3NR0A

Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution r6 6/10a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
245
Chain Sequence
ATLKASSLRALKLMHLATTDENVIALCHQAKTPVGNTDAIFIYPRFIPIARKTLKEQGTPEIRICTSTNFPHGNDDIDIALAETRAAIAYGADSVAVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLAVIIETGELKDEALIRKASEISIKAGADNIVTSTGKVAVGATPESARIMMEVIRDMGVEKTVGFIPVGGVRTAEDAQKYLAIADELFGADWADARHYAFGASASLLASLLKALGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords deoxyribose phosphate aldolase
publication title Optimization of the in-silico-designed kemp eliminase KE70 by computational design and directed evolution
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 92
structure length 245
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3nr0A00
5D2VA 1N7KA 4UFIA 3W87A 3W2KA 1QWGA 4BI6A 5BMXA 2C16A 2FFCA 2E6YA 3SSJA 1KFJA 3NA8A 3UWWA 3S9YA 4IXXA 2OJPA 1EWEA 1Z44A 1PIIA 4K36A 4DQWA 3W7HA 4IMDA 2GVJA 3N14A 4M6PA 4PFMA 2NUXA 3OIXA 5G4EA 4LS0A 3S8HA 3W7CA 4ADSA 4YXGA 2HSAA 3GDLA 3H55A 1OX4B 1M7OA 3QW4B 3NOEA 1DORA 3W88A 4R34A 2ABBA 2VFHA 1YTKA 4PL1A 4LRTA 5LNUA 1VHCA 2E77A 3L5LA 3M0ZA 1GG0A 4JTUA 2A21A 5U4NA 4LTSA 3KRZA 4XKYA 4NXKA 3SGZA 2OCZA 1GVRA 2E68A 4EF8A 1Z41A 5HR7A 5HULA 4QAIA 2H8XA 4HIBA 1W56A 1EA0A 2ABAA 2FDSA 3ZS4A 1ME9A 4M19A 1E51A 3IIPA 4S2BA 2Y70A 3PBUA 4AXKA 3HO8A 1QPOA 3W23A 2ZCGA 4UIOA 1OG0A 2UV8G 4IMEA 4UTIA 4RXFA 1XCFA 1AW1A 4NVTA 4PEKA 4QNEA 2C1HA 3SZ8A 2DU2A 4O19A 5DCEA 2FIQA 1PHWA 4UTMA 2YX0A 3G1HA 2ZRVA 3EXTA 4O17A 3SI9A 2Z0IA 2FTPA 3A24A 4O50A 1VLWA 3O6YX 5AFDA 2C3ZA 1P1XA 4UFHA 4PCFA 3KHJA 3TE9A 4MVAA 2OX1A 3FEMA 4RLIA 3TC7A 3O8AA 5EL1A 1SW3A 3HGOA 4OHQA 4M5PA 1TREA 2E6DA 5G2WA 2X2GA 1K7FA 3QFEA 1NSJA 4N6EA 3M16A 1M5WA 4E2DA 5HUPA 3DBPA 1ZENA 3NM3A 5K7JA 5I3FA 1DV7A 4WX2A 1DJNA 1EEPA 6ALDA 5KSWA 5F2MA 1W5OA 4KKXA 5G2IA 3ELFA 3HB9A 1YXCA 2VKZG 1JCJA 2GVGA 2ZZ7A 3OEXA 4Y96A 4O8RA 1OX5A 2QUVA 1I2PA 3QRHA 4IX2A 3UD6A 3W7JA 4MZYA 3W9ZA 1YPFA 2YFOA 4UTWC 3IIOA 3TJXA 1F05A 1RZMA 3W07A 1UCWA 4BR1A 1QAPA 3EX3A 2HTMA 4LVDA 1TPUA 3C4UA 1JCXA 3PWAA 4ORIA 1X1ZA 2YGYA 3LXBA 4I7UA 3HG2A 3KX6A 3STCA 1H1ZA 1MSSA 2Y6ZA 3Q94A 1MEWA 2A6LA 3A23A 3B06A 2CLMA 4ZQCA 3VI2A 1CX9A 3W7MA 3VE7A 3RLVA 5K9DA 4GC4A 5J5RA 1TV5A 3SECA 3LM7A 4IQLA 1AG1O 2NV1A 3I7SA 1F6PA 4WOQA 5D38A 2ZQ0A 2R94A 3HQ1A 3S5OA 2EGZA 1J5TA 2QKFA 1R2RA 3W1TA 1O5KA 1DOSA 1RD5A 4LNYA 5K9XA 1VLIA 1H50A 3L0NA 2Y85A 2E1DA 4LVAA 4PA8A 3W1XA 1QNVA 1G67A 3O6DA 4A2RA 1HTIA 4UTLA 4O1CA 4QISA 4RR4A 2NWRA 4FNRA 4NT0A 1SW0A 4ONVA 3QEZA 3W1PA 3W7QA 4MZ8A 5K4ZA 3KRSA 3JS3A 3G3MA 1BWLA 1Z42A 3HJZA 1NAL1 1XBYA 1BEUA 1LOSA 3F03K 3RMJA 4NUWA 5AHMA 3WJSA 1JQVA 3HMJG 3EXRA 1Y0EA 4FF7A 4FX6M 1KLYA 4MFEA 1RV8A 4JS3A 1G7UA 2Z6JA 3LCXA 3A22A 3H53A 3LRLA 1IIHA 4WZHA 3E0IA 1WV2A 1AK5A 1TJRA 1H7NA 1XUUA 3L5AA 1BKSA 1XDMA 1W37A 1LDCA 4Z0SA 1MXSA 5DXXA 1G69A 3C2FA 2GJNA 3O63A 4AWTA 3S42A 3FKKA 1JRBA 4OU1A 3GAKA 3TA6A 1J2WA 1XFBA 2WO5A 5E1QA 4RZ5A 3LDVA 1KW1A 1QFEA 3W74A 1Z48A 3CLMA 2VXNA 3E02A 1DQWA 5HWJA 2VELA 3BLIA 3MI3A 3NQ8A 2CZDA 3Q37A 4ZQNA 1WOBA 4AB4A 1ONRA 4IMCA 4IXHA 1VH7A 3CWOX 4Z1BA 3UYCA 4AHOA 3LRKA 3N9SA 3DKJA 3UXDA 4L4MA 3LXCA 2CLEA 3LHYA 4FXSA 3BV4A 4JTKA 3INPA 2FPTA 3LHUA 4RV8A 1W54A 4FIQA 5BOOA 4GJ1A 3EX6A 3EKLA 2X1RA 1IXPA 4MKNA 2QCFA 3M5VA 1SPQA 2VFGA 3E9AA 3SJ3A 5D2WA 3TNOA 1XDLA 3PC0A 3QSRA 4Y6GA 1A5AA 4TMBA 1IGSA 4UUIA 3W84A 4I7WA 4NJIA 2CU0A 2X30A 2VFEA 4WY0A 3WK2A 2QDHA 3B0VC 4K37A 4FX7A 2ZA3A 2LLEA 4TMCA 2E6AA 1SSGA 4M7SA 2A4AA 4EF9A 3AJXA 3W7RA 3LB0A 4NU7A 4EVZA 1FWNA 2EPHA 4O1BA 2FLIA 4K7VA 4H6KA 2YW3A 1LRQA 1F76A 4KFNA 4PTNA 3W7PA 4D2JA 4FIRA 3WJXA 5G2HA 5KITA 1A5SA 3NQVA 3G22A 4Y9AA 1V7YA 4G1KA 5F4WA 3SGUA 3FS2A 4CQ8A 2C19A 3PG9A 5I3IA 5IBXA 1KTBA 3TQVA 1OFPA 3NQFA 4MLJA 1OF6A 3IIVA 3VNDA 4ALDA 2XN1A 2A6NA 4HPJA 5BMWA 1SFJA 1PHQA 2NUYA 4WUIA 2C15A 1L6WA 4U28A 2WSRA 3B03A 5AHIA 3LTSA 5I3HA 1QPNA 3PUDA 1DHPA 3FJLA 2QCDB 3B0UX 3F4WA 3P8IA 2E5CA 5EKYA 3W1UA 3CEPA 3EX2A 1GOXA 1SO6A 4FEZA 1J4EA 3HG5A 3CB8A 3C52A 3IRDA 3ATZA 1VHNA 3UWUA 3UQNA 3SR7A 4RZ4A 4N9BA 3VFLA 3BO9A 4J9JA 3BW2A 3W86A 1XM3A 2Q3RA 3TQKA 1A50A 3OVRA 3R89A 4B5NA 3QSTA 5LNVA 2PC4A 1JCNA 1W0MA 1G4PA 6TIMA 1TPVA 1LLWA 4GFSA 2RFGA 3DENA 2ZZ1A 3TAOA 4PH6A 1WAUA 4DBDA 4A3UA 1B4KA 1LBLA 3QC3A 4GBUA 4FNSA 2ISSA 4LUIA 3QPYA 3P62A 3W2NA 3W2MA 3G8RA 4O10A 1S3HA 2DZUA 3DFSA 4P61A 1LRTA 5FESA 3AO0A 3UXAA 4CQ9A 2Y7DA 5MHBA 5AC8A 3GR7A 4E38A 3GDRA 2HMCA 3L0GA 1ALDA 1NF7A 1YDOA 2A2IA 3THAA 2R91A 4NNAA 3C8FA 4JY9A 3NYZA 3N73A 5DCDA 4QSHA 1SFLA 1IXNA 1TMHA 3QH2A 5CZTA 1C29A 1KV8A 4M6VA 3NQ6A 1ZFJA 1FBAA 3HPXA 1YLVA 3M1ZA 5FF0A 2C0AA 2ALDA 3DI0A 3EWYA 2W0UA 3MBDA 1W3NA 4GUJA 1YXDA 2B0MA 1G6CA 2FPVA 3PS7A 2I1OA 4WOZA 4OT7A 4UFLA 5FEXA 3DFNA 3W83A 1OFDA 3T4CA 4AF0B 4BK9A 1ZY9A 3BPWA 3LLDA 4O4VA 5I3JA 3QF0A 5FEWA 3L68A 3N34A 2V0TA 4QIUA 4BI5A 2P10A 1K03A 4TU1A 3TAKA 4UMCA 3F4NA 4H3DA 2WNZA 4K8EA 2QUTA 4GUFA 4FNTA 2R8WA 4O14A 3TV8A 3NG3A 2VENA 3SIZA 1MZHA 3QM3A 1ICQA 2E5DA 1CI1A 4X2RA 1EB3A 4BWLA 4XQ6A 2WQPA 4N9EA 1OK6A 2YZRA 1O60A 5AHLA 1VCFA 3N19B 1SO4A 2V2HA 1H5YA 2GPTA 3HPZA 4MIMA 4LU0A 3RLUA 1KM2A 1I4NA 3S6DA 3LTYA 5D02A 4ZQMA 2GQ8A 4NJJA 1KM1A 4HT3A 3V1PA 1TIMA 2WNQA 2DZWA 5D32A 4XKYB 5EPDA 1FUYA 3MP5A 5F1VA 1W5MA 2Y61A 5LHEA 3W1LA 1ICSA 4QITA 4JYEA 4NQ1A 4R7JA 1SQ7A 4BF9A 2QF7A 3W70A 1RVGA 4PODA 2JGQA 4BI7A 1YPIA 4MYAA 1ME8A 3O06A 3TH6A 1T99A 3VKJA 4N4PA 5EY5A 1OJXA 5FF2A 3W7LA 1AL8A 3O16A 4HKPA 4LRSA 4LC6A 7TIMA 3EB2A 1ZHAA 2B7QA 4JD4A 2JBMA 1LBMA 2ISWA 3W7KA 2GOUA 1GPWA 3LHVA 3HBLA 2VFIA 1W1ZA 3NL3A 4JDYA 1Q3NA 4LW7A 5DBUA 5CKSA 4L4LA 3W1NA 1FCQA 5AYYA 3FYOA 1O4UA 3U8GA 4OWGA 3NQGA 3CU2A 3QMSA 1R2TA 2WPBA 4ORMA 2PRMA 1W5PA 4GNJA 3QJAA 3PR2A 3W85A 2TYSA 2A7PA 3UPWA 1GG1A 1XUZA 1TTPA 1P0NA 3MI6A 1ZNNA 3HOJA 1Q6QA 1WDWA 4LC8A 5KZMA 1FDZA 1X8FA 2B7PA 3GNDA 5DN1A 3L21A 4O16A 4ZVJA 1JRCA 3P5YA 4R33A 2PRLA 1F7BA 5FF7A 3W7IA 3W2LA 4JN6A 3L65A 1OFBA 1WOAA 5AC7A 4O57A 4AVFA 3NQ2A 4DELA 3SW6A 4HSOA 2TPSA 3NM1A 1R47A 4NJKA 3WJZA 5CZJA 2J88A 3C2EA 1GEQA 1D3HA 1R46A 4JTTA 1S5WA 2EAWA 1C8VA 1TPC1 3G1SA 3OVQA 3EX4A 4MYXA 3FYPA 2WV8A 3T44A 1TO3A 3W72A 5LNSA 3HPSA 1TQJA 4K8HA 1XC4A 1L6SA 3MBFA 3GXTA 3EEGA 2YCEA 3W22A 1KFBA 4HHPA 1X6UA 3T7VA 4LV9A 3S1WA 2EKCA 4JTLA 3S1VA 1DVJA 1F73A 2VEMA 1PL9A 2Q8LA 3HF3A 1W31A 4FXRA 2VC6A 2ZTJA 4YCPA 1HG3A 2A1YA 3W71A 1TTJA 3L0KA 3MJYA 1QPQA 1TRIA 5BRBA 3CEUA 5C54A 5C5YA 4K7YA 2A7NA 3GZ3A 2QCMA 1OK4A 4O1DA 2H3DA 3M6YA 3T78A 4YCOA 3E96A 1H61A 3WJYA 4Y90A 3P5ZA 3NQ7A 1H7RA 4UR8A 1K8XA 3MHGA 3H54A 2CLHA 1TCDA 3KOFA 4WJEA 3W7DA 4IWWA 1GZGA 3HIJA 1TRDA 3ATYA 3ZWSA 1H62A 4JX5A 4JTJA 1VR6A 1PVNA 1OYCA 3M5ZA 4RK8A 1ADOA 3W7OA 4FO4A 2RH9A 1NVMA 2QCNA 3NQEA 3O6CA 4P2VA 2CW6A 1ZAJA 3ABOA 3B8DA 2Y88A 2CWNA 3PSVA 3L5MA 3N9RA 4KWVA 3DAQA 4FX8A 1TSIA 3KVJA 4HNTA 4WXZA 1V5XA 2X1SA 2AAMA 3D0CA 4XZ9A 3P7YA 4TR9A 3UNDA 2O7SA 1L9WA 3MHFA 2J6XA 1I2NA 2JKAA 5HMSA 5BNKA 2I14A 2VOMA 2YFNA 1KM5A 1AW5A 1VYSX 3DGRA 2QJHA 3WK3A 3BGGA 4A21A 4GRSA 4NZJA 4WY0F 1KTNA 4RZ6A 4JYDA 2J27A 5G5IA 4Z1AA 4UFJA 3VCRA 1VZWA 3CIWA 3STFA 3NL2A 1W3TA 1SO5A 2E09A 2YYUA 3DKLA 3C2OA 4JYFA 5F2IA 1EWDA 1MO0A 4FNPA 4XUGA 4UTKA 2QJIA 1JUBA 4ZQOA 1WQ5A 3MI2A 4LT9A 4RJEA 3PULA 1TB3A 2P0OA 4UFMA 4DEFA 5HQEA 4ZL1A 1GJPA 3HGSA 4X3ZA 3NAVA 1W3IA 2QCEA 4IX0A 4K38A 3WFAA 4DO4A 2H90A 4AAJA 1D3GA 1LOQA 4MOZA 1EP1A 3UWYA 1K02A 3CPRA 3GKFA 1GT8A 1TQXA 4O4WA 2W6RA 3LBCA 1Q6LA 5CG7A 3TMQA 1WBJA 5G1YA 2NXIA 4GUHA 3BLEA 1YTDA 3HG3A 4Q32A 4LS1A 5D09A 4N9CA 1FX6A 4JIQA 3UWQA 3W6YA 4CNNA 4S1FA 3KXQA 3W75A 3TDFA 3QQ1A 4WXYA 3EKZA 3FJ6A 1RQHA 1W5QA 2ZRXA 2WOQA 3P8JA 2WSYA 4JY8A 4C1KA 4E2BA 1K7XA 2ZYFA 3C56A 4MPQA 2ZZ3A 4O54A 2QUUA 3QW3A 3IGXA 1LORA 2NLIA 1FWTA 1B57A 3LCWA 1XBVA 3MP4A 3S1UA 3W2JA 1KV5A 3TROA 3BVJA 2RHGA 1SW7A 4ZQRA 4POCA 2OMAA 1XKYA 4O1AA 3UWVA 4DF1A 1W8SA 1S5TA 3FLUA 3LLFA 4HPXA 1RR2A 5DY2A 4UC5A 3RK8A 1X1OA 2G5WA 3UPBA 4XTIA 1OFAA 3BW4A 2ZRZA 1FDJA 4CNOA 4JICA 5C2XA 3EWZA 3TC6A 1VYPX 3FKRA 2CLOA 1OABA 2Y63A 2WNNA 3PG8A 4HN4A 3MYPA 1FWWA 4ADUA 3IVSA 3TW6A 2A0NA 3GNNA 4AH7A 3MW7A 4LOCA 3ZR4A 1KM3A 1P5BA 5CZSA 2FQIA 4Z08A 1QOPA 4GUGA 2IQTA 3NL6A 2V2CA 3OHIA 1RQBA 1UUOA 3IGUA 2NX3A 4IMGA 1WX0A 2EHHA 4DO6A 5IBXC 4MJZA 1SUXA 3G0UA 5AHFA 3KVMA 3LCFA 3NL5A 2X16A 3GKAA 4RKAA 4CNPA 4FNUA 1M6JA 1G4SA 2B7OA 5GVJA 5KZEA 1YDNA 3MMTA 2BXVA 4EWND 2ZRWA 1KBJA 1ZJIA 4ZZ9A 2BZNA 2QJGA 5HR6A 1H51A 4UCGA 1OYBA 3CQ0A 1Q45A 2CFFA 3G18A 4RX0A 3TKFA 5L6UA 3UY7A 4AEOA 3G1AA 3IVTA 1LBFA 4MY9A 4ZMGA 5CSRA 1P4CA 1EPXA 2VEPA 4N4QA 2I9EA 2V2DA 1LROA 1I8JA 1K7EA 5F2LA 1T96A 3EX1A 3LRMA 5D2XA 2QCHA 1JCLA 2CLIA 1IXQA 4RCXA 5LGXA 1H7OA 1YDVA 3OVPA 4W9TA 2YXGA 1T8XA 4JEQA 1XL9A 5G4WA 1TPWA 3QZEA 2C18A 5TQLA 3FOKA 4UNKA 3DFTA 8TIMA 3IIZA 5D05A 3TUUA 1EUAA 1FDYA 1T0OA 5AHNA 4N02A 3QQ0A 2YSWA 3WJWA 4ICNA 2VFFA 5D30A 2NV2A 4HNUA 3P82A 5DY3A 1PS9A 4CQAA 2BLEA 4TX9A 4I9AA 2FPYA 1QPRA 1H60A 1OHLA 2G95A 4LVBA 3T40A 1SZFA 4LUJA 3MP3A 4QQ3A 1NEYA 3TW7A 1QDSA 4FNQA 3TCEA 4UTTC 3GYEA 1O5XA 3STGA 3W1AA 5CPMA 1SZEA 3S1XA 3EWXA 1BTMA 3DFPA 4A22A 5TBOA 3DXIA 5I3KA 3TIMA 1VJIA 4JGDA 1TPEA 1DQXA 4YL2A 2P1FA 4XTDA 3P81A 4DF2A 3BG5A 1Q6OA 5FEZA 3QMTA 3A5VA 1TV8A 4RXGA 3TSMA 4JX6A 4M6QA 2OT0A 3BK0A 4IJBA 3PUEA 2NX9A 1JUEA 3NEVA 3GAYA 3M43A 3USBA 3B4UA 3IGSA 2JK2A 4TO8A 3NZRA 5LZLA 4O53A 4UR7A 3A21A 4KFOA 5K9CA 2QEZA 4GXMA 2VFDA 3QMRA 4NX0A 3UWZA 1YADA 3JR2A 2W79A 3S5NA 3C2RA 3O07A 4IGHA 5H2ZA 3T55A 4LS2A 3ABSA 2V9DA 3QYQA 5K2ZA 4U4MA 1MEIA 4AHQA 1IXOA 3GXNA 3TU9A 5KMYA 3KRUA 4BWLC 2FB2A 2NXHA 4LWWA 3LX9A 1F74A 2ZZ4A 1SSDA 3EXSA 4NX5A 3PF3A 4JTFA 5CPLA 5LNRA 5BW6A 1NFBA 4O13A 3DH7A 3PUOA 2Z6IA 2V82A 5DELA 4O12A 2J24A 3NQDA 4E0CA 3W76A 3BG3A 1A5CA 3TR2A 1N55A 2C13A 4LVGA 2QCLA 3G3DA 4Z1DA 2HS8A 4UXDA 3MUXA 3UZJA 3LCGA 5AOUA 4BFAA 1EIXA 1L2UA 2OT1A 1KM6A 3B04A 3DFOA 5IM51 2H6RA 2GQAA 1QOQA 3F1QA 3M9YA 1XI3A 4YMZA 1HFBA 3ZFHA 3C2VA 3UY8A 2V30A 1JCYA 3THQA 1UASA 3NVTA 3MYOA 1DL3A 3P80A 3PVFA 4DO5A 1XXXA 3BW3A 2AGKA 1WXJA 3NNTA 2YPIA 4JTGA 1KFCA 1FWSA 2CLKA 2PURA 3KVLA 5SWUA 3FFSA 5CPOA 4HNNA 1AL7A 1EX5A 3R8RA 3LERA 3N2XA 4MLRA 4UFKA 3BARA 1KFLA 3OA3A 5HNRA 1OX4A 2XFWA 2PE4A 3V75A 5DLCA 1BWKA 4OV4A 3I65A 3LHTA 4HSNA 2ZA1A 1KTCA 5AN7A 5DCBA 1U5JA 1X7FA 4N6FA 1UUMA 4IMFA 3GVGA 4PC8A 2Y89A 1K8YA 2BSLA 3B0PA 3E12A 1TPB1 1TJPA 1TYGA 2WJZA 4O18A 3LI1A 2ZA2A 1G7VA 1JULA 2ISVA 4AMAA 2WKJA 3RF9A 1YXYA 2JKPA 5I3GA 4MJMA 5D03A 3FA5A 4JTSA 1HL2A 1JJKA 1I2OA 5LGZA 3TFXA 1GQNA 1QMLA 1LYXA 3CTLA 3TSBA 1O95A 4H4IA 4S2CA 5C55A 3NPUA 4XWUA 1SR9A 4M7TA 3QPZA 1GTEA 2QAPA 3G1YA 1GVQA 1I2RA 1LRNA 3LI0A 2O7QA 2DZTA 5D33A 3B05A 1KFEA 4UTWA 3P60A 3W7GA 3W1QA 3TJLA 1ICPA 1VRDA 4O11A 1THFD 3PAJA 3G1FA 4MFDA 2RKXA 4NJHA 3NQMA 2AQWA 1LP6A 1QR7A 1LOLA 1TPH1 2QCCA 5AYZA 3LOTA 1OFEA 2OZ0A 3LCHA 3KAOA 1FY6A 4UNLA 1UB3A 2TSYA 3I7RA 2ATMA 1M7PA 2DP3A 3N3MA 3TX9A 1MEHA 3PBWA 1GVFA 2JGYA 1TPDA 4UTJA 3G0SA 2YW4A 3A5FA 3CIXA 3GXPA 2TRSA 3O05A 4NNCA 3MWAA 2G97A 3W7EA 3R2GA 3L9CA 1A5BA 3MO7A 5D37A 2Y7EA 3C3NA 2ZTKA 5C6MA 3CM4A 1TPFA 4JIPA 2KZHA 3PM6A 3I6RA 2B4GA 4CCCA 1F2JA 3NZ1A 2NXGA 4A29A 1HO1A 2E5BA 3NGJA 3G1XA 4DPQA 3TMLA 5KTLA 1W5NA 2G96A 2C14A 1JVNA 1PE1A 1VQTA 1OFRA 2DJLA 3CT7A 4C1LA 4MY1A 1H7XA 1VGAA 2RDUA 2FJKA 3W7NA 1RPXA 3G0XA 3UZ5A 4KFPA 5LKYA 2DZVA 3P84A 2JKEA 4DXVA 2DZPA 1TTQA 3W2UA 4A2SA 3DU0A 3ABRA 2CLFA 3PB0A 4OV9A 3STEA 1OFOA 2ZRYA 4YWIA 1O94A 4YLWA 1DJQA 4ML9A 5A8GA 5HWMA 3HGJA 5D04C 1IF2A 1I45A 5DXYA 3IIXA 2QR6A 1KBIA 3CC1A 3P61A 4IPIA 1OX6A 2QCGA 2Z1BA 1PCKA 2Y7GA 1AMKA 2NWSA 5FF4A 2GVLA 3IVUA 3S0CA 2E6FA 3ZWTA 3LHZA 5AYXA 4LV4A 2VEKA 5FI8A 3C0JA 3C61A 1LZOA 3LHWA 5LHFA 3LV6A 1EP3A 2XN0A 1H7PA 2A5HA 4UMAA 1KA9F 1ZALA 4DF0A 5HUOA 3G1DA 1TTIA 4WY0B 2J9ZA 1ZCOA 4Y8FA 1R2SA 5E93A 1FQ0A 1EUNA 2FB3A 1FWRA 4XBKA 2ZZ5A 4O0KA 3K30A 3PB2A 3RFAA 3LXAA 3NXFA 1FXQA 3IV3A 4OBTA 1B4EA 4JTEA 1WYIA 1PCWA 3L2IA 3WK1A 3U2OA 4JDBA 1IIGA 2DZXA 3TFCA 4O28A 4JTHA 1K8ZA 2QAFA 5H91A 1FCUA 3U6WA 3I68A 3RNDA 3GDTA 3LGEA 1JQXA 4PL2A 1H7WA 3M41A 1G4EA 1GVOA 2J9YA 4LY8A 5TIMA 2BWGA 1Q6RA 5FEPA 1DKWA 4TIMA 1R30A 4EIVA 4QJ1A 5D2TA 4K39A 1HO4A 3GIYA 1ZAHA 3DI1A 4OQVA 1N8FA 3LV5A 3TQ0A 5K4XA 1SZGA 1S5VA 3M44A 4JXCA 1YYAA 5A5WA 2Q3OA 4N2YA 2ZDRA 2B7NA 3EWBX 1SZNA 2DORA 3Q58A 3L67A 3S5YA 5D2YA 2H3BA 3NQAA 2J9XA 2VEIA 3TSDA 1GWJA 1VPXA 4XBSA 2ZFAA 3EWUA 2R14A 5E0KA 1B9BA 2RDWA 3C6CA 1UBSA 5F2GA 2CZEA 4FB7A 1VCVA 1SU5A 1QO5A 3WK0A 4WQ6A 3LCLA 1LM1A 4KWWA 4AWSA 3Q2DA 1ML1A 4Q4KA 1KM0A 3BGJA 1OFQA 4JNMA 5ABTA 2YYTA 1VCGA 1GVSA 1U83A 5T26A 2DJXA 1ZAIA 4WD0A 2YR1A 3GDMA 2GQ9A 3PSWA 3NR0A 4CCEA 4IPJA 4OE7A 1F5ZA 3L66A 1RQEA 4JX4A 5AC6A 4NXSA 1FXPA 4QNWA 3NQCA 2CZ5A 1QCWA 4QM1A 2DZSA 3P74A 3O15A 3KVKA 5HWNA 3GB6A 2GUUA 1C9DA 1XBXA 1LCOA 2ZBTA 3G1VA 2V81A 1GTHA 2RDTA 3ANYA 5AB3A 1P0KA 5F4SA 1WBHA 3PBVA 3TXVA 2A85A 3OBKA 1FCBA 3NO5A 5DBTA 3GX9A 5LSMA 2ZRUA 5F4XA 1CW2A 4O52A 4EOUA 1ME7A 2Y7FA 4Z1CA 3DHDA 3I7QA 1KM4A 1UJPA 1H1YA 1F6KA 1TV7A 1VS1A 2V5LA 4N9DA 3R5EA 4MY8A 1H63A 5CSSA 3SFKA 4X9SA 3TK7A 5K3VA 3E49A 2PCQA 2Y62A 3CWNA 1JUKA 4O0ZA 3W3OA 4K6AA 4CLMA 3JRKA 3EWWA 1DBTA 2NX1A 2ZZ6A 3HGRA 2CZFA 4FHAA 5HJLA 2F84A 5L9FA 4UTUA 2BTMA 4IUOA 4JTIA 5EBUA 1YTEA 1A53A 3NPWA 3M7WA 5CPNA 2QDGA 4X22A 3N2MA 1EP2A 3CHVA 1B3OA 1SO3A 4O15A 4LVFA 2QCDA 2ZZ2A 4NJGA 4AWUA 1VYRA 1KLZA 3LBMA 3W73A 3A9IA 3KFTA 3DHFA 4CCDA 3RU6A 1WA3A 3YPIA 1LTDA 5EMUA 2YDAA 3W1RA 2H8ZA 3P67A 3GK0A 4UTTA 3G24A 2NUWA 5KZDA 3NPVA 1OYAA 5EYWA 4MUZA 2XN2A 3BG9A 3SY5A 2TMDA 1HUVA 4IOTA 5F1UA 3ABQA 3MHUA 4I7VA 2PRHA 3W1MA 1D9EA 5AHEA 4NZFA 3G8EA 3GR8A 1L6YA 4UTHA 5U7SA 5LNWA 1JCMP 1GYLA 1NF0A 4OGZA 1GYNA 3GDKA 3LCIA 2BX7A 2ATSA 1FCVA 1AW2A 2F7FA 2V8ZA 3S5ZA 1VC4A 2Z2UA 3DZ1A 5KINA 1I2QA 3VE9A 2EF9A 3M47A 4R53A 4GE8A 5FF3A 4HNVA 1XBZA 2D73A 3FIGA 3R13A 1PV8A 4AHPA 4DBEA 2NZLA 4NNBA 4GWEA 4ADTA 5HINA 3NPXA 5CZ0A 3IEBA 5EA9A 1KFKA 3HG4A 1QO2A 2Q8ZA 3NDOA 4GUIA 4Q33A 3DFQA 2X1TA 1OVDA 3GLCA 4ZQPA 2X1UA 3R12A 2HS6A 4JR5A 3O1NA 4UMBA 2WSQA 2C6QA 2V5BA 5J5DA 3TXZA 3PY2A 3OG3A 3M5YA 1JR1A 4DPPA 1LLZA 5CGQA 2CLLA 3LTPA 3BLFA 3M5XA 4AF0A 1OF8A 3PBYA 2A7RA 4Z0JA 1G4TA 1K3UA 5G1TA 2GJLA 4MZ1A
chains in the Genus database with same CATH superfamily
4M82A 3FJ4A 3WX7A 3ITGA 2HPMA 3IPWA 1BLIA 3SCQA 4C5ZA 4J3XA 2E6YA 1UH4A 2OJPA 1PIGA 4LBSA 1Z44A 2XFFA 3L7RA 4DQWA 3R4IA 1MUCA 4M6PA 2NUXA 5FAGA 3OIXA 2WCSA 3S8HA 4ZGYA 4ADSA 2NQLA 4GISA 3H55A 1OX4B 3GNXA 1WDQA 2PEVA 5M3WA 3W88A 4M80A 2OZ8A 4C6NA 4XAPA 4LRTA 3R6IA 1B5TA 1J10A 3WENA 3L5LA 3M0ZA 1CEOA 1XIFA 2A21A 3KRZA 4U3CA 1W9DM 4XKYA 5B80A 2E68A 1GHSA 1ZJBA 2H8XA 4RV3A 3UA4A 1W56A 1BVZA 3ZS4A 4QE4A 4F8XA 1B3WA 2XIBA 4M19A 1E51A 4RDWA 4DHGA 1V02E 3IIPA 2Y70A 2FZ9A 3HO8A 3T0BA 4M29A 2CPUA 2YB4A 2FJUB 4UIOA 1OG0A 4S3FA 4IMEA 2D2JA 4QNEA 4O19A 1XCXA 2OOGA 2FIQA 5CSUA 3ZZ1A 4UTMA 5HOSA 5DFAA 2ZDSA 5BCAA 2I16A 4O50A 4M81A 5AFDA 4UFHA 5D8WA 4MVAA 4RLIA 1GZ1A 3O8AA 3BAWA 1TVNA 1YPXA 2UY4A 1ZP3A 4QLKA 1TREA 2X2GA 4C6EA 1K7FA 3WLQA 3M16A 1O66A 1UWIA 4JCLA 1ZENA 5I3FA 4PMXA 3AJ7A 5KSWA 4HYVA 1JPIA 4HJFA 2PLKA 5G2IA 3S5SA 2PP1A 5CAKA 4MWAB 2ZZ7A 4XVDA 3VDBA 1JYXA 2GUBA 2FVMA 1ENUA 3QRHA 1Z9AA 2PUZA 3ZJ6A 3UD6A 4F66A 1NQ6A 2VGIA 3H2EA 4YJ5A 3CLWA 3W07A 4F0MA 1UCWA 1UD2A 4BR1A 1TVPA 4F2UA 4LVDA 3C4UA 1JCXA 1X1ZA 3KL0A 3M0VA 1SJDA 4I7UA 4ZO7A 1C92A 3KX6A 1E40A 2Y6ZA 3A23A 3B06A 4ZQCA 1IV8A 3W7MA 3VE7A 1BYBA 1EGVA 5BYWA 4B5VA 2ON3A 3SECA 4OECA 2G8ZA 2NV1A 5E0CA 3P0XA 3LSCA 1F6PA 5D38A 1S2TA 5ECVA 3SUWA 1J79A 3S5OA 4IIGA 1FA2A 1RD5A 4LPCA 2GSJA 3L0NA 3MUIA 2OZ3A 3KS6A 1RJRA 4LVAA 1WDSA 4QJ3B 3O6DA 3R79A 4A2RA 4DJFA 1HTIA 4O1CA 2D0FA 1RH9A 1IEQA 3OLGA 1S3TC 3BSMA 4ONVA 5K4ZA 3JS3A 4W8AA 1QPKA 1XBYA 3F03K 4X0NA 3WJSA 3A9BA 4FX6M 4QG8A 1UP2A 3PZVA 4JS3A 4PB3A 2Z6JA 3DG3A 3LCXA 1ZBVA 1BAGA 3VOCA 4LJ3A 3W00A 2R1NA 3E0IA 1WV2A 4PN2A 1TJRA 5CBBA 5KZ6A 1XDMA 1W37A 1LDCA 4Z0SA 5DXXA 3C2FA 2GJNA 3O63A 1XFBA 1FWGC 2PZNA 4J27A 1MYRA 2PDHA 5HJYA 4ATWA 2VELA 5I02A 3DYPA 1JPMA 3BLIA 1OCBA 3MI3A 1WKYA 2CHOA 2GK1B 4PTXA 3MMWA 4LCRA 4A3RA 1ONRA 4KIEA 4Z1BA 3E38A 4E4UA 1E1FA 5D9MA 2BY2A 4YTTA 4JTKA 3BQ6A 1E0WA 1IHIA 1XYFA 1EOKA 3INPA 4NI3A 3NURA 4KT2A 4RV8A 3EKLA 1XSIA 2PD9A 3I6EA 4UQ9A 3M5VA 4LF1A 5DMLA 1E4MM 8XIMA 1JDAA 3IJ9A 4Y6GA 3N6HA 1IGSA 4NZ1A 4NJIA 2J7GA 2V3FA 1EC7A 4K37A 6REQB 2HDJA 2WMIB 4XZHA 1HW6A 4G7FA 1FKWA 3MCNA 2E6AA 2TODA 1SSGA 3FHAA 4HA1A 3BAKA 4EF9A 4I6VA 4AZHA 3CL8A 1MDRA 1GJWA 3APGA 4EVZA 4K7VA 2BY1A 4XSMA 1ODUA 2B31A 4PTNA 4F48A 2ACRA 1A5SA 3GVWA 3NQVA 3G22A 1V7YA 3FS2A 2C19A 3PG9A 2D2GA 1OF6A 3IIVA 2V63A 5GNXA 3VNDA 4HD5A 1OC7A 1SFJA 1J0HA 4WUIA 4D6FA 1QW9A 1XR2A 2QCDB 1UC4A 1SR0A 3KLKA 4WSHA 1XRSA 2GDQA 3PWIA 3W1UA 4PRWA 1DE5A 4RL3A 1I9CB 3LM3A 1XLIA 4JIIX 1CXKA 3SCTA 1QXLA 4JTDA 1E70M 3KUMA 2PF0A 3SR7A 4WSKA 1FKXA 1LWIA 1H5VA 4IIFA 2WANA 3VIIA 4AIUA 3ES7A 2DVXA 4Q4SA 2I17A 3SRKA 4C1NB 3QSTA 3NIYA 6TIMA 3LGGA 1TPVA 3TAOA 5FSDC 1VEOA 1QJWA 1UOZA 2GGIA 3PZTA 3QC3A 4FR1A 4FR6A 4FNSA 4GFIA 2R24A 3P62A 4O10A 4R7OA 4P61A 5HQMA 1LRTA 3AO0A 2Y7DA 3B8IA 1EF2A 1GOMA 2BNJA 1OGGA 4DZIA 3L0GA 1NF7A 2A2IA 2YA2A 3THAA 2R91A 4NNAA 3C8FA 1EPVA 4AC7C 1V3HA 4QSHA 5I78A 3ZT6A 3D3AA 3NFUA 3QH2A 5CZTA 1KV8A 2OB3A 1MW2A 1KC7A 5FF0A 2C0AA 5GNYA 3QN3A 1W3NA 3FDGA 4B2DA 3CHDA 4UFLA 4W7VA 6XIMA 4DJDC 3UZYA 4DJEC 4AF0B 2AQOA 3KBWA 4HZ7A 5FEWA 1K03A 2P88A 5FA5A 3TAKA 4N7QA 4UMCA 1Q85A 5CPTA 2OO0A 2QUTA 1EJ7L 5CSYA 3H4XA 4ZBCA 1RA5A 3NG3A 1REQA 1FWEC 2VR5A 4JTQA 3RYSA 1R9XA 3RPTA 1ICQA 4BWLA 3PFRA 1EBGA 1Q65A 1P48A 2J78A 1JDDA 1OK6A 4NAFA 3WDJA 3OPSA 4PMNA 3N19B 4LCSA 4C60A 2V2HA 1H5YA 4TX6A 4LU0A 1AQ0A 2EQDA 5IHRA 1EJTC 1ISXA 3QTPA 5C7VA 5A6JA 2DZWA 1H3GA 4XKYB 1TVLA 5LA2A 5EPDA 3DHPA 3RPMA 4E2VA 3VIFA 4NHVA 4H04A 3FHQA 5LHEA 4B5WA 1M68A 1ICSA 4BF9A 1E9LA 1AH0A 1SQ7A 1C7TA 2QF7A 1EJVC 1SJBA 1NDZA 4PODA 4S3JA 4H00A 3URNA 1HKVA 3O06A 4Q7BA 3AIVA 1HX0A 4GXPA 3IUHA 4Q8WA 1DTUA 1V02A 4B3ZA 3CL6A 1UZDA 1UWUA 1AL8A 2A3LA 3GC2A 3G1RA 7TIMA 2WVSA 5LIXX 1E1EA 1NH6A 2VO5A 4DLMA 2VFIA 1XSJA 1UR0A 3PZMA 4QEEA 3KDNA 1E4LA 4JDYA 1VRXA 3MTWA 3RM8A 1DQUA 4J3VA 4L4LA 1QI3A 1FCQA 2ZUVA 3L4TA 5AYYA 5MKGA 3W26A 1JD9A 1XINA 1O1HA 1HJXA 2E8ZA 1FP8A 2A7PA 1KGWA 1P0NA 3ZQ9A 3MI6A 1ZNNA 3HOJA 4Q3MA 1GQKA 4H9YA 4OTKA 1HKKA 1X8FA 2D0HA 5DN1A 4LYKA 4UOQA 3NZGA 4O16A 4R7WA 2WZIA 4GO9A 3UWEA 1F7BA 4YU1A 3IRSA 3W2LA 1FWBC 1POJA 3VA8A 1OFBA 1WOAA 5JQ9A 4FAMA 2PDFA 1FRBA 4DELA 4BQ3A 1F3XA 1PWMA 2IKIA 1DWGM 2J88A 3C2EA 1U1JA 3AHXA 1DJZA 2VP8A 3OVQA 3DIPA 1AJ0A 4YVPA 3RX4A 2WV8A 4AY8A 3SCPA 1OIMA 1JNEA 1VFHA 1TQJA 3OW1A 2X41A 3MBFA 3PTQA 3ZVHA 2DIEA 1OZQA 1Q8JA 4NIRA 1Q4WA 3W22A 1XLMA 2P50A 1VEMA 1VFMA 1QNRA 3FV9A 1GK8A 1AH3A 2KAUC 2Q8LA 3HF3A 2VC6A 2ZTJA 1QUMA 1HG3A 2A1YA 3W71A 1TTJA 3MJYA 3L2MA 2IXUA 1FHUA 4JFUA 4CQBA 4O1DA 2H3DA 1GORA 4RW5A 3LU2A 1P6WA 2XIQA 3WJYA 2WZEA 2OQYA 3MHGA 4P7NA 2OPJA 4WJEA 1RVKA 4PMOA 3W7DA 4IWWA 3JVAA 3DGBA 4EK7A 4F2BA 4JZ5A 3ZWSA 3AICA 3DHUA 4JTJA 2WCGA 3M5ZA 1ADOA 3W7OA 1CDGA 4ACYA 4ZFCA 3EPNA 2WC3A 1ZAJA 1R9YA 2CWNA 4MKVA 3AMLA 4KERA 3ARRA 4XZNX 5FL1A 2X1SA 4PUKA 3N17A 3D0CA 4XZ9A 2IPWA 2DVUA 5TAOA 2QDEA 4R9XA 4D8AA 5DX7A 2ZX7A 3WEZA 3G6LA 1I2NA 2I14A 1WNOA 2VOMA 3HJEA 2OELA 2DT1A 1AW5A 2VC7A 3WK3A 1XLGA 1A3HA 2C0HA 2QHAA 1J12A 4K1GA 4GRSA 3CHCA 4KIRA 3W37A 3CMFA 5BOFA 1VZWA 3CIWA 3STFA 3NL2A 4JYFA 5F2IA 1CGYA 3LBOA 4ZQOA 4WVXA 3MI2A 3Q67A 3MA8A 4MMWA 2WM1A 3HGSA 4X3ZA 2QCEA 4XD5A 3L4UA 4L6HA 3BLPX 3WLMA 4RDYA 1QBAA 4AAJA 1JXKA 3PTKA 5C70A 1D3GA 3MV01 2EPMX 1EP1A 1K02A 3MKCA 4TX8A 3RR4A 4ZSUA 1GOIA 1Q6LA 3PZGA 4EPBC 3U5YA 1CLXA 2NXIA 5AYIA 4Q32A 3BV7A 1V7AA 1EO5A 4CNNA 3KXQA 1EJWC 2PDBA 4HNOA 1F4HA 5LA0A 1W5QA 5E09A 2ZRXA 1S2VA 1W3LA 4MSSA 3P8JA 1K7XA 4JBRA 2ZZ3A 4HYRA 4M1RA 4M24A 4O54A 4LXFA 1LORA 2NLIA 1W2VA 3M0JA 3W2JA 4DZ5A 4IHCA 3V35A 2RHGA 5IFTA 1UR9A 2DGAA 5A95A 4DF1A 3H2NA 3R94A 3T42A 4HPXA 3VNJA 1J6PA 3CV1A 2NT0A 2G5WA 3UPBA 2ZRZA 2WBKA 3IK4A 4CNOA 3T9PA 1VYPX 3FKRA 4ZXOA 1QNPA 4ADUA 4AH7A 3GNNA 1E55A 4LOCA 1CENA 4Z08A 1M7XA 2DPEA 1ZJHA 1XYBA 3AIQA 3G5EA 5AC5A 2NX3A 2EHHA 3GFXA 2D2OA 2DH2A 4E4FA 5AHFA 4QS5A 5FIPA 4GI4A 5I06A 3N2OA 5GVJA 3MMTA 1C8YA 5AY7A 1Q6CA 2ZRWA 3GVQA 5A3HA 1Q2RA 4R5EA 3S6OA 4M1BA 4RX0A 1MUMA 1P4CA 3M4HA 4JN8A 5CSRA 5LIYX 3IK2A 3WF4A 2VDGA 2VEPA 3CJPA 4OVXA 1DPMA 2I9EA 1LLOA 1W9XA 1BQCA 3CYJA 4R85A 4Q7IA 3OJGA 2Y0FA 3EDDA 3QGKC 1JCLA 2CLIA 2PF8A 3DC0A 1TV4A 3OQEA 4HK6A 2XPKA 1ISWA 5TF0A 3VNYA 5LGXA 1H7OA 2X05A 1XL9A 4JOMA 1TPWA 2ASHA 2WHMA 2C18A 4YN5A 4HU8A 3FOKA 5CPQA 4XBJA 1LQAA 3IIZA 1T0OA 3BJFA 4NASA 4PE8A 3QQ0A 2CXEA 4W89A 1O5RA 4DAFA 4HNUA 2QIWA 4I3GA 4CQAA 2BLEA 4TX9A 3BUVA 1H60A 1UP0A 1SZFA 4LUJA 1PX3A 3CWHA 4FNQA 4L64A 1EXPA 4IL2A 4EPDC 3STGA 3W1AA 3S1XA 4H7ZA 4DJEA 3DFPA 4A22A 4ECLA 2EPLX 4NAFB 3DXIA 3TIMA 3QHNA 3MQTA 1BD0A 1U1UA 4YL2A 3P81A 3AIRA 1ISYA 5FEZA 3QMTA 4RXGA 3UETA 4JX6A 3GH5A 4MNKA 4U33A 1V6TA 2ZE0A 2NX9A 4R9OA 3M43A 5DEZA 2CWXA 3B4UA 1JZ5A 3CHEA 4DRSA 5BU6A 3REQA 3C86A 3C0LA 3U0HA 3LLXA 1CPUA 4MADA 5DMYA 2WYSA 3I6TA 3UWZA 1YADA 1VIWA 1XRFA 4FXJA 1M04A 3T55A 4LS2A 3WO8A 1EQCA 1UIPA 2AMXA 1HKWA 4J3TA 2X0YA 1RBLA 3MZNA 4GIYA 1QW8A 2VGGA 2OO6A 1F74A 1W9VA 1HQTA 3TOYA 3EXSA 3PF3A 5BW6A 1NFBA 1YE4A 1G0CA 5MKGB 1NIUA 2IS7A 4E0CA 3W76A 5I6SA 3BG3A 3FCPA 4GMEA 1QWKA 2C13A 3EAUA 5CC3A 2QCLA 1VJZA 2HS8A 1EFZA 1HXJA 2FYMA 1PTAA 1KM6A 1E9IA 2BFGA 3FK4A 3M9YA 1CXIA 1HFBA 4L6DA 1JCYA 4HTYA 1UASA 3NVTA 1DL3A 1YEYA 2OX4A 1ZUAX 4RNFA 2WVTA 2XIMA 1CB7B 4CKQA 3NNTA 4IFOA 1LQ0A 1FWSA 4EPKA 4JAWA 2H9AA 4DWDA 3ANVA 4KESA 4AY1A 3LD5A 2O4QA 1TFVA 4NZ3A 5M1TA 3DFHA 3BARA 5HNRA 2XFWA 1FWIC 3T2PA 1BWKA 4YIWA 3LHTA 2PWFA 5EBAA 3UGRA 2VGBA 4N6FA 4E8DA 2TAAA 1E43A 1TYGA 2Z1WA 2WJZA 1OGSA 1PSCA 4O18A 2X40A 4JTAA 4W93A 2Z2AA 1ZBCA 5T9BG 4MJMA 2Y5JA 3C0QA 2V69A 1C91A 4HHLA 1JJKA 1I2OA 2XVLA 2FTWA 2VWSA 4P8VA 4IIBA 1MW3A 2GDVA 1C9WA 2FTYA 3SRDA 4O8AA 3PFMA 1QMLA 4HTBA 1LYXA 2WKGA 4AZ5A 3ONBA 4CQDA 4M7TA 2WMHA 4L1WA 4PMDA 3VM7A 2V5DA 3O7UA 3QZ6A 2Z1KA 3VINA 3KBSA 1LRNA 3LI0A 5D33A 3P60A 5B7YA 3WL1A 1THFD 1LP6A 2XSBA 1QR7A 3LCHA 1FY6A 1TELA 2GGGA 1UB3A 2TSYA 1AZ1A 3KE0A 2E28A 4WDWA 4BHYA 1MEHA 1GVFA 2POZA 1YHTA 3WQ6A 4J3UA 3EB4A 5I77A 5IXEA 3N25A 1H1NA 3A5FA 5C9RA 3CIXA 3GXPA 3Q45A 4NNCA 5JIPA 2G97A 4DYEA 4N42A 3L9CA 1A5BA 5C6MA 1OIFA 2DSUA 3WH7A 1NDYA 1KCKA 4WK9A 1FH7A 1PEZA 3NZ1A 5A6KA 5KTLA 3PN8A 4GYPC 4NF7A 4DM1A 4YVXA 1PE1A 1US2A 2DJLA 5D9OA 4MY1A 2PGEA 2RDUA 5DMNA 2G3NA 2IW0A 4KFPA 2Y8KA 3AS1A 2PI6A 4ROQA 2DZPA 4A2SA 3SJNA 1I0DA 1O94A 1FVPA 4YLWA 5A8GA 4KEVA 1XLDA 5DXYA 2F61A 2J6VA 3SCSA 2Z1BA 2NV9A 2EO7A 3GR4A 3IVUA 5BXTA 3I10A 2E6FA 3R0DA 4LV4A 2VEKA 3IJDA 3C0JA 3C61A 4B3KA 5CC5A 3LV6A 1EYWA 3NJ3A 4CNUA 3MUAA 3RM4A 3VNLA 1O6IA 2GJXA 3FVDA 3ARPA 2AAAA 3WF1A 1PDZA 3T1GA 4WY0B 2J9ZA 4F2TA 1QOXA 1ZCOA 2EPNA 1SMDA 1HJUA 5EMYA 1SZRA 4ERGA 2J8GA 2VZTA 3NSXA 3TFCA 4O28A 1FCUA 3I68A 3E6EA 2GOKA 1JQXA 4PL2A 4S3KA 1G4EA 1X8CA 4BQ4A 4QJ1A 3VGBA 3K46A 5A6MA 4AXNA 3TQ0A 1SZGA 1DWJM 4CQCA 2XIIA 1SZNA 3Q58A 1UH3A 4ZOEA 4L4PA 3C5QA 2PMQA 1PDYA 3H70A 3TSDA 2R82A 1HP5A 4WDUA 4LBRA 3GUWA 2RDWA 3DECA 2Y2WA 1KBBA 3GH4A 2E0PA 2DZAA 2W62A 3E0FA 3WSUA 5EMMA 2NQ9A 2JALA 4QLLA 1D3CA 1RCOB 2G41A 1KM0A 4OOZA 3CT2A 1EOMA 2YYTA 1VCGA 3DFYA 1KGUA 3VIGA 1ZAIA 4G5DA 1XLAA 1FH9A 4KCTA 1F5ZA 4YWSA 4NXSA 1FXPA 4TTGA 2O92A 2PC8A 1QCWA 3PJTA 4XO7A 2BXZA 1T41A 3KVKA 2UZ9A 2YA0A 4AW7A 3GB6A 2GUUA 1XBXA 4GCAA 2V81A 1J0ZA 2RDTA 5F4SA 3UZXA 1YQ2A 3SAZA 3BCFA 3SFWA 2A85A 1TUFA 1FCBA 3GTFA 3A3WA 5DT5A 5EMKA 3H2MA 4IG2A 1NARA 1PZ1A 3DESA 1KM4A 3ZSTA 1UJPA 1TV7A 1X39A 4NYUA 2YZ5A 3M0IA 1H63A 2DT0A 3TK7A 2PCQA 3CWNA 5FCZA 3O2LA 3BLDA 3JRKA 3EWWA 2NX1A 3HURA 1YW1A 5HBFA 5HJLA 3APYA 2CITA 2QDGA 3AWOA 4X22A 1YX1A 3FXYA 1PZ3A 1SO3A 1R3WA 4LVFA 3URAA 2WSPA 3M0MA 1KLZA 3A9IA 1QTWA 1V0NA 5A8QA 3R1ZA 2OFJA 4AEFA 3G6MA 3B40A 4CCDA 3ZSSA 4X61A 2HVMA 5AVHA 2YDAA 1X6NA 3PTMA 3V0SA 3REQB 3T81A 3K1GA 1OYAA 3NSMA 5E5CA 4MUZA 1HNYA 2X0SA 3SY5A 2AL2A 1V0LA 3O0KA 1G1YA 3ABQA 1F6YA 3W1MA 4BQ2A 3CUZA 3KOZA 5AHEA 5I03A 2O4MA 3GR8A 1L6YA 2OSWA 4UTHA 3AI0A 3WLLA 1EJSC 1JCMP 3WD2A 3LCIA 1DE6A 2Z1SA 1W2PA 2V8ZA 1VC4A 3WFZA 4FXFA 3DZ1A 5KINA 3M47A 5FF3A 2MANA 1PV8A 4V15A 4GIAA 2XH0A 3RU8X 4ADTA 1FH8A 1OEPA 5A69A 4FOKA 1KFKA 4GUIA 4Q33A 3DFQA 4JIHA 4PTDA 4KCUA 4PZVA 2PGFA 1A47A 1HT6A 1NWTA 2X1TA 4QFUA 4ZQPA 4A3YA 2HS6A 2ACQA 3O1NA 4Y9PA 4UMBA 2B81A 3OG3A 3DCPA 3WLKX 3LN3A 5A6TC 3BLFA 1TX2A 1Z89A 4J3WA 3CV6A 1N7KA 3AXIA 4UFIA 3XISA 2WK2A 1D7FA 4B4HA 1EJUC 2FFCA 1KFJA 4IXXA 2H9AB 1DXEA 3N9KA 3LMZA 1Z8AA 4K36A 3W7HA 2WHLA 1FFRA 4IPLA 4PFMA 3WUFA 4DM2A 1E6RA 4FSAA 5G4EA 3W7CA 4W87A 4YXGA 2HSAA 2JEPA 1AFSA 1F3EA 3WDHA 3GG8A 1DORA 1DJGA 3SEPA 3VGEA 1XKJA 2VFHA 4PL1A 4F9JA 1O68A 2VZSA 1J8VA 2ACSA 5U4NA 1HKMA 1VBGA 5A6BD 3SGZA 2OCZA 1W9UA 3WLIA 2VC9A 4NY2A 1Z41A 5HULA 3U3HA 4HIBA 1XLKA 3CUXA 2XM1A 3CAQA 1D2KA 3W82A 3KTCA 5DO8A 3BMWA 4S2BA 3PBUA 1RCXB 4GVHA 2WNWA 1JGIA 1QPOA 3W23A 2R6OA 3AZSA 2VVNA 1XGZA 4G6CA 1AW1A 1MFUA 4IPNB 4Q8PA 3SZ8A 2DU2A 3O0FA 3F2CA 1VFTA 3EXTA 4X63A 2Z0IA 2FTPA 1B2YA 2XUCA 1JL8A 3A4AA 3ME3A 4Y9OA 3O6YX 5LA1A 3IJIA 3TE9A 1PYMA 3HGOA 3N15A 3ZYZA 3MV11 1F07A 2E6DA 4DUXA 3S6TA 1GOWA 2VC5A 1NSJA 5I7GA 1K8CA 3EDEA 1M5WA 2REQA 4ZODA 3WN6A 5K7JA 4URIA 9XIAA 2C71A 5JIWA 4ZB2A 6ALDA 1V6UA 4DNMA 3L4YA 3SN0A 3LA4A 1W5OA 3AIBA 4AZCA 1YXCA 2XH7A 5HATA 1JCJA 4KBXA 4O8RA 5C8BB 3BANA 3M0XA 2PBOA 2QNEA 2NSXA 1I2PA 2PS2A 4XD6A 3IJLA 2OG9A 3PPGA 2BOGX 4KETA 3ITVA 2FHBA 3W7JA 2J79A 4C7DA 3SN4A 3S2MA 2CLPA 4UTWC 3IIOA 1F05A 3KW3A 2FH6A 1GCYA 1AD1A 1TPUA 2HTMA 4IJRA 3PWAA 5HNTA 4KEUA 1K9EA 2YGYA 1HZYA 1LG2A 4ZXLA 1KBKA 4LANA 4Y9MA 3LM7A 4FOUA 4IQLA 2WWDA 3K2GA 5M03A 1BYDA 3HQ1A 1ISVA 2BHUA 2HROA 1J5TA 2C1IA 3W1TA 4W7WA 3VDCA 2QPSA 1I0BA 4MWAC 2YB1A 2E1DA 4C6QA 1L8PA 2ZWZA 3J7HA 3V5CA 4GVIA 2V3GA 4UTLA 3WLPA 1A0EA 2GJXB 3SCVA 3IGHX 4FNRA 1SW0A 2IPGA 1Q6FA 3DDMA 2VMFA 3QEZA 4MZ8A 4I90A 3G3MA 1BWLA 1GKPA 5C7HA 1LOSA 3AZRA 4NUWA 3HMJG 3AHVA 4L1GA 1KNWA 5A8OA 4Y8EA 3CBWA 1BG4A 3UR2A 3W28A 3VKKA 3H53A 1IIHA 5HDRA 1M1BA 1BKSA 1TWIA 4JIEA 3ZR5A 1MXSA 2FHCA 3S46A 1GVIA 3UVAA 3S42A 4OU1A 2E3ZA 3EPMA 3OODA 3TA6A 3MUY1 3LSBA 1QFEA 4U10A 4J40A 1J96A 2CKRA 3EB3A 1QI2A 3VTRA 5EB8A 4S39A 5JBEA 1V79A 5A8PA 3K4WA 4ZQNA 4AB4A 4IMCA 4IXHA 3SB0A 5CXPA 2YLLA 3CZKA 3CWOX 3POCA 3UYCA 3N9SA 1WO2A 4F9DA 2XVKA 3MANA 4C5YA 2VEFA 1OZMA 2YCJA 1R3VA 4HU3A 4J7RA 3H23A 1WZAA 1X6LA 2JEQA 2CZVA 4GJ1A 4GX8A 3TJIA 2X1RA 1IXPA 3BJSA 4MKNA 3M7SA 4JNZA 3NTYA 1SPQA 1YNPA 5D2WA 2DT3A 1XDLA 2GGJA 2CHNA 5HMDA 1V77A 3DUGA 1A5AA 2PTWA 3GHRA 3OLIA 4TMBA 4DWSD 1E3XA 2CU0A 3H2AA 2NVAA 2X30A 1XYZA 2QDHA 3B0VC 2CBVA 4FX7A 2HV5A 1XW8A 2ZA3A 1KBLA 4M7SA 2J7FA 2A4AA 2PDMA 5HA7A 5F7UA 3W7RA 1T5AA 4IFRA 3ARYA 2Z27A 1LT7A 3HQPA 3TTSA 4YVVA 3WNMA 1H0GA 2FLIA 5FJPA 1RA0A 2YW3A 3QHMA 4IG2B 2E9MA 2I5GA 1PWLA 1DTNA 2G37A 2RGMA 3Q65A 4D2JA 3GG1A 2YCIX 3LGDA 2PTYA 1E71M 1UZ1A 1UROA 3SQLA 2SFPA 3GBDA 3SGUA 5JH2A 4A8NA 4RE2A 1X7IA 4LYQA 3SUVA 1ZL1A 4JQ3A 5JMUA 1E6QM 3NQFA 4LALA 3WQFA 2A6NA 4HPJA 5BMWA 3V1HA 1JIBA 3V36A 5PTDA 2NUYA 1L6WA 4U28A 2XIOA 3B03A 3PPFA 3AZTA 1DWHM 1QPNA 2X42A 3PUDA 3FJLA 4H9ZA 4XIMA 3UPMA 3WLJA 4DBWA 3OZMA 3BCDA 3VFCA 3CEPA 3PWGA 2GQ3A 3H7VA 4MB3A 1Z69A 2X7WA 3CO8A 4FEZA 1UPMB 3V0TA 4PUNA 4MNMA 3HG5A 1QT1A 4S23A 2QT3A 3SDOA 3UWUA 3NDYA 3QOKA 2WHKA 4LYPA 2OR2A 4J9JA 3S47A 3BW2A 3XINA 3W86A 1XM3A 2VURA 1A50A 4P8XA 3R89A 3USZA 4B5NA 5LNVA 1CGUA 5ABFA 2AL2B 1JCNA 4A35A 3AOFA 4NRRA 3DENA 2ZZ1A 4LUYA 4IIEA 3A13A 1WAUA 4A3UA 1MW1A 1WP6A 3T0AA 5AECA 4LUIA 4BEUA 4EE9A 2PTZA 5CBJA 4OUIA 3W2MA 3T0TA 5LXXA 3BJTA 1CIUA 5HPOA 3UXAA 3CPUA 4QCFA 1OG6A 5HJXA 4H8UA 3GDRA 3S1GA 4GNKB 1ALDA 3TLLA 3GU2A 3NYZA 4QHRA 1SFLA 1IXNA 1TMHA 3WZ0E 1C29A 5FD0A 4M51A 4M6VA 3NQ6A 1ZFJA 3RCYA 1YLVA 3CZ8A 2PP3A 2ALDA 3FEQA 2W0UA 3MBDA 4Q8UA 2WMKA 4HSHA 1YXDA 2I1OA 3W83A 3MO4A 1OFDA 2BB0A 3T4CA 1SGJA 1LL7A 3CB3A 4ZCWA 3GTNA 3MCMA 1GJUA 3QF0A 2V0TA 4QIUA 3LY0A 2ZICA 2WNZA 4DO7A 3I3DA 3MMUA 2R8WA 4O14A 4Q6XA 1MNSA 4QROA 3TV8A 2VENA 1MZHA 3N2CA 4HZ6A 1NY1A 1Q6GA 4XD4A 2E5DA 1CI1A 1ZS2A 1EB3A 2WQPA 4HOZA 4N9EA 4RNJA 2UWFA 3ICJA 5AHLA 1VCFA 3FY1A 1SO4A 2Q8XA 1P1MA 1J0KA 4AZGA 1IE7C 1A49A 2GPTA 4MIMA 2F9RA 4GABA 3LTYA 5D02A 2PWUA 3WDRA 3N04A 2ZOXA 6PTDA 3VC6A 4GKLA 3AHTA 2IKHA 4RE0A 1EJRC 3R10A 5F1VA 4X0VA 4IP7A 2BS9A 3W1LA 2XWEA 1XLLA 1R7OA 4JHZA 5B7ZA 2UBPC 4D6DA 3NGFA 1T40A 2JGQA 2XM2A 4Y9NA 1YPIA 4GYFA 4MYAA 4CEXC 2W91A 2QW5A 3WH8A 1K9FA 1EC8A 4HMDA 3LUTA 1QK0A 1T99A 1WDRA 1P0BA 4PR4A 1Q13A 5EY5A 4DUWA 2PDYA 4JEJA 3OLEA 1GKQA 1LQ2A 4GO8A 1UZHA 3OZPA 4J5NA 1ZGDA 4HKPA 4LC6A 4DZHA 3QGVA 3R0KA 4QE1A 2I57A 2JBMA 4D6CA 1LBMA 2VD9A 1XLHA 2ISWA 3W7KA 3LHVA 1U22A 3HBLA 1DJIA 1D8CA 3CUHA 4KQNA 5DBUA 4ERIA 1RALA 3WBEA 4QDMA 3NUKA 1NFGA 2J66A 4OWGA 3NQGA 3QMSA 4HOXA 4GHRA 2W66A 1ECQA 1W5PA 3MPGA 4W8BA 1JNDA 4GK8A 2REQB 2O9RA 3UPWA 1GG1A 1WKEA 3EEZA 1Z3NA 4FLQA 4G9PA 7REQA 4LC8A 5KZMA 4AZCB 2B7PA 2IQDA 3K1DA 4YS1A 1XLCA 4R33A 3GS6A 3W7IA 3UERA 3L65A 2OYMA 2OWXA 5AC7A 2PWEA 1BFNA 1KXTA 1B3YA 3ARQA 4MNLA 3HPFA 4GKTA 3HA1A 4JTTA 2EAWA 3G1SA 2OEJA 2FKPA 3H8AA 4CVUA 1OC5A 1E72M 4QP0A 1AVAA 3T08A 3W72A 1UHVA 4OFCA 4CGTA 1XC4A 1ODZA 1KRBC 2VM8A 4U5IA 4ZTYA 1B0IA 3EEGA 4J4KA 2CHRA 3BGAA 2QGYA 3W01A 3WG6A 4UZSA 2YXXA 3SCOA 3AIWA 2OGJA 1CNVA 2YDRA 2EKCA 5DT7A 3CZJA 1F73A 4LH8A 4CD6A 2IUZA 1W31A 4PMQA 4YCPA 4AD3A 1UD3A 3FN9A 1KRMA 1PZ0A 1YIXA 4DYKA 3CEUA 5C5YA 4K7YA 1DXFA 1UQZA 1UWRA 2VX4A 3T78A 4YCOA 3QY7A 1H61A 3P5ZA 3NQ7A 3VOIA 3CZGA 3XIMA 3H54A 5E9AA 2CLHA 3B8TA 1DP0A 4AD5A 3UBPC 1K77A 3GRIA 3HIJA 3KTXA 3PJXA 4EX4A 1UA7A 3KDOA 3QZAA 1DWIM 4G7EA 3V7PA 4NP7A 5BXSA 2V5KA 2QCNA 3O6CA 3ABOA 1J6OA 3VMNA 3B8DA 1UR3M 4KWVA 1TR9A 3IACA 2DIKA 3NDZA 3H2OA 2QYGA 3GUGA 1UUQA 1J5SA 1V51A 3KP1A 1TSIA 4WSJA 4HMCA 3CO4A 4HNTA 1V5XA 2PDUA 1XGDA 4JCMA 5AYBA 4JQAA 3R58A 3P7YA 2O7SA 1L9WA 3OYXA 4DJFC 2J6XA 1E4NA 5HMSA 5M17A 3KP0A 2VZUA 2QJHA 3UJFA 3BGGA 4A21A 4O0QA 1IT0A 2P8CA 4WY0F 4RZ6A 2QPXA 1FWJC 4FZIA 4KMQA 2WMFA 2Z1XA 3KS5A 2O9PA 3A4WA 2VRKA 3UEQA 3C2OA 1W32A 2QJIA 1JUBA 4LEFA 3SIMA 2EPKX 4P7QA 1WQ5A 2XZ7A 3WNNA 2VT0A 4L56A 7ODCA 3PULA 3HV9A 3TLQA 2P0OA 4GQGA 5HQEA 1GJPA 3NAVA 3PZQA 1W3IA 4IX0A 2E8YA 4CCZA 3WFAA 3EYPA 4LSBA 4LUSB 3SADA 4FPSA 4GQRA 1PB0A 3QV8A 2OQLA 3RN6A 2WXDM 2GGEA 2YKKA 3G2GA 2W6RA 3HV8A 3VU2A 3CQHA 4EAMA 3TMQA 2Q01A 3BLKA 4GUHA 1YTDA 3AYSA 3HG3A 1QHOA 1WDDA 3ARZA 2YOCA 5D09A 3VOGA 1EHAA 4JIQA 4V33A 3UWQA 3GDBA 5HMEA 2EPOA 3DEQA 2PDPA 1B3ZA 3LPPA 3QQ1A 4KEMA 2UY2A 3VMPA 4B5SA 4JY8A 5XIAA 3AUOA 4C1KA 1JFHA 1MRQA 4OUEA 3UJEA 4MPQA 2QUUA 5IDIA 5JH1A 3QW3A 2O9OA 4J2MA 3IGXA 1B57A 3LCWA 5JXQA 4L9ZA 3AMDA 1KV5A 3TROA 1KR1A 3BVJA 1SW7A 3ANUA 3GBEA 4POCA 4O1AA 1R38A 9CGTA 1W8SA 1S5TA 5DY2A 2D0GA 4W4QA 3H2FA 1LWHA 1RJPA 1XP3A 4GYJA 2NQZA 5C2XA 1IEWA 1E0UA 2J74A 2CLOA 3MYPA 1FWWA 3TW6A 2A0NA 3MW7A 1V6WA 3ZR4A 1KM3A 1P5BA 3V0UA 1R3QA 2FQIA 4C6CA 1W8GA 4GUGA 2IQTA 2YDSA 1KRCC 6REQA 1W1VA 1UKQA 1JCTA 5ABEA 4JL1A 3IGUA 4D9PA 1E6XM 1KXHA 1V0KA 3LCFA 2X16A 2WMJA 3GKAA 4CNPA 4HMNA 2FZDA 1M6JA 1G4SA 1OCJA 1V08A 2OEMA 1KBJA 1ZJIA 1A4LA 1Z32X 2BZNA 3LPGA 4UCGA 4D6HA 2YL6A 3TKFA 4ICCX 3UY7A 1EXBA 1LBFA 3QY8A 4MY9A 1F9CA 2V2DA 4TVUA 1XX1A 1XWYA 2YCKX 3EA3A 1K7EA 5F2LA 1T96A 4RNHA 3SQSA 4QTGA 4PTVA 4MGGA 1K4HA 1JXJA 1FWCC 1JI2A 5CLWA 2GWNA 3NOYA 3CXOA 1FOBA 2HK1A 3OVPA 1C8QA 4JEQA 3FA3A 3QZEA 2V5JA 2GSHA 5D05A 2Q02A 4C6DA 4M3PA 3MUCA 1HL8A 2XFYA 2VFFA 4H01A 1BF6A 1V6XA 3LYEA 4LVBA 1OHLA 4JQ2A 1BKHA 3MP3A 1NEYA 3TCEA 4I8DA 1HJVA 5CPMA 4LF2A 3EWXA 2OLSA 3BE7A 3A12A 4B15A 4KS0A 2OSYA 3UJSA 3TN4A 4PYSA 1QNSA 3RXZA 3DYOA 3WMLA 3AS3A 4NKCA 4XTDA 4DF2A 1Q6OA 3A5VA 1U5VA 4IJBA 3WUGA 3E0WA 3M46A 3BL3A 3GG7A 3KZPA 3GAYA 1NWRA 3UGVA 3F5KA 4TO8A 1KCLA 1ZB5A 1F4AA 3NZRA 3NO3A 4J1OA 2OSXA 4KFOA 1JDFA 4GXMA 1P6BA 4NX0A 3TP4A 2GFTA 3B9DA 2W79A 1XG3A 4GY1A 3O07A 4IGHA 1EH9A 3TWBA 1EJXC 3ABSA 3T09A 3QYQA 4CN6A 4U4MA 4HZMA 1IR1A 3IAQA 3ORWA 3GXNA 3KRUA 4BWLC 3LX9A 3PP7A 4NX5A 4JTFA 1B3VA 5CPLA 5LNRA 3PUOA 5CG0A 3WF3A 1W6TA 1WUFA 1YDYA 4GI9A 4O12A 2J24A 3NQDA 4K68A 4HHHA 3BZGA 3R8HA 1A5CA 3TR2A 4LVGA 1GVEA 2D20A 1I75A 2WC7A 4IJCA 3LCGA 1P43A 5AOUA 2JFEX 1LWJA 1EZ2A 3B04A 3DFOA 5CJMA 2GQAA 7REQB 1QOQA 1UD5A 5A6AA 1XI3A 1BXNA 1GZJA 3ZFHA 4AX6A 3S9ZA 2V30A 1OT1A 4GGBA 3P80A 4DO5A 4UR9A 3VGFA 3BW3A 2CXGA 7CGTA 1JF5A 2F6XA 2AGKA 1WXJA 1R3YA 2HWGA 3ZJ7A 1M3UA 2WBGA 4E4PA 2OEKA 3TCSA 1KFCA 2A79A 3BURA 2CLKA 3FFSA 5CPOA 1Q66A 5DF0A 1ZCCA 4AIBA 3PJWA 3R8RA 3W25A 4E6MA 2E4TA 5DLCA 3SQMA 4J35A 4HSNA 2EG7A 1AD4A 2WB5A 5AN7A 1CXFA 1A4MA 1U5JA 2E9LA 2PB1A 1UUMA 3GVGA 4DBUA 4NYYA 1PZ2A 3E12A 3GVRA 2ZXDA 3QPEA 1TJPA 4HP5A 4XX6A 3WYZA 1YNQA 4J3ZA 3T2OA 3T2QA 1M03A 1A80A 3STPA 3UYIA 4CNSA 2WKJA 4G1NA 2JKPA 5I3GA 3GTXA 5GJPA 1ECEA 3QY6A 5C2GA 4JTSA 1HL2A 2GWGA 3CQKA 3E5PA 4HK5A 1E5NA 3EOOA 2V67A 3AIUA 1L0PA 1GQNA 1QW7A 3WFLA 3CTLA 1O95A 4JNYA 5C55A 1MRAA 4XWUA 7XIMA 1SR9A 2P0IA 2GVEA 3QPZA 2QAPA 4UZUA 3G1YA 3F5JA 4AEEA 2IQ0A 1VPYA 1EBHA 1I2RA 2O7QA 3VO0A 3B05A 1KFEA 1AA1B 3W7GA 5HPCA 3W1QA 5ABHA 4O11A 4CD8A 4MHBA 4ZOBA 4AYSA 3RJYA 3BXWA 4MFDA 4NJHA 4C6LA 4G7EB 3WLOA 2R1MA 1TPH1 1LOLA 5AYZA 4W5UA 3UZZA 2DT2A 3LOTA 2I9UA 1RK5A 3LQGA 3KAOA 5GPRA 3CTTA 2J8TA 1BPLB 4FK9A 3RIKA 3U7VA 3PBWA 3EDFA 2DUZA 3WH6A 4KGLA 3G0SA 1XLEA 3VZXA 4PMZA 2G3JA 3MSGA 4KRTA 1TPFA 4XSLA 3PM6A 1NQKA 5A1AA 4CCCA 3D3FA 2FMNA 1XIGA 3NGJA 3MCOA 2C14A 5IDZA 3VDHA 1IEVA 2ZXAA 2X0HA 4B4FA 2A3BA 4V2XA 1LF1A 3CT7A 4C1LA 4HPHA 2YBUA 3W7NA 3L4VA 1RPXA 4Z2KA 1L2QA 5LKYA 4C6IA 4DXVA 1UR4A 3DU0A 4YPJA 4AUBA 4DWSC 3VKDA 3AALA 2P8BA 2PDNA 5D04C 4DBSA 1SFTA 2V3DA 1FTXA 1RLCL 3IIXA 1P0EA 3WDPP 3CC1A 4IUGA 1OX6A 1XISA 3RG6A 2NW0A 4RNIA 3S2NA 3LHZA 4EXAA 3DBNA 5AYXA 5FI8A 1RP8A 2VR4A 4WKHA 4CEUC 3LHWA 5LIUX 2NQJA 1H7PA 2A5HA 4S3EA 1KA9F 1TJ1A 3II1A 2AQVA 4DF0A 5HUOA 1XIEA 2DSKA 3I4EA 1XH0A 4H9XA 3KCLA 1K9TA 3B9NA 4RZBA 4Y8FA 2P3EA 1XIBA 2FB3A 1GYMA 2WLYA 4XBKA 4O0KA 3PB2A 1XIIA 1Q5MA 4OBTA 1PCWA 5IHSA 2DZXA 1K8ZA 3ZM8A 3TC3A 3LGEA 3KRBA 3M41A 3C8NA 2J9YA 3EZ4A 4LY8A 1LL4A 1EHNA 4TIMA 3TYUA 4U5KA 1X1NA 4Q4PA 4AFYA 4PSRA 2CEQA 1XYCA 2XDFA 3RJXA 2ZKMX 3DI1A 3LV5A 4QSFA 4JXCA 4PUUA 4H8NA 2ZDRA 4FS9A 3CV7A 4PTWA 5I3DA 3T0CA 3L67A 1IWBA 3S5YA 4Q8VA 4I6KA 5D2YA 3NQAA 2J9XA 2GZXA 2Q71A 5E6ZA 4FA3A 1VPXA 4XBSA 3S3GA 1UBSA 2ZC1A 1BWVA 5E70A 4Q4QA 5TD4A 2FGZA 1VCVA 1QO5A 4RUBA 3LCLA 3L2LA 3C0SA 4AWSA 3Q2DA 1XPYA 4Q4KA 2VX6A 4TVCA 4L4OA 4Q8QA 1OFQA 3KWSA 4JNMA 5ABTA 1U83A 1MWOA 3BOXA 2GQ9A 4PB5A 4CCEA 4C6OA 4OE7A 2J62A 1B3XA 3K8KA 4JX4A 4XV0A 1CLVA 3VX0A 3DG7A 5HWNA 4QG6A 2ZBTA 2X7VA 3M0KA 3KOWA 4CU6A 1JI1A 3B0XA 2DW7A 1WBHA 4FP1A 3PBVA 3TXVA 5CBIA 1TMLA 2YLAA 1UR2A 3PZIA 5DBTA 3GX9A 3OLDA 3L4ZA 3WNKA 2BY3A 4GX9A 2HXUA 1CW2A 3GD6A 3TN5A 4Z1CA 2W9MA 3VD7A 5GQBA 2V3EA 4GIRA 2GVYA 4N9DA 3S9IA 2VCAA 4JFVA 5CSSA 3SFKA 4AG0A 5K3VA 3PHAA 2QQ6A 1B90A 4CLMA 1ZU8A 4A8IA 4UWMA 1NP2A 1CECA 4QX4A 4GGHA 1G94A 1XHGA 1TIWA 2ZVIA 1BYAA 4UTUA 4ATDA 4LAZA 5EBUA 1YTEA 1A53A 2D24A 3NPWA 4DIAA 4H6QA 5CPNA 3N2MA 1EP2A 1IQ8A 3SGGA 1ZSXA 2XVPA 3Q4DA 3RLHA 3CHVA 3TYEA 3WLHA 5G1MA 4O15A 1ZBKA 1BVWA 4AWUA 1PBGA 1VYRA 1JEZA 3LBMA 5CC6A 3U4AA 4CU7A 3ITTA 3QGAC 4XD3A 3RU6A 5C71A 4PBEA 4L6OA 3WKZA 5EMUA 4LYRA 2PU0A 3P67A 3GK0A 1QBBA 2NUWA 1WZKA 5KZDA 1ADSA 3NPVA 4KWSA 3SRHA 4GH3A 3UNTA 1Y5XA 3CK5A 1UMYA 2O9TA 3OA5A 1JFXA 1OM0A 2CBIA 3BMXA 3MSRA 4NZFA 1RD6A 1ONEA 5DRCA 3N18A 2QUMA 1K6WA 3M07A 5U7SA 1GYLA 1NF0A 4Z2JA 3ZT7A 1GYNA 3GDKA 5A6BA 4MB4A 4H8HA 1J0IA 2D2HA 5AZ0A 4S3BA 4AWEA 3SUUA 4GE8A 2PLCA 1R3RA 1BSLA 1NOWA 2OQHA 3VGGA 4MB1A 4IZGA 3PZUA 2BXYA 5EA9A 1QO2A 5CPSA 2Q8ZA 3WQWA 1KQYA 1J9YA 2QPUA 3IUDA 1OVDA 3SURA 4Q4OA 2YXOA 1OGBA 3B8UA 4FF5A 2WSQA 2WJDA 1XQLA 4AD0A 1PO9A 3M5YA 1J18A 4DPPA 1LLZA 1YKWA 2ZUNA 3TEVA 3TNBA 3M5XA 4CNTA 1OF8A 4Z0JA 3MKVA 1K3UA 5G1TA 3UXIA 2GJLA 2G3IA 3W87A 5DRIA 5BMXA 2YL9A 3LEPA 2HVNA 1DIKA 1FFQA 6A3HA 3SSJA 1VBRA 3NA8A 3HN3A 3FSUA 2PDCA 4AZ7A 2VVSA 3A6OA 2GVJA 1OB0A 2ZUTA 3W0KA 2CIPA 3QKZA 3GHTA 4EXBA 2OWCA 3QW4B 2VI0A 4DJDD 1E9YB 3COTA 4ZENA 5HNNA 4R34A 2ABBA 3ZMRA 2O56A 1YTKA 2DFAA 4D8LA 2DUAA 1D7KA 4WJ8A 1XIMA 4NXKA 3DERA 1NWUA 5HR7A 3F4CA 1WKFA 1VJSA 4H9VA 1J11A 3HQOA 3TA9A 1RAKA 2XIJA 5ENLA 1FWFC 3WMCA 1ME9A 3PZOA 4PUMA 2FZBA 4WR3A 1AJ2A 5FACA 4AXKA 2Z7GA 2ZCGA 3FJNA 3VNKA 2UV8G 4RXFA 1XCFA 4NVTA 4AIEA 4PEKA 2PFHA 2YDQA 1E56A 1S1RA 1H41A 3MMDA 1J2BA 1HVQA 4QXIA 1PHWA 2YX0A 4AU0A 2ZRVA 4ZE5A 1OBAA 1VLWA 1UG6A 2C3ZA 4CN4A 4PCFA 3FEMA 2OKOA 4PUWA 3TC7A 3LPOA 5EL1A 3PUGA 1SW3A 3UG8A 4D1JA 4HBKA 2FHFA 5G2WA 3GWQA 1UWQA 4N6EA 3WQDA 3WBAA 4E2DA 5HUPA 1JZ2A 3BAJA 3NM3A 2RDXA 1MZRA 1DV7A 2VR2A 5C9XA 4WX2A 4JTCA 1WE5A 2I7GA 3QXBA 4KKXA 1KGXA 2VKZG 1NM9A 2C7FA 3OG2A 1TZ7A 3CPGA 5H8MA 4MZYA 4N0RA 1HIZA 1UD6A 3EX3A 5FSEC 4PCNA 4AZIA 2PCEA 3WD0A 1ITQA 1HP4A 4ORIA 4AZBA 3WQEA 1A5NC 3HG2A 4PULA 1MSSA 3UR5A 3Q94A 1MEWA 1M53A 2CLMA 5K9DA 3BLOA 3RLVA 4GC4A 4C91A 1US0A 2RJHA 4H41A 3GW0A 4H9TA 4CD7A 1AG1O 2F2HA 3I7SA 5I24A 4WOQA 1V0MA 3VCNA 3HFTA 3I3EA 3QFWA 1UWSA 1HKJA 4F0LA 2QKFA 1R2RA 4G8TA 1CGXA 1O5KA 1QVBA 1H50A 4H19A 2BGNE 2J7EA 1PX8A 2Y85A 3W1XA 1HN1A 1QNVA 3E2SA 4DWSA 4QISA 2QV5A 2XZ9A 4FLSA 4XG1A 2NWRA 4Q8NA 3S2CA 4US5D 4NT0A 1KKRA 2P5NA 3HJZA 1Z42A 2BASA 3GNRA 1NAL1 1VKFA 1SFSA 3RMJA 3N6QA 3QR1A 1JQVA 5XIMA 4D6GA 3PTDA 3EXRA 1SJCA 4FF7A 2WZHA 1RV8A 1G7UA 3VNMA 3JU2A 1ZRQA 1LUCB 3LRLA 4C6FA 1H7NA 3UP8A 1EEXA 1XUUA 2OXNA 3L5AA 1V93A 1C93A 3AISA 2BV9A 1VIZA 4AWTA 2E67A 7TAAA 3FKKA 1JRBA 3WH5A 3CUJA 3GAKA 3IJQA 5C9WA 1J2WA 1GOQA 5E1QA 4RZ5A 3P0WA 3LDVA 4GQBA 3WBWA 3W74A 1AZ2A 1Z48A 3AQUA 3CLMA 2JF7A 2VXNA 4KCVA 5T8GA 1DQWA 4RPQA 3RCNA 1DHKA 2HNEA 3Q37A 1VH7A 4ZE4A 4DAIA 4L7ZA 3KL5A 2R1PA 1UQYA 2CLEA 4FXSA 4QEHA 1RPKA 3BV4A 3H2CA 2A3EA 3AS2A 4S3CA 1UKPA 1W54A 4HU4A 3CUGA 3WNPA 3EX6A 1DEDA 5LIKX 3E9AA 3SJ3A 4IT1A 3PC0A 3TNOA 4L61A 4Z17A 3QSRA 3FXGA 1VENA 2Q6ZA 1TUXA 1PKMA 4I7WA 3TZFA 3WK2A 4WY0A 4LB3A 2EBNA 1TMQA 2EG8A 4GACA 1ZLPA 4XK2A 5E0FA 2LLEA 4QBXA 2D1ZA 2ZVRA 3EMZA 3AJXA 3LZ3A 3PBGA 3LB0A 4XAGA 4NU7A 4E3TA 3T07A 1FWNA 2EPHA 4O1BA 4A8LA 1E0VA 3R7MA 1E6PA 4GG9A 4H6KA 4WJXA 1LRQA 1V6VA 4S38A 3W7PA 1IZJA 3MSDA 2VWTA 2WZMA 1CYGA 3NZQA 5A2CA 5G2HA 1NFPA 1B54A 4HK7A 4Y9AA 5F4WA 5IFPA 3TJ4A 4CQ8A 3AU2A 2ZADA 1W3JA 5IBXA 3TQVA 1OFPA 4MLJA 2XN1A 3T8LA 2C91A 2ISFA 1PHQA 4XISA 1KXQA 1UP3A 4H9MA 5AHIA 3LTSA 4Q4RA 1DHPA 1MQRA 3B0UX 2WLZA 5HANA 4Y7EA 5H8UA 2E5CA 5EKYA 3AROA 1GOXA 2XJ7A 3QR0A 3CASA 3PPCA 1J4EA 1VEPA 3IRDA 3C52A 3ATZA 1X96A 5LXEA 4WIWA 3GYCA 4IQDA 1UW9A 1IT8A 4WGXA 3TYDA 5A6LA 4RZ4A 2PGWA 3UQNA 5EFFA 4P8WA 1XG4A 3BO9A 1YBQA 1A5MC 2Q3RA 3T8QA 2J4GA 1HVXA 3KHDA 1G4PA 2VUYA 3GNOA 1UZ4A 4PH6A 4BJHA 1JZ7A 3MWCA 4DBDA 2Z4GA 1LBLA 1R6WA 3CUIA 3PAOA 4GBUA 2ISSA 1I6NA 3W2NA 4D6JA 1BQGA 1CTNA 3U9IA 1B9ZA 4BF7A 2DZUA 3DFSA 1TV3A 5D4YA 5FESA 5FJTA 4LAUA 1XPGA 2NQ5A 5AC8A 2PPGA 5IOBA 4GVGA 3OTRA 3UA3A 3E2VA 1OY0A 3N73A 5DCDA 4W85A 1AJZA 1TA3B 2HVOA 2CKSA 4E2OA 4PUDA 3W29A 3M1ZA 2IKGA 1CGTA 2B0MA 1G6CA 2FPVA 4INFA 3GW3A 3DFNA 3ZT5A 4LBUA 1UR1A 1PUDA 4PMJA 3BPWA 3LLDA 4P7OA 3SSZA 3L68A 3N34A 4OIFA 1UWTA 3MDWA 2OGYA 3F4NA 4KRZA 4JKMA 4CUCA 2BVYA 1EL3A 4GUFA 4FNTA 3ITCA 4HYWA 5EFDA 3SIZA 4CD5A 4X2RA 3VIKA 2YZRA 1O60A 3B8WA 3VOJA 2DEPA 5FAJA 3HPZA 4OBRA 3RLUA 1KM2A 3S6DA 2GQ8A 2P76A 4CU8A 4HT3A 1TIMA 2FH8A 2WNQA 4OJYA 1RXOB 1UR8A 5E6YA 2L5HA 2ZWYA 1G01A 1MFVA 3VVGA 3MP5A 3E74A 4PMVA 2ZUUA 2Y61A 1Y5WA 3RM9A 1V03A 2BOFX 1W9BM 4QITA 4NQ1A 4F40A 2ZC8A 3OBEA 3W70A 4E8CA 4U2YA 4UTFA 4XAYA 1VPQA 4N4PA 3UXLA 3KEHA 1DJHA 3W7LA 4HJWA 4LRSA 3VZYA 3EB2A 2B7QA 2OLHA 5CC7A 4JD4A 1EIBA 1QNQA 3PNZA 1VB9A 1W1ZA 3NL3A 3WMSA 1DJYA 1Q3NA 3CHFA 5CKSA 5I5RA 3W1NA 3OYZA 4UQAA 1P0DA 3RRXA 4ML4A 3CU2A 2EJ1A 1R2TA 4ORMA 4LEQA 2PDXA 2VCBA 3QJAA 1YNYA 3PR2A 3W85A 2TYSA 3VM5A 5A6SA 1TTPA 4B16A 3OO2A 4C7GA 3GXMA 1TWDA 3TTQA 3L21A 3P5YA 1E1CB 2PRLA 2QMKA 4REQB 4JN6A 3N1AA 4KGJA 1KCZA 3AXMA 1O7AA 5BZAA 3NQ2A 3SW6A 1H11A 1R47A 2W4XA 1DWAM 2QJMA 3VIJA 4ERAA 2DSVA 1GEQA 2PWHA 1WXYA 3EMCA 3O6AA 1D3HA 1S5WA 4D6EA 2PAJA 1C8VA 4W7UA 3FA4A 3A47A 6XIAA 4MYXA 1AQFA 3FYPA 3T44A 1CGVA 3PZNA 1TO3A 4K8HA 1ADDA 3BLLA 5BOEA 3RDKA 2PP0A 1B31A 4AQLA 3GXTA 2YCEA 3T4WA 1OCNA 1HJSA 1KFBA 2DVTA 4NG3A 4HHPA 1X6UA 3T7VA 4LV9A 3S1WA 4JTLA 1E6ZA 1YRRA 4IGNA 4ZEPA 1DVJA 1W1IE 3TYZA 3VKCA 1PL9A 4HN8A 4K1WA 4FXRA 1KWKA 1W1B1 1KR0A 1XLBA 4DWSB 3D47A 2JIEA 4L1XA 1QPQA 3KM8A 4AVNA 3AWNA 3F7JA 1S39A 3QLDA 2A7NA 4XAFA 2V5CA 4Z2GA 3QLLA 2GGHA 1OK4A 3M6YA 2CCRA 3E96A 4GYKA 1Q7QA 4UR8A 4NZCA 1K8XA 1RBOB 3TVAA 4HNCA 3ITLA 1TCDA 3KOFA 2HQAA 4D6IA 1W1A1 3BZJA 4E5TA 3ARXA 2INEA 1ELSA 1H62A 4S3AA 1PVNA 1OYCA 2WJFA 4LAKA 4RK8A 4FO4A 5BWAA 4HPGA 4P2VA 2ACUA 2CW6A 2P53A 3R25A 3PSVA 5FKYA 1ZTVA 3L5MA 1JAEA 3N9RA 4FX8A 1KKOA 1X98A 3LNMA 2EJAA 3AMCA 2PTDA 4A8RA 2NLYA 4HU0A 3CAKA 3N13A 2JKAA 5BNKA 4ZOAA</