3NREA

Crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
291
structure length
291
Chain Sequence
GMTIYTLSHGSLKLDVSDQGGVIEGFWRDTTPLLRPGKKSGVATDASCFPLVPFANRVSGNRFVWQGREYQLQPNVEWDAHYLHGDGWLGEWQCVSHSDDSLCLVYEHRSGVYHYRVSQAFHLTADTLTVTLSVTNQGAETLPFGTGWHPYFPLSPQTRIQAQASGYWLEREQWLAGEFCEQLPQELDFNQPAPLPRQWVNNGFAGWNGQARIEQPQEGYAIIMETTPPAPCYFIFVSDPAFDKGYAFDFFCLEPMSHAPDDHHRPEGGDLIALAPGESTTSEMSLRVEWL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose 1-epimerase
publication title Crystal structure of a Putative aldose 1-epimerase (b2544) from ESCHERICHIA COLI K12 at 1.59 A resolution
rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 66
structure length 291
sequence length 291
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 3nreA00
1LF9A 1EGUA 1DP0A 3T2PA 1LXMA 1OJNA 2WVXA 2WW3A 3MV01 1TXKA 1RWAA 3I3EA 3T0DA 1NS4A 3VD5A 2E22A 1HN0A 3DYMA 2XSGA 5A1AA 1UG9A 3OBAA 3VD9A 3MUZ1 1NSRA 1X1HA 3DCDA 1J0NA 3VD3A 2BRPA 3K25A 1HN1A 5E1QA 3T2OA 4TTGA 3BGAA 1JZ4A 3VDBA 1ULVA 1OJMA 1SO0A 1PX4A 3I3BA 2WCOA 1K1YA 1LURA 2E24A 3SEPA 1HM2A 1JZ2A 1JZ3A 3MWXA 4BZEA 1OJPA 2CIQA 2WVZA 3MUY1 1C82A 4RNLA 3WFAA 1NSUA 3IAQA 1K1WA 3MV11 3A24A 3VDAA 1NKGA 1JZ6A 1YGAA 2JKPA 2WDAA 1X1JA 1N7PA 4BZHA 2JKAA 1JOVA 3DYPA 1F4HA 2ZXQA 3IAPA 3NREA 1Z45A 1F4AA 1HMWA 1MMZA 2BRWA 2JKEA 2Q1FA 1LOHA 1RW9A 1LF6A 1L7KA 3OS7A 3T0AA 2CIRA 1K1XA 3VDCA 1NS7A 1MN0A 3NJVA 4DUVA 1N7RA 1NS8A 2CISA 4AQ0A 1JZ7A 1OJOA 1NS0A 2HTAA 3IMHA 1RWGA 2ZQ0A 1PX3A 1N7OA 2WVYA 1F9GA 3Q1NA 4DUXA 2WW1A 1NSMA 3NJXA 1JYXA 1F1SA 1RWFA 1JZ8A 1JYVA 1MMUA 1NSXA 1N7NA 3CZJA 3DECA 2WVXB 4DUWA 3E1F1 1YQ2A 1JYNA 2HTBA 1J0MA 4BZFA 1CB8A 1HMUA 2WW0A 2X03A 1NS2A 3I3DA 1HM3A 3T0BA 1MMYA 2WZSA 3T08A 1X1IA 1RWHA 3DYOA 2XHNA 3T09A 2BRVX 1JYWA 1SNZA 3VD7A 1JZ5A 1RWCA 1NSVA 2WW2A 3T2QA 3VD4A 1I8QA 1LXKA 1W3YA 1L7JA 3OB8A 1NSZA 3ECQA 4BZGA 2D73A 1MMXA 1NSSA 3J7HA 1N7QA
chains in the Genus database with same CATH superfamily
3T2PA 2WW3A 1TXKA 3X41A 3T0DA 3D52A 1HN0A 2XSGA 1J0NA 3VD3A 3ACSA 3BGAA 3NBJA 3VDBA 1D6YA 2CFLA 1ULVA 1AV4A 2CFGA 1PX4A 3I3BA 2WCOA 1K1YA 1AVKA 3SEPA 1W6GA 1W2ZA 1OACA 4BTWA 2OW6A 1SPUA 4RNLA 3MUY1 1LVNA 3IAQA 1K1WA 3VSMA 3QDEA 2Y73A 1W5ZA 3KN4A 1YGAA 2WDAA 3X40A 2JKAA 2CQSA 3BVUA 2EAEA 1MMZA 4FNVA 2Q1FA 1LOHA 4FNSA 2YX9A 1LF6A 1MN0A 3E7JA 1N7RA 2E2TA 2WGQA 1NS0A 1TQTA 2E2VA 2OW7A 2CFDA 3QFZA 2WVYA 1F9GA 1O7DD 2C11A 4OK2A 2WW1A 1NSMA 4DUXA 3RSYA 3CZJA 3T0UA 3E1F1 2HTBA 3WA2X 3HIGA 2X03A 1NS2A 2OOVC 1JRQA 3A0OA 1IVWA 4BTXA 3DYOA 2XN1A 1SNZA 1QWNA 3DDFA 3X42A 4K3AA 3LVTA 4MMHA 1QALA 3W7WA 1DP0A 3BUQA 2ZL8A 2WVXA 3S4CA 3DX0A 4KTPA 3DYMA 1V7XA 3CV5A 3S4BA 1UG9A 3VD9A 2EABA 3DX1A 3DCDA 4FNTA 5JMFA 3VSNA 4TTGA 3T2OA 1SIHA 4KFFA 3HIIA 1N9EA 1RJOA 3MWXA 1JZ3A 3QG0A 3WFAA 2WVZA 1UI8A 2F1BA 2WOHA 4KFDA 2F1AA 1US1A 2OQEC 1NKGA 2JKPA 1X1JA 2FUTA 3AMOB 4OK4A 3PGBA 3EJSA 3IAPA 3NREA 1H54A 4UFCA 2F7QA 1IVXA 3OS7A 5GW7A 3BUBA 1NS7A 4DUVA 2CISA 2CQTA 1JZ7A 1IQXA 1R34A 2HTAA 3IMHA 1PX3A 4K35A 3BLBA 3MPHA 3W7TA 1WMOA 3BVVA 1JYVA 4BTYA 1NSXA 2EACA 4DUWA 1YQ2A 1TQVA 4BZFA 1KSIA 3HI7A 3DDGA 1HM3A 3WA3A 1MMYA 4MMIA 1RWHA 2CWVA 1QX1A 1WMPA 1UI7A 2ALWA 3T09A 3VD7A 2OOVA 3DX4A 1RKYA 2WW2A 3T2QA 5KBPA 1LXKA 1NSZA 3SX1A 4FNPA 3KIIA 1HXKA 1N7QA 1LF9A 2F7RA 1EGUA 3W7SA 1OJNA 3TY1A 2BT3A 1NS4A 3AFLA 2E22A 3AFJA 4J5TA 5A1AA 3OBAA 2FYVA 1X1HA 2W0QA 1HWWA 3K25A 1HN1A 5E1QA 4EV2A 1QWUA 1WMNA 3ALAA 1A2VA 3D3IA 1LURA 2E24A 4FNUA 1HM2A 2WYHA 2Y74A 3WVFA 4OJZA 1OJPA 3BVWA 3SXXA 2CIQA 2F7PA 3WIQA 1NSUA 3D4ZA 1IQYA 3MV11 1V7VA 3A24A 3S4DA 3VDAA 3DX3A 1N7PA 2CFKA 1JOVA 3D4YA 4NEIA 2XN2A 2OQEA 1Z45A 1HMWA 1QAKA 3N9HA 2BRWA 2JKEA 4FNRA 1D6UA 1RW9A 1TQWA 2CIRA 3E80A 5JMDA 2FUQA 3NJVA 1NS8A 1EKMA 3EJUA 1IU7A 1RWGA 2ZQ0A 3AMOA 4KFEA 2WO0A 3NJXA 3LOYA 1JYXA 1RWFA 2XN0A 1R33A 4FNQA 1HMUA 2WW0A 2YFNA 3BVXA 3I3DA 2F7OA 2E2UA 2RDYA 3T08A 3X3YA 1TU5A 2XHNA 3MI6A 2BRVX 3EJQA 1QAFA 3BUPA 1JYWA 1W7CA 1NSVA 1DYUA 3VD4A 1L7JA 1AVLA 3WIRA 3RRSA 2CFWA 1LXMA 3X3ZA 1RWAA 3DX2A 3I3EA 1TQSA 3BVTA 1W6CA 3VD5A 2F18A 2CWUA 2CG0A 3X3XA 3MUZ1 1NSRA 2BRPA 3BUDA 1JZ4A 2PNCA 1OJMA 1SO0A 2CWTA 2EADA 3K5TA 1JZ2A 4BZEA 1HTYA 2C10A 2WYIA 1C82A 3W7XA 1JZ6A 4BZHA 3DYPA 3EJPA 3QFYA 1F4HA 2ZXQA 1F4AA 1TQUA 1L7KA 4EV5A 3T0AA 3CZNA 1K1XA 3VDCA 2YFOA 1PS3A 4AQ0A 1OJOA 3BLCA 1V7WA 1N7OA 5CA3A 3BS6A 3BUIA 3Q1NA 3D50A 1F1SA 1JZ8A 1MMUA 2WOFA 3S4AA 1N7NA 3DECA 2WVXB 1JYNA 2D1WA 1IVVA 2CG1A 1J0MA 1CB8A 1IVUA 3CZSA 1PU4A 3T0BA 3NBBA 1D6ZA 2WZSA 1X1IA 3W7UA 1SIIA 1W4NA 3D51A 1JZ5A 3EJRA 1RWCA 3ACTA 1I8QA 1W3YA 3EJTA 4KTRA 3OB8A 3ECQA 4BZGA 2D73A 1MMXA 3MV01 1NSSA 3J7HA
chains in the Genus database with same CATH topology
1LF9A 1EGUA 1DP0A 3T2PA 1LXMA 1OJNA 2WVXA 3TY1A 2WW3A 3MV01 1TXKA 1RWAA 3I3EA 3T0DA 1NS4A 3VD5A 3AFLA 2E22A 1HN0A 3DYMA 4J5TA 2XSGA 5A1AA 1UG9A 3OBAA 3VD9A 3MUZ1 1NSRA 1X1HA 3DCDA 5JMFA 1J0NA 3VD3A 2BRPA 3K25A 1HN1A 5E1QA 3T2OA 3VSNA 4TTGA 3BGAA 1JZ4A 3VDBA 1ULVA 1OJMA 1SO0A 1PX4A 3I3BA 2WCOA 1K1YA 1LURA 2E24A 3SEPA 1HM2A 3WVFA 1JZ2A 1JZ3A 3MWXA 4BZEA 4OJZA 1OJPA 2CIQA 2WVZA 3MUY1 1C82A 4RNLA 3WFAA 1NSUA 3IAQA 1K1WA 3VSMA 3MV11 3A24A 3VDAA 1NKGA 1JZ6A 1YGAA 2JKPA 2WDAA 1X1JA 1N7PA 2FUTA 4BZHA 2JKAA 1JOVA 4NEIA 4OK4A 3DYPA 1F4HA 2ZXQA 3IAPA 3NREA 1Z45A 1F4AA 1HMWA 1MMZA 2BRWA 2JKEA 4FNVA 2Q1FA 1LOHA 1RW9A 1LF6A 1L7KA 3OS7A 3T0AA 2CIRA 1K1XA 3VDCA 3E80A 1NS7A 1MN0A 3E7JA 5JMDA 2FUQA 3NJVA 4DUVA 1N7RA 1NS8A 2CISA 4AQ0A 1JZ7A 1OJOA 1NS0A 3BLCA 2HTAA 3IMHA 1RWGA 2ZQ0A 1PX3A 1N7OA 2WVYA 3BS6A 1F9GA 3Q1NA 4OK2A 4DUXA 2WW1A 1NSMA 3NJXA 1JYXA 1F1SA 1RWFA 1JZ8A 1JYVA 1MMUA 1NSXA 1N7NA 3CZJA 3DECA 2WVXB 4DUWA 3E1F1 1YQ2A 1JYNA 2HTBA 1J0MA 4BZFA 1CB8A 1HMUA 2WW0A 2X03A 1NS2A 3I3DA 1HM3A 3A0OA 3T0BA 1MMYA 4MMIA 2WZSA 3T08A 1X1IA 1RWHA 3DYOA 2XHNA 3T09A 2BRVX 1JYWA 1SNZA 3VD7A 1JZ5A 1RWCA 1NSVA 2WW2A 3T2QA 3VD4A 1I8QA 1LXKA 1W3YA 1L7JA 3OB8A 1NSZA 3ECQA 4MMHA 4BZGA 2D73A 1MMXA 1NSSA 3J7HA 1N7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LF9 A;  1EGU A;  1DP0 A;  3T2P A;  1LXM A;  1OJN A;  2WVX A;  2WW3 A;  3MV0 1;  1TXK A;  1RWA A;  3I3E A;  3T0D A;  1NS4 A;  3VD5 A;  2E22 A;  1HN0 A;  3DYM A;  2XSG A;  5A1A A;  1UG9 A;  3OBA A;  3VD9 A;  3MUZ 1;  1NSR A;  1X1H A;  3DCD A;  1J0N A;  3VD3 A;  2BRP A;  3K25 A;  1HN1 A;  5E1Q A;  3T2O A;  4TTG A;  3BGA A;  1JZ4 A;  3VDB A;  1ULV A;  1OJM A;  1SO0 A;  1PX4 A;  3I3B A;  2WCO A;  1K1Y A;  1LUR A;  2E24 A;  3SEP A;  1HM2 A;  1JZ2 A;  1JZ3 A;  3MWX A;  4BZE A;  1OJP A;  2CIQ A;  2WVZ A;  3MUY 1;  1C82 A;  4RNL A;  3WFA A;  1NSU A;  3IAQ A;  1K1W A;  3MV1 1;  3A24 A;  3VDA A;  1NKG A;  1JZ6 A;  1YGA A;  2JKP A;  2WDA A;  1X1J A;  1N7P A;  4BZH A;  2JKA A;  1JOV A;  3DYP A;  1F4H A;  2ZXQ A;  3IAP A;  3NRE A;  1Z45 A;  1F4A A;  1HMW A;  1MMZ A;  2BRW A;  2JKE A;  2Q1F A;  1LOH A;  1RW9 A;  1LF6 A;  1L7K A;  3OS7 A;  3T0A A;  2CIR A;  1K1X A;  3VDC A;  1NS7 A;  1MN0 A;  3NJV A;  4DUV A;  1N7R A;  1NS8 A;  2CIS A;  4AQ0 A;  1JZ7 A;  1OJO A;  1NS0 A;  2HTA A;  3IMH A;  1RWG A;  2ZQ0 A;  1PX3 A;  1N7O A;  2WVY A;  1F9G A;  3Q1N A;  4DUX A;  2WW1 A;  1NSM A;  3NJX A;  1JYX A;  1F1S A;  1RWF A;  1JZ8 A;  1JYV A;  1MMU A;  1NSX A;  1N7N A;  3CZJ A;  3DEC A;  2WVX B;  4DUW A;  3E1F 1;  1YQ2 A;  1JYN A;  2HTB A;  1J0M A;  4BZF A;  1CB8 A;  1HMU A;  2WW0 A;  2X03 A;  1NS2 A;  3I3D A;  1HM3 A;  3T0B A;  1MMY A;  2WZS A;  3T08 A;  1X1I A;  1RWH A;  3DYO A;  2XHN A;  3T09 A;  2BRV X;  1JYW A;  1SNZ A;  3VD7 A;  1JZ5 A;  1RWC A;  1NSV A;  2WW2 A;  3T2Q A;  3VD4 A;  1I8Q A;  1LXK A;  1W3Y A;  1L7J A;  3OB8 A;  1NSZ A;  3ECQ A;  4BZG A;  2D73 A;  1MMX A;  1NSS A;  3J7H A;  1N7Q A; 
#chains in the Genus database with same CATH topology
 3T2P A;  2WW3 A;  1TXK A;  3X41 A;  3T0D A;  3D52 A;  1HN0 A;  2XSG A;  1J0N A;  3VD3 A;  3ACS A;  3BGA A;  3NBJ A;  3VDB A;  1D6Y A;  2CFL A;  1ULV A;  1AV4 A;  2CFG A;  1PX4 A;  3I3B A;  2WCO A;  1K1Y A;  1AVK A;  3SEP A;  1W6G A;  1W2Z A;  1OAC A;  4BTW A;  2OW6 A;  1SPU A;  4RNL A;  3MUY 1;  1LVN A;  3IAQ A;  1K1W A;  3VSM A;  3QDE A;  2Y73 A;  1W5Z A;  3KN4 A;  1YGA A;  2WDA A;  3X40 A;  2JKA A;  2CQS A;  3BVU A;  2EAE A;  1MMZ A;  4FNV A;  2Q1F A;  1LOH A;  4FNS A;  2YX9 A;  1LF6 A;  1MN0 A;  3E7J A;  1N7R A;  2E2T A;  2WGQ A;  1NS0 A;  1TQT A;  2E2V A;  2OW7 A;  2CFD A;  3QFZ A;  2WVY A;  1F9G A;  1O7D D;  2C11 A;  4OK2 A;  2WW1 A;  1NSM A;  4DUX A;  3RSY A;  3CZJ A;  3T0U A;  3E1F 1;  2HTB A;  3WA2 X;  3HIG A;  2X03 A;  1NS2 A;  2OOV C;  1JRQ A;  3A0O A;  1IVW A;  4BTX A;  3DYO A;  2XN1 A;  1SNZ A;  1QWN A;  3DDF A;  3X42 A;  4K3A A;  3LVT A;  4MMH A;  1QAL A;  3W7W A;  1DP0 A;  3BUQ A;  2ZL8 A;  2WVX A;  3S4C A;  3DX0 A;  4KTP A;  3DYM A;  1V7X A;  3CV5 A;  3S4B A;  1UG9 A;  3VD9 A;  2EAB A;  3DX1 A;  3DCD A;  4FNT A;  5JMF A;  3VSN A;  4TTG A;  3T2O A;  1SIH A;  4KFF A;  3HII A;  1N9E A;  1RJO A;  3MWX A;  1JZ3 A;  3QG0 A;  3WFA A;  2WVZ A;  1UI8 A;  2F1B A;  2WOH A;  4KFD A;  2F1A A;  1US1 A;  2OQE C;  1NKG A;  2JKP A;  1X1J A;  2FUT A;  3AMO B;  4OK4 A;  3PGB A;  3EJS A;  3IAP A;  3NRE A;  1H54 A;  4UFC A;  2F7Q A;  1IVX A;  3OS7 A;  5GW7 A;  3BUB A;  1NS7 A;  4DUV A;  2CIS A;  2CQT A;  1JZ7 A;  1IQX A;  1R34 A;  2HTA A;  3IMH A;  1PX3 A;  4K35 A;  3BLB A;  3MPH A;  3W7T A;  1WMO A;  3BVV A;  1JYV A;  4BTY A;  1NSX A;  2EAC A;  4DUW A;  1YQ2 A;  1TQV A;  4BZF A;  1KSI A;  3HI7 A;  3DDG A;  1HM3 A;  3WA3 A;  1MMY A;  4MMI A;  1RWH A;  2CWV A;  1QX1 A;  1WMP A;  1UI7 A;  2ALW A;  3T09 A;  3VD7 A;  2OOV A;  3DX4 A;  1RKY A;  2WW2 A;  3T2Q A;  5KBP A;  1LXK A;  1NSZ A;  3SX1 A;  4FNP A;  3KII A;  1HXK A;  1N7Q A;  1LF9 A;  2F7R A;  1EGU A;  3W7S A;  1OJN A;  3TY1 A;  2BT3 A;  1NS4 A;  3AFL A;  2E22 A;  3AFJ A;  4J5T A;  5A1A A;  3OBA A;  2FYV A;  1X1H A;  2W0Q A;  1HWW A;  3K25 A;  1HN1 A;  5E1Q A;  4EV2 A;  1QWU A;  1WMN A;  3ALA A;  1A2V A;  3D3I A;  1LUR A;  2E24 A;  4FNU A;  1HM2 A;  2WYH A;  2Y74 A;  3WVF A;  4OJZ A;  1OJP A;  3BVW A;  3SXX A;  2CIQ A;  2F7P A;  3WIQ A;  1NSU A;  3D4Z A;  1IQY A;  3MV1 1;  1V7V A;  3A24 A;  3S4D A;  3VDA A;  3DX3 A;  1N7P A;  2CFK A;  1JOV A;  3D4Y A;  4NEI A;  2XN2 A;  2OQE A;  1Z45 A;  1HMW A;  1QAK A;  3N9H A;  2BRW A;  2JKE A;  4FNR A;  1D6U A;  1RW9 A;  1TQW A;  2CIR A;  3E80 A;  5JMD A;  2FUQ A;  3NJV A;  1NS8 A;  1EKM A;  3EJU A;  1IU7 A;  1RWG A;  2ZQ0 A;  3AMO A;  4KFE A;  2WO0 A;  3NJX A;  3LOY A;  1JYX A;  1RWF A;  2XN0 A;  1R33 A;  4FNQ A;  1HMU A;  2WW0 A;  2YFN A;  3BVX A;  3I3D A;  2F7O A;  2E2U A;  2RDY A;  3T08 A;  3X3Y A;  1TU5 A;  2XHN A;  3MI6 A;  2BRV X;  3EJQ A;  1QAF A;  3BUP A;  1JYW A;  1W7C A;  1NSV A;  1DYU A;  3VD4 A;  1L7J A;  1AVL A;  3WIR A;  3RRS A;  2CFW A;  1LXM A;  3X3Z A;  1RWA A;  3DX2 A;  3I3E A;  1TQS A;  3BVT A;  1W6C A;  3VD5 A;  2F18 A;  2CWU A;  2CG0 A;  3X3X A;  3MUZ 1;  1NSR A;  2BRP A;  3BUD A;  1JZ4 A;  2PNC A;  1OJM A;  1SO0 A;  2CWT A;  2EAD A;  3K5T A;  1JZ2 A;  4BZE A;  1HTY A;  2C10 A;  2WYI A;  1C82 A;  3W7X A;  1JZ6 A;  4BZH A;  3DYP A;  3EJP A;  3QFY A;  1F4H A;  2ZXQ A;  1F4A A;  1TQU A;  1L7K A;  4EV5 A;  3T0A A;  3CZN A;  1K1X A;  3VDC A;  2YFO A;  1PS3 A;  4AQ0 A;  1OJO A;  3BLC A;  1V7W A;  1N7O A;  5CA3 A;  3BS6 A;  3BUI A;  3Q1N A;  3D50 A;  1F1S A;  1JZ8 A;  1MMU A;  2WOF A;  3S4A A;  1N7N A;  3DEC A;  2WVX B;  1JYN A;  2D1W A;  1IVV A;  2CG1 A;  1J0M A;  1CB8 A;  1IVU A;  3CZS A;  1PU4 A;  3T0B A;  3NBB A;  1D6Z A;  2WZS A;  1X1I A;  3W7U A;  1SII A;  1W4N A;  3D51 A;  1JZ5 A;  3EJR A;  1RWC A;  3ACT A;  1I8Q A;  1W3Y A;  3EJT A;  4KTR A;  3OB8 A;  3ECQ A;  4BZG A;  2D73 A;  1MMX A;  3MV0 1;  1NSS A;  3J7H A; 
#chains in the Genus database with same CATH homology
 1LF9 A;  1EGU A;  1DP0 A;  3T2P A;  1LXM A;  1OJN A;  2WVX A;  3TY1 A;  2WW3 A;  3MV0 1;  1TXK A;  1RWA A;  3I3E A;  3T0D A;  1NS4 A;  3VD5 A;  3AFL A;  2E22 A;  1HN0 A;  3DYM A;  4J5T A;  2XSG A;  5A1A A;  1UG9 A;  3OBA A;  3VD9 A;  3MUZ 1;  1NSR A;  1X1H A;  3DCD A;  5JMF A;  1J0N A;  3VD3 A;  2BRP A;  3K25 A;  1HN1 A;  5E1Q A;  3T2O A;  3VSN A;  4TTG A;  3BGA A;  1JZ4 A;  3VDB A;  1ULV A;  1OJM A;  1SO0 A;  1PX4 A;  3I3B A;  2WCO A;  1K1Y A;  1LUR A;  2E24 A;  3SEP A;  1HM2 A;  3WVF A;  1JZ2 A;  1JZ3 A;  3MWX A;  4BZE A;  4OJZ A;  1OJP A;  2CIQ A;  2WVZ A;  3MUY 1;  1C82 A;  4RNL A;  3WFA A;  1NSU A;  3IAQ A;  1K1W A;  3VSM A;  3MV1 1;  3A24 A;  3VDA A;  1NKG A;  1JZ6 A;  1YGA A;  2JKP A;  2WDA A;  1X1J A;  1N7P A;  2FUT A;  4BZH A;  2JKA A;  1JOV A;  4NEI A;  4OK4 A;  3DYP A;  1F4H A;  2ZXQ A;  3IAP A;  3NRE A;  1Z45 A;  1F4A A;  1HMW A;  1MMZ A;  2BRW A;  2JKE A;  4FNV A;  2Q1F A;  1LOH A;  1RW9 A;  1LF6 A;  1L7K A;  3OS7 A;  3T0A A;  2CIR A;  1K1X A;  3VDC A;  3E80 A;  1NS7 A;  1MN0 A;  3E7J A;  5JMD A;  2FUQ A;  3NJV A;  4DUV A;  1N7R A;  1NS8 A;  2CIS A;  4AQ0 A;  1JZ7 A;  1OJO A;  1NS0 A;  3BLC A;  2HTA A;  3IMH A;  1RWG A;  2ZQ0 A;  1PX3 A;  1N7O A;  2WVY A;  3BS6 A;  1F9G A;  3Q1N A;  4OK2 A;  4DUX A;  2WW1 A;  1NSM A;  3NJX A;  1JYX A;  1F1S A;  1RWF A;  1JZ8 A;  1JYV A;  1MMU A;  1NSX A;  1N7N A;  3CZJ A;  3DEC A;  2WVX B;  4DUW A;  3E1F 1;  1YQ2 A;  1JYN A;  2HTB A;  1J0M A;  4BZF A;  1CB8 A;  1HMU A;  2WW0 A;  2X03 A;  1NS2 A;  3I3D A;  1HM3 A;  3A0O A;  3T0B A;  1MMY A;  4MMI A;  2WZS A;  3T08 A;  1X1I A;  1RWH A;  3DYO A;  2XHN A;  3T09 A;  2BRV X;  1JYW A;  1SNZ A;  3VD7 A;  1JZ5 A;  1RWC A;  1NSV A;  2WW2 A;  3T2Q A;  3VD4 A;  1I8Q A;  1LXK A;  1W3Y A;  1L7J A;  3OB8 A;  1NSZ A;  3ECQ A;  4MMH A;  4BZG A;  2D73 A;  1MMX A;  1NSS A;  3J7H A;  1N7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...