2RDWA 2VELA 3BG9A 3EWXA 1W3NA 3QEZA 4LVFA 3BG5A 5AYXA 4BI6A 2ZZ2A 2CLFA 4AWUA 2NXGA 4FX8A 3DH7A 4QJ1A 2I9EA 4UFKA 1L9WA 2C6QA 3ABOA 3LGEA 4JDBA 1THFD 4Z08A 3PVFA 1S5TA 4CCEA 6TIMA 5CG7A 1O5XA 4LNYA 1YTEA 1LTDA 3CPRA 4LVGA 7TIMA 2E5CA 3QF0A 5DELA 3A22A 1Q6QA 4FX6M 3B8DA 3VNDA 4NNCA 3LBCA 5D37A 4K37A 4JTKA 2DJXA 3NQAA 3IIZA 2NUXA 5TQLA 1XBZA 2YW4A 3S5OA 3NQCA 1O60A 3C56A 5E93A 3SR7A 1OF6A 3EWUA 4GUJA 5G1YA 2C14A 4PL2A 2BZNA 3A5VA 1OYBA 3TJXA 1KM1A 2RKXA 3PUEA 4LY8A 4GWEA 2X30A 1TTPA 1L6SA 5EY5A 1TTIA 3FKRA 4W9TA 5KZEA 4NX0A 5F2MA 5G2HA 2CWNA 3NGJA 4L4MA 3GIYA 3PF3A 4NXSA 3R13A 3BW2A 1KM5A 4O1CA 1A5BA 1B57A 1K8XA 5HWNA 3G1DA 4KKXA 3BPWA 5D2XA 4LW7A 1U83A 5K9DA 4XBSA 4O57A 2QCHA 1KV8A 4OBTA 1XXXA 1QCWA 5E0KA 2WPBA 4NXKA 3QPYA 3BO9A 4EF9A 2A7PA 1TJPA 4BI5A 4O4VA 1DVJA 3TW6A 5K9XA 4K6AA 2A7RA 1BWKA 2HMCA 3H54A 3KVJA 4JNMA 1S5VA 5AHFA 4PH6A 3UWYA 4OHQA 1LRQA 4K7YA 1P1XA 1AK5A 4BWLC 3DFQA 2DZWA 4UMBA 5CZTA 3UZJA 4MJMA 3DFNA 1ME8A 1B4KA 1K03A 3N73A 1R2SA 4FXSA 1OFOA 3LLDA 3Q2DA 5D2TA 1LDCA 5HR7A 4S1FA 1H7WA 3LXAA 4RZ5A 2WJZA 3NEVA 1QPOA 2JBMA 3GZ3A 4H6KA 3F4WA 1CW2A 4NJKA 3H53A 3U6WA 4JEQA 4HSNA 1KLZA 3GVGA 3PBUA 2VFFA 1JCJA 2DZSA 3S42A 3LHVA 5AHIA 4XZ9A 3TU9A 1JRBA 4Z1CA 2PE4A 2ZZ6A 3L9CA 3FEMA 1M5WA 4FHAA 3BV4A 3TROA 1DOSA 4LRSA 3W7RA 4E2DA 2TYSA 1ZENA 1N7KA 4UXDA 4ZMGA 3ABSA 1F74A 4O1BA
chains in the Genus database with same CATH superfamily
4EWJA 3DHFA 4Q8VA 4NSBA 1H41A 1XLMA 4EPKA 1IXOA 2ZC1A 3V0TA 4G7EB 2HPIA 3N2XA 1RK6A 3BOLA 4IMGA 1OT1A 4NKCA 3QKZA 4C6JA 5HATA 3PR2A 3N2CA 4NU7A 1JQVA 3CB8A 2VFEA 3KHDA 3NZGA 3QTGA 3P82A 3XISA 3HURA 4TQTA 4QQUA 4W8BA 2G97A 4G5DA 4HNCA 3B4UA 1BG9A 3IEBA 2FB3A 2YR1A 3WF3A 2PBGA 3AISA 2BVTA 1S3HA 3MJMA 1R38A 4CQDA 5REQA 1EP3A 1CB7B 2E9MA 5CAKA 1EJXC 1U5JA 2OQHA 2C1HA 3CZ8A 1SW0A 1IE7C 3BLDA 3M0XA 3EWCA 4PUDA 1FH8A 5K4XA 2V3GA 1UKOA 1M9HA 3EX1A 3NJ3A 3BLIA 3POCA 2BS9A 1J0HA 2JKPA 2DUZA 4N42A 4P8UA 2TPSA 3GTIA 1PJ9A 4OECA 3MC5A 1T40A 4GGHA 4B5XA 3U4FA 5FSEC 1J0YA 3NM1A 1NDVA 1JZ2A 2QCDA 1SFSA 3LY0A 5HJYA 4JXCA 2ZYFA 1W1ZA 1UR8A 3OHMB 1FFQA 1RV8A 3IK2A 4B4FA 3FEQA 5PTDA 3ZJ6A 1SW3A 2OX1A 8CGTA 4LS2A 1US3A 1E3ZA 1IGWA 2VURA 2DVXA 1X1ZA 2QMJA 1ZFJA 3UWWA 3GTXA 5D9NA 3S6OA 1BF2A 4JFTA 3F2DA 3H22A 3M4HA 2Q02A 2DZPA 2GQ9A 3FYYA 3UR8A 1TMLA 4PB5A 1QWKA 3VZYA 3BK0A 2CITA 2GOUA 4QSHA 2E6AA 3IARA 2BVYA 5F1UA 3OVRA 1HVXA 4MUPA 1ZHAA 5GNXA 4IPIA 1GORA 2FVMA 3ABRA 3GAYA 2VJXA 1E51A 3M6DA 2PDPA 1PKYA 1AUSL 5I0DA 1NVMA 4DZAA 1H61A 1EWEA 4N6EA 4RE4A 1VBRA 4W8LA 1MRAA 1R5YA 4RV3A 4AZCB 1E5JA 5DCBA 3T8QA 3AMDA 1AMYA 1GQKA 4Q22A 4WUIA 3GC5A 3DENA 1Q85A 2BHUA 3E5PA 3RJXA 1RQBA 2VMFA 1Y5XA 2D73A 3EX6A 1DWFM 1A5LC 1OF8A 2C1IA 4AY7A 4AZIA 3WFZA 3VILA 3N17A 3W02A 5LXEA 5HK4A 3NPUA 2XINA 4IT1A 1QNPA 3WUFA 4BJHA 2XFWA 4GYJA 3EOEA 2NQHA 1I6NA 5KZ6A 1EFZA 4ZQMA 4S38A 4C6OA 2ICSA 4B3ZA 1OG0A 5A8NA 3SW6A 3QOMA 2VTFA 5CPSA 2C18A 1I1WA 6XIMA 1TRIA 1HJQA 3UG8A 1FWSA 1IEQA 1F2JA 3EPMA 1XBYA 1O95A 4HMCA 4CNTA 4DLFA 3RGTA 3JU2A 1I1XA 2GOKA 3TN4A 1SGJA 3TR2A 2FVLA 1F73A 3G77A 4QGCA 4H9UA 1XDJA 1EC7A 4MLRA 1PZ2A 3WDHA 3ITLA 4AX6A 3GS6A 4C5ZA 2B4GA 4H83A 4BF9A 3HQOA 7XIMA 3CZKA 5B7YA 1OD8A 1DJYA 1JCNA 2PWDA 2EPMX 1L2QA 3W2UA 3W73A 1VCGA 3ONBA 2V8ZA 3GVQA 2WVTA 1C8XA 1JF5A 1Z48A 2VX6A 5D2VA 3RLHA 3PANA 2ZRZA 3N3TA 3PAJA 4CGTA 1AODA 5AC4A 1RVKA 4CN4A 5HXMA 5LNSA 4DWSC 1BXBA 1K6AA 4HT3A 1J4EA 1MUCA 1VJSA 1BVNP 4MB5A 4CQCA 4ZVJA 3EGJA 3VIOA 2DH2A 4O0ZA 3G1FA 3VI2A 2VCAA 4Y8FA 3OP2A 4UQAA 4ERGA 1ZJAA 1OIMA 3O6CA 1XI3A 4GQBA 3KS6A 4HHHA 3VMNA 3HG2A 2FLIA 3WX7A 3ZVHB 1BXNA 3SFWA 3VO0A 3ES8A 3HZ3A 1PKLA 3TTQA 3BTNA 1JNDA 1UJQA 2QF7A 1UP3A 2NUWA 4PMJA 3ZIZA 4AD5A 5FOOA 3BAWA 4IOTA 4DXVA 3NGFA 4UOJA 2ZQ0A 4O13A 1UUMA 1JULA 1V03A 4B5VA 1E4IA 3DFTA 5EBAA 3BGAA 2BMBA 4Q33A 4QFUA 8XIMA 1TWZA 1M03A 3T05A 3U8GA 1L8NA 3N2TA 2A3BA 1U5VA 3W4RA 2V3EA 1EJTC 4OBSA 4S2BA 4XD3A 2DEPA 1S5NA 3UXAA 1R3VA 2BWGA 1E72M 2Z1XA 3CLMA 1UWTA 1F3WA 2Q8XA 1TYGA 4AD0A 4R7WA 4PR4A 2ACSA 3NQGA 1SPQA 4KFPA 2PTXA 5AFDA 1GQLA 2E67A 4HPHA 3DC8A 1Z3NA 4FNUA 4AHOA 4CNUA 4O28A 1TV4A 2ZUVA 1EPVA 2GUUA 2Z6JA 3S3GA 1XIEA 2CZVA 5FEPA 3GXDA 1I8JA 3TC3A 2QS8A 2XH0A 4WXYA 4O4WA 4GBDA 1DBTA 1Q45A 3A9BA 4IISA 4GVIA 3IJLA 3M64A 3NSXA 5I3JA 2ALRA 4GUGA 3S2MA 3GTFA 2YYUA 1AL8A 1XLHA 4MZYA 4NT0A 1XIIA 5HULA 4BI7A 2WANA 5EGRA 3RRAA 1TV2A 3QKEA 3HMJG 1V0MA 2H90A 3NDYA 3GKFA 2CKSA 3TOPA 1V6YA 2Y6ZA 4H2HA 1GTEA 1Q2RA 1EL3A 2HPMA 4IMEA 2O56A 3NR0A 4CNOA 3POHA 5K2ZA 3TK7A 1X96A 3CB3A 3L5MA 1W8SA 3P2VA 4NI3A 4RXGA 3AXMA 1CXFA 4K8EA 1L0PA 2XIOA 2ZX5A 1W6TA 2G95A 1EJWC 4WIWA 1P1MA 4YVPA 3C8FA 1SMDA 3TX9A 3N4EA 4X2RA 2Y5SA 1UWAA 2XVGA 5HNRA 4DXXA 3UWEA 3EWDA 3RM8A 3CEPA 1MZHA 3ITXA 4FS9A 5CG0A 3OA3A 4O52A 4X9YA 3H7VA 3RCNA 4XAGA 1FP9A 1PWLA 4GY7A 4W4QA 4YTQA 3E38A 3CV1A 3UXLA 4DWSB 1HTIA 2V5BA 4RX0A 1OC7A 1ZGDA 4RL3A 4B92A 5E70A 3ZSTA 4CU8A 4QLKA 2AOSA 3M47A 3S5ZA 4J27A 2QIIA 3V0SA 4AEOA 3WLHA 3BXWA 3P5ZA 4QBXA 3OYZA 2PDWA 2EPLX 1TFVA 1UH3A 1WAWA 4JPGA 1E0VA 3LTSA 4HK7A 3K8LA 4JFUA 4E2OA 2G4FA 3M7WA 1D8CA 3WFLA 3TJIA 1JFXA 3UY7A 3VCRA 5E0FA 1ISYA 1GJUA 4OV9A 1E71M 5IFTA 3JZUA 1XUUA 3C2EA 3KBSA 1M6JA 4KWWA 3G22A 1PVNA 3M0MA 1KFEA 3NQVA 1UR9A 1EWDA 1SM9A 3PPHA 3FJ4A 4US6A 3NQEA 2WCGA 3A21A 1HVQA 2B7QA 3G6MA 2AAAA 4M19A 5T26A 1WDRA 3B0VC 3KTXA 3TTEA 4LTSA 4S23A 2PF8A 4B91A 4M24A 2GQ8A 2WZEA 3EPOA 2YIHA 2VOMA 1QI3A 2Z25A 2D24A 4UQEA 5AECA 1YADA 3T6CA 4FXRA 5TAOA 4ADSA 1JGIA 2FVKA 3A4JA 1PHQA 3OLEA 2VKZG 4JL2A 3GU1A 4NAFB 4XQ6A 7A3HA 1CI1A 2XZ9A 2GJXB 3DFPA 1Q63A 3LLXA 2X0SA 5E6YA 1BEUA 4U10A 5LA2A 1SO5A 1XSJA 1SJAA 1TR1A 2VGIA 1LF1A 2BSLA 3LXCA 4HMNA 4QAWA 1TZ7A 1NIUA 1R2RA 4DF2A 3OIXA 1X39A 1JI1A 5HINA 1WPCA 3UWZA 2UY4A 5EMJA 2NV1A 2D2OA 4L64A 3WK0A 3TN3A 3W75A 1R7AA 2O4MA 4IUOA 1E1CB 4DEFA 4YTUA 3PHAA 3LCWA 3CK5A 1P7TA 3M7SA 3W1QA 3GSMA 2OELA 2REQA 2H8XA 3SI9A 1CX9A 3MWAA 4B3LA 2V2DA 1AG1O 4F2TA 3EDEA 4JCMA 3U9IA 3G5EA 3H7RA 4HNUA 3KZPA 4JTSA 4UTWA 1GZ1A 4H9MA 2X7WA 1GGOA 3VC5A 3ANYA 2ZKMX 1WZKA 3O6YX 3PB0A 2ZXQA 2W5FA 5DBUA 1CGXA 2A0NA 3ZXWA 4NZ1A 3SURA 3UVIA 3NUKA 3BZJA 1BF6A 3S2NA 4MG4A 2HDJA 4OE7A 1KFJA 4JIPA 4PMYA 4HVXA 2PFHA 3MW7A 4AHPA 3LHWA 1B5TA 5I24A 3BAJA 1K7FA 4W93A 3WH8A 1QPRA 3HJZA 3M1ZA 2JGYA 3OA5A 1DJWA 2VC9A 3GKAA 4JYDA 1HL8A 2E25A 1O5QA 3TYZA 4LNCA 2QR6A 2F38A 4L4PA 1YRRA 4GXPA 1F8MA 2TAAA 3BMWA 3TV8A 4YHEA 1M7JA 2ABAA 4FLOA 4GGBA 5BMXA 4GNJA 4RV8A 2WC7A 1RD6A 4P8XA 4UOQA 2FFIA 4AIOA 1FX6A 4KWSA 3ES7A 1W2VA 3FVDA 1F07A 4KCTA 3ZJ7A 1LJYA 1MZRA 5CPNA 3EB4A 3KTCA 4UFLA 3S47A 3OU8A 2BOFX 3AICA 3ZLHA 3NVDA 1QASA 1ZL1A 5I02A 6ENLA 4Z1AA 1BFNA 4H9ZA 2E6FA 4UR8A 3GR7A 4IL2A 1DIOA 1MW2A 1GZGA 1X38A 1VPYA 5B80A 3L67A 1NM9A 2O55A 1QMLA 4JGDA 3AAMA 3GYCA 5I3DA 2P5NA 2E77A 2VEIA 3TTYA 2Y24A 1K9EA 1YTDA 4CVWA 4XZWA 3MTWA 3WJYA 3E1F1 4QNEA 3GG0A 2GDUA 1OFQA 4QEEA 1IR1A 2C0AA 4C1KA 5BXRA 3IUHA 1QVBA 2IPGA 3VABA 4ALDA 1F6YA 4RW5A 4IMCA 3CT2A 1XRVA 3I6RA 3TA6A 4GQQA 5FKYA 4UCGA 1OD0A 1OC5A 2EKGA 2EG8A 1GKPA 2WC4A 4A3QA 1F7BA 5DCDA 3U5YA 2ZA2A 2NX3A 2C15A 1RK5A 1TTJA 3ID7A 3T0CA 2NVDA 3QC0A 4NQ1A 3C0SA 5AHNA 6PTDA 4LY4A 2WVUA 2J8FA 3V4BA 4M80A 3SCTA 3HV9A 2FDSA 1SJCA 2F2KA 3O63A 2GK1A 1V51A 1A5MC 3OLDA 1OABA 3GFYA 4C6DA 3E0IA 3VKJA 4QE4A 1DXFA 3QTPA 4AU0A 1T96A 1E0TA 5CBIA 3IWPA 1UROA 4H7CA 4LV9A 1DWGM 2Y70A 3FA5A 3GIPA 2NQLA 1FHLA 5A6SA 2W66A 4MY9A 4XBKA 2QZRA 4WDTA 5LNVA 2PDCA 3ARYA 4AYSA 1W54A 1ZCCA 1J96A 3RM9A 1WQ5A 1BTCA 1TPEA 1YPFA 4H6EA 3WENA 5FJTA 1XLDA 3VDAA 4D8ZA 1HFBA 2G3MA 2QPUA 4P8WA 3NAVA 3E12A 4MTVA 1ZCOA 1K9FA 1HKJA 4PUWA 1TCMA 2WXDM 3FGCB 4GI8A 4W7VA 4E4FA 1M7XA 1UOZA 2VXNA 1XWYA 3IRSA 1XDMA 3P80A 4HPNA 1NQKA 1MVYA 3MUXA 4EIVA 5DCEA 5H2ZA 3A3XA 4MAZA 5HUPA 2YDAA 1I0BA 3NDOA 5FJPA 2XUCA 3EKGA 3ZT5A 1NWSA 1W32A 4W89A 4TUFA 3TOYA 5I07A 4G56A 2GVGA 3TYUA 3QOKA 1YDOA 3E2VA 3WDRA 5HWMA 2E8ZA 2CXEA 5DT7A 3UNDA 3WJZA 1V3MA 3MO4A 1DIEA 4WKHA 1TQJA 3W7QA 3BLOA 2V69A 4PFHA 3NL2A 4UCFA 1W3IA 4JIQA 2OFJA 1AD4A 4AQLA 2BGNE 4H1ZA 1LM1A 3RO6A 4GIEA 4HNTA 4XKMA 4H8UA 1W1A1 2CLMA 1KM3A 1NP0A 2E1WA 1V6WA 4ZOEA 4H00A 4IFKA 5LXXA 3PFRA 2ACUA 8TIMA 2Y89A 2ZUWA 1IT7A 1NSJA 2VFIA 3DIPA 3R43A 2YSWA 3EEGA 3PJXA 1H4PA 1N8WA 2X2GA 3TZNA 4AMCA 1XYFA 1WKDA 3RPMA 4K1WA 3NZ1A 3VDCA 4PB3A 3K5XA 2YYTA 3AIWA 1HX0A 5F2IA 2R82A 2OTDA 4LBSA 2ZFAA 2YJQA 2ZVIA 3RILA 4JQ1A 5CC6A 2VRKA 1MFUA 4NASA 3IIXA 2XSAA 2VWTA 4AVOA 4E2VA 2RAGA 3WQWA 1K8CA 2QMKA 1PPIA 4WKAA 3MSDA 1W2PA 4YXGA 2UY5A 3C2OA 4DY1A 3M44A 3W7PA 4QG9A 5HOSA 1EDQA 4KH2A 4UC5A 2DIKA 5F2GA 3O9NA 1LG1A 2IXVA 2CLOA 2WCSA 4TU1A 1PTAA 5LIWX 3RU6A 3EWYA 2HSAA 4FALA 3T2OA 1K1DA 4FOJA 1X97A 3E49A 5IRPA 3E0LA 3CNYA 3NQMA 2W91A 3EDFA 4QNWA 4P7QA 1WKEA 2VFGA 4GFIA 3N9RA 3HIJA 1SSGA 4GVHA 1RBLA 1UQZA 2R94A 4XB3A 2GYIA 4I3GA 3KLKA 2X1SA 1UW9A 3SAZA 3VKBA 1JL8A 2DORA 1UWSA 2X42A 1EKOA 4MKVA 4NNBA 1XISA 1H5YA 2PTDA 4PCSA 1JYVA 3OJGA 1REQB 1J01A 1T5AA 4EXQA 1A5NC 4ML4A 3CL7A 2Z24A 5BXSA 3OQ8A 3LDVA 2OT1A 2I57A 1UG6A 1KRBC 5AB3A 4JIEA 1W0MA 2WBGA 4UQ9A 2POTA 2WO5A 4RJEA 4NRSA 4WSHA 1TRDA 3SIMA 1FUYA 3P84A 2J9ZA 4QR6A 3R2GA 4ACZA 1KKRA 1TIWA 2VM8A 1OCJA 5A6BA 4J9JA 1XCFA 2X2YA 5A8PA 1AA1B 3T55A 2C8NA 3AYRA 2H6RA 2Q71A 4B16A 3LRLA 1FWHC 1XGDA 1G5AA 1XQKA 2QYGA 1SZGA 2CEQA 5GQBA 2VL4A 4LUIA 2PWFA 2HVNA 3KBMA 1W91A 4CVUA 4JFSA 1V3IA 1RPXA 1RXOB 4Z0JA 1K9DA 3Q67A 5ABGA 3LTYA 3P60A 2V2HA 3VYLA 2PDLA 1A4MA 3P81A 4LUTA 4HNNA 3NG3A 4LU0A 5EYWA 3TSDA 3G1RA 3DGBA 1DP0A 1A50A 1KBIA 2VC5A 1IQ8A 1V0LA 1J79A 2CLIA 1HW6A 2DDXA 4I9AA 2IKGA 1TJ2A 4HJWA 1TG7A 4H7ZA 3H12A 4RDYA 5A8QA 4TMCA 4FNTA 1GJPA 1QOPA 2FHFA 3INPA 2CNCA 4L61A 5EMUA 1L6FA 3FHQA 3FJNA 2Y5JA 3F2BA 4ZEPA 2PDMA 1P4CA 1OX4B 3UZXA 3OLIA 1FH9A 2W92A 2WSRA 5EMYA 3FNDA 1H51A 3ZWTA 3HPXA 3C6CA 3T09A 1W17A 3TN5A 2FGLA 4AHQA 1BPLB 2NX1A 1M01A 1J6OA 2QXWA 3VOJA 4ZOCA 3QM3A 3WQOA 3MMDA 3RM4A 3WMBA 3GLCA 5C71A 5G1MA 4Z2JA 2V3FA 2WMKA 3O6DA 3PWIA 4YYFA 4JX6A 2EPNA 3QFWA 3HV8A 4C6IA 2J7HA 1JVNA 4RCXA 3NL3A 3NURA 1UD8A 3FSUA 3I4KA 4BQ4A 3R6IA 5T8GA 3A6OA 3ZO9A 1YTKA 1XBVA 3OIHA 1V4YA 4Y90A 5LZLA 2WQPA 2DT2A 4MWAD 1U5HA 3DHPA 3W1XA 4CQBA 3APGA 3NZPA 4JTTA 3AROA 2QLYA 4M29A 3LXBA 2OOFA 3LA4A 4FPSA 1MNSA 2VD8A 3T7VA 1UJPA 2I56A 6A3HA 2AL2A 3F4VA 2O92A 5FL0A 3W2NA 2ZX6A 4NRRA 5CJNA 2VEFA 5AHMA 2E40A 4U4MA 3TW9A 1VRXA 4ZO6A 5JMUA 3EDJA 1TQXA 1Y65A 3O7UA 5C54A 1Q6RA 2E28A 2JQXA 3MSRA 4JY8A 1KFCA 4Q4MA 3W1NA 2PUZA 2ESCA 3WLRA 2WBKA 3W6LA 4OGZA 1LOSA 1TPWA 3WQCA 5DY2A 3IGSA 1GG0A 1VYRA 3TSBA 5FACA 4PMQA 1GVEA 2GGHA 3B06A 3WLMA 1AQFA 5E0CA 1EBHA 3VVGA 3ZVIA 4IJCA 1FHVA 3PP7A 2I7GA 1V0KA 3W6YA 1LL4A 3VU2A 1FKWA 2CESA 1VPQA 4F0RA 3H2FA 1QOXA 3MHFA 1SO4A 4JL1A 3C0LA 4REQA 5I3FA 4AXNA 1YXDA 3CH0A 2DSUA 4O50A 4A8IA 3TVAA 3WF2A 4HA3A 1WOAA 1EPXA 1XLEA 4G7EA 5ABFB 1LUCB 4R27A 2R1MA 5DN1A 3AIBA 3T81A 4EXBA 1DXEA 3MYPA 3OTRA 1GKQA 3Q58A 2WZMA 4J3UA 4AEFA 4S3BA 3M5XA 2QULA 1Z7AA 2EO7A 3MB9A 4IQDA 1E40A 2FJUB 5LSMA 5HNNA 3GYEA 3QHOA 3WQ4A 2E6YA 2O7SA 3IJ8A 5BRBA 3FXYA 3UF9A 3NO5A 4NYUA 4IZGA 2A6LA 3WLJA 4IPPA 1LWHA 3BAIA 1JUKA 4OUIA 4LAZA 3ZR4A 4UIOA 1M7PA 3M46A 2QJNA 2C7FA 3BE7A 5D38A 5GJMA 3ZR5A 4Z2IA 3W7JA 4HCDA 4AD1A 1KTNA 1Q2SA 2OT0A 3SCPA 4AB4A 3MUY1 1QW7A 3TW7A 4X9SA 1KR1A 1GQIA 3TAOA 2P10A 1XIJA 4JICA 2O9RA 2AQWA 1IZJA 4IIGA 4CD6A 7TAAA 3TC6A 1AH0A 3U7VA 4AVFA 2VRJA 5D32A 1GZJA 1I2PA 3I10A 5DRIA 3WNPA 3CT7A 3EOUA 2RFGA 4KEVA 4I6KA 1EXPA 1XYMA 3O0FA 1EB3A 4BQ2A 1CNVA 3BSGA 2RDWA 5BOEA 4BF5A 4FX8A 3DH7A 3OYXA 9XIMA 2AKMA 3PK7A 4JDBA 4Q8MA 2GLKA 4DBUA 4DRSA 4Z08A 5CG7A 5I03A 3NTYA 1K4HA 5AZ1A 3CUIA 5LIUX 4CN1A 7TIMA 1XH0A 2E5CA 3WLPA 3H2OA 2XFRA 3B8DA 3LPGA 3VNDA 4NNCA 4K37A 2DZAA 1E0XA 2NUXA 5TQLA 1XBZA 2YW4A 3S5OA 3SR7A 4GUJA 2C14A 3TTSA 2BZNA 1OYBA 7REQB 3DN5A 4U2YA 2A3CA 1L6SA 2X30A 1BQGA 1XIDA 5EY5A 4PCPA 4H19A 1KBLA 5M1TA 4YYCA 4DBSA 4IQJA 5KZEA 4NX0A 3IAPA 1H09A 2CWNA 3KOWA 3M0VA 3PF3A 3R13A 3S2JA 1B57A 1K8XA 1NJJA 3G1DA 3OZPA 5E9XA 4DN1A 3KS5A 2PC8A 1K70A 2KX9A 4PEEA 1XW8A 1B0IA 4M82A 3UBPC 4GI6A 3WSUA 1N82A 1E73M 4HHLA 3TW6A 4G8TA 4DJFC 4X63A 2HMCA 2H9AA 3H6OA 4OHQA 1LRQA 1D7FA 3H4XA 4K7YA 3TCSA 2G4JA 1ITXA 1P1XA 1AK5A 3WELA 4DNMA 2DZWA 2GVYA 2OLAA 4UNIA 1C90A 5ABEA 1XLLA 3DFNA 2EJAA 4FLRA 1BSIA 3LLDA 3Q2DA 1H7WA 3D46A 2J7EA 2JBMA 4H6KA 4MNKA 3CHCA 4HSNA 1ZZMA 1PDYA 4FXJA 4KT2A 1J0KA 2YCLB 3B8IA 1BYBA 3TU9A 1R9XA 3HMCA 4J5NA 3AMGA 3T2PA 4A6GA 1J0ZA 4M1BA 3VC6A 4GCAA 3VNJA 3CL6A 1W1YA 4Q8UA 4E5TA 4E2DA 5D9MA 4UB9A 1F74A 4CEUC 4O1BA 1NWUA 5D33A 1LT7A 5BRQA 4WJXA 2NXHA 5C9RA 4GK8A 4MY8A 2QF8A 3WEMA 4YVVA 1XBXA 1BKSA 2A4AA 3CPUA 4RDVA 1PAMA 3MO7A 1PL9A 3GUGA 4R33A 3LMYA 1KXQA 1YDYA 3A5FA 4QG6A 4UFMA 1PDZA 2E5DA 3UJRA 4U28A 1NF0A 3M0HA 3ZVHA 1OBAA 5G4EA 1XPYA 5T91A 5D8WA 1PUDA 3NDZA 1GWJA 2XTKA 5K4ZA 4PUEA 3ZR6A 5GJPA 2FB2A 4W88A 1EBGA 3DEQA 3T07A 3LGGA 1DJHA 5AC5A 5LNUA 4ZQCA 3CQHA 2ZZ7A 1VD6A 1CWYA 5I2UA 1NQ6A 3N25A 1MEWA 4M7SA 4M1RA 5HR6A 2IPJA 4PL1A 3IACA 4TMBA 4O1FA 1EDTA 3RIKA 4X2PA 3LPOA 1V3JA 1AZ2A 4L9XA 2AAMA 1AVAA 5I6SA 3H23A 1KFKA 3G1AA 3MS8A 3ARRA 4EAYA 4GUFA 1RR2A 3LCIA 1VFLA 1OX5A 2G50A 4R9OA 1PIFA 3W84A 4DO7A 3M43A 4GYPA 3H2EA 2WJFA 3WFAA 3GRIA 2VC6A 4WJ8A 1ZRQA 3STEA 1NU5A 1AH3A 1JRCA 2PGWA 1Z41A 1G9HA 3VINA 2CLEA 5AYIA 5CZJA 4K2SA 2OZ0A 2PDXA 2JK2A 1YDNA 2PTWA 4RZ6A 1UIPA 4KPLA 4EOUA 1O1ZA 1LP6A 1XLGA 4M3PA 1J5TA 1EO7A 2GWGA 1BTMA 1O12A 1AFSA 3AIQA 2WZTA 1DQUA 1T99A 4ILSA 1NWRA 4QS5A 2JGQA 4Z2KA 1D2KA 3SY8A 3O8AA 3W29A 3WN6A 3GTHA 1IF2A 4KEUA 2WJDA 2IS7A 4YN5A 5AN7A 5AC6A 3VNKA 4ECLA 2P0OA 2I16A 3O1NA 4DVOA 2F9RA 3KUMA 1G94A 1HGWA 2Q3RA 1EA9C 1KR0A 1IR2A 4QLJA 4YLWA 1E4LA 4Z17A 3GXIA 5CH9A 3BUVA 3R0KA 3QYQA 3GDMA 2QJHA 3VIHA 3FKKA 1KXHA 1RBAA 1QR7A 2I17A 3NL5A 2XM2A 3REQA 4B5TA 4POCA 3UG3A 4DZIA 5LIXX 2I5IA 4GIAA 4Z1YA 3MCOA 1X6UA 2J4GA 2Z28A 4PGLA 4O19A 1O7AA 3VA8A 4D6DA 4M8UA 4IJRA 4ZFCA 3K1DA 1H5VA 4NG3A 5AC8A 4DJED 3B8TA 2D69A 1PX4A 5TNVA 3QMRA 3GDBA 2OZ3A 2VEPA 4X60A 4HGXA 5D09A 1UKTA 4Q4OA 1EP1A 3KL3A 2J27A 2ZRWA 1C8VA 3CV7A 3LLFA 3CAVA 3KFTA 3VFLA 2V5LA 3FFSA 1XG4A 2GJRA 1ADOA 4MUZA 3SQSA 2AGKA 1GPWA 2PDBA 4KIEA 3VKKA 1UB3A 2CZFA 4OJYA 1W1PA 3SGZA 2G8ZA 1FDZA 2QW5A 4US5D 4PBGA 3S2CA 4MWAB 4FZIA 1TA3A 4E3VA 1R9ZA 3VTRA 1S2CA 2MNRA 1DTUA 1LLZA 1WV2A 3PUGA 3ARPA 2FGBA 4GD0A 2GPTA 1V7YA 9XIAA 3ZT7A 3AFBA 3VD5A 3WF1A 4B90A 5AHEA 4I9JA 5AHLA 2X1IA 3BLFA 1K02A 4R34A 1I2RA 3CH9A 5FAGA 4RE0A 4HOZA 4O8AA 1VFMA 2PDNA 4C6CA 4HOXA 1TSIA 4AH7A 2DW6A 3MY9A 4JN7A 2Y7EA 4NNAA 4KCUA 4RR4A 4NAFA 2V3DA 3NFUA 1GONA 3MZ2A 2GJXA 2WV8A 3GWQA 3LV6A 4ZXOA 4C6EA 2ZTJA 1O68A 3PB2A 3AHZA 1XGZA 1TMHA 2QJMA 3M0IA 3HGJA 4O1EA 4K8GA 1L6WA 3DFSA 1DWIM 5ECVA 3ZLGA 5BOOA 1R30A 4LEFA 3CBWA 3B4YA 1UZ4A 1DE6A 3CPGA 1PZ0A 3UYCA 5DMYA 4MM1A 2XISA 3VD3A 1B31A 9CGTA 3NSMA 3QLLA 2P8BA 2GVLA 3VMPA 4GI9A 2GFTA 4UTHA 3N2MA 2BHYA 1H3GA 5KITA 4TIMA 3S6DA 4C6FA 1IZCA 4S3EA 2QCFA 4ICCX 5HJXA 4OFCA 2XIMA 1NOFA 8XIAA 1E3XA 3BL3A 3DOPA 5CGTA 1CXKA 3EX2A 1V5XA 3GUWA 3MPGA 5HA7A 3VNZA 3PG8A 1AQ0A 2BXYA 4XTIA 1R87A 5BRPA 4PTNA 4MVAA 4LJ3A 1OG6A 3W38A 1TWDA 3N4AA 2QJIA 4PTMA 4K1GA 1NDYA 4IWWA 3TN6A 2CIPA 1ISXA 5CAHA 1TX0A 1BXCA 1ME7A 2VWSA 4GX9A 1E70M 3GFZA 1EGZA 1FHDA 3WH6A 1XSIA 2WMJA 4E8CA 4UTLA 3EZ4A 4LCQA 3L4YA 3CTTA 3DKJA 3LNPA 2OSXA 3V7PA 3IJDA 4CNPA 3UERA 2J7FA 1LOQA 4D6EA 5LHFA 4Q8NA 2ZX9A 3ZM8A 2G41A 1E56A 1JR1A 4I7WA 4PUKA 3ARWA 5AYYA 3TWBA 1VS1A 2BHZA 4N9EA 4IP4A 1LBLA 1WDDA 4ZOBA 3F4CA 4YNGA 4CQAA 3KOFA 3NQ2A 2NW0A 3N04A 2EKCA 4DWDA 3EWBX 4HN8A 4QP0A 4JTIA 2J74A 3CIVA 1EXBA 3N9KA 1XUZA 3RLGA 2GQ3A 2QGHA 1V7AA 3SGUA 3CWNA 1TUFA 2ATSA 4H2CA 1X98A 3B8UA 3BARA 5JQ9A 2Z29A 3WBEA 2JIWA 2PC4A 3VD7A 1FFRA 1OQFA 4O0KA 2ZE3A 1JCYA 2VOTA 5D2YA 1ENUA 3TMQA 3W2MA 2WW5A 6ALDA 2E1DA 3OODA 4MJZA 1JDEA 3KVLA 3GO2A 4AD3A 3H4WA 3CUFA 3UZWA 4AXKA 4F48A 4PMOA 1B30A 4AIUA 1JD9A 3M0KA 1NEYA 2PDUA 3QY7A 3G8RA 4QAIA 1VF8A 4RDWA 5M2FX 4R7OA 3C86A 3G6LA 4LPCA 3N3MA 2R1NA 1Z89A 1F3EA 2A5HA 3HTWA 1ZJBA 5GVJA 4MOZA 5G1TA 1DHKA 3V1HA 2OZ8A 3MVTA 3B8WA 1YX1A 2OCZA 5DXXA 2E9BA 3PBMA 3AWNA 1BVWA 1W9UA 2XM1A 1MYRA 2HJPA 4HU4A 4X22A 3AYTA 1XIMA 3DBNA 3W7MA 3LZ5A 1I60A 1UBPC 3KRUA 2PTZA 4GXMA 3ZJKA 2VEKA 3TAKA 4HOWA 3IVUA 3TFXA 1KNWA 2ZZ4A 1O5RA 3B9OA 1OVDA 1CENA 4F2UA 4JTEA 4FO4A 1FWTA 1FWNA 5DANA 3IGHX 3MZNA 4ACYA 4C6QA 3B04A 3K4DA 1IV8A 4J1OA 3TLLA 1D3HA 5KZDA 3FJLA 1E6NA 4ENLA 1J18A 1B3XA 4OWGA 3R8RA 4Y9PA 5H8UA 5D05A 3LENA 5I00A 2PDQA 4HK5A 1O5KA 3FGCA 3EXSA 4GUHA 3PZTA 3BDKA 4E38A 3H2MA 1LZOA 2GDQA 3K8KA 3GXTA 1A53A 1XQLA 4C5YA 5KSWA 4YTTA 3N13A 2Q8LA 3OZMA 1TKKA 2SFPA 3R4IA 3OVGA 3STFA 3AJXA 4IM4A 4AY8A 4XZMX 4FNPA 4MPKA 3CASA 5DQPA 2FQIA 1ITCA 1JCTA 1IWPA 3UGRA 3DERA 2NQ5A 3C0QA 5C8BB 2YXOA 2Z1WA 2D2JA 4DJEC 3W81A 4UMCA 1N8FA 1W5OA 2DV0A 3GHUA 1C9WA 5D8ZA 3NQ7A 4QM1A 5H91A 4C1LA 4XK2A 3CGTA 1ITQA 1MEIA 3R94A 1TPC1 4S3AA 1PYMA 4UR9A 3BURA 2DZUA 3OHIA 3LV5A 3VKAA 2BVDA 3C2VA 3RHGA 3I68A 2AQVA 1XDLA 1KFWA 2W63A 3PG9A 3GR4A 3SO7A 3VK5A 1ESWA 4LVBA 4C65A 2NWSA 2J9XA 4FB7A 4FI4A 1CGVA 3TQVA 4O15A 3CO8A 4HKPA 3QSRA 2ATMA 2J6VA 1GHRA 4E8GA 2V6AA 1DKWA 4LUJA 1KCZA 1IEXA 1OYAA 1C8YA 2A3LA 3SCRA 1W9PA 2J47A 2YCKX 4KS0A 3ARUA 4GMEA 4PB4A 2HEJA 1TO3A 5FD0A 3IPWA 2PD5A 3ORWA 2POZA 5IDIA 4BFAA 2ZX7A 3UG5A 4UFIA 4H9XA 1R8LA 2OKTA 3I7SA 3IK4A 1P6BA 4LUSB 1XR2A 1VGAA 3N6HA 1Z6KA 4R7JA 2GSEA 2HQAA 3THQA 4DELA 3RUBL 3AYSA 3IJ9A 1TPVA 1S46A 4B5WA 2GGGA 2V5JA 2ZRXA 3VE9A 3P8JA 2Y7FA 1HKWA 2YX0A 1YXYA 3FJ6A 3ZMRA 1REQA 2P88A 2VR5A 4MFDA 1H2JA 2AMGA 1RVGA 3A3HA 1OFPA 1QTWA 4XZBA 1XKYA 2EEXA 3DC0A 4LC8A 3D6NA 3BWWA 5F2LA 2QEZA 3SADA 4AWEA 4LRTA 2Y62A 2EPKX 3KVKA 4QHRA 4WDWA 4MB3A 1P43A 4IHCA 1Q6DA 4J35A 2NWRA 1SR0A 3GY1A 4WHBA 3P7YA 1OK6A 3SY5A 4P7RA 4JFWA 2PDKA 3SFKA 3WNNA 1JYXA 1POJA 2PWEA 2OQLA 5HBFA 1OJXA 3UXKA 3B3DA 3L21A 4JIIX 1M04A 3G1SA 4GUIA 3NOEA 2XN2A 3KLLA 3PZIA 4RKAA 5FCZA 1RA0A 3FDKA 1LLOA 1A49A 3BJTA 2ZA3A 1YLVA 3HGOA 1MW1A 1Q3NA 4GIYA 3UR2A 3MSGA 4ZA0A 1JZ3A 4O12A 1YMYA 3HG3A 1W8GA 4Q4KA 4EPDC 2CHNA 1XYZA 3PSWA 2JALA 4A3RA 4S39A 1W1VA 3EA1A 2VP8A 3NEHA 4PODA 2XHYA 1XLIA 1TX2A 1OB0A 5IFPA 3FA4A 3MUZ1 1Q5MA 2RJHA 1QBAA 3AZSA 3D0CA 3UZYA 1WNOA 5C7VA 4TR9A 4RE2A 3PS7A 4GHRA 3PPFA 1K8YA 2P3ZA 3BJFA 3W1UA 1OK4A 4GH1A 3OZYA 3S1WA 4DO5A 1AMKA 3ARSA 4HCLA 3EDKA 1QAPA 1Q6CA 5JH2A 1PO9A 1IT0A 3VCNA 1OX4A 3J7HA 3OLGA 2R24A 1WO2A 2E09A 4G7FA 4LQ1A 3S9ZA 4WOQA 4JBRA 3PSVA 3ALFA 2EXOA 3EOLA 3L4VA 4ATWA 3HJEA 3TUUA 4EF8A 4CKQA 1DL3A 2GZXA 1XLCA 4D6IA 1ZNNA 4HB7A 3QR1A 2FH8A 4NHVA 1W5NA 3A13A 4LAMA 4MGGA 4JTAA 1IGSA 2RDXA 1B9BA 2WSYA 4GNKB 3S83A 4CU7A 1IWAA 2AMXA 1FCVA 1R46A 4LVDA 1KQYA 3PZOA 2JKAA 3WBXA 4DWSD 3RDKA 4S3GA 2R9RA 4JYEA 1XYLA 3PZQA 4BWLA 1FQ0A 4ORMA 3PZUA 2WHJA 3E02A 1AQHA 4M6VA 4ZGYA 3R5EA 3UJEA 4FNSA 1R3SA 3QY6A 3QZ6A 3WUGA 3KP0A 1WDPA 4XBJA 3QSTA 2BGQA 4WX2A 4GJJA 3KE0A 4IPNB 5JBEA 4WY0B 3WK1A 5F7UA 1Q7QA 2PF0A 5J04A 2OGYA 2CETA 3CM4A 1QO5A 3CHFA 4H8HA 1WZAA 4JQAA 4AIBA 1R3TA 3BZGA 2B7OA 4LB4A 1TV5A 5CPLA 3NQBA 4NJJA 1KM0A 2FTPA 4E6MA 1MW0A 3LTPA 1JQXA 3HGRA 2ZTKA 1P0BA 3EMZA 4O8RA 3COTA 3RO8A 4INFA 1GK8A 3EPNA 1OGBA 3JZEA 3VDBA 1VCVA 5LNRA 4DF0A 3WLSA 4LWWA 2J79A 4Q7NA 4MY1A 3SN4A 2J13A 3UR5A 3W83A 1QK2A 1I0DA 2QDHA 4GY1A 3N14A 3PZ9A 1A47A 3UVAA 4GZJA 1ECEA 4FOUA 5KINA 3W28A 5FEWA 2ISVA 4O10A 3UETA 1OWQA 5I3KA 4DF1A 4ONVA 3A23A 2XH4A 5CC3A 2Z7KA 4MPQA 4YIWA 4MNMA 2D3NA 1TZZA 4Q8TA 4GLEA 2VX7A 1ECQA 4HPJA 1EHAA 3DI0A 1V02A 5MHBA 5AVHA 1QRQA 3SRHA 3MP5A 2BY3A 3WL1A 1GNXA 3L4XA 4WSJA 5HDRA 1LUCA 3URQA 5LIYX 2IQDA 2PDGA 2XJ7A 4U3AA 4TTGA 2J24A 5A2CA 3AOFA 3VIFA 1B4EA 2GUBA 4GKLA 3HG5A 5T9BG 3UCCA 5GPRA 2OSYA 3AHXA 1SSDA 1N2VA 2WLZA 1YBQB 4ZOAA 4S3CA 1J0JA 4DYEA 2ONEA 4XZLX 3W23A 2J75A 4LSBA 2WOQA 5AZ0A 2C0HA 1SO3A 3PJUA 1ZAHA 3L4UA 2CZ5A 4BY3A 1XH1A 1OINA 5FF4A 1RSCA 1E0WA 5BOFA 3R89A 1U1JA 1RCQA 2VZTA 4AZ6A 5DXYA 4Q6XA 4NJIA 4DPQA 3EKZA 3RNDA 1WBHA 1EIXA 2OEMA 3S46A 1TIMA 3ARTA 2X41A 3V5OA 2O4QA 1DQXA 3BG3A 5J5RA 3WBWA 4IG2B 1HJSA 3AQUA 1C93A 3WLNA 1K6WA 2OSWA 5CPMA 2ZADA 4AYGA 1CXIA 3R12A 1QHZA 1VFFA 4NIRA 3KM8A 4CEXC 3UW6A 4L9ZA 1Z42A 5DEZA 4A21A 4FNQA 2ZXAA 1KTBA 3KBWA 2INZA 2OWXA 1M1BA 4DPPA 3I4EA 5HQEA 3L7RA 4Q32A 4N0RA 2OG9A 1HKVA 4MKNA 2Z1KA 3PZVA 2DSWA 1H0IA 3QN3A 3N6QA 1H49A 3I65A 4W84A 2Y4SA 3GAKA 3DG6A 4GIRA 3B97A 3LG3A 3DX5A 2WVVA 4UBPC 2DZTA 2QUUA 5CEWA 3APTA 3HG4A 4FEZA 2MANA 1QWGA 4KGJA 3C4UA 4XD6A 2FZMA 3JRKA 5D9OA 1UH4A 5FIPA 1XV8A 3N9SA 2ASHA 3KP1A 2YL5A 1P6WA 2CXGA 3LRMA 4AX7A 1ADDA 4ZE5A 4ZMGA 1FHUA 1PE1A 4R88A 4ZSTA 5EKYA 2IKHA 5D9PA 4ZB5A 3VGEA 2CZEA 5EL1A 3HFTA 4QJ3B 2CPUA 4XUGA 3MI6A 1XIFA 1BG4A 5JIPA 4Q4QA 4AZHA 3DYPA 7REQA 1WZLA 2X09A 1K8ZA 3VNLA 4U5KA 3BV7A 3G18A 2EHHA 1B1YA 1KTCA 3TYDA 1J2BA 4P7NA 3CUXA 3W7DA 5CXPA 2CBIA 2HXUA 1B3WA 1D9EA 1YPIA 2KAUC 1RH9A 1EYWA 4CD8A 3LPFA 3G1HA 4BA0A 1AW5A 1W1IE 1H0GA 3K30A 4XKYB 4UTWC 4WCJA 3MP3A 5C70A 1Y0EA 3FN9A 3MHUA 3TYEA 1OCQA 4IP5A 3ENLA 2WQDA 4S2CA 1FWDC 1SZFA 3THDA 1VQTA 1UUQA 2VFDA 1X1OA 3SDOA 3HPZA 1C29A 3GTNA 3E5BA 1V77A 2FYMA 2F84A 5LKYA 1DIKA 4HU0A 1NFGA 1HQTA 3ARZA 4B9YA 1NH6A 4JHOA 4D1JA 1X8CA 2BV9A 2WMIB 4PMVA 3BW4A 4HZMA 3BSMA 2Q09A 4JR5A 1A5OC 1DTNA 4V27A 4QEHA 3T78A 4L80A 3VGBA 1A5AA 2B0MA 3BH4A 5U4NA 4H7VA 1A3XA 2NLYA 2WMFA 2HWGA 3KCOA 1TMQA 2WKLA 4Q4RA 3SQLA 3E3HA 2HK0A 4OOUA 4C7DA 3C5QA 1CYGA 3AS2A 3GW3A 1GOWA 4IFOA 2F2HA 1W3LA 3CTLA 3AIUA 2CLPA 2PDJA 4W85A 3EX3A 2I14A 3PC0A 1EIBA 4LEQA 1EA0A 4IF2A 1Q66A 3PPGA 4PMZA 2GDVA 4D72A 4G1KA 4KETA 1VCFA 4HA1A 3O15A 2FMOA 1VZWA 2OGJA 2G3JA 3GX9A 2VVNA 4OU1A 4V28A 3AHVA 5FJIA 1F3XA 3L23A 2A6NA 2WYSA 1XRTA 2VEGA 2NSXA 2B31A 2YL8A 4LAKA 4WGHA 1XPGA 1ONEA 4KWOA 1NP2A 2Q3OA 3TONA 2V0TA 4KESA 5ABTA 3RITA 5CLTA 2OYLA 3P62A 1YPXA 3OOQA 4BR1A 4GVFA 1KBKA 3MP4A 3P61A 4Q4PA 1UD3A 3ZS4A 4A4AA 3ALGA 2V5DA 4EP8C 3AC0A 4O1DA 3TYAA 5LGXA 2GVEA 2XDFA 4L4LA 3FYOA 2BLEA 1ZTVA 4IICA 3P6LA 4IQLA 1EJSC 2QIWA 3TYCA 3DZ1A 1EGVA 3WK2A 1OHLA 3KBVA 2IPFA 3QJAA 1GYNA 3YPIA 3G1YA 1YEYA 2DSKA 3TQ0A 1ZP4A 4MJ4A 2CFFA 3NWRA 2Y85A 3PWGA 2DQWA 3WQFA 3LX9A 3SM0A 2W9MA 1XD1A 2UV8G 4ES4A 1BKHA 1VHCA 3L2LA 2W4XA 1A4LA 1JPDX 1XX1A 4LS0A 1UKSA 5J8LA 1P7TB 2A1YA 2OO6A 3T9PA 2IUZA 3BLEA 3CJPA 3BG9A 2ZVRA 3EWXA 4LVFA 3IS4A 3BG5A 4N7QA 3E6EA 6XIAA 4HPGA 3LGEA 4JTCA 1EF3A 4EK7A 1UR2A 1NOWA 3WMSA 2C79A 4LNYA 3NO3A 1LTDA 1BYDA 3DFYA 3CPRA 1RP8A 4LF1A 5H8MA 1Z8AA 3GH7A 1FWIC 2CHRA 1UWIA 4OVXA 4J3TA 4LF2A 3LBCA 1UP0A 3IIZA 2FTWA 3URBA 3II1A 4PUUA 3NQCA 4LAOA 1OGSA 2PGFA 4JQ4A 1MUMA 3EWUA 5G1YA 4LGXA 3A5VA 3TJXA 3RXZA 1KM1A 3PUEA 4GWEA 1TTPA 1DEDA 1TJ1A 4HSHA 1CT5A 1U22A 3E2RA 1W9BM 4MDOA 4KQNA 4JZ5A 3AMCA 3T42A 1BLIA 5F2MA 2JEPA 1GQJA 3NGJA 3GIYA 4NXSA 4RDZA 3UA4A 3BW2A 1KM5A 4JIHA 1A5BA 2ZICA 1C8QA 1FKXA 1HF6A 1UKQA 3BPWA 4C6BA 4H6RA 3W82A 5K9DA 4XBSA 4O57A 4DAFA 3EOOA 3MV11 2QCHA 4XAYA 3OPSA 2PWUA 4NXKA 3BO9A 4EF9A 2A7PA 3MDWA 1TJPA 4YU1A 1DVJA 1JZ7A 2OR2A 3SCOA 4MB1A 3SCVA 3V16A 1BWKA 5HQLA 1T6MA 3H54A 3MU7A 4LFYA 2VNCA 2QUNA 1UA3A 1M53A 4V1XA 4ZFMA 3WD3A 2VD9A 1B4KA 1K03A 2PTYA 4PBFA 1J9YA 4CD5A 2BY1A 2WJZA 3P14A 1QPOA 4E3TA 3LNMA 4NJKA 4JIRA 3WD4A 4CUCA 3U6WA 2X8RA 5I23A 3GVGA 3PBUA 1JCJA 1NDZA 2HE5A 4UOZA 1DPMA 4MWAA 2AKZA 5AHIA 4XZ9A 2MUCA 1JRBA 1PEZA 2ZDSA 1QNSA 4KWUA 1M5WA 4HP5A 3SEPA 2R6OA 4RUBA 3BV4A 1Q7ZA 4B2DD 1DOSA 2TYSA 3BCJA 4UXDA 3ABSA 2J25A 1N8IA 4Q8WA 1G7VA 2OLSA 3O16A 4W5UA 5DFAA 1W37A 3LSCA 2AQOA 3GXPA 3U3HA 2C3ZA 5JXQA 5E9AA 3USBA 3UA3A 1EO5A 3CQJA 4URIA 3WUEA 1SFTA 1UYQA 2GK1B 2H8ZA 2WZIA 3WH5A 3BOXA 1CTNA 3M5VA 3A24A 3F5KA 3EWZA 4L4OA 1OCBA 3HBLA 3WNKA 3CMFA 2Y2WA 4MZ8A 5LGZA 4IIEA 3SUWA 2BODX 3RCYA 3MUIA 1VFOA 3VOGA 3NPXA 3S5SA 1DJZA 3GG8A 4UR7A 2GGEA 1PZ1A 3R10A 3UCQA 3GH4A 3UPWA 3RF9A 1UWUA 3U0HA 3B9EA 3FVMA 5EBUA 4UTTC 1D3GA 4U31A 1PIGA 3F1QA 4DZ5A 4RNFA 4LT9A 4GZEA 5IBXC 1U30A 1E1FA 1GOQA 1IXNA 2QHAA 3W7EA 3DFOA 1SVDA 2PDFA 3WQPA 2E6DA 1VRDA 5LYRA 3DYMA 3PM6A 3L66A 3EB3A 4KEZA 3CV2A 4DLMA 3MA8A 1JXJA 3GNPA 4J3VA 3A9IA 5D02A 2TMDA 4F9DA 2QCMA 3W1MA 2RDTA 3RJYA 2WJEA 5C9XA 4NJGA 1O94A 3B0PA 4Y9MA 3PZMA 1K77A 1PCWA 3LEPA 4WR3A 4YHGA 3BLLA 1JF6A 4HSOA 1JFHA 4FP1A 4IFKB 4W8AA 3LD5A 4JTRA 1Q8AA 2YW3A 1JD7A 1YYAA 2ODOA 1GVIA 3V0UA 2YFNA 4PMDA 5FJUA 3NXFA 2Y88A 3UZ5A 3GNXA 4XTDA 3WH9A 4AMAA 5C2GA 2FTYA 1CGUA 4I8YA 3STGA 4XAZA 1ZP3A 2WM1A 3NCOA 3FYPA 1ADSA 1AJZA 1CBGA 2X1RA 1W5MA 1GOKA 1F61A 3VZXA 1Q4NX 3ISIX 1NF7A 5CZ0A 2F6XA 1M3UA 4E2BA 3WQ6A 2E4TA 1XYCA 1FWCC 2D3LA 1Q6FA 2NT0A 3R0DA 3CQ0A 4AISA 1IZKA 2NV2A 1XS2A 3AZTA 2QQ6A 3T0TA 2E5BA 1EX1A 4TVDA 1F76A 2HS8A 1OGGA 3SJNA 3N19B 3VMOA 4GO9A 5A6LA 3I3EA 1LYXA 4A05A 3H70A 1I2NA 3P67A 1CECA 2VCBA 4J3WA 3TXVA 4C6MA 2VEMA 3LUTA 3R0UA 1FY6A 3VOIA 3R1ZA 4NP7A 4OIFA 3AXXA 2W62A 1AD1A 3CIXA 3W74A 1Q65A 4TV6A 3AMKA 3FOKA 2W3ZA 2NLIA 2HNHA 3Q4DA 1QJWA 2Z1BA 1EGMA 3W72A 5DT5A 1VFSA 4FLSA 1KQZA 4C7FA 2X16A 3NYZA 1A3HA 1OFDA 3U2CA 5BXTA 1CZ1A 3UY8A 1XIGA 2Q01A 2Z6IA 3MDUA 5DRCA 4EVZA 1DJIA 3KX6A 4E4PA 3IUIA 2VRQA 1UR3M 5LA1A 5G2WA 2D23A 3AO0A 3GD6A 3OGSA 3NNTA 1GPFA 7ENLA 3LHYA 3V1PA 3EDDA 4M5PA 4NUWA 2YL6A 3AS1A 2Z2BA 1L8PA 5BWFA 1Y8BA 1RPKA 3GHRA 3TP4A 1KBJA 5FI8A 4I7UA 5KMYA 2YPIA 4DAIA 1VFUA 3ECQA 3M9YA 1YNQA 2QCEA 3LS9A 1WP6A 3QV6A 1WZMA 3LI0A 4H8VA 4XWUA 4AZGA 2HISA 4WJEA 4V33A 3SY1A 1Q6LA 2PDYA 3BMVA 1R85A 2OOGA 2QT3A 3VXGA 3A3WA 3SUVA 5HJLA 1KFBA 3IUDA 4JCLA 3S5YA 4MYAA 4NX5A 4D2JA 3AXHA 4M7TA 2XSBA 1H7OA 4LUTB 1QK0A 3XIMA 3B9NA 4LOCA 2YB1A 4NILA 4JQ2A 1CIUA 1VIZA 4F0HA 4RK8A 5D2WA 1MQQA 4TV5A 1E6XM 3C2RA 2Z1SA 5MKGB 3P74A 3EWWA 5CLWA 4U2ZA 2PPGA 3E0VA 3W1RA 1YE4A 4DJDD 3TFCA 2YZ5A 3WEZA 3T0AA 1GVOA 1PB0A 4N9BA 1JCLA 2ZRUA 4QS6A 1DHPA 1LT8A 3LK6A 3AHTA 3A12A 1VJZA 4GI4A 3W2LA 1H1ZA 2AL1A 1VHNA 3RLUA 1PBGA 1KA9F 1UBSA 4AY1A 4FF7A 4WK9A 2ZWYA 1VEOA 4QIUA 3H2CA 1VKFA 3LI1A 3BJSA 3F7JA 2VVSA 3B05A 1IEIA 4DO6A 4N6FA 1HUVA 4QG8A 1R0MA 5AC7A 3L0KA 1LROA 2GQAA 2Y7GA 4ZENA 1NELA 3HPAA 1RALA 4FNRA 2IKIA 4A3HA 5CZKA 1HJWA 2PP1A 4LBUA 4RXFA 3S9YA 2TSYA 1A5SA 3HB9A 2ZOXA 4NVTA 3PTDA 3FXGA 3CAKA 3FLUA 4GPNA 1QPKA 3LPPA 1MXSA 1J93A 1V6VA 1CDGA 4TXEA 3LCFA 3R8GA 4HZ8A 1QATA 1PZ3A 1LL7A 4GYKA 5FEXA 4XZIA 4IUGA 1TTQA 2V5CA 4LUSA 3PTMA 3M0LA 4WD0A 2WPGA 3GNRA 3S1XA 1JYWA 4P5UA 1E9LA 4RNIA 1WOBA 2X1UA 2ZE0A 4DBWA 4XSLA 2XVLA 3A47A 3O05A 2CERA 2DPEA 3N11A 3WUBA 3OZOA 4M81A 1P0DA 2E68A 3KEHA 3BAKA 3OW1A 3CC1A 3W71A 1KBBA 4MSSA 4LV4A 1RD5A 1BD0A 4KFNA 1T41A 1TV7A 4MIMA 5EMKA 5I77A 2EPHA 1I2OA 1GEHA 1PKNA 1TJRA 3WQ5A 3B9AA 4DM1A 4G6CA 1V3LA 4Z1BA 4GZIA 4PMNA 3EMCA 1Q8JA 3N15A 2J7CA 1G69A 2J7DA 3L5AA 1BWLA 3CUGA 2R91A 4GRSA 4LYRA 4O54A 1ONWA 3NOYA 1WYIA 3JUGA 3RAOA 2GL5A 5C5YA 3S6TA 1XD0A 3P3BA 1XGEA 2C19A 2GSHA 4EXAA 3SRFA 1PV8A 3VX1A 4Q7IA 2BX7A 4LALA 4TTUA 8RUCA 1WUEA 1IHIA 4FR1A 3WCZA 1GVYA 2Y8UA 1LLWA 4C90A 2VUNA 1J10A 2EG6A 1OFEA 2IMRA 1NARA 2VHLA 2ZXDA 4DM2A 2VR4A 2HZGA 3C3NA 4E4UA 4DJEA 4CD7A 1UPMB 1HO4A 5E1QA 2P53A 2P50A 3P0WA 2OLHA 5F4SA 3ZFHA 3IJIA 1CEOA 1ZUAX 1D7KA 5JIWA 4DJFD 5K9CA 1XICA 3W01A 1FXQA 4B5NA 3I7RA 4X61A 1BYCA 2BY0A 3W26A 4ZQNA 2PSNA 3NPVA 3T4CA 1BRLB 2FHBA 2INFA 2BDQA 1QPNA 5K7JA 1JGMA 1AL7A 3KRSA 2PMQA 2YDSA 4ADTA 2QDDA 3AU6A 2NXIA 1QUMA 1G7UA 4US5A 3VIGA 5D04C 1WAUA 5AY7A 3W27A 3PBVA 1X8FA 4JOMA 1YHTA 4ICNA 4UMAA 1TPFA 4O1AA 4WSKA 5FF3A 1GEQA 2BG5A 1DJQA 4NAEA 1QT1A 3STPA 1TV8A 3CYVA 1H60A 2HK1A 3THAA 3GZAA 2QVHA 4RW3A 1G4PA 1F6PA 4PTWA 4G1NA 3GDRA 5AYBA 3PFMA 4UQDA 3ANUA 4MB4A 1G4SA 3QQWA 1XINA 3WQGA 1TWIA 3L0GA 4P7OA 4EKJA 4BKNA 4C1NB 2VCCA 2AGTA 3MBDA 3TC7A 2QCNA 3TH6A 2EG7A 4QXIA 4EX4A 4QSFA 1PWMA 3CZEA 3K46A 5I3IA 1DJXA 5BROA 5EFFA 2QUVA 3BAXA 5C9UA 3CIWA 2O9PA 3TTOA 4LXFA 4CN6A 5M17A 4WY0A 1CB2A 1XIBA 2WHLA 4NZFA 3KCLA 4FMVA 3KRZA 5A1AA 2RJGA 4IX0A 5I7GA 3RX4A 1MEHA 2FZDA 1FP8A 3L4ZA 1W56A 4L1WA 4Y9AA 1EOMA 1VBJA 4GYPC 2PU0A 1NWTA 4IJBA 1JXKA 3LMZA 1GVQA 1J2WA 2YBTA 4M56A 1MQRA 1VFHA 5A95A 3ARQA 2PURA 3GDTA 4F8XA 2H3BA 1S2TA 1W3TA 2HTMA 2F7FA 3A4XA 1QHPA 2BGSA 1VBGA 4DUWA 2X40A 4FX7A 2YCIX 2EQDA 5CCZA 1QNVA 1E6RA 4JTJA 1UZ1A 1Z32X 1XLBA 1OX6A 2LLEA 2H9AB 4WQ6A 3HQPA 3AI0A 4QE5A 4GACA 1WDWA 3QY8A 4I5XA 1UC4A 2OODA 4J28A 1FH7A 4XUYA 2FZ8A 3GU2A 5F4XA 3GB6A 3LCLA 2FZ9A </