3NR0A

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r6 6/10a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
245
Chain Sequence
ATLKASSLRALKLMHLATTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASASLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords deoxyribose phosphate aldolase
total genus 92
structure length 245
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nr0A00
1YXCA 4HHPA 5EMUA 3BW3A 5HQEA 3GKAA 1YTDA 4UTKA 2O7QA 3WJWA 2VFIA 1TREA 4XKYA 1DHPA 2FPYA 3W22A 3NPUA 4LOCA 2NLIA 1TPEA 3LDVA 2GQ8A 4UC5A 3GAKA 3LLDA 1ME9A 2VFGA 1YDNA 3EWXA 3KRSA 5BW6A 1W5MA 1YADA 5BRBA 4FNPA 3LRKA 3LCFA 1TB3A 5F4SA 2OJPA 3HGSA 3EX2A 4JDYA 4LRSA 1TO3A 5KITA 2P0OA 5LZLA 2YGYA 2V2DA 3C0JA 5LNRA 2PC4A 1R47A 4UCGA 3EWBX 2WNZA 3WK2A 4Y90A 1PV8A 1KM1A 1L6SA 1FQ0A 3LRMA 2C3ZA 3ZWTA 2YSWA 1GYLA 3BW4A 1CI1A 4OV9A 4AXKA 5G4WA 3UY8A 3GXTA 4X22A 1YPIA 3MBFA 4BI7A 2D73A 3O6CA 3HMJG 3ATZA 3CC1A 1ZAIA 4JYFA 5TQLA 4HPJA 4TU1A 1R2SA 2Y7FA 3L67A 3SSJA 2Y6ZA 3Q58A 2GQAA 4JTIA 5AHIA 4Y6GA 1XDMA 1MEHA 2QCFA 4IMCA 2Z6JA 1WXJA 3WK0A 2BXVA 4IPIA 1H1YA 3UD6A 3N19B 1KBIA 5D02A 3L0KA 1X6UA 3UWYA 4UTHA 3PAJA 1H7OA 1ZAJA 4JR5A 1G4PA 4JTEA 3S5YA 2I14A 3TSMA 3M5ZA 4AHOA 1AW5A 1SO5A 1G4TA 2PURA 3TR2A 3EX4A 4K6AA 1FWSA 4WX2A 2BLEA 4O0ZA 4O50A 3DHDA 5IBXC 4DF2A 2Y62A 1LLWA 3P67A 4M7SA 3FIGA 1OX4A 1W5NA 3L5MA 3TW6A 3GDTA 3HB9A 1H50A 2V5LA 4CNOA 4JS3A 4RKAA 2Y89A 1KM4A 1VZWA 3W2JA 1SO3A 1JR1A 3IGXA 3KXQA 4UMAA 2Z6IA 4NNCA 4DEFA 2VFDA 3CB8A 4A29A 2YYUA 5L9FA 3FFSA 1OFBA 1FCVA 2QCGA 3DAQA 1LBLA 1DQWA 2JGQA 3LHWA 1KM0A 4K8HA 3W72A 4TIMA 4UTLA 2W0UA 3W86A 3LHUA 1Q6LA 1L2UA 3B0VC 3G3MA 4MOZA 1FBAA 2NUWA 1OX5A 3I68A 3MP4A 4LC6A 3RMJA 3F1QA 3NQFA 2CLEA 1KTBA 2V0TA 2YPIA 3OHIA 2C18A 3PUEA 4HNNA 3NO5A 2DJLA 1TPDA 1GQNA 1TPH1 4C1LA 1Z48A 2X30A 4NJKA 4O8RA 1H7XA 2VOMA 1A5AA 3O6DA 1PIIA 2WKJA 3G8EA 1KFBA 3KAOA 3NG3A 4GUIA 5BMWA 2F7FA 2NXGA 2FPTA 5FEZA 1RD5A 1JULA 3GDLA 4JDBA 4YXGA 4O18A 1EP2A 4ML9A 1VRDA 5FEXA 3UNDA 2CWNA 4OV4A 2F84A 4OHQA 3M1ZA 1A53A 2VELA 4I7UA 4JTLA 1Q3NA 1OK4A 3M16A 3QYQA 2A7RA 1ADOA 2CZEA 3HPXA 4ALDA 4BWLC 2J88A 1FCUA 1O5XA 3G1XA 3P61A 3PSWA 4JTJA 3DI0A 5EYWA 2KZHA 3TUUA 4O13A 1JUEA 3IV3A 2NXHA 4R7JA 3E49A 3M5XA 3P84A 5C5YA 4FNUA 2Y85A 1D3GA 2FB2A 2ZZ7A 3W7GA 2ZRXA 2YFNA 4JY8A 4IPJA 4MYXA 1GVOA 1M6JA 5CZSA 2DORA 3NL6A 3HGOA 2I1OA 3EWYA 3TAOA 1E51A 2ATMA 3SW6A 4O19A 2RKXA 2Y70A 3W1PA 5FI8A 1ICQA 4ADTA 3NQEA 2E6DA 2P10A 4DO4A 4CQ9A 4BI5A 3S1UA 3W85A 3IVSA 3T78A 2C13A 3VNDA 2ZBTA 4FO4A 3EWWA 1J5TA 5T26A 2H3DA 4MLRA 4PH6A 2C14A 2QCMA 5ABTA 1BWLA 1FDYA 3MMTA 4ZZ9A 1QMLA 3KVKA 3L5AA 1H7PA 1TPWA 3IIZA 3DGRA 5D2YA 1XCFA 1O4UA 2ZDRA 3HQ1A 3W7HA 2FB3A 1I2RA 1K7EA 2WPBA 1XDLA 3T7VA 4MZYA 4Z08A 1SZEA 1XL9A 3N9SA 3W7QA 5J5RA 1ZAHA 4QITA 1EEPA 3F03K 3L65A 5DCDA 2QJIA 1G69A 1KM6A 2C15A 3ANYA 4LW7A 3A9IA 3BG3A 3GDMA 1QPNA 3TXZA 4DQWA 1K02A 1SZGA 2HS6A 3VE9A 3GXNA 5AHMA 4O4VA 1VQTA 3BG9A 4JTHA 2R14A 3C2OA 2QJGA 1MZHA 4S2CA 3P5YA 2J9YA 5CPMA 3MWAA 1QR7A 2G97A 2UV8G 2E09A 4JIQA 3E02A 3TK7A 1U83A 1VCFA 5SWUA 5DBUA 1UBSA 1F73A 4JYEA 2QCHA 3QSRA 5CPLA 3EX6A 1LTDA 4NU7A 4NJJA 4IX2A 5CSRA 4H6KA 4O14A 4KWWA 3LXAA 2EGZA 4O54A 3O8AA 3B8DA 3G1VA 1GYNA 1UCWA 3DZ1A 3NQ2A 2QDGA 5DBTA 1R2RA 4LV9A 1SW3A 3ZS4A 4O15A 1OVDA 2J27A 2EPHA 1OABA 1YLVA 4JY9A 4ORMA 5FEWA 5HR6A 2YX0A 3W2MA 1ZJIA 3DFSA 2YDAA 1OX6A 2A0NA 5KZEA 1VHCA 4R53A 3FKKA 3MI3A 4LWWA 4MZ8A 3W7NA 1C9DA 4LTSA 1YDVA 1TTIA 4R33A 3I65A 1B4KA 3LV5A 2V8ZA 1K8XA 4YCPA 4K8EA 3H55A 1F74A 1TV7A 5D2XA 4LC8A 2DJXA 2ZA1A 5FESA 5AOUA 4IXXA 3S9YA 3IVUA 3B05A 3UPWA 4MLJA 3GB6A 5CPNA 3W3OA 1W3NA 3S1WA 3LTPA 4A2SA 3FKRA 4FX8A 1MSSA 2EF9A 3SI9A 3IGSA 4Y96A 1VLIA 2WNNA 5D33A 1K7FA 5LHFA 1DJNA 3EWZA 4LV4A 3PUDA 2CLFA 3PBUA 4I7WA 2DZVA 3S1VA 4IUOA 1A5BA 5EA9A 3GZ3A 2ZZ3A 2A6NA 2H90A 4UR7A 4PCFA 1J4EA 3QPZA 4AVFA 1V7YA 3L5LA 3DKJA 3DFQA 2E1DA 4MFEA 3O63A 2PCQA 5G2IA 3TFCA 1P5BA 3G1HA 5FF2A 3GDRA 5DELA 2H3BA 3DENA 3LCXA 4JTGA 3THQA 2Z2UA 3WK3A 4UTUA 1SPQA 3S42A 3LCWA 3M5YA 2JKEA 3G1SA 4H4IA 3TFXA 3W9ZA 5BMXA 3NPVA 2FLIA 2GVJA 5AHLA 1XXXA 1GVFA 1Z41A 3W76A 2A4AA 3NQ8A 4KFPA 4WY0B 4QQ3A 1GOXA 1ME7A 3HG5A 3NVTA 2JK2A 1KM5A 4UTTA 1ZFJA 1EPXA 3LLFA 3A24A 5F2LA 3UZ5A 4IGHA 1TYGA 3W7CA 3I7RA 1KFEA 4TR9A 3TCEA 1X7FA 5C6MA 1JUBA 1WX0A 3QQ1A 2PRLA 1OFQA 3QF0A 1M7OA 1I2PA 3WFAA 3Q37A 1THFD 4YLWA 3PBYA 3SECA 4U4MA 1F7BA 1KV5A 3NL3A 3R8RA 4RLIA 1DV7A 3OIXA 2RDUA 4E38A 2NUXA 4ZQRA 2A5HA 5I3IA 2GJNA 4A21A 5G4EA 4Z1AA 4AAJA 1RQEA 2TPSA 2ABAA 2WO5A 1M5WA 3QSTA 2YW4A 4MY8A 1I8JA 4ZQPA 2DU2A 2H8XA 3IIPA 2DZPA 3S6DA 3UY7A 3HF3A 4FHAA 5CZJA 3T4CA 1G6CA 4UTJA 3FYOA 1LRNA 3LTYA 3NDOA 3HG4A 5HNRA 3N34A 3SR7A 3W1TA 3UWUA 2QUVA 3EWUA 4LS0A 4LVAA 4E2DA 4GRSA 1A50A 3CWOX 4Z1CA 1UB3A 2JGYA 3O1NA 3CU2A 3PC0A 5CGQA 5KSWA 2CZ5A 3W84A 4M6VA 1LCOA 4UFKA 3W7EA 1YXDA 1Z44A 3VE7A 3IVTA 1X1OA 5GVJA 1IXOA 2RDWA 4GUHA 2JKAA 2VKZG 3TA6A 1D9EA 4ADSA 4N2YA 5A8GA 1VYRA 1LOLA 4EF9A 1NEYA 2RH9A 4DF0A 4CLMA 4NVTA 1SO6A 2WV8A 5EL1A 3MHUA 5AHEA 1YTEA 1JCXA 3W7MA 4GE8A 2PRHA 4O12A 1HG3A 4CCEA 4ZQNA 2ZZ1A 3GDKA 4RCXA 4D2JA 2YR1A 5AYXA 4DF1A 4KFNA 1R2TA 1KV8A 3T40A 3F4WA 3TQVA 3LGEA 2FJKA 2BZNA 4LT9A 2Q3RA 5TBOA 3TC7A 3LM7A 2HMCA 5DY2A 5I3FA 4O10A 1AW2A 1OX4B 2ZRVA 3PB0A 5U7SA 4ZQCA 1OYAA 4BF9A 1H7NA 5EKYA 3NXFA 4JTSA 3TROA 4CNNA 2YFOA 3WJZA 2OZ0A 3HPSA 5AC6A 1OHLA 1LBFA 4RZ5A 3NZRA 4NUWA 1ALDA 2QJHA 4N4QA 4JNMA 1WBHA 1SW7A 4OBTA 2TSYA 3RU6A 1LRTA 3PG8A 3L66A 4KFOA 4NJIA 3P81A 4XBSA 3U6WA 1RR2A 1K3UA 3MYPA 4WD0A 5D2VA 1SQ7A 1XUZA 3TW7A 3HBLA 2X1TA 5CPOA 3RF9A 1KBJA 3LCHA 1OJXA 5DLCA 3GX9A 3PF3A 2G5WA 4LU0A 2E6AA 4K7VA 3ZWSA 1P0KA 5TIMA 1IXNA 5K9CA 3G0SA 1JRBA 1XBXA 2JBMA 3A5VA 2V2HA 4TX9A 4KWVA 2QR6A 3UWVA 3QJAA 3TIMA 2QCLA 3W83A 2RDTA 3P74A 1VS1A 5F4WA 4O1CA 2OX1A 2NX9A 2XFWA 3PVFA 4RZ4A 3FEMA 4UTWC 1WAUA 4CCCA 1K8ZA 3ELFA 1UASA 2B0MA 4UIOA 4N9BA 1PHQA 2DZUA 3KOFA 1B3OA 3TAKA 3BLEA 3G22A 4Y8FA 1W54A 4M5PA 1H7RA 1XBYA 4HIBA 3W7PA 3EXRA 3NGJA 2P1FA 4LVDA 2CLOA 1F76A 2B7QA 3LBMA 2DZTA 1DJQA 1HFBA 3PY2A 5C54A 5LNVA 3TU9A 1RQBA 1X8FA 5HWJA 1D3HA 1H60A 2QCNA 2HS8A 3W2LA 2NWRA 4ZL1A 3W75A 1JCYA 3LOTA 4HPXA 4G1KA 3MI6A 3MJYA 3JR2A 3STGA 3T55A 1XI3A 2DZXA 2DZWA 1TJRA 3QW3A 4JD4A 1FXPA 3EX1A 5AYZA 1VYSX 1W37A 1EP3A 1KA9F 4K38A 5KINA 4GBUA 3B06A 2VENA 3EX3A 3V1PA 2NX1A 4M6PA 3I6RA 3MW7A 3NM3A 3M41A 3L21A 1SZFA 3B4UA 4M7TA 4BK9A 5HR7A 3KVMA 3DFPA 3LB0A 1GG1A 2XN0A 2A2IA 1W3IA 3ZFHA 3INPA 4CQ8A 3KHJA 4WOZA 5HWNA 1EA0A 1TQXA 1XFBA 1EX5A 2X1UA 3GKFA 4UTMA 2FIQA 2ZRUA 4L4MA 1G7UA 2Y61A 3M6YA 4GNJA 4N6EA 2ZFAA 4LUJA 3GK0A 3BLIA 3M9YA 1XM3A 2Y7EA 4FIQA 3HJZA 1GWJA 2QAPA 1I2NA 4DO5A 5HINA 5F2GA 5DCEA 1LM1A 3FOKA 4Z0JA 1KFJA 1GJPA 2GQ9A 2QCEA 4UTWA 1KM3A 4AHPA 1H62A 4TMCA 4MYAA 1UUOA 2J6XA 3MI2A 4JX5A 4K7YA 4Z0SA 2BWGA 3A21A 4RK8A 1IGSA 1EWDA 3LHVA 2J9XA 2Y63A 1GVRA 2A1YA 4QSHA 1WOBA 1L9WA 2FFCA 4NJHA 4NNAA 4PFMA 1GTHA 4KKXA 4XWUA 1ZCOA 4LVGA 1O5KA 3HG2A 1HTIA 1B57A 5FF0A 1SSGA 4N4PA 2A85A 1H5YA 1O60A 4YWIA 3IIOA 1G4SA 1W8SA 3WJYA 4K39A 3S0CA 1DOSA 3NQCA 2CW6A 4XTDA 3W1XA 3WJXA 4JEQA 3UWWA 2CLKA 2QAFA 3I7SA 2VFFA 3W7JA 1LORA 3CT7A 4FNRA 4LS2A 4IMGA 4JTKA 2NV2A 1ONRA 3KVLA 3OVPA 1T99A 4X3ZA 1NSJA 2NXIA 5I3GA 1HO4A 3Q2DA 4WUIA 3ABQA 1TV5A 4EOUA 4JN6A 5LGXA 3T44A 1LZOA 1MXSA 4DPPA 1W5OA 3QFEA 4XUGA 1SFLA 3O05A 1JRCA 4PA8A 4PL1A 5D09A 3EXSA 3W2KA 1LOSA 1HL2A 1OFPA 1VH7A 4FNTA 1TSIA 2GVLA 2HSAA 2WOQA 4ZQMA 4MJMA 4JGDA 5H2ZA 1H61A 3C2VA 4O1AA 3G1YA 3L0NA 2YCEA 3S8HA 1B9BA 5DCBA 2TRSA 4LNYA 3QPYA 1QDSA 5HWMA 4E2BA 2PE4A 3TX9A 1WQ5A 5IBXA 4N02A 3W07A 4Z1DA 1V5XA 5EPDA 4QISA 3N2XA 5H91A 4IQLA 2WSRA 1ZY9A 3BV4A 2E6FA 2C0AA 1BKSA 1IXPA 3GNNA 2ALDA 1LDCA 5I3KA 3R13A 1OG0A 1N55A 4UFIA 1GT8A 2CFFA 3CM4A 3W1LA 1XBVA 2IQTA 4JYDA 1QOPA 3OG3A 1S5TA 3GYEA 3W7IA 3TC6A 3C2EA 4AWTA 1FX6A 1RQHA 5LKYA 5F1UA 4O0KA 2VEIA 3DBPA 3PSVA 1C8VA 3KRUA 3TH6A 4NXKA 2QUUA 3P80A 4MVAA 5CZTA 1W1ZA 1QCWA 1LP6A 3SGZA 3OA3A 4Y9AA 5HJLA 3GXPA 3W1UA 3GLCA 4B5NA 4RX0A 1FY6A 4I7VA 1A5CA 4O1BA 3E12A 4RV8A 3CWNA 2CU0A 1GZGA 1WBJA 1JUKA 3BGGA 3KX6A 3FLUA 4NNBA 4POCA 3OBKA 4FNSA 1PE1A 3K30A 3W7DA 3PM6A 1ML1A 4P61A 3NL5A 3QMSA 1SU5A 3M0ZA 2H8ZA 4J9JA 2Q8ZA 4A2RA 2OCZA 3QM3A 1EP1A 4OGZA 1JCMP 3QEZA 4UFLA 4DBDA 1KLYA 3H54A 4MFDA 4UXDA 1M7PA 1OFEA 3G1DA 2J9ZA 5G5IA 3RFAA 5EBUA 4IMFA 3W23A 3JRKA 4YMZA 3IRDA 3STEA 3SJ3A 1FDZA 4UR8A 4ZQOA 3O06A 3NEVA 3KVJA 2WSQA 6ALDA 1KLZA 4LY8A 3A23A 4LVBA 1TIMA 3CEPA 3G0XA 4O4WA 4K37A 2E5DA 1WDWA 4RJEA 1AMKA 4AMAA 3ABRA 3N73A 2GPTA 4BWLA 1JVNA 1NF7A 4ICNA 2QCDA 4UNKA 4UFHA 3TSDA 4CQAA 2QUTA 3W73A 3AJXA 3FYPA 3MHGA 4JXCA 4AWSA 1KW1A 3C8FA 1NFBA 1K03A 3STCA 2ZZ4A 3TQKA 2H6RA 1KTNA 1QPOA 2VFEA 3S5OA 1BEUA 5F1VA 3W1MA 4ZVJA 1G4EA 3VKJA 5U4NA 4WY0F 5AC8A 3UXAA 5LNSA 4FIRA 1VCGA 4QNWA 4A3UA 3V75A 1QOQA 1QPQA 2CLMA 3BLFA 3TMQA 4UTTC 3IIVA 3U2OA 4RXGA 2ZZ2A 3W87A 2TYSA 5K2ZA 1VYPX 1PCKA 4O57A 1GPWA 2V2CA 1PHWA 1WOAA 1BWKA 2J24A 2Q3OA 5HMSA 1OFRA 4UFJA 3SGUA 2GJLA 4WQ6A 5D03A 3TSBA 4HT3A 4MKNA 5D32A 1LLZA 5MHBA 3NZ1A 4ORIA 2I9EA 4IMEA 4P2VA 3NA8A 1ZHAA 4FXRA 5DXYA 5C55A 1T8XA 3NQ6A 3O6YX 3CEUA 5I3JA 5K3VA 1C29A 5E0KA 3HGRA 3EB2A 1SO4A 4JX6A 2ZRWA 3QZEA 5G2WA 1OF8A 5L6UA 2V81A 3G0UA 3M44A 5AN7A 4I9AA 3PULA 3L68A 3FS2A 3IEBA 4XZ9A 3W7LA 3QMTA 3MO7A 4GUGA 4MUZA 2ZCGA 3CHVA 2YYTA 3C6CA 1ZALA 2ZTKA 3TNOA 2CZDA 4ONVA 3C4UA 1A5SA 3EKZA 1AG1O 3MHFA 3BW2A 1TCDA 3O16A 3P60A 4TO8A 4WY0A 3KRZA 5D04C 1QPRA 3W1QA 1GVQA 2QCDB 2VXNA 1T96A 3C2FA 3C56A 3CLMA 5E1QA 4HKPA 1TV8A 4GJ1A 3P8IA 5FEPA 4GWEA 1FCQA 2JKPA 5AYYA 3JS3A 4NZFA 3UXDA 1VJIA 5F2MA 1H63A 1WV2A 3DFTA 2AGKA 1K8YA 2RHGA 3LI0A 5K9XA 2EHHA 2NUYA 5EY5A 3HPZA 3M5VA 5AB3A 2YXGA 1OK6A 3LHTA 4BI6A 1NVMA 1G67A 3P8JA 3DI1A 4XKYB 4UNLA 3R2GA 3GVGA 3HG3A 2GVGA 4MY9A 4FX6M 4WJEA 3R5EA 2OMAA 2VC6A 3STFA 1T0OA 1TMHA 1PVNA 3PBWA 5J5DA 2Y7DA 3TXVA 5BNKA 4NJGA 1Z42A 4NXSA 5HUPA 1TJPA 2CZFA 1QAPA 4HNVA 4N9CA 3LBCA 4LRTA 4N9EA 3GAYA 2O7SA 2ZRZA 1TTJA 4M19A 5LSMA 5BOOA 3M7WA 3RK8A 1AW1A 1P1XA 1SR9A 3W74A 3QH2A 4QAIA 1YYAA 1TPUA 2R94A 1IXQA 4PTNA 2NX3A 3ZR4A 2LLEA 2G95A 5LNUA 1FXQA 2C16A 2NV1A 4UFMA 1F2JA 1H1ZA 1KFLA 2ZA3A 3QC3A 4C1KA 1LROA 3P7YA 3UZJA 4Q32A 1PL9A 1QWGA 4GXMA 3L9CA 3TE9A 2TMDA 3DFOA 3WJSA 1L6YA 4EIVA 1RVGA 1GVSA 5IM51 5C2XA 5DXXA 3NAVA 5LHEA 1F05A 1F6PA 2DP3A 1TRIA 4NT0A 3H53A 1S3HA 4FNQA 2CLIA 4H3DA 5K7JA 4HSOA 2XN1A 2OT0A 3F4NA 2OT1A 3NL2A 4LVFA 4CNPA 2ISSA 2XN2A 2AQWA 3A5FA 4MY1A 4MJZA 1F6KA 3CPRA 3OVQA 3W2UA 4CCDA 1XC4A 1TPVA 4QJ1A 4AF0A 1NAL1 2A7NA 8TIMA 4MPQA 1DQXA 4WXYA 4JTFA 4QM1A 4JTUA 1PCWA 1JCLA 3UWZA 3N14A 5CZ0A 3B03A 2ABBA 3DFNA 2ZA2A 2EAWA 4HN4A 1FWWA 2NZLA 4O52A 2PRMA 3VCRA 3O07A 1AK5A 3NPWA 4AH7A 1RPXA 1ZENA 3CTLA 3C52A 4WZHA 1TPC1 3GNDA 2EKCA 2Y88A 1XKYA 1EUAA 4U28A 4JTTA 3SZ8A 5LGZA 3EKLA 3PS7A 4IMDA 1MEWA 1PS9A 3NR0A 3BO9A 1W5PA 1DORA 5G1YA 1KM2A 3G18A 3DU0A 4O11A 1HO1A 4FEZA 3MP5A 3ATYA 3G24A 4FX7A 1K7XA 4K36A 3GIYA 4NX0A 3WK1A 4N6FA 2V9DA 3W88A 3PB2A 2ZZ6A 1YXYA 1ZNNA 3ABOA 3OVRA 4ADUA 5KZDA 2ISWA 3R12A 4QIUA 3NM1A 4HSNA 1DBTA 4JIPA 1LYXA 3W7KA 2X1SA 4RR4A 1X1ZA 1VC4A 2WJZA 4YCOA 4HNUA 4O17A 2QEZA 5AHNA 3R89A 2C19A 4PC8A 1DKWA 3HOJA 2RFGA 4O1DA 4EVZA 4DBEA 3NQGA 2E77A 3W7OA 1MEIA 1JCNA 3IIXA 3QQ0A 5LNWA 1W56A 4W9TA 1EWEA 4JICA 1FCBA 2E5CA 1FWTA 3UQNA 3LCIA 2ZQ0A 2G96A 1MO0A 3BGJA 1GTEA 3CIXA 1RZMA 3TV8A 4YL2A 1VLWA 4Q33A 3W7RA 4XTIA 1B4EA 1J2WA 3LTSA 5CG7A 3HIJA 4DPQA 1GEQA 1IIHA 3LXCA 2CLHA 3YPIA 4AWUA 2E6YA 4AB4A 1NF0A 4EF8A 4LUIA 4IOTA 2WSYA 1RV8A 2QCCA 1KFCA 1R46A 3UWQA 5D37A 2E68A 5G2HA 5CKSA 1JQXA 3GR7A 1VCVA 1VR6A 1Y0EA 3FJ6A 4S2BA 5I3HA 1L6WA 3THAA 1W5QA 1YPFA 1YDOA 2YW3A 4ZMGA 1ICSA 3N3MA 3SFKA 3PR2A 1LOQA 4GC4A 2FDSA 2R91A 1FWRA 4S1FA 3TJLA 1JCJA 1Q6OA 3N2MA 2ZZ5A 2NWSA 5F4XA 3TQ0A 1P0NA 4MIMA 5D05A 2CLLA 2B7NA 1N7KA 1OFOA 3B0PA 1EUNA 4EWND 2C1HA 1YTKA 1TTPA 2R8WA 3VI2A 3NYZA 1FWNA 1W3TA 1CX9A 4O16A 2B7OA 5D30A 1W31A 4HNTA 3BK0A 2VEKA 2BX7A 4GUJA 5D38A 3RLVA 2VEPA 4NZJA 3AO0A 2A21A 4NQ1A 1I45A 4OWGA 3E96A 4UMCA 4LS1A 1Q45A 4M6QA 1GG0A 3MP3A 2ZTJA 5DY3A 3P5ZA 1XUUA 7TIMA 1OYBA 1SFJA 3NQAA 1P4CA 4XQ6A 3LXBA 4RZ6A 1WYIA 3QRHA 4NX5A 3C3NA 1KFKA 4OE7A 6TIMA 1TPFA 4Q4KA 2ATSA 4QNEA 5F2IA 3FA5A 4RXFA 1AL7A 3G1AA 4PEKA 3U8GA 1OFDA 5FF4A 1N8FA 3LCGA 1U5JA 3BARA 4BFAA 3ABSA 1O95A 3I7QA 1LRQA 1QO5A 2B4GA 3OEXA 3DHFA 3GR8A 1UJPA 4A22A 1UUMA 3N9RA 5KZMA 2BSLA 2V82A 3KFTA 3S1XA 5AFDA 5FF3A 3VFLA 3NQVA 1I4NA 2A6LA 1QFEA 4IX0A 2Q8LA 3S5ZA 3W71A 1R30A 4L4LA 4IJBA 2FPVA 1FDJA 1I2OA 3UYCA 1ME8A 3W1RA 2VFHA 4TMBA 2BTMA 3DH7A 1FUYA 4O28A 3C61A 1OF6A 2WNQA 3W6YA 2GUUA 3NQMA 1IF2A 2FQIA 2QKFA 3E0IA 4OT7A 1OYCA 4X2RA 4E0CA 1JJKA 2QF7A 3DXIA 3MBDA 4XBKA 3LERA 1SUXA 4O53A 1XBZA 2FTPA 3Q94A 1DVJA 1Q6RA 5AC7A 5HUOA 2E5BA 5K4ZA 2Y7GA 3PG9A 1JQVA 3E9AA 2AAMA 4GFSA 3HGJA 3G8RA 3QMRA 4BR1A 2V5BA 4PL2A 4FB7A 5HULA 3L2IA 1SSDA 1CW2A 3W1AA 1H51A 1BTMA 5D2TA 5CSSA 3S5NA 1TQJA 3BPWA 3P82A 3LX9A 1WA3A 1I2QA 5KTLA 2GOUA 2V30A 3M43A 5FF7A 3W1NA 1SZNA 3MYOA 1TRDA 3SIZA 4AF0B 1DL3A 2B7PA 1HUVA 3L0GA 1F5ZA 3CIWA 3NPXA 3LHYA 1VHNA 3CQ0A 1W0MA 1AL8A 2X16A 3D0CA 4FF7A 3HO8A 3RNDA 3TJXA 3TDFA 1VGAA 5DN1A 2QDHA 1EIXA 4UUIA 3SY5A 4Z1BA 2ZRYA 2W79A 3P62A 2W6RA 3W70A 5KMYA 4X9SA 4UTIA 3LI1A 3G1FA 1Q6QA 5A5WA 1O94A 1S5WA 2DZSA 3UPBA 4DXVA 3NQ7A 1IIGA 3MUXA 1S5VA 4GUFA 3NQDA 2YZRA 3LCLA 5AHFA 3PWAA 3EEGA 4UMBA 5E93A 3QW4B 3C2RA 4IXHA 1QNVA 3G3DA 4R34A 5K9DA 3O15A 3DKLA 2VEMA 3EXTA 1TTQA 3W2NA 3B0UX 2ISVA 3PUOA 4AHQA 4DELA 3FJLA 1H7WA 4FXSA 3B04A 5G1TA 3A22A 1OFAA 3TMLA 3TKFA 3PBVA 3USBA 1QO2A 3NOEA 5K4XA 2ZYFA 2Z1BA 3NNTA 4OU1A 1KTCA 4WXZA 3BVJA 4DO6A 4IWWA 4AEOA 2WQPA 4N9DA 1EB3A 3LV6A 4OQVA 1TPB1 2X1RA 4JX4A 3LRLA 4PODA 2A7PA 3LHZA 3RLUA 2C6QA 1VPXA 5D2WA 2X2GA 2Z0IA 1G7VA 2HTMA 3IGUA 3BG5A 1SW0A 1ICPA 1LBMA 4MZ1A 3M47A 4WOQA
chains in the Genus database with same CATH superfamily
3PTQA 1ISVA 1HW6A 4PUWA 4ZXOA 2OODA 3GKAA 4I8YA 4US5D 2PDYA 4XKYA 1BHGA 3DGBA 3E0WA 1O68A 2YJQA 2WM1A 3NPUA 2NLIA 4A3YA 3QTPA 2GQ8A 3FJNA 2YA1A 3O6AA 3VABA 3EWXA 4O1FA 3DERA 2CBVA 2AL2A 1TG7A 4PEEA 4FNPA 1YHTA 2OJPA 2Z24A 1VEMA 1KRCC 4JDYA 4BQ3A 4LRSA 4BCEA 3SM0A 3KDOA 3OLEA 1RP9A 1HGYA 1XRSA 4GYKA 1MDRA 2VUNA 2GK1B 2V2DA 4KWSA 3I6TA 4UCGA 4GQQA 1OT1A 3EWBX 2BP1A 1UR8A 1K9TA 2HV5A 2QNEA 3LRMA 3WQDA 1E6QM 3FAWA 5G4WA 5DRCA 4X22A 4PZVA 5C8BB 1A49A 2D73A 1UR3M 2CKSA 3HMJG 1XLKA 2PDCA 2WMFA 2OB3A 4Q4SA 2Y6ZA 5AHIA 4Y6GA 3MSRA 2Z6JA 5FA5A 3WK0A 1H1YA 4X60A 5D02A 3M0YA 2CLPA 2F6UA 1VJSA 1PX4A 1NTHA 3EYPA 1H7OA 1N82A 3B8VA 1ZAJA 3WQFA 4W5UA 2OWWA 1CZ1A 2ZC8A 3DYPA 5JU6A 1AW5A 3SCUA 4Q7BA 3ZYZA 4B4FA 3USZA 1ZP4A 3R8GA 3FIGA 3W4RA 3W25A 3TWAA 4C6LA 1MI3A 3HB9A 3FW6A 1U5VA 2JIWA 4D71A 1KXVA 1KM4A 4Q8PA 1VZWA 2WWDA 3V36A 3W2JA 2WMHA 4DJFC 3VD9A 1JR1A 2WXDM 3W27A 2VFDA 4P7RA 3LYEA 2DQWA 1GVIA 4KRUA 3UG4A 2JGQA 4K8HA 1J12A 3VXGA 4TIMA 4UTLA 2W0UA 2V5JA 2J6VA 3UR5A 3B0VC 4MOZA 1FBAA 2IKGA 4CEUC 1OC5A 4LC6A 1UZ1A 3F1QA 4K3ZA 4AXNA 4JFUA 5B80A 1UIOA 3TW9A 1JPMA 3WO8A 3W81A 2DJLA 1KRAC 1GQNA 1TPH1 2OOGA 4NJKA 4O8RA 3WSUA 5IXEA 3CMFA 4GNKB 4LBUA 4WDTA 1PIIA 4K1WA 3T8LA 4F0RA 3KAOA 3IARA 4JDBA 1O12A 1KD0A 2BBFA 2VURA 3L12A 1VRDA 1LQ0A 2C0HA 4OHQA 4JTRA 1S2TA 1NFPA 3E2VA 3PBGA 3QZAA 2VELA 3QGKC 3GTHA 1T7LA 3M16A 4B16A 4W86A 5HAOA 1E0UA 4H9ZA 4ML4A 1KR1A 3TZFA 1O5XA 3G1XA 1MRQA 3P61A 3LA4A 4JTJA 2FKPA 2NXHA 4NZ3A 4ATWA 5I78A 3UJSA 4NAFA 4E8CA 1C7SA 1XRVA 3H22A 2Y85A 1YE6A 3BJFA 2ZZ7A 1XP3A 4MYXA 1IEXA 4J7RA 1P6CA 1BXNA 4PTXA 3P0WA 3VGEA 2RKXA 1GKPA 1ICQA 4ADTA 4B5XA 3CZJA 4J3XA 3NQEA 4PB4A 4CQ9A 1PZ1A 1OGGA 3T78A 4XV0A 2E8ZA 4FO4A 4LAUA 4YU1A 4PH6A 3CPGA 2QCMA 2RDXA 4GZIA 4A8IA 1FDYA 3AIUA 1V0NA 2WJEA 3R6IA 3WLSA 3PJXA 3KVKA 9XIAA 5M3WA 3PTMA 5JH1A 3FV9A 4PMUA 2D0GA 1D8WA 3HQ1A 4H7VA 4ZFCA 3M7SA 4C6JA 1JYXA 4UB9A 1BYCA 1SZEA 1XYBA 3VD7A 3W7QA 1VPYA 1ZAHA 4B2DA 3G6LA 3F03K 1MW3A 3OBEA 1U1JA 3E3HA 5JBFA 3ANYA 4MWAD 2ZX7A 3A9IA 3BG3A 1QPNA 3VM7A 5AHMA 4C6KA 1TZ7A 1BG9A 4X63A 1MZHA 2PTXA 2C79A 2CBUA 2G97A 2UV8G 4JIQA 4QP0A 1VCFA 5I6SA 5DBUA 3SIMA 1MW1A 1HN1A 1POKA 3EX6A 1A5NC 4NU7A 4H6KA 1DJXA 3LXAA 4IPLA 3VIHA 3GRIA 6TAAA 5C9ZA 1UCWA 3E6EA 1R2RA 2J7DA 3WDPP 3BC9A 2YXXA 1XLHA 4DWSB 3RCYA 3FHAA 3KL5A 1EGVA 2A3EA 3W7NA 1C9DA 1JCTA 2FFIA 3TTQA 1EJWC 4R33A 3LV5A 4Q8NA 3GIQA 3H55A 4BQ4A 5D2XA 2OZTA 5FESA 1TIWA 5AOUA 2H9AB 3BAKA 3S9YA 2XGIA 4PRTA 1GW9A 3HV9A 3APYA 4CU6A 3CV1A 3AHXA 2W4XA 1EBHA 1VLIA 3UCDA 2WNNA 5LHFA 1E9YB 4XSLA 5FJJA 1WDSA 2D2JA 9RUBA 1UD3A 3GZ3A 5BYWA 3R4IA 1FWJC 3N1AA 2ZZ3A 1A4MA 4PCFA 4AD3A 1J4EA 2FYMA 3DFQA 3QGVA 4B5VA 1UZDA 2PCQA 3PZMA 1H1NA 3G1HA 4HNCA 4JTGA 4D8ZA 2JKEA 3ZMRA 3E5PA 2FLIA 4KWOA 5CJNA 4CGTA 4AISA 4IZGA 3OLDA 3CASA 3HPFA 1GOXA 2R1MA 3HG5A 4HOZA 2WMGA 2WYSA 2Y8KA 4PTMA 3O0KA 3CJPA 2NQ5A 4RNIA 4TR9A 1DP0A 1X7FA 5C6MA 5PTDA 1LQAA 1WX0A 2PRLA 1EBGA 1OFQA 3S2CA 1XCWA 1G94A 3Q37A 4DLMA 3SECA 4GYJA 3IUHA 2EG7A 3BLKA 5CC6A 1RLDA 2HE5A 1UWSA 2NQZA 1QRQA 2OO0A 2OFJA 3UJRA 4WF7A 4E38A 3WEOA 2WVVB 3W01A 5XINA 2Z1XA 1RQEA 2ABAA 2WO5A 1M5WA 1IR1A 3RG6A 3URQA 5A6BA 2DZPA 3S6DA 3UY7A 1MYRA 1QU4A 1ZS2A 4FHAA 1I0BA 2PFHA 1H0GA 3WLKX 1G6CA 4UTJA 3FYOA 1LRNA 3TYBA 3LTYA 4PBGA 5HNRA 3SR7A 3W1TA 4MM1A 2ZUNA 3FYYA 2FHCA 4YS1A 1TMQA 1X6NA 4Q4OA 4XAFA 2ZC1A 3CWOX 3KCOA 4X0VA 3MVTA 3CU2A 4DB7A 3PC0A 4M6VA 1XLDA 2PWDA 4CD6A 1Z44A 3VE7A 5GJNA 2PF8A 4NHVA 1XIBA 3RITA 1X1OA 3KBJA 5GVJA 4UQAA 4QE1A 2D1ZA 1DJHA 3OGVA 4GUHA 3V0SA 3K13A 2JEPA 1H09A 4DUXA 4ADSA 3ARVA 2YKKA 1UR0A 1A5LC 5A8GA 8CGTA 4CLMA 1EFZA 1M7JA 1SO6A 2PD9A 5E9AA 5EL1A 1Z3NA 2D23A 2XGZA 5CG0A 3N6QA 4TTUA 1J2BA 4GE8A 4O12A 1WE5A 3FA3A 4RCXA 1ITUA 4C6MA 4HPGA 2BZNA 4LT9A 2Q3RA 3TC7A 2HMCA 3PB0A 1OX4B 3AUOA 4ZQCA 1OZQA 1ZJBA 1PKYA 4GI9A 4AD0A 3P6LA 3TROA 1EC9A 3GUWA 4W7UA 5I24A 5EB8A 2QJHA 3W24A 1XYAA 4Q8MA 2TSYA 3KL3A 2F6XA 1LRTA 3AIRA 3OA5A 1XHGA 2X42A 3P81A 4H00A 2IKJA 4XBSA 2Y1HA 3BQ5A 5CPOA 3VGGA 3RF9A 1XCXA 1OJXA 1FHDA 3PF3A 2E6AA 3ZWSA 3CAVA 5TIMA 3RUBL 2W9MA 2Q09A 4XX6A 4A05A 4TX9A 1VS1A 1TVLA 3G6MA 3TVAA 3QV8A 4JCMA 2XFWA 2XVLA 2FGBA 4L6HA 4UIOA 2OG9A 4N9BA 1ZB5A 3ME3A 2QJNA 3WUFA 3BLEA 4C90A 4M5PA 1H7RA 2DUZA 4MTVA 3QYSA 1E0WA 1MMFA 3PPFA 4LVDA 1F76A 2B7QA 3LBMA 1EH9A 1F3EA 1HFBA 5C54A 4L4OA 1H60A 1US2A 2WVSA 3H4WA 4ZL1A 1JCYA 3LOTA 1JDAA 4G1KA 4H9YA 4AZHA 3PPGA 3WMBA 3STGA 3EPOA 4REQB 1FXPA 4Z2LA 3ARRA 3T9PA 1W37A 2QIIA 4GY1A 1EP3A 2P3ZA 3BAIA 3CMGA 3WQPA 1E73M 2QMJA 3WH6A 3WQVA 4GBUA 3DIPA 3WBEA 4GZEA 3EX3A 2NX1A 3R1ZA 1JDCA 1AUSL 1T8QA 3I6RA 1T40A 3L21A 1SZFA 4GQ0A 2HRWA 3A47A 3QHNA 3KVMA 3LB0A 1GG1A 2FH6A 4ZBCA 3SRHA 4NI8A 2J8GA 2XPKA 4WOZA 1EA0A 2PDIA 2C7FA 3F2DA 2JALA 1EX5A 2X1UA 3N4AA 2F6KA 3ALGA 2Y61A 2F2KA 3M6YA 4GNJA 5BRPA 3GK0A 4FIQA 1OCBA 1GWJA 2QAPA 3PNUA 5DCEA 5ABFA 1LM1A 4JIEA 3SBFA 4Z0JA 3T0DA 1XV8A 4UTWA 4B5TA 4NIRA 3ES7A 3EDJA 1UUOA 4Z0SA 3GD6A 3A21A 1RVKA 1IGSA 4GVFA 3T2QA 4E8GA 2J9XA 5IFTA 2Y63A 2A1YA 4QSHA 4MWAA 5CC5A 3NSMA 4XWUA 4GC3A 2ACSA 4C5ZA 5FF0A 3SB0A 4M24A 3MKVA 1O60A 3AXHA 3NSNA 1VBUA 1XD1A 3CUHA 4XTDA 3CPUA 1R3WA 3CK5A 4GBDA 2CLKA 4AMCA 2IPWA 4CN6A 1TV4A 1ONRA 3OVPA 4Q8VA 5BWFA 4DYEA 1NSJA 2BHUA 2NXIA 3LSCA 4AD1A 3U9IA 3Q2DA 4WUIA 1BKHA 3ABQA 3CZKA 2O9TA 5LGXA 3C86A 3DFYA 3SFWA 2Z29A 3TJIA 2X8RA 4DPPA 3PWGA 3QFEA 1XQLA 1RXOB 3EXSA 3W2KA 1HL2A 1YPXA 4FNTA 2G50A 2HSAA 4ZQMA 2G3NA 1E6NA 1SJBA 1VAHA 3G1YA 2GSJA 3FSTA 1B9BA 4NYUA 5DCBA 5C70A 3PBMA 2PE4A 3TX9A 3N11A 5I0DA 5IBXA 1EDTA 4PB3A 2VD9A 1XF0A 5H91A 3H2FA 1ZY9A 4PMJA 2E6FA 1XIEA 3H2AA 3RRXA 3WNLA 5GJMA 4C7DA 3LQLA 3SSZA 3SY1A 2I5QA 3BCDA 3R13A 4WDUA 1N55A 4UFIA 1OADA 1D7FA 4PSRA 3GU2A 2CFFA 3TOPA 1KGWA 4J2PA 3CL7A 4DM1A 2WLZA 3W1LA 3RPTA 3NXLA 3N4EA 1CEOA 1K9EA 1R3VA 4AWTA 4LF1A 5AY7A 5F1UA 1OINA 1TA3A 4AFYA 2ADAA 1CYGA 1FWDC 1SMAA 1Q63A 4E2OA 3P80A 3CIVA 2PA6A 1HKIA 1SJDA 3KBMA 1XKJA 2FZBA 1LP6A 2VRKA 3H2EA 4YN5A 3GXPA 2IUZA 1TV2A 3THCA 3W1UA 4CNTA 3VUPA 4WSHA 2Z28A 3UT0A 1S2WA 2E25A 3CYVA 3E12A 2CU0A 1GZGA 2QVNA 1WBJA 2PGEA 3KX6A 1WKFA 3FLUA 2V68A 4KF1A 3K30A 3PM6A 1ML1A 3NL5A 3M0ZA 1JEZA 1RH9A 4J9JA 2MANA 3KCLA 4A2RA 3UETA 2CNCA 1IWAA 1I1WA 1S5NA 4LEFA 1JCMP 2WW5A 4DBDA 3V0UA 2UY5A 3H54A 5AC5A 3EMZA 1O7AA 4UXDA 1XICA 3G1DA 1FVPA 5C9XA 3JRKA 1HL9A 4ZQOA 3O06A 3NEVA 5IHSA 1KLZA 1TIMA 3CEPA 3EKGA 3WBWA 1QW8A 1WDWA 3ABXA 4AMAA 2Z4GA 3WF2A 2GPTA 1NF7A 4ICNA 3KL0A 2PS2A 4QS6A 4UNKA 4UFHA 2AAAA 3HZ3A 3W73A 5I79A 1UWRA 1S2UA 1K9DA 3C8FA 3EB3A 3BZGA 5C9WA 4ZA0A 1UKSA 1K03A 2Z00A 3IS4A 3STCA 2ZZ4A 2H6RA 4HYWA 1C7TA 1Q2RA 5F1VA 5BOFA 4ZVJA 4XO6A 5AC8A 2Y8UA 4S3EA 4C6PA 2XVPA 3OZYA 3V75A 2QYGA 3RDKA 1QPQA 4W7WA 2CLMA 3TMQA 3IIVA 8XIMA 1RY8A 1YX1A 4GJIA 4AD4A 1PYFA 2J75A 3CL8A 4H8NA 3S4TA 3S2NA 1E0XA 2VQTA 1PHWA 4C6FA 1RP8A 2Q3OA 5HMSA 2OTDA 1OFRA 4UFJA 4ZTXA 1HJWA 3C8NA 4MKNA 3MANA 3GZAA 4S3FA 3THUA 2HNHA 3NZ1A 4GYFA 3W6MA 2XH7A 3NA8A 3ANVA 1ZHAA 1W8GA 4FXRA 3URNA 3S6TA 5C55A 5I3JA 5K3VA 1MXGA 1K77A 1E6ZA 3KDNA 2ZRWA 3UR2A 3APGA 3D3FA 4QR6A 3G0UA 3PULA 3KHDA 3L68A 4XZ9A 4R3UA 3MO7A 4GUGA 1A4LA 2ZCGA 4UOJA 1HNYA 1ZALA 1HXJA 3K46A 5CBJA 4TVCA 3ITCA 1KBBA 4RDZA 1HIZA 3W82A 3EKZA 1AG1O 1C9WA 4TO8A 1V51A 1VBJA 3BCJA 4U31A 1AODA 3ENLA 1V3HA 4HU4A 2QCDB 1V0MA 2VXNA 3C56A 3CLMA 4F9JA 4DAIA 3BLOA 5LYRA 1W1PA 2WZIA 1TV8A 4MPKA 5FEPA 3UERA 4Q6JA 4WK9A 1FCQA 5BXRA 2JKPA 2HNEA 4KT2A 2GGEA 3D46A 3GVQA 4L7ZA 3LI0A 5K9XA 4NILA 2BV9A 1GUVA 3GTFA 1RHCA 3HPZA 1W9VA 4CQCA 5AB3A 3DG3A 1OK6A 4GZ7A 1DXFA 4PUEA 1G67A 1A5KC 3VKCA 1QW7A 3P8JA 3DI1A 4XKYB 3ARYA 2GVGA 4WJEA 3R5EA 1QPKA 1T0OA 1CNVA 3AOFA 3PBWA 5J5DA 5BNKA 1Z42A 4MSSA 3G77A 3F2CA 6ENLA 3AI0A 3VNZA 7TAAA 3E5BA 3E2SA 4L1XA 3WLMA 4UR9A 4U3CA 2DUAA 4Y7EA 5BOOA 3M7WA 3RK8A 1RLCL 3W74A 1HKKA 4QAIA 1YYAA 3W02A 1WUFA 3ZR4A 3VIPA 4QRNA 3MO4A 2G95A 3RHGA 1FXQA 2JEQA 3TN5A 4H01A 1F2JA 1AH4A 3N15A 2BGQA 2OGJA 2V38A 4D8LA 2GGHA 3AS1A 3GS6A 3TE9A 2TMDA 3WJSA 3CH9A 4OUEA 3V4BA 4M82A 1F4AA 3H53A 4FNQA 2CLIA 3BMXA 2OT0A 4PMVA 3IWPA 5CBIA 4CNPA 2ISSA 4MNKA 3BCFA 4MKSA 3VGBA 3E74A 2GGJA 3SO7A 2P3EA 4CCDA 1XC4A 1BAGA 5M1TA 4XAGA 1NAL1 3TZNA 4WXYA 2WKLA 3UWZA 1IQ8A 2ZA2A 4HN4A 1FWWA 3IJ8A 4O52A 5C9UA 4AW7A 3WDQA 2UWFA 4AH7A 3RYSA 2XVNA 4WZHA 1H3GA 1Q6GA 3VZZA 1NU5A 1TPC1 3RR1A 2CXGA 4LEQA 3MCMA 3ARQA 2PF0A 1YW1A 4U28A 1OWQA 5D9OA 1NOWA 1S2VA 3EKLA 5B7YA 1JG9A 2TODA 3NR0A 3EWDA 1J6OA 4L56A 3E2QA 3G18A 3IJ6A 1US0A 2P0IA 1E4NA 4PMXA 4K36A 2HK1A 4I90A 3KOYA 1CXKA 2XIQA 4QCEA 4QLLA 2V9DA 3PB2A 4C6CA 5KZDA 4QIUA 4AY8A 3NM1A 4S3KA 1ZBWA 1LYXA 1EDGA 4RR4A 1AD4A 4JN8A 2WJZA 2GL5A 4IJCA 4Z2HA 1B5TA 1PAMA 4R88A 1GONA 3HOJA 3QLDA 2E77A 4AZGA 3W7OA 5LNWA 4W9TA 1NQ6A 2D0FA 4LAMA 1FWTA 3UGVA 2MNRA 1EEXA 1VLWA 4Q33A 3W7RA 3QHMA 4QGCA 3LXCA 4UQCA 4H19A 4A4AA 1F9CA 1I6NA 2WSYA 1RV8A 1KFCA 3AS3A 2X09A 3T1GA 5D37A 2E68A 1ODUA 5G2HA 5MKGB 4DZAA 4FF5A 4FOJA 1VR6A 1Y0EA 2OSXA 4O1EA 3PNZA 2JE8A 4ZMGA 3VILA 2OU4A 1ECEA 3R8HA 3T07A 1HT6A 2R91A 4S1FA 5A8NA 5DF0A 1YNYA 2ZZ5A 2NWSA 2EPKX 1EUNA 1MW2A 1YTKA 5C0QA 1W3TA 1CX9A 3C0SA 4AWEA 4EXBA 1TV3A 3WH8A 3KS5A 2VEKA 1W3KA 3GM8A 2OVLA 2A21A 3AO0A 4NQ1A 5D8ZA 1Q45A 1UROA 4M6QA 1XC6A 4IIDA 3VNYA 1XUUA 4DXKA 1P4CA 2GOKA 3LXBA 3ITTA 5EMMA 1WYIA 1BXCA 3C0QA 4IFOA 5A3HA 2EPOA 1G01A 2HPMA 4PBFA 4RXFA 3CQHA 3G1AA 1EPVA 4RUBA 5FF4A 4J4KA 1U5JA 3BARA 1V03A 3GXMA 3I7QA 1O95A 3AALA 4GVGA 4F0MA 1JDEA 1KQZA 3TYZA 4A22A 4ILSA 3KZPA 3ZR5A 1N8WA 2V82A 5HANA 3A13A 1ENUA 4MHBA 5AFDA 2QZRA 4QROA 3VD4A 3W37A 2XM2A 2Q8LA 3S5ZA 4H7ZA 3U4AA 2FPVA 3AIVA 1PZ0A 1I2OA 1ME8A 2VFHA 4J27A 3R43A 2XSBA 1UD4A 4H6QA 1FUYA 4QE5A 1V6TA 3C61A 4XD3A 3M64A 3RPMA 3O2LA 2Z7GA 2YCIX 4OT7A 4IM4A 1E1FA 4FMVA 3EA3A 4O53A 1RK5A 1YKWA 1IR2A 4N7QA 4HGXA 4B3LA 1DVJA 3WKZA 1OC6A 4XD6A 5HUOA 2QPXA 1JFHA 2X7VA 3Q4DA 4D6JA 3E9AA 4GFSA 3HGJA 5DEZA 4F4RA 3P3BA 2V5BA 1FHVA 3VCCA 1MZRA 1LWIA 3BAJA 3LUTA 3C5QA 4KWUA 1TWSA 5CSSA 1IEQA 1I2QA 5KTLA 2GOUA 4LAOA 2VD8A 3TQPA 4P7OA 3W1NA 4AF0B 4P8VA 5MF5A 1FH8A 2BHYA 3NDYA 1VHNA 2X16A 1AL8A 4M51A 4XZNX 4US6A 4D72A 1P0BA 3B40A 3OB8A 2W79A 3P62A 2P5NA 4PRWA 4KEUA 4GQRA 4X9SA 3LI1A 3G1FA 5A5WA 1HJXA 5EMJA 1S5WA 2PODA 1HVXA 3NQ7A 1IIGA 4GQGA 5EFFA 4QEHA 3KEHA 2INEA 4E3TA 4R34A 4ZE4A 3EXTA 3PPHA 4PCNA 3B0UX 3PUOA 4AHQA 1EF3A 1GVYA 4Q4MA 3B04A 1XGZA 3K8MA 5DANA 1E6SM 1E55A 3USBA 1FP9A 2PDJA 1QO2A 3SQSA 4F0HA 5AKQA 5FJOA 3RILA 3MMUA 4N9DA 1E70M 1S2CA 3QY6A 1WZKA 1VPXA 2J7GA 1U1HA 3S2LA 3RMEA 3M0IA 3H21A 3RCNA 4MZ1A 2VC5A 4WOQA 4HHPA 1BVNP 4HHHA 3BW3A 4H8VA 4KCUA 1YTDA 4L9YA 4GY0A 1TREA 2NQ9A 1DHPA 3S6OA 1UYQA 4LOCA 3W22A 1W91A 1TELA 3GAKA 1H41A 4MDOA 4HHLA 5H6HA 1W5MA 5BRBA 4DJEC 1UWAA 3A4WA 3UZXA 1F3XA 2BHZA 3AROA 4INFA 2QHAA 2CETA 3S3GA 2D69A 1E4LA 2J74A 2P0OA 2WQDA 4Y9OA 5LNRA 3TYCA 1JGMA 2WBKA 1BWVA 3AMDA 3B0YA 3GY1A 1PKMA 4Y90A 3WK2A 1KM1A 1DXIA 3FXGA 4JQ3A 2C3ZA 1IV8A 2YSWA 4C6NA 1GYLA 4IUGA 1CI1A 3WZ0E 4OV9A 3UY8A 5HATA 1DHKA 4HU8A 4C6BA 3CC1A 1ZAIA 4JYFA 5A6TC 3F5KA 5G1MA 1EC8A 1R2SA 5J8LA 2GQAA 4U10A 3RM9A 2VZOA 1MEHA 3DESA 2W61A 3UWEA 1WXJA 2O9OA 3UD6A 3RJYA 4TV6A 1XLFA 3UWYA 1DJYA 3PAJA 1AQHA 1W9XA 2A3BA 4AHOA 3CAQA 3EX4A 4JFVA 3M46A 3DHDA 2BVTA 5IBXC 3NDZA 4DF2A 2Y62A 1LLWA 1OX4A 3CHEA 3GDTA 3KLKA 2JFEX 4W8AA 2PU0A 2WCAA 2CESA 2Z6IA 1UQYA 4DEFA 1OGBA 1OCNA 3U5YA 2GWGA 4DX3A 4A29A 2Y24A 1OBAA 3FFSA 3O9NA 1QTWA 3IJ9A 1K4HA 1K1DA 3W72A 1K9FA 3T8QA 4H8HA 2DVUA 3WFLA 5A6KA 2NUWA 1BG4A 1E56A 1EJXC 3I68A 3MP4A 4B5UA 1KTBA 1VF8A 4JTAA 1HKMA 2YPIA 3E0LA 3OHIA 4KS0A 3KWSA 3NO5A 3DYMA 1TPDA 2ZXBA 2UY4A 4S3CA 2QT3A 2ZUUA 1A5AA 3Q65A 3BURA 3VU2A 3NG3A 3NUKA 3VTRA 5BMWA 1RD5A 3II1A 1JULA 3OPSA 3GDLA 3BWWA 2XZ9A 5DO8A 4YXGA 5I06A 1R9YA 1Z89A 4DWSC 1OK4A 2A7RA 1ADOA 2E7FA 3CHDA 2CZEA 4H83A 2J88A 3H8AA 2YLAA 1LWJA 2WPGA 3S1GA 2DIEA 3GFYA 1MRAA 5A1AA 4O13A 1JUEA 1W2PA 4FLQA 3IV3A 4JFWA 4NI3A 2D24A 2OGYA 5C5YA 2E8YA 4XZLX 1P0EA 1D3GA 3N18A 3ZO9A 3V7PA 2YFNA 4IPJA 1CGYA 2L5HA 5CZSA 2I1OA 3B0XA 1NELA 3TAOA 4HSHA 3SW6A 4UTFA 4MMWA 5FI8A 3V5OA 5LXXA 2DV0A 6REQB 3H70A 4DO4A 4IH3A 3ZZ1A 3W85A 2OQLA 3IVSA 1QATA 3EWWA 2G3JA 3UA3A 3DHUA 2H3DA 4FXJA 3ARSA 1RK6A 1BWLA 1QNOA 1VD6A 4E4UA 1QMLA 3L5AA 1H7PA 1TPWA 4A35A 1WDDA 3GVRA 1UKTA 3U5UA 1O4UA 2ZDRA 3VIOA 1XRFA 3S9IA 4WCJA 2QJJA 2FB3A 2WPBA 4QLJA 4WEVX 1UOZA 3S47A 2PZNA 5FJTA 4Z08A 1MFUA 1J10A 1XL9A 4O8AA 4DYKA 1DJWA 3WL0A 3WBXA 1KCLA 1B3ZA 1PKNA 3L65A 4J40A 3ZT7A 2GFTA 4ZO7A 4TOQA 1B9ZA 1GYMA 3GDMA 3VIKA 3ISIX 4DQWA 1K02A 1RJRA 2HS6A 3VE9A 3GH7A 3WUEA 1VQTA 2QV5A 3EDDA 2QJGA 4HK5A 4S2CA 3P5YA 2YCLB 4PMOA 4PUDA 3AIBA 4XZWA 3SRFA 2E09A 1Q2SA 1F8MA 3TK7A 4QFUA 3LZ3A 1PXGA 2XIIA 4JYEA 3QSRA 1R3YA 4IX2A 1E6RA 1ISZA 1V0LA 3G1VA 1GYNA 3CV2A 1JNDA 3ARWA 1GOIA 3M0JA 3GBDA 4ZENA 1SW3A 4O15A 2J27A 4GISA 3W2MA 1ZJIA 4LAZA 2YDAA 1OX6A 1VHCA 5IFPA 2BY3A 2YDRA 1Y7VA 4MZ8A 2VZSA 3WMCA 4AZCB 2OPJA 3F7JA 2HPIA 2CZVA 4FPSA 3A3HA 2DJXA 2ZA1A 4AVOA 3MB9A 4IXXA 4FA3A 3UPWA 4NKCA 3GB6A 3WD4A 2YL5A 3VINA 1W3NA 2QF8A 3HMCA 3S1WA 5E0FA 1A0CA 2EF9A 4ZSTA 1Y5VA 4PUUA 5D33A 1K7FA 4F9DA 1SJCA 3PUDA 4DJDD 4I7WA 1VFSA 2X0YA 3T05A 4IUOA 5EA9A 2A6NA 4A8LA 2OYMA 4UR7A 3QHOA 3QPZA 1V7YA 4MFEA 4TXEA 1KCKA 7REQA 5FF2A 5DELA 2H3BA 1U22A 3T08A 2J8TA 1AA1B 1SPQA 5EGRA 2PDGA 1E3XA 4GABA 1AFSA 3LCWA 4H4IA 1YNPA 3TFXA 3W9ZA 5BMXA 4IGMA 1TJ0A 1V79A 3NPVA 4WGHA 1GVFA 2ODOA 2GGGA 3HA1A 8RUCA 4AEFA 4KFPA 3LZ5A 2DVTA 9CGTA 5TNVA 5CCZA 3NVTA 2JK2A 5GNZA 2YLLA 5F2LA 4F0SA 1TR9A 3I7RA 1KFEA 4WKHA 3TCEA 1HKVA 2DSZA 1JUBA 1UH3A 5G4HC 3QF0A 1I2PA 3WFAA 4YLWA 2XG9A 4PMYA 4DWDA 4RLIA 3KOXA 1DV7A 3F4DA 4ERGA 5FJRA 2ZE3A 2NUXA 4ZQRA 7XIMA 2A5HA 2JIEA 5I3IA 1GK8A 2TPSA 2NVCA 1JGIA 3QSTA 1ITCA 1I8JA 1EIBA 5E0CA 4JTDA 2YBUA 1ITQA 3HF3A 2QIWA 5I5RA 4RW3A 4P7QA 1W2VA 3ZLFA 4F3HA 3T4CA 1RUSA 2Z1SA 1O1HA 3N34A 1YQ2A 2AKMA 1WKYA 2QUVA 4LS0A 3WNOA 2W63A 5C9RA 1E43A 1TE1A 3LNPA 2JGYA 3EMCA 2PTDA 4BJHA 4ZGYA 5CGQA 1N8IA 1NDWA 2CZ5A 1PYMA 1NDYA 2OZ3A 1LCOA 4ZR8A 1QNPA 4KIEA 3W7EA 4CKQA 5D9NA 3VNIA 4A8RA 2PDWA 4LCSA 1J6PA 2VHLA 4BQ5A 3IPWA 4LUSA 2BOFX 1XD0A 1OD8A 1JL8A 1IXOA 2CWXA 2JKAA 4P8WA 3CO8A 4BQ2A 1D9EA 4RPPA 3REQA 4N2YA 5GNYA 1LOLA 1R86A 5AHEA 2MUCA 3FCPA 1UC5A 1YTEA 3W7MA 2PRHA 1NQKA 2R24A 2XSXA 2ZZ1A 4W87A 1UJQA 3IJIA 5AYXA 4KFNA 1KV8A 3F4WA 2FJKA 5TBOA 2DIKA 2AMXA 3LM7A 1F4HA 4O10A 1HGWA 3AXIA 5U7SA 4GH1A 3SCNA 5DMYA 1OYAA 4BF9A 4XB3A 5EKYA 4JTSA 1LUCB 1UD6A 1O1ZA 1OHLA 2D20A 4N4QA 3UESA 2VZVA 1SW7A 4LUTA 4OBTA 1DIKA 9XIMA 2DSVA 3NZPA 3PG8A 3AU2A 1WZMA 3K8KA 3U6WA 1SQ7A 4HCHA 5HMEA 1R3TA 1ZPTA 4BKNA 5B7ZA 1XWYA 2OEKA 2R1LA 1RPKA 3GU9A 3MVIA 4L9ZA 4CCZA 4ES4A 1MFVA 3M0VA 3UXIA 3REQB 3LNMA 3OQEA 4RDVA 4Z17A 4V1YA 3S46A 1IGWA 2V2HA 2PU1A 3KTXA 2DVXA 3RGTA 1SFSA 3SCRA 5F4WA 2XM1A 4LAKA 4O1CA 3PVFA 4FP1A 3PHAA 1VFOA 5FIPA 3FEMA 4UTWC 4CCCA 3GW3A 3VM5A 2DZUA 3G22A 3H2OA 1XBYA 4HIBA 2A3AA 1A0DA 4GGHA 1HKJA 3PY2A 3NYDA 2DGAA 1X8FA 4PCTA 4EPDC 3W2LA 1FWGC 4HPXA 2RJGA 4ZOCA 4TQTA 1XI3A 2DZXA 1S2AA 4JD4A 2OELA 3EX1A 3DEQA 2QS8A 4UOQA 5I77A 1KA9F 4K38A 5KINA 2VQUA 4JPGA 3B06A 4HMCA 4IGNA 5AZ0A 4M6PA 3ES8A 3M41A 4PMNA 3QOKA 4J28A 4N0RA 4M7TA 2OWCA 2BOEX 3DFPA 1E71M 2A2IA 1W3IA 3ZFHA 3INPA 1XW8A 1JAEA 3U7BA 4F0KA 1NM9A 2WHMA 1XFBA 4U5IA 3GKFA 1GOOA 3HV8A 2CHOA 5E9XA 1MVYA 1XLEA 4GIRA 4JKKA 1CB2A 3M9YA 1XM3A 2V67A 3AWOA 2I17A 3HJZA 3OU8A 4DO5A 5HINA 3R58A 5F2GA 4IP5A 1UP3A 2QXWA 2GQ9A 1V93A 4TMCA 4I9MA 3DHPA 3WBAA 4ECLA 1CLXA 2J6XA 4WGXA 3AYVA 3MI2A 4MAVA 2F9RA 2YCLA 4K7YA 4FK9A 3MJMA 3S9ZA 4RK8A 4QDPA 4PE8A 3L23A 1WOBA 1L9WA 4NJHA 3EZ4A 4KKXA 3SJNA 3CMJA 4XD4A 3W00A 2O9RA 4N4PA 2ZUSA 1FKWA 3GBEA 1CB7B 3O0FA 3AXXA 1W8SA 2V3GA 2ZDSA 3WJYA 4K39A 2YB4A 3FDKA 3S0CA 1DOSA 2OOFA 2P8BA 3CHCA 4IISA 2XSAA 3UYIA 1DIEA 4RNFA 3M0HA 1KNWA 1LORA 3CT7A 4LS2A 4IMGA 1CLKA 3AZRA 3IGHX 4HA0A 1XIDA 1ZBKA 2IS7A 3WLIA 1T99A 3V0TA 3BLDA 1WPCA 3ALFA 2BVWA 1JPKA 5GPRA 3VKAA 4EOUA 2A3LA 2ISFA 1LZOA 2WZHA 1W5OA 3LMZA 1MW0A 4S3BA 2YL6A 1JRCA 4PL1A 5ABEA 4QJ5B 5D09A 2W5FA 2WVUA 3CZGA 1OFPA 3URBA 4CD7A 1VH7A 1TSIA 2GVLA 4F2BA 4MJMA 3C2VA 4O1AA 3MMWA 4TX6A 3L0NA 1GOKA 2YCEA 3GO2A 4EAMA 3QPYA 2V3EA 3BXWA 1QDSA 5HWMA 1NH6A 4E2BA 4WSKA 5I07A 1UWTA 2ZVRA 3W07A 3IUDA 3WLLA 2C8NA 4Z1DA 3GUGA 1EGZA 4IQLA 4ZXLA 1J0ZA 3BV4A 3MY9A 3A4XA 3B4YA 1MNZA 2PI6A 3UFYA 3L4WA 3KM8A 1BKSA 1IXPA 3WBYA 2ALDA 2A3CA 4G1NA 4LQ1A 3IRSA 3BICA 3VKBA 1PKLA 3EGJA 3WYZA 2X0HA 3CM4A 3GG8A 2VZTA 4U2ZA 1OB0A 2C71A 1FX6A 4QE4A 4HMDA 5C2GA 4O0KA 3WLRA 2BOGX 3DBPA 3B9NA 2XFRA 3KRUA 4HNOA 5REQB 1CENA 4NXKA 1W1IE 2PWVA 3M0XA 1W1ZA 1QCWA 4H6RA 4Y9AA 1RJQA 1QWKA 3RU8X 4NZ1A 1FY6A 3HFTA 3V1HA 1A5CA 4O1BA 4Q4RA 4RV8A 2EXOA 1AQMA 3BGGA 3UCCA 4S39A 1B3XA 3VOGA 4KGLA 1PBGA 3OBKA 1PE1A 3W7DA 4S3DA 1SU5A 3S5SA 3WNMA 1DWFM 3FNDA 2H8ZA 1B3VA 1QI4A 2Q8ZA 1D8CA 4FR6A 1HJSA 5A2BA 3JUGA 4LUTB 4IIGA 3AISA 5FSDC 1EP1A 4C60A 4OGZA 1DE5A 2C1IA 4Q4PA 4F66A 1E4IA 2J9ZA 4AVNA 5FSEC 5EBUA 3W23A 4YMZA 3W29A 3ZJKA 4QXIA 1PZ2A 2G37A 1KRBC 2HROA 1BD0A 3N3TA 5I03A 3EDKA 4C6DA 2X05A 4JNZA 5MKGA 1HF6A 1ZZMA 3DYOA 2WWCA 4RJEA 4AQLA 4O0QA 5FJPA 3VIIA 4BWLA 4ACZA 4J5NA 2QCDA 2R1NA 1GHSA 3AXKA 3BZJA 2QUTA 1UHVA 3AJXA 4HJWA 4LNCA 3MHGA 1Z9AA 4JXCA 4E3VA 1V3LA 4S3AA 1KW1A 3CZ8A 2ZOXA 3DOPA 2ZUWA 1JDFA 2QUNA 1KTNA 2VFEA 3W1MA 4JKLA 2VT0A 4OECA 4WY0F 4GGBA 4AZ5A 1HP4A 2PWEA 3UF9A 3WQ6A 3E38A 3ZVHB 2XU2A 3U2OA 4RXGA 1WB0A 1ZUAX 3GG1A 3B3DA 4RNHA 3MSGA 5K2ZA 1I1XA 1PCKA 4E6MA 3TA9A 1BWKA 4WKAA 2W67A 2J24A 1VB9A 2CPUA 4XKMA 3GC2A 1QNRA 4DVOA 2GJLA 3QBUA 4WQ6A 3SURA 3TSBA 2EO7A 4J3VA 3COTA 1LLZA 5MHBA 5M03A 4ORIA 3H2NA 2I9EA 4P2VA 1RBAA 4HU3A 1DIOA 2WVVA 1WO2A 3O6YX 1C29A 2AMGA 4HTYA 1EXPA 4LBSA 3HM7A 3EB2A 2CBJA 4M3PA 1QI5A 2HXTA 2V81A 3ZVHA 5FAGA 2R9RA 2Z1VA 5AN7A 3QY8A 1V3JA 4AEEA 1TWZA 4QLKA 3VDBA 3QMTA 3L4TA 1QHZA 4G8TA 3NO1A 5BXPA 3MZ2A 1KO0A 2ZTKA 2Z27A 3B9DA 1RCQA 3C4UA 4HA1A 2P53A 3BW2A 3DC8A 3MHFA 3O16A 3P60A 2HJPA 4H9XA 2I57A 3KRZA 5CJ5A 1QPRA 1Y5XA 2BODX 1M53A 3BGAA 3KTSA 4GVIA 4H2CA 3TC3A 2X7WA 4HZ8A 4GJ1A 4GWEA 1V3MA 1MNSA 4S3GA 4OKDA 2I16A 2DH3A 1JXJA 2GVEA 1NIUA 1VBRA 4C1NA 1A5UA 1UBPC 2DPEA 2XIOA 2XJ7A 1XR2A 1XSIA 4RE3A 1RBOB 5EY5A 4MF4A 4B5WA 3OOQA 4KCTA 3LHTA 3CYJA 3B9AA 4PUJA 3ARTA 2F2HA 3NZQA 3GVGA 4QDWA 3HG3A 4MY9A 2OMAA 2X2YA 3STFA 2HVMA 4B90A 1Q85A 4LCQA 1BF2A 4NJGA 1Q66A 4NXSA 4HNVA 1R6WA 1YE4A 3VOCA 1TTJA 1VBGA 3N04A 4CD8A 2QDDA 2DIJA 4IIFA 3MUCA 4FSAA 2VC7A 2R94A 3QKEA 2OX4A 4RV3A 4ACYA 3R10A 1IZJA 2GQ3A 4GPNA 3FA4A 4UFMA 1H1ZA 4ZSUA 4C1KA 1LROA 1Z32X 4P7LA 2OSYA 3TYAA 3NSXA 1XLIA 4Y8EA 3O7UA 3UZJA 4Q32A 1PL9A 1AZ2A 4MB4A 2DQXA 3VD5A 3CUXA 4FR1A 3MMDA 2W92A 4IPNB 4YTQA 1L6YA 4EIVA 2WBGA 1RVGA 1XH0A 5IM51 5C2XA 3FDGA 2EPNA 5HMFA 4NT0A 2V5CA 1YDYA 2AGTA 1V6UA 4PCPA 2VGBA 2DT1A 4HSOA 3A4AA 4CEXC 1GNXA 4MB3A 3F4NA 2VC9A 4UCFA 4A8NA 3NL2A 4PMRA 3VX1A 1BYDA 1KGUA 4CNUA 2ALRA 1F6KA 3FJ4A 3AMLA 2XWEA 3CPRA 1C8QA 3QKZA 3OVQA 3GHTA 2EG8A 3W2UA 4DWSD 1E0VA 3PPCA 4JQ4A 4AF0A 3QV7A 1EJUC 1JCLA 3N14A 3B03A 1SJAA 3DFNA 1CGVA 2ZUMA 2VR5A 3MTWA 4ZO6A 4QG9A 3KBNA 3VCRA 3O07A 3NPWA 4Z2IA 5JBEA 1IEIA 3AAMA 1RPXA 2HE8A 3CTLA 3K2GA 5JH2A 2Y88A 1XKYA 3TN6A 1ITXA 1V8EA 4Q8OA 2AQOA 1DWHM 1MEWA 3BO9A 1DORA 2WZEA 1KM2A 4O11A 2PDNA 2P76A 3ATYA 3L4XA 4FX7A 1ONWA 2TAAA 3VC5A 4NX0A 1RCOB 3AHVA 3LPGA 3VOJA 1UH2A 4QSFA 2ZXAA 1NWRA 4JIRA 4B92A 5FACA 3R12A 3GTXA 3GVWA 1TUXA 2JF6A 4FLSA 3ZQ9A 1DWIM 2W27A 1DBTA 4JIPA 3ZT5A 5H8PA 5T91A 2QEZA 1R3QA 5AHNA 3R89A 2C19A 2OLAA 1L6FA 5ENLA 1DKWA 3GHRA 1JYWA 5HNNA 4UQDA 2PDXA 3NQGA 1MEIA 1Y65A 1W56A 1DJZA 1EWEA 4I6VA 2E5CA 3LEPA 3BSHA 3CQIA 3CIXA 4RPQA 1UP2A 3B8TA 1REQB 3LTSA 1EF2A 1CBGA 1GEQA 3SUSA 3YPIA 4AWUA 1R85A 3TYDA 4J2MA 4IOTA 1BSLA 3QTGA 1W1TA 2Y0FA 3UWQA 1E0TA 1EZ2A 5CKSA 3RN6A 3H23A 3GR7A 1L6GA 4K68A 3FJ6A 4LANA 4LYRA 1YPFA 2Y5SA 2YW3A 2QULA 3UZWA 3N3MA 3A6OA 2PDPA 3DDMA 4GC4A 3A12A 4LPCA 3VIMA 1ODZA 1Q6OA 4CU7A 1M65A 3WL1A 2GSHA 1P0NA 5D05A 2PUZA 4RE4A 1JI2A 5A8OA 3NURA 2XIBA 2R8WA 1I9CB 3NYZA 2J7HA 1XIIA 4Q8TA 2GGIA 5D30A 3TEVA 1CCWB 2C1GA 4HNTA 1PPIA 2HQAA 3KBWA 1XGEA 1S1PA 1CWYA 2BX7A 4PMDA 4HVXA 4NZJA 1I45A 3W28A 2OKTA 4CN1A 5DY3A 3UJFA 3P5ZA 3NIYA 7TIMA 1OYBA 4XQ6A 2DDXA 3T81A 4NX5A 2WNWA 3UZYA 4Q4KA 2ATSA 4HOWA 4QNEA 5F2IA 1JPHA 4PMZA 4IIBA 1AL7A 3BTNA 3UXKA 3KUMA 2XWDA 2Z1WA 1QI2A 3LCGA 3A3XA 1E1CA 4M0XA 1UG6A 2PWGA 1QO5A 2B4GA 3OEXA 4JQ1A 2ZUTA 4KCWA 1UUMA 3L2MA 2VP8A 2BSLA 3MZNA 4EE9A 2QW5A 2BNJA 5FF3A 3SCVA 3VFLA 5A6AA 3KOZA 1I4NA 2A6LA 1VFTA 1DWGM 4HMEA 4HQVA 3A9BA 4IJBA 1JDDA 3VKDA 1PWMA 4DJDA 2BTMA 4E4PA 2FTYA 3QZ6A 4I5XA 4ATLA 1OF6A 1X8CA 3TYUA 3NQMA 2WANA 2FQIA 3E0IA 1OYCA 4X2RA 3DC0A 3EWCA 2NT0A 3DXIA 3VPLA 2ASHA 3MBDA 4QS5A 1SMDA 2QLYA 2POTA 4NRSA 1PTAA 2FTPA 1Q6RA 3VUSA 1S3TC 1GGOA 5K4ZA 5LIXX 2G8ZA 1SYTA 4HZ7A 5I02A 3G8RA 2DT3A 3WF3A 4PL2A 4WHBA 2EBNA 3MKCA 1EYWA 4KBXA 3W1AA 1H51A 5E6YA 5BU9A 1LT8A 1DPMA 2VZUA 2R82A 2PGRA 3UBPC 1G0CA 5E70A 1JNEA 3M43A 4KERA 1SZNA 1TRDA 1DL3A 4YTRA 2D2OA 1R87A 1F5ZA 3EMQA 5CBBA 3VK5A 2ACUA 3LHYA 3CQ0A 3D0CA 1US3A 3CH0A 1E1EA 3VNKA 1E9IA 1VGAA 3NJ3A 3CWHA 5HA7A 3MQTA 3SY5A 1ZBCA 3S2JA 4Z1BA 4D1IA 3LD5A 4JN7A 4B4HA 3BOXA 1J18A 4DXVA 5I00A 1JF6A 1UIPA 3WX7A 1E15A 2GUBA 3FGCA 3PWAA 2O4MA 3RIKA 4ZB5A 4UMBA 4D6FA 5HPCA 1ZJAA 5E93A 2G4FA 3BOLA 3C2RA 1OEPA 2V5KA 4DHGA 2BVDA 1TTQA 3ANUA 3QGAC 2ISVA 5BXTA 2PTYA 3FJLA 4DELA 2QPSA 5G1TA 3A22A 3THDA 2V5DA 3PFMA 3PZOA 5EU9A 5CC3A 1EQCA 4C7GA 5K4XA 2ZYFA 4OU1A 3AXMA 3VGFA 4WXZA 2UZ9A 4DO6A 1V4YA 4IWWA 3EDFA 1CDGA 3F2BA 1TPB1 4PODA 2A7PA 4MWAC 2YDQA 4Q3MA 3B8IA 1XFCA 2GJRA 1EJ7L 1G7VA 2HTMA 3WDJA 3J7HA 1SW0A 3OTRA 5KETA 1GVEA 4OJYA 3SUUA 4HBKA 2O7QA 3WJWA 4IL0A 2VFIA 3MCNA 2FPYA 1TPEA 3KBSA 4UC5A 3R94A 3LLDA 1ME9A 2VFGA 1YDNA 4FZIA 3KRSA 4K8GA 1M68A 2O92A 5BW6A 1YADA 2OWXA 1TA3B 3LRKA 2UY2A 2DH2A 4W93A 1E72M 3MWCA 1P7TB 3OVGA 3EOOA 5KITA 2WJFA 3G2GA 1M01A 4M1RA 4D6GA 2YGYA 3C0JA 1VFHA 2XGBA 3GIPA 3TTSA 4FI4A 1QASA 1S39A 1L6SA 4AC1X 2ZX5A 5M17A 3I6EA 3BW4A 4AXKA 4BI7A 5D9PA 1A80A 3O6CA 5KZ6A 1JIBA 1QK0A 1FHUA 4AZ7A 4GY7A 1B3YA 4QBXA 2PP1A 4TU1A 2Y7FA 3L67A 3SSJA 1D3CA 1CGXA 4JTIA 1LG1A 1R3RA 1XDMA 2QCFA 3OZMA 2NW0A 4IPIA 3N19B 1KBIA 1J0IA 1X6UA 2Q71A 4R9XA 4NG3A 1NWSA 1G4PA 4JTEA 1RCXB 3S5YA 3TSMA 2WZTA 1SO5A 2PBGA 4MJ4A 3TR2A 1FWSA 4WX2A 5ECVA 1LUCA 2BLEA 4O0ZA 4CVUA 5RUBA 4DUWA 2PLCA 1KWGA 3VZXA 1H50A 1A3XA 2V5LA 4JS3A 4RKAA 3R7MA 1V02A 3KXQA 3AIWA 1XYFA 4NNCA 2ACRA 3GG7A 2YYUA 5L9FA 3WUBA 1OFBA 2QCGA 2Z7KA 2YOCA 3PZGA 4Z2JA 3EOUA 3UVAA 2HBVA 1KM0A 5JQ9A 1SFTA 4MDPA 3W86A 2R1PA 4GX8A 1Q6LA 1L2UA 3OLGA 3G3MA 4EPEC 3M0LA 3VNMA 4LUSB 4DJDC 2XZ7A 3WEMA 3VO0A 2BFGA 3RMJA 3VA8A 3NQFA 2CLEA 2V0TA 3M0KA 1HQTA 3GR4A 2REQA 2C18A 1OIMA 4DZHA 2VL4A 1Z48A 2X30A 3H4XA 3WLJA 3I4KA 2VOMA 3Q45A 4CUCA 3FN9A 3G8EA 1KFBA 1EZWA 2FPTA 1OCQA 3HURA 4OV4A 4WJXA 2VWSA 3QR0A 3M1ZA 3MSYA 1PB0A 2E4TA 3LN3A 1Q3NA 1GQJA 3QQWA 2FVKA 4QJ3B 3HPXA 3NQBA 4ALDA 1Z69A 4DBWA 1O6IA 1KXQA 4ZB2A 3PSWA 3DI0A 5EYWA 4MKVA 3CAWA 1KBLA 1MQQA 2FB2A 3PJTA 1H49A 5A69A 3W7GA 2J79A 2ZRXA 4JY8A 4KMQA 4REQA 2FVMA 3HGOA 1E40A 4HK7A 5HDRA 2ATMA 4O19A 4D9PA 3W1PA 4LJ3A 2E6DA 2IKIA 2EJ1A 3MUY1 1KB3A 1GZJA 3WF1A 2PB1A 1AZ1A 2C13A 3VNDA 3W53A 2ZBTA 3QY7A 1J5TA 3F5JA 4MG4A 2PC8A 2O56A 2C14A 5ABTA 4QHRA 3MMTA 5HJYA 4DBSA 1XLJA 4OFCA 3EBVA 3IIZA 5D2YA 1JD9A 1XCFA 3PUGA 3AHYA 4UZUA 5FJUA 1I2RA 1JD7A 2GDUA 3CGTA 4MZYA 3NCOA 3ID7A 3AS0A 3GYCA 5J5RA 4QITA 2J62A 4D1JA 1EEPA 5DCDA 1G69A 1KM6A 2C15A 3N2CA 4LW7A 4KGJA 3AHTA 1QNQA 2W66A 2WHLA 2E0PA 3GXNA 4O4VA 3WMLA 3BG9A 2FZ8A 2CIPA 1GJWA 5CPMA 3VD3A 3TTYA 1QR7A 2X1IA 2WHKA 1U83A 1H4PA 2HBXA 1KR0A 1UBSA 1F73A 2QCHA 5CPLA 1WDQA 1LTDA 5CSRA 1U2YA 4V33A 1XISA 4KWWA 1TVPA 2EGZA 4O54A 1CTNA 3NQ2A 4ZO8A 2CHRA 2QDGA 5DBTA 5LA0A 4LV9A 3ZS4A 1C92A 2XDFA 2EPHA 1OABA 1YLVA 2VGIA 4ORMA 5FEWA 2YX0A 3ONBA 3RRAA 3WF4A 2PWUA 4IF2A 4LWWA 5I09A 1TWWA 3TN4A 4LTSA 1YDVA 2PZ0A 1FRBA 3SQLA 3I65A 4DM2A 3R11A 1K8XA 4YCPA 3EOLA 5HK4A 1W32A 1EQPA 1XLBA 2EPLX 2HXUA 4BEQA 3UA4A 3W3OA 3MSDA 3LTPA 4A2SA 3FKRA 4GIYA 4FX8A 4Y96A 1QHOA 2PP3A 3AYRA 4G9PA 4LV4A 5AVHA 1NFGA 3PBUA 3GXFA 1A5BA 1NDVA 2QDEA 1G1YA 4MB1A 5DRIA 1PZ3A 2H90A 2GWNA 4YVVA 3DKJA 1PIFA 2E1DA 3AMCA 5G2IA 4I6KA 4GI4A 3GDRA 3DENA 3LCXA 3D5HA 3UR8A 3WLPA 5BXSA 1XH2A 3S42A 4GI6A 3M5YA 3CT2A 1BPLB 1BGGA 2GVJA 3H4GA 4W89A 4WDWA 3D6NA 1Z41A 5CJMA 3W76A 2A4AA 3PWIA 5H8MA 1DTUA 1IT8A 4Q8QA 1ME7A 3BMVA 3WLHA 5DT7A 1KM5A 1ZFJA 3DN5A 3A24A 3HQPA 3FK4A 1TYGA 3OIHA 4YJ5A 3DCPA 3W7CA 2XHYA 3QXBA 3P0XA 4D6EA 1B31A 3TNBA 1M7OA 4QTGA 3VDHA 3CL6A 3PBYA 2V6AA 4U4MA 4DYJA 1F7BA 1KV5A 5I7GA 1BVZA 3NL3A 1VKFA 1UZHA 1TMLA 1K70A 1Q6DA 2VRJA 2BVYA 1BVWA 2OQYA 4JCLA 2GJNA 1OZMA 1UWQA 3IK2A 3FXYA 5G4EA 1WDPA 4Z1AA 1TCMA 4IFKA 5XIAA 3T42A 1TKKA 4JQAA 4MY8A 1B3WA 2ESCA 2DU2A 5E09A 2H8XA 4R5EA 1WZAA 2FMOA 2GSEA 5CZJA 1AMYA 3L4VA 1WCGA 3ICJA 3RAOA 3AICA 4I5RA 1O5QA 5IDIA 2PP0A 2PBOA 4Z1CA 1UB3A 3O1NA 3VC6A 5KSWA 1XS2A 1MWOA 4W7VA 1ZGDA 4ATDA 1MQPA 2Y8VA 3KZSA 1FFRA 1SM9A 3AIQA 1EOMA 1R3SA 1T41A 3IVTA 4HZ6A 2DFAA 3SADA 2RDWA 3TA6A 4DJEA 1YBQA 2VR4A 3W26A 3ITYA 1VYRA 3U2CA 4DF0A 2QGYA 4NVTA 1R7AA 1H5VA 3MHUA 4MWAB 2YXOA 3UCQA 1ELSA 2NQLA 1G5AA 1HG3A 1TVNA 4ZQNA 1B90A 3GDKA 4DF1A 1E6PA 3M07A 3T40A 3TQVA 1Y8BA 2Q02A 5DY2A 5I3FA 1JZ8A 1AW2A 5CLWA 1R0MA 1P48A 3UNTA 1H7NA 3UPMA 3NXFA 5EMKA 4FALA 5A6JA 5AC6A 3GQYA 1K8CA 3NZRA 4NUWA 1ALDA 1XPGA 4JNMA 1WBHA 1U30A 3SCWA 4KFOA 1PEZA 2J78A 3ZLHA 4NJIA 1K3UA 4WD0A 5D2VA 4XIAA 3TW7A 4KH2A 1NOFA 1KBJA 3AYSA 1AQFA 1JZ7A 3GX9A 2G5WA 4H9TA 3MT1A 3QV6A 3NVDA 1OSEA 1WUEA 3G0SA 1JRBA 1XBXA 1X38A 3N2OA 3LGGA 3UWVA 3I3BA 2QCLA 3W83A 2QMKA 3N6JA 1Q5MA 2NX9A 4RZ4A 4NY2A 4ICMA 2D2GA 2KAUC 3ELFA 1UASA 2B0MA 3QR3A 4XZMX 1PHQA 1XYMA 2EG6A 3TAKA 3MC5A 1FWHC 1W54A 2IW0A 3W7PA 1F3WA 2GJXA 2GJXB 2CLOA 2WZMA 2DZTA 2BGNE 3TU9A 5LNVA 1XYCA 4PYSA 4U33A 5HWJA 2QCNA 6REQA 5KEZA 3R25A 3W75A 4S3JA 2E9LA 2ZIDA 3MI6A 4ERAA 3G1RA 3MJYA 5T9BG 1IWBA 2O0TA 2DZWA 2ZVIA 1TJRA 3QW3A 2VX4A 1EJRC 1VYSX 2BXYA 5H8UA 4DAFA 3OLIA 1JAKA 3XISA 1WP6A 2FDMA 2VENA 2BG5A 3ZT6A 3NM3A 2I7GA 1GQIA 3B4UA 3IAQA 4BK9A 2BY2A 5HR7A 1JPIA 4HMNA 1UH4A 4PN2A 2PDBA 3SCTA 1JYNA 4I8DA 4CQ8A 4R9OA 4GMEA 4GVHA 3KRBA 4UTMA 2G0WA 2FIQA 2OLHA 4JIIX 4HJFA 3PTKA 4L4MA 1CIUA 4N6EA 2G41A 1REQA 3BLIA 3WELA 2PTZA 3ITOA 1I2NA 1OGSA 2PDFA 3FOKA 1BQCA 4JBRA 4HN8A 1GJPA 2QCEA 3MV01 4US5A 6XIAA 1YNQA 4MYAA 3ABZA 2BWGA 2E1WA 3T09A 3LHVA 5CGMA 3Q67A 1GVRA 4NNAA 2INZA 4TVUA 4D6DA 5A94A 2W3ZA 1GTHA 1ZCOA 4LVGA 5DFAA 1O5KA 3HG2A 1B57A 1SSGA 4S23A 2NSXA 3WNKA 2A85A 1H5YA 4YWIA 1G4SA 2IPFA 1XLMA 3MUZ1 3BL3A 2RGLA 3W1XA 1BQGA 3WJXA 6PTDA 3FY1A 4CVWA 1WAWA 4JEQA 1PIGA 2ZADA 3I7SA 4AZIA 1RBLA 4JTKA 2NV2A 1XH1A 4IFRA 4IL2A 3VDCA 2WJDA 1TV5A 3VGDA