3NRHA

Crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
158
Chain Sequence
QVIFDKNVIEFVTVAAEFCAFLERAESMKRSTFVDTTLKILPLLYLKASMLPKCEMIGDESPETYVTEEIYEVLRINLASILAEKDDYLEIKKNISEDLADIYQDIKDFIFVFQLGLNETMNDSLAICQENFGLLWGQKLVNTMRALHDVKYSPKARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein BF1032
publication title Northeast Structural Genomics Consortium Target BfR309
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 54
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16702 DUF5063 Domain of unknown function (DUF5063)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nrhA00
3NRHA
chains in the Genus database with same CATH superfamily
3SXMA 3RQEA 5JS5A 1YA9A 3ASNC 3M79A 2CDQA 2CNWA 4AK9A 3J06A 4WGZA 2Y3DA 3ZG1A 2KQ9A 4U9DA 2A0BA 2X51A 2EIJC 2MYSA 3RVZA 1YZAA 1C17M 2H7OA 3K6BA 1ZHYA 4BJ6C 3WHNA 4AX2A 5CIVA 1KTMA 3JRTA 3AG4C 5JSLA 2EPLX 4W8KA 4JTCB 1R5ID 1WASA 2ZD9A 4PK4A 1PCXA 4XEFA 1L7CA 1QPUA 1I4YA 1XZQA 2L6FA 2ETSA 2QE9A 3DMDA 3OEOA 4R32A 4IAOA 1JPJA 1ST6A 2QNLA 4DRIB 1OCOC 1Q0FA 1FFHA 1OCRC 2YL0A 2LFDA 1FNTc 3Q7GA 1A7VA 3UGOA 2RSEB 3GEHA 3LJBA 4XQ1A 1MMGA 3ZDLA 5B3IA 1MNEA 4BJTA 4CIPA 1OQCA 4IARA 2PNOA 1K04A 3HNJA 4Q7CA 3B9QA 4PACA 3C62A 1M6TA 5IY5C 4LLCA 5K0IA 3AOUA 1BR2A 4ZLDA 2J45A 3H2VA 4EIYA 1TQGA 2NG1A 3U3BA 3SP1A 4O79A 2XLOA 2OEXA 1HW2A 4PFOA 2YEVA 1O5HA 2Q9AA 4GYTA 5L0IA 1V55C 3DXJF 2R03A 3O39A 1JOGA 3RH3A 2EINC 3M1CB 1PD0A 1WATA 3DJNB 3EFOA 3JSEO 4FWVA 4E17A 5KYWB 4W8PA 1D0YA 2FAPB 2HZ8A 4N4WA 3S84A 4E0HA 3C8GD 2XL8A 2IM8A 3I4UA 3V5ZA 2H7BA 3JRMO 1UG7A 2JD3A 1Z5ZA 2IXPA 2LQGA 2PX0A 3M4CA 1FAPB 3KL4A 1BBHA 3NYMA 4U5FE 4E0IA 4HEAJ 1S05A 3E70C 1RKCA 3DM5A 2HV7A 2OCCC 3EFOB 1A7DA 2KYHA 3LLKA 3Q7LA 4MVSA 3U2MA 2R7RA 4OIOF 1OCZC 1ZZPA 1FMVA 2AVKA 2A68F 4YL1A 3GM2A 1KU2A 2J8WA 4JURI 5D92A 1ZU4A 2C04A 3K66A 4P9TA 4IB4A 3LLIA 2R9RB 1JRAA 2Y3GA 2ZPAA 5DVWA 3U9MA 4YT4A 1YYJA 3HTKC 4EBJA 4B6IA 1M2OA 3IQCA 3FDQA 4JJFA 3CQZA 2X0CA 2WZFA 2L81A 3RF3A 4EWCA 5HV9A 3VM6A 3HLZA 1E84A 4PJNA 2E87A 3L34A 4I1OB 1FTSA 3MYFA 1C02A 4Q4ZF 4RBNA 4EBBA 2JX0A 2W4MA 4MVZA 4XEVA 3KPHA 3OWTA 3SEOA 1U0BB 4C3BA 4JE9A 3G4XA 5L0FA 1OKKD 1G4WR 2VASA 4XTKA 4I44A 4CDVA 1RJ9B 1QZXA 3AG2C 3V5YA 1LKXA 1VLSA 1G8XA 3A11A 2Y69C 4DXWA 1BR1A 4C7OB 1UFBA 2OJQA 1VK5A 4KC9A 2W9YA 4N6HA 1JR8A 2WZLA 2YVKA 4BJ1A 1FFTC 2VCCA 3N0TA 5E33A 1I5NA 3KYJA 4JCZA 2HJMA 1PV3A 4ER9A 2IXMA 1NBBA 3JYHA 1Q0DA 3FAPB 3N2ZB 3DWWA 3NMIA 1SR2A 4FESA 4U5CE 4GEHA 2XLVA 2R7XA 3EH1A 4CDYA 3U8VA 4DOZA 3WG7C 3C8GA 2M4EA 3C63A 5CI8A 2WVQA 4IAQA 3LEOA 4CS8C 1TKNA 3EGDB 5AC4A 3GEEA 4MVOA 4HFKB 5FZTA 3ZVRA 3S29A 4BJ6A 1YZCA 4MTOA 4UDVA 1M56C 3SXZA 3DAGA 1U6HA 1OW8A 2ICWG 5KYNA 2HMQA 3HJCA 2IOQA 5JRAA 2YLDA 3NMJA 1NU7D 2FGYA 1D1CA 3EHNA 4ANJA 5L3QA 2PBEA 1A7EA 3JTLO 1NU9C 2DYRC 2YQYA 5JP7A 2WB7A 1C03A 1Z6AA 5COGA 3PDMP 1M57C 3WAQA 1Y4CA 2GDCA 1LE4A 1RXQA 2LCHA 3DAFA 3EHMA 4OD4A 3AGUA 3RW0A 2XRHA 4CJOA 2J7PD 4JVSA 4JTAB 2TMVP 1KNYA 2A6EF 4P9FA 3SNHA 3IQTA 5EGYA 1T01A 1XWJA 2PFDA 3L8JA 1WTYA 1K40A 1D0XA 1R4TA 2J9WA 5E2QA 5A6KA 3B0UX 2KC3A 3IPMO 3W4YA 1IZMA 1OW7A 2UUIA 3ZWIA 3I5QA 1EI7A 1Q0GA 4A4AA 1OKKA 1CPQA 1ZW2A 2XL4A 3LUTB 3T6BA 3VRCA 4NCQA 3WODF 1YDIA 3TOLA 4MVUA 3MFNA 2EIKC 4XLNF 2EPKX 3G50A 3B0VC 3CAXA 3NKEA 2YLIA 2IBFA 1T6UA 4XPXA 2XLMA 4IWBA 1D0ZA 3UR3C 2ZXOA 5B1BC 4KI2A 4CX9A 5KYXB 1VYKA 2NPUA 2J9UA 5D91A 2EIMC 4EKWA 1Y6DA 1HY5A 4MVQA 1CGNA 3F47A 5HSWA 1QVXA 4OIQF 1TWHA 4BPMA 2J0WA 3QTHA 3DM9B 2HKVA 2HSQA 3GWLA 1VMAA 2HJ3A 5KYWA 2OG2A 4G7OF 2LD6A 5L0GA 3ITFA 2YRFA 2Q4FA 3LS1A 1LI7A 3X1OA 3BEHA 3U3FA 3T6JA 1OCCC 4LERA 5DQZA 4H4KC 5CI9A 4YT8A 5KYUB 4XLPF 4DBRA 1CGME 4YL0A 5BQIA 1AVOB 1WOLA 3NRHA 5E3CA 2XL6A 4Z9HA 3AQBA 3VF0A 1NLXA 2AU5A 5AGFA 4MW8A 1GQAA 3L0IA 1GGQA 2QUPA 1V74B 2XS1A 3RIPA 4AE4B 3OA1A 5KYYB 3ECSA 3FOPA 2J7PA 1EKYA 3T4RA 2XLHA 2HS5A 1YJGA 1SZIA 2IYLD 2J46A 4LDRA 2W4BA 1TWCA 3EJNA 2KJGA 2YL3A 3K1HA 3L1MA 4NTAA 2R25A 1CGOA 3R7CA 2R7OA 4MNDA 1E86A 2CCYA 3CZ6A 3B29A 1MMAA 5L0DA 3AG1C 2YL1A 3AGTA 3KH2A 1N1CA 1AEPA 4U5HA 4CSAA 4PR9A 5A6BD 2YL7A 4BEMJ 1APCA 3UMIA 4K7BA 4KBLA 1HW1A 1G5ZA 2OKUA 2OJED 2CW0F 1OR3A 2V26A 1FR0A 1M2VB 1DOVA 1LVKA 3TJ5A 1QQ3A 1J8YF 2WZGA 5T1DB 5AC5A 1RJ9A 3HNIA 3U8PA 5BQHA 3TOMA 2NUTB 3FAJA 4MTFA 4U5DE 4E7SA 1NG1A 3A9CA 1PD1A 2HMZA 5A6JA 4C7OA 2WVOA 3K7DA 4ULWA 3LEVA 1E85A 2H7VC 3DKAA 2R05A 3PMRA 1V54C 1Z23A 2OEVA 4N06A 3JCUQ 5L0CA 4DVZA 3QMKA 1ZHXA 4Z9IA 1G4US 3EPVA 3MX3A 1A0BA 4BEJA 3E9VA 1HMDA 1LS4A 4DVYP 2P6VA 4O6MA 3TULA 2KK1A 4F4BA 2NSFA 3EGDA 3M15A 4NY3A 3DZAA 1VOMA 2WVNA 5EHHA 2CGEA 1EA8A 2PX3A 2R7WA 3B0PA 1YVIA 4Q5SF 3NDBB 3RQFA 4JW1A 1ZHTA 1LE2A 4PJJA 2V3CC 2P1AA 4XWJA 1OXBA 1TFOB 1WWPA 2CYDA 2G62A 3N24A 4NTBA 256BA 3EG9B 2XXAB 2W45A 3W8IA 2BL2A 3O55A 3EQLF 3ABKC 3Q6NA 3GEIA 4EHPA 3GM1A 3EGXB 3VAYA 1F1MA 2XS8A 3GWNA 4WJ0A 4K1OA 3ZQVA 4DJ9A 3ABMC 5T3TA 3ZIBA 1GS9A 1ZYRF 2GFHA 1T6QA 3DJUB 3KKBA 3UNGC 2R02A 1YAUO 3SXYA 3FXHA 4OIRF 4D4NA 3TK0A 4FAPB 5L3VA 3BRJA 1H7IA 4QDLA 5A6BA 2VH3A 1VB5A 3AQCA 3AG3C 1RKEB 3JZ0A 3MYIA 4LLEA 4G7HF 3O6XA 1VTMP 4J7YA 3UMKA 3MBGA 2R7SA 3ATPA 2JPUA 3NYJA 5L0HA 1XZPA 4M63A 2YHSA 1ZHWA 1TFKB 3JSZA 2Q7RA 2WL8A 2R7QA 3LAYA 1MNDA 1ORYA 2Y3BA 1OXKA 3IQ6A 4XPWA 2L6HA 2VC9A 2YZSA 4N6CA 5E3AA 1BR4A 3HNKA 1AUEA 2Q9BA 3QZCA 2ZXPA 4U5EE 3S9OA 2G3KA 2I8BA 5T3WA 2KNHA 3ZSUA 1LS1A 2H8AA 2M64A 5COFA 4J7TA 4JC7A 3FHDA 2LK4A 2Q9CA 3V5XA 3S90A 2EILC 4XEKA 5KYXA 1FMWA 3FOOA 1A41A 3HKKA 3QVZA 3SZRA 2ZXWC 4D4XA 2LP4A 2B0JA 4NC3A 1YLMA 2Y39A 4IJJA 2XLEA 1TR2A 1Q0KA 4MS2A 4MVMA 2PP4A 3ZC4A 1VYIA 3SXKA 5DS4A 2AWCA 2J9BA 1TWAA 3TD7A 3QW1A 5KYUA 4PFPA 3U0CA 1ZHZA 1QSPA 4RDAA 3T9OA 2XLDA 5BQGA 3FMSA 2QY9A 3ZTZA 3AJMA 1U89A 2NUPB 3RVYA 2R7TA 1H9TA 3CSKA 2XM4A 2LIGA 5B3SC 1NFOA 5JT4A 4X0RA 4MW3A 4BJ5C 4AE4A 2DB4A 3R2PA 5KYYA 1GM5A 2KW3C 4FX5A 2Z15A 3W2WA 3C7JA 4G7ZF 5JLIA 4NQFA 1CPRA 3LNMB 3I5PA 4U5BE 3NKDA 1NFNA 4LDKA 2HSBA 4CS9C 1NSGB 3B71A 3SYNA 2YWAA 1J8MF 3QVYA 1Q0MA 3C8ZA 3H2UA 4U9EA 2NSGA 4CIHA 3PCVA 5EK0A 3X2QC 3JT1A 5DQTA 2XSEA 3K1IC 5JUAA 3ASOC 4DRHB 2DGJA 1L3PA 4AL0A 2D4UA 4L6RA 1LPEA 4YN0B 1OW6A 1JAFA 4JCHA 3KMIA 4I1MA 1D1BA 1M2VA 2YLGA 1EQ1A 2I15A 4KNVA 3NG1A 4C3DA 4U5GA 5BUOA 2NUTA 4XPYA 4IGGA 1Z7Qc 1OR2A 4EUKB 3W8HA 1T9KA 1HE9A 1Z3IX 2HV6A 3LESA 4MQ9F 3EH2A 1RCPA 2ZXRA 4O7GA 3NMKA 4QI0A 1LIHA 4CS8A 2KSFA 5FCLA 4G0HA 2QLAA 3S0XA 1IW7F 1ZVZA 4P6IC 1WGWA 2L6GA 1K05A 2UUHA 4JRZA 3GODA 4ONSA 4PJMA 3RQGA 1W2WA 3C18A 4RD9A 2C03A 3L8IA 4JEAA 3VYWA 3M4BA 4HE8D 3U2LA 2DI3A 5B1AC 5DLJA 3PHF2 3O10A 3K33A 4JJGA 3Q6MA 1ZW3A 2J9VA 4OD5A 2G3VA 2VB6A 1O3UA 3EG9A 3EZHA 3NYLA 1MQVA 2XXAA 3JYYA 2RD9A 3ABLC 3S27A 4DRJB 2DYSC 3RKOF 4Z9JA 1S7ZA 1D1AA 1SMYF 5A69A 2Y3HA 2L7AA 1H9GA 2GWWA 3EGXA 4H54A 4WGYA 3F46A 4YK5A 1QLEC 2P0NA 3T6GB 4J30B 4JIOA 2LFFA 3S28A 4O6NA 5F28E 4LDQA 4O6YA 2R7UA 4IRUA 3GANA 2EPOA 5A6AA 4KNWA 3W2VA 4ZLCA 2A6HF 3IQ5A 4BG0A 1T6IA 1E83A 3RFYA 1Z63A 4E7ZA 3UGPA 3LNRA 1YA7O 4MVRA 3GORA 1E2XA 2EPNA 1LI5A 1RKEA 5TJ5E 3RYLA 4OIPF 1SYQA 3HNLA 2CNWD 3TQOA 3POVA 2LSEA 2VCBA 4JTDB 5JVEA 2QTVA 5F5HA 5L0JA 2O9XA 2MHRA 3IHUA 1BDJB 2KGOA 2Q00A 1B68A 4DBQA 2EPMX 2OOCA 1BZ4A 1QKRA 2A1DD 2BE5F 2BC5A 2IXOA 3DE8A 5F5FA 2F22A 3IEEA 3US6A 2ASRA 4E18A 2L9JA 4QI2A 1MMDA 4YL3A 4I3MA 5DS5A 1DOWA 1HMOA 2YKZA 3EZIA 2Q3TA 3ZQYA 1JMWA 5DS6A 4CSAC 2P7VA 5COMA 1H6GA 3G4ZA 4YT5A 3LS0A 4CDAA 4JEBA 2GA0A 4LACB 2PF4E 5GPGB 4BJ5A 3H65A 3KYIA 4YJWA 1V4AA 1I4ZA 4CJGA 1NZEA 1SF8A 2A69F 2D5RB 4YT2A 4PJLA 1YYXA 2FFHA 4JZAA 2VCAA 4YWQA 2HFIA 4G78A 1YARO 1JPNA 2AP3A 4CS9A 1ORSC 4AL1A 2J0XA 1ZU5A 1VLTA 3MLGA 2A0UA 3ZTMA 1T5OA 2AWYA 4C3EA 4CS7A 3GM3A 3U9JA 4ULVA 4J32B 3UMHA 2R7VA 3C8GB 4HFFB 2OQMA 3QW0A 4WABA 2HUJA 2NUPA 4MTGA 2B0HA 3DE9A 2MWQA 3K1IA 4K0DA 2P61A 4A2NB 2GAQA 1TWGA 4OINF 1HE1A 4CBEA 3FVYA 4JKVA 4GQHA 2IXNA 4NTFA 3CEXA 4EBKA 1WN0A 2XLWA 3DI5A 1MMNA 1O87A 2XM0A 3TJ6A 1LM3B 3U5SA 1ORJA 2OU6A 3V7OA 3DD7A 1RMVA
chains in the Genus database with same CATH topology
3ASNC 2CDQA 2CNWA 4AK9A 2Y3DA 3ZG1A 2KQ9A 2X51A 2EIJC 2MYSA 3K6BA 2H7OA 1ZHYA 4BJ6C 4AX2A 3JRTA 3AG4C 4W8KA 4PK4A 1PCXA 3DMDA 3OEOA 4IAOA 1JPJA 1ST6A 1OCOC 1FFHA 1OCRC 3Q7GA 3UGOA 3LJBA 1MMGA 1MNEA 4BJTA 4Q7CA 3B9QA 5IY5C 4LLCA 1BR2A 4ZLDA 2J45A 2NG1A 3SP1A 4O79A 4PFOA 2YEVA 1O5HA 2Q9AA 4GYTA 1V55C 3DXJF 3O39A 3RH3A 2EINC 3M1CB 1PD0A 3DJNB 3EFOA 4FWVA 5KYWB 1D0YA 3I4UA 2H7BA 2JD3A 1Z5ZA 2IXPA 2PX0A 4U5FE 3KL4A 3NYMA 4HEAJ 3E70C 3DM5A 2HV7A 2OCCC 3EFOB 3LLKA 3Q7LA 2R7RA 4OIOF 1OCZC 1FMVA 2A68F 1KU2A 4JURI 5D92A 1ZU4A 2C04A 3K66A 3LLIA 2Y3GA 2ZPAA 5DVWA 4YT4A 3HTKC 3FDQA 4B6IA 1M2OA 4JJFA 3CQZA 2WZFA 2L81A 4EWCA 3HLZA 4PJNA 2E87A 3L34A 4I1OB 1FTSA 4Q4ZF 4RBNA 4EBBA 2W4MA 3SEOA 3OWTA 4C3BA 1OKKD 2VASA 4XTKA 4I44A 1RJ9B 1QZXA 3AG2C 1LKXA 1G8XA 4C7OB 2Y69C 1BR1A 1VK5A 4KC9A 2W9YA 2WZLA 4BJ1A 1FFTC 5E33A 3N0TA 2IXMA 3JYHA 3N2ZB 4FESA 4U5CE 4GEHA 2R7XA 3EH1A 4DOZA 3WG7C 5CI8A 2M4EA 4CS8C 2WVQA 1TKNA 3EGDB 4HFKB 3ZVRA 3S29A 4BJ6A 1M56C 3DAGA 5KYNA 3HJCA 2IOQA 1NU7D 2FGYA 1D1CA 3EHNA 4ANJA 5L3QA 1NU9C 2DYRC 2WB7A 1Z6AA 1M57C 3DAFA 3EHMA 4OD4A 2XRHA 2J7PD 4JVSA 2A6EF 3SNHA 5EGYA 2PFDA 1D0XA 2J9WA 5E2QA 3B0UX 1IZMA 3I5QA 1OKKA 2XL4A 3T6BA 3WODF 2EIKC 4XLNF 3B0VC 3NKEA 4IWBA 1D0ZA 3UR3C 2ZXOA 5B1BC 4KI2A 5KYXB 1VYKA 2J9UA 5D91A 2EIMC 3F47A 5HSWA 4OIQF 1TWHA 2J0WA 3DM9B 1VMAA 5KYWA 2OG2A 4G7OF 3ITFA 3LS1A 3X1OA 3T6JA 1OCCC 4LERA 5DQZA 4H4KC 5CI9A 4YT8A 5KYUB 4XLPF 4DBRA 3NRHA 5E3CA 3AQBA 3L0IA 4AE4B 3RIPA 3OA1A 5KYYB 3ECSA 2J7PA 3T4RA 2IYLD 1SZIA 2J46A 2W4BA 1TWCA 3EJNA 2KJGA 3K1HA 2R7OA 4MNDA 3CZ6A 1MMAA 3AG1C 3KH2A 1N1CA 4U5HA 4CSAA 3UMIA 4K7BA 4KBLA 2CW0F 2V26A 1M2VB 1LVKA 1J8YF 2WZGA 5T1DB 1RJ9A 2NUTB 3FAJA 4U5DE 4E7SA 1NG1A 1PD1A 4C7OA 2WVOA 3K7DA 4ULWA 3LEVA 2H7VC 3PMRA 1V54C 1Z23A 4N06A 3JCUQ 4DVZA 3QMKA 1ZHXA 3EPVA 3MX3A 4BEJA 3E9VA 4DVYP 2P6VA 4O6MA 4F4BA 3EGDA 4NY3A 3DZAA 1VOMA 2WVNA 5EHHA 2CGEA 2PX3A 2R7WA 3B0PA 4Q5SF 3NDBB 4JW1A 1ZHTA 4PJJA 2V3CC 4XWJA 5T3TA 3N24A 2G62A 3ZC4A 3EG9B 2XXAB 2W45A 3W8IA 3EQLF 3ABKC 3Q6NA 3EGXB 3VAYA 4WJ0A 3ABMC 3ZIBA 1ZYRF 2GFHA 3DJUB 3KKBA 4OIRF 5L3VA 4QDLA 2VH3A 3AQCA 3AG3C 4LLEA 4G7HF 3O6XA 3UMKA 2R7SA 3NYJA 4M63A 2YHSA 1ZHWA 3JSZA 2WL8A 2R7QA 3LAYA 1MNDA 2Y3BA 3UNGC 5E3AA 2YZSA 1BR4A 2Q9BA 3QZCA 2ZXPA 4U5EE 2G3KA 2I8BA 5T3WA 2KNHA 3ZSUA 1LS1A 3FHDA 2Q9CA 2EILC 5KYXA 1FMWA 3SZRA 2ZXWC 2B0JA 2Y39A 4IJJA 1TR2A 2PP4A 1VYIA 5DS4A 1TWAA 3TD7A 5KYUA 4PFPA 1ZHZA 4RDAA 2QY9A 2NUPB 2R7TA 3CSKA 5B3SC 4X0RA 4BJ5C 4AE4A 5KYYA 2KW3C 4FX5A 2Z15A 3W2WA 4G7ZF 4U5BE 3I5PA 3NKDA 4CS9C 3SYNA 1J8MF 4CIHA 3X2QC 3JT1A 5DQTA 2XSEA 3K1IC 3ASOC 2DGJA 4YN0B 4JCHA 3KMIA 4I1MA 1D1BA 1M2VA 4KNVA 3NG1A 4C3DA 4U5GA 5BUOA 2NUTA 3W8HA 1Z3IX 2HV6A 3LESA 4MQ9F 3EH2A 2ZXRA 4O7GA 4QI0A 4CS8A 3S0XA 5FCLA 4G0HA 1IW7F 4P6IC 1WGWA 3GODA 4PJMA 1W2WA 4RD9A 2C03A 3VYWA 4HE8D 5B1AC 5DLJA 3PHF2 3K33A 4JJGA 3Q6MA 2J9VA 4OD5A 2G3VA 2VB6A 3EG9A 3EZHA 3NYLA 2XXAA 3ABLC 3S27A 2DYSC 3RKOF 1S7ZA 1D1AA 1SMYF 2Y3HA 3EGXA 3F46A 1QLEC 4J30B 3S28A 4O6NA 2R7UA 4O6YA 4IRUA 3GANA 4KNWA 3W2VA 4ZLCA 2A6HF 4BG0A 3RFYA 1Z63A 4E7ZA 3UGPA 3LNRA 3RYLA 4OIPF 2CNWD 3POVA 2LSEA 2QTVA 5F5HA 2O9XA 2KGOA 4DBQA 2A1DD 2BE5F 2IXOA 5F5FA 3IEEA 2L9JA 4QI2A 1MMDA 5DS5A 4I3MA 3EZIA 2Q3TA 5DS6A 4CSAC 2P7VA 4YT5A 3LS0A 4LACB 2PF4E 4BJ5A 3H65A 4YJWA 1NZEA 1SF8A 2A69F 2D5RB 4YT2A 4PJLA 4JZAA 2FFHA 4YWQA 1JPNA 4CS9A 2J0XA 1ZU5A 3MLGA 4C3EA 4CS7A 2R7VA 3UMHA 4J32B 4HFFB 2NUPA 4A2NB 2MWQA 4K0DA 1TWGA 4OINF 4CBEA 3FVYA 2IXNA 1MMNA 1O87A 3V7OA 3DD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRH A; 
#chains in the Genus database with same CATH topology
 3SXM A;  3RQE A;  5JS5 A;  1YA9 A;  3ASN C;  3M79 A;  2CDQ A;  2CNW A;  4AK9 A;  3J06 A;  4WGZ A;  2Y3D A;  3ZG1 A;  2KQ9 A;  4U9D A;  2A0B A;  2X51 A;  2EIJ C;  2MYS A;  3RVZ A;  1YZA A;  1C17 M;  2H7O A;  3K6B A;  1ZHY A;  4BJ6 C;  3WHN A;  4AX2 A;  5CIV A;  1KTM A;  3JRT A;  3AG4 C;  5JSL A;  2EPL X;  4W8K A;  4JTC B;  1R5I D;  1WAS A;  2ZD9 A;  4PK4 A;  1PCX A;  4XEF A;  1L7C A;  1QPU A;  1I4Y A;  1XZQ A;  2L6F A;  2ETS A;  2QE9 A;  3DMD A;  3OEO A;  4R32 A;  4IAO A;  1JPJ A;  1ST6 A;  2QNL A;  4DRI B;  1OCO C;  1Q0F A;  1FFH A;  1OCR C;  2YL0 A;  2LFD A;  1FNT c;  3Q7G A;  1A7V A;  3UGO A;  2RSE B;  3GEH A;  3LJB A;  4XQ1 A;  1MMG A;  3ZDL A;  5B3I A;  1MNE A;  4BJT A;  4CIP A;  1OQC A;  4IAR A;  2PNO A;  1K04 A;  3HNJ A;  4Q7C A;  3B9Q A;  4PAC A;  3C62 A;  1M6T A;  5IY5 C;  4LLC A;  5K0I A;  3AOU A;  1BR2 A;  4ZLD A;  2J45 A;  3H2V A;  4EIY A;  1TQG A;  2NG1 A;  3U3B A;  3SP1 A;  4O79 A;  2XLO A;  2OEX A;  1HW2 A;  4PFO A;  2YEV A;  1O5H A;  2Q9A A;  4GYT A;  5L0I A;  1V55 C;  3DXJ F;  2R03 A;  3O39 A;  1JOG A;  3RH3 A;  2EIN C;  3M1C B;  1PD0 A;  1WAT A;  3DJN B;  3EFO A;  3JSE O;  4FWV A;  4E17 A;  5KYW B;  4W8P A;  1D0Y A;  2FAP B;  2HZ8 A;  4N4W A;  3S84 A;  4E0H A;  3C8G D;  2XL8 A;  2IM8 A;  3I4U A;  3V5Z A;  2H7B A;  3JRM O;  1UG7 A;  2JD3 A;  1Z5Z A;  2IXP A;  2LQG A;  2PX0 A;  3M4C A;  1FAP B;  3KL4 A;  1BBH A;  3NYM A;  4U5F E;  4E0I A;  4HEA J;  1S05 A;  3E70 C;  1RKC A;  3DM5 A;  2HV7 A;  2OCC C;  3EFO B;  1A7D A;  2KYH A;  3LLK A;  3Q7L A;  4MVS A;  3U2M A;  2R7R A;  4OIO F;  1OCZ C;  1ZZP A;  1FMV A;  2AVK A;  2A68 F;  4YL1 A;  3GM2 A;  1KU2 A;  2J8W A;  4JUR I;  5D92 A;  1ZU4 A;  2C04 A;  3K66 A;  4P9T A;  4IB4 A;  3LLI A;  2R9R B;  1JRA A;  2Y3G A;  2ZPA A;  5DVW A;  3U9M A;  4YT4 A;  1YYJ A;  3HTK C;  4EBJ A;  4B6I A;  1M2O A;  3IQC A;  3FDQ A;  4JJF A;  3CQZ A;  2X0C A;  2WZF A;  2L81 A;  3RF3 A;  4EWC A;  5HV9 A;  3VM6 A;  3HLZ A;  1E84 A;  4PJN A;  2E87 A;  3L34 A;  4I1O B;  1FTS A;  3MYF A;  1C02 A;  4Q4Z F;  4RBN A;  4EBB A;  2JX0 A;  2W4M A;  4MVZ A;  4XEV A;  3KPH A;  3OWT A;  3SEO A;  1U0B B;  4C3B A;  4JE9 A;  3G4X A;  5L0F A;  1OKK D;  1G4W R;  2VAS A;  4XTK A;  4I44 A;  4CDV A;  1RJ9 B;  1QZX A;  3AG2 C;  3V5Y A;  1LKX A;  1VLS A;  1G8X A;  3A11 A;  2Y69 C;  4DXW A;  1BR1 A;  4C7O B;  1UFB A;  2OJQ A;  1VK5 A;  4KC9 A;  2W9Y A;  4N6H A;  1JR8 A;  2WZL A;  2YVK A;  4BJ1 A;  1FFT C;  2VCC A;  3N0T A;  5E33 A;  1I5N A;  3KYJ A;  4JCZ A;  2HJM A;  1PV3 A;  4ER9 A;  2IXM A;  1NBB A;  3JYH A;  1Q0D A;  3FAP B;  3N2Z B;  3DWW A;  3NMI A;  1SR2 A;  4FES A;  4U5C E;  4GEH A;  2XLV A;  2R7X A;  3EH1 A;  4CDY A;  3U8V A;  4DOZ A;  3WG7 C;  3C8G A;  2M4E A;  3C63 A;  5CI8 A;  2WVQ A;  4IAQ A;  3LEO A;  4CS8 C;  1TKN A;  3EGD B;  5AC4 A;  3GEE A;  4MVO A;  4HFK B;  5FZT A;  3ZVR A;  3S29 A;  4BJ6 A;  1YZC A;  4MTO A;  4UDV A;  1M56 C;  3SXZ A;  3DAG A;  1U6H A;  1OW8 A;  2ICW G;  5KYN A;  2HMQ A;  3HJC A;  2IOQ A;  5JRA A;  2YLD A;  3NMJ A;  1NU7 D;  2FGY A;  1D1C A;  3EHN A;  4ANJ A;  5L3Q A;  2PBE A;  1A7E A;  3JTL O;  1NU9 C;  2DYR C;  2YQY A;  5JP7 A;  2WB7 A;  1C03 A;  1Z6A A;  5COG A;  3PDM P;  1M57 C;  3WAQ A;  1Y4C A;  2GDC A;  1LE4 A;  1RXQ A;  2LCH A;  3DAF A;  3EHM A;  4OD4 A;  3AGU A;  3RW0 A;  2XRH A;  4CJO A;  2J7P D;  4JVS A;  4JTA B;  2TMV P;  1KNY A;  2A6E F;  4P9F A;  3SNH A;  3IQT A;  5EGY A;  1T01 A;  1XWJ A;  2PFD A;  3L8J A;  1WTY A;  1K40 A;  1D0X A;  1R4T A;  2J9W A;  5E2Q A;  5A6K A;  3B0U X;  2KC3 A;  3IPM O;  3W4Y A;  1IZM A;  1OW7 A;  2UUI A;  3ZWI A;  3I5Q A;  1EI7 A;  1Q0G A;  4A4A A;  1OKK A;  1CPQ A;  1ZW2 A;  2XL4 A;  3LUT B;  3T6B A;  3VRC A;  4NCQ A;  3WOD F;  1YDI A;  3TOL A;  4MVU A;  3MFN A;  2EIK C;  4XLN F;  2EPK X;  3G50 A;  3B0V C;  3CAX A;  3NKE A;  2YLI A;  2IBF A;  1T6U A;  4XPX A;  2XLM A;  4IWB A;  1D0Z A;  3UR3 C;  2ZXO A;  5B1B C;  4KI2 A;  4CX9 A;  5KYX B;  1VYK A;  2NPU A;  2J9U A;  5D91 A;  2EIM C;  4EKW A;  1Y6D A;  1HY5 A;  4MVQ A;  1CGN A;  3F47 A;  5HSW A;  1QVX A;  4OIQ F;  1TWH A;  4BPM A;  2J0W A;  3QTH A;  3DM9 B;  2HKV A;  2HSQ A;  3GWL A;  1VMA A;  2HJ3 A;  5KYW A;  2OG2 A;  4G7O F;  2LD6 A;  5L0G A;  3ITF A;  2YRF A;  2Q4F A;  3LS1 A;  1LI7 A;  3X1O A;  3BEH A;  3U3F A;  3T6J A;  1OCC C;  4LER A;  5DQZ A;  4H4K C;  5CI9 A;  4YT8 A;  5KYU B;  4XLP F;  4DBR A;  1CGM E;  4YL0 A;  5BQI A;  1AVO B;  1WOL A;  3NRH A;  5E3C A;  2XL6 A;  4Z9H A;  3AQB A;  3VF0 A;  1NLX A;  2AU5 A;  5AGF A;  4MW8 A;  1GQA A;  3L0I A;  1GGQ A;  2QUP A;  1V74 B;  2XS1 A;  3RIP A;  4AE4 B;  3OA1 A;  5KYY B;  3ECS A;  3FOP A;  2J7P A;  1EKY A;  3T4R A;  2XLH A;  2HS5 A;  1YJG A;  1SZI A;  2IYL D;  2J46 A;  4LDR A;  2W4B A;  1TWC A;  3EJN A;  2KJG A;  2YL3 A;  3K1H A;  3L1M A;  4NTA A;  2R25 A;  1CGO A;  3R7C A;  2R7O A;  4MND A;  1E86 A;  2CCY A;  3CZ6 A;  3B29 A;  1MMA A;  5L0D A;  3AG1 C;  2YL1 A;  3AGT A;  3KH2 A;  1N1C A;  1AEP A;  4U5H A;  4CSA A;  4PR9 A;  5A6B D;  2YL7 A;  4BEM J;  1APC A;  3UMI A;  4K7B A;  4KBL A;  1HW1 A;  1G5Z A;  2OKU A;  2OJE D;  2CW0 F;  1OR3 A;  2V26 A;  1FR0 A;  1M2V B;  1DOV A;  1LVK A;  3TJ5 A;  1QQ3 A;  1J8Y F;  2WZG A;  5T1D B;  5AC5 A;  1RJ9 A;  3HNI A;  3U8P A;  5BQH A;  3TOM A;  2NUT B;  3FAJ A;  4MTF A;  4U5D E;  4E7S A;  1NG1 A;  3A9C A;  1PD1 A;  2HMZ A;  5A6J A;  4C7O A;  2WVO A;  3K7D A;  4ULW A;  3LEV A;  1E85 A;  2H7V C;  3DKA A;  2R05 A;  3PMR A;  1V54 C;  1Z23 A;  2OEV A;  4N06 A;  3JCU Q;  5L0C A;  4DVZ A;  3QMK A;  1ZHX A;  4Z9I A;  1G4U S;  3EPV A;  3MX3 A;  1A0B A;  4BEJ A;  3E9V A;  1HMD A;  1LS4 A;  4DVY P;  2P6V A;  4O6M A;  3TUL A;  2KK1 A;  4F4B A;  2NSF A;  3EGD A;  3M15 A;  4NY3 A;  3DZA A;  1VOM A;  2WVN A;  5EHH A;  2CGE A;  1EA8 A;  2PX3 A;  2R7W A;  3B0P A;  1YVI A;  4Q5S F;  3NDB B;  3RQF A;  4JW1 A;  1ZHT A;  1LE2 A;  4PJJ A;  2V3C C;  2P1A A;  4XWJ A;  1OXB A;  1TFO B;  1WWP A;  2CYD A;  2G62 A;  3N24 A;  4NTB A;  256B A;  3EG9 B;  2XXA B;  2W45 A;  3W8I A;  2BL2 A;  3O55 A;  3EQL F;  3ABK C;  3Q6N A;  3GEI A;  4EHP A;  3GM1 A;  3EGX B;  3VAY A;  1F1M A;  2XS8 A;  3GWN A;  4WJ0 A;  4K1O A;  3ZQV A;  4DJ9 A;  3ABM C;  5T3T A;  3ZIB A;  1GS9 A;  1ZYR F;  2GFH A;  1T6Q A;  3DJU B;  3KKB A;  3UNG C;  2R02 A;  1YAU O;  3SXY A;  3FXH A;  4OIR F;  4D4N A;  3TK0 A;  4FAP B;  5L3V A;  3BRJ A;  1H7I A;  4QDL A;  5A6B A;  2VH3 A;  1VB5 A;  3AQC A;  3AG3 C;  1RKE B;  3JZ0 A;  3MYI A;  4LLE A;  4G7H F;  3O6X A;  1VTM P;  4J7Y A;  3UMK A;  3MBG A;  2R7S A;  3ATP A;  2JPU A;  3NYJ A;  5L0H A;  1XZP A;  4M63 A;  2YHS A;  1ZHW A;  1TFK B;  3JSZ A;  2Q7R A;  2WL8 A;  2R7Q A;  3LAY A;  1MND A;  1ORY A;  2Y3B A;  1OXK A;  3IQ6 A;  4XPW A;  2L6H A;  2VC9 A;  2YZS A;  4N6C A;  5E3A A;  1BR4 A;  3HNK A;  1AUE A;  2Q9B A;  3QZC A;  2ZXP A;  4U5E E;  3S9O A;  2G3K A;  2I8B A;  5T3W A;  2KNH A;  3ZSU A;  1LS1 A;  2H8A A;  2M64 A;  5COF A;  4J7T A;  4JC7 A;  3FHD A;  2LK4 A;  2Q9C A;  3V5X A;  3S90 A;  2EIL C;  4XEK A;  5KYX A;  1FMW A;  3FOO A;  1A41 A;  3HKK A;  3QVZ A;  3SZR A;  2ZXW C;  4D4X A;  2LP4 A;  2B0J A;  4NC3 A;  1YLM A;  2Y39 A;  4IJJ A;  2XLE A;  1TR2 A;  1Q0K A;  4MS2 A;  4MVM A;  2PP4 A;  3ZC4 A;  1VYI A;  3SXK A;  5DS4 A;  2AWC A;  2J9B A;  1TWA A;  3TD7 A;  3QW1 A;  5KYU A;  4PFP A;  3U0C A;  1ZHZ A;  1QSP A;  4RDA A;  3T9O A;  2XLD A;  5BQG A;  3FMS A;  2QY9 A;  3ZTZ A;  3AJM A;  1U89 A;  2NUP B;  3RVY A;  2R7T A;  1H9T A;  3CSK A;  2XM4 A;  2LIG A;  5B3S C;  1NFO A;  5JT4 A;  4X0R A;  4MW3 A;  4BJ5 C;  4AE4 A;  2DB4 A;  3R2P A;  5KYY A;  1GM5 A;  2KW3 C;  4FX5 A;  2Z15 A;  3W2W A;  3C7J A;  4G7Z F;  5JLI A;  4NQF A;  1CPR A;  3LNM B;  3I5P A;  4U5B E;  3NKD A;  1NFN A;  4LDK A;  2HSB A;  4CS9 C;  1NSG B;  3B71 A;  3SYN A;  2YWA A;  1J8M F;  3QVY A;  1Q0M A;  3C8Z A;  3H2U A;  4U9E A;  2NSG A;  4CIH A;  3PCV A;  5EK0 A;  3X2Q C;  3JT1 A;  5DQT A;  2XSE A;  3K1I C;  5JUA A;  3ASO C;  4DRH B;  2DGJ A;  1L3P A;  4AL0 A;  2D4U A;  4L6R A;  1LPE A;  4YN0 B;  1OW6 A;  1JAF A;  4JCH A;  3KMI A;  4I1M A;  1D1B A;  1M2V A;  2YLG A;  1EQ1 A;  2I15 A;  4KNV A;  3NG1 A;  4C3D A;  4U5G A;  5BUO A;  2NUT A;  4XPY A;  4IGG A;  1Z7Q c;  1OR2 A;  4EUK B;  3W8H A;  1T9K A;  1HE9 A;  1Z3I X;  2HV6 A;  3LES A;  4MQ9 F;  3EH2 A;  1RCP A;  2ZXR A;  4O7G A;  3NMK A;  4QI0 A;  1LIH A;  4CS8 A;  2KSF A;  5FCL A;  4G0H A;  2QLA A;  3S0X A;  1IW7 F;  1ZVZ A;  4P6I C;  1WGW A;  2L6G A;  1K05 A;  2UUH A;  4JRZ A;  3GOD A;  4ONS A;  4PJM A;  3RQG A;  1W2W A;  3C18 A;  4RD9 A;  2C03 A;  3L8I A;  4JEA A;  3VYW A;  3M4B A;  4HE8 D;  3U2L A;  2DI3 A;  5B1A C;  5DLJ A;  3PHF 2;  3O10 A;  3K33 A;  4JJG A;  3Q6M A;  1ZW3 A;  2J9V A;  4OD5 A;  2G3V A;  2VB6 A;  1O3U A;  3EG9 A;  3EZH A;  3NYL A;  1MQV A;  2XXA A;  3JYY A;  2RD9 A;  3ABL C;  3S27 A;  4DRJ B;  2DYS C;  3RKO F;  4Z9J A;  1S7Z A;  1D1A A;  1SMY F;  5A69 A;  2Y3H A;  2L7A A;  1H9G A;  2GWW A;  3EGX A;  4H54 A;  4WGY A;  3F46 A;  4YK5 A;  1QLE C;  2P0N A;  3T6G B;  4J30 B;  4JIO A;  2LFF A;  3S28 A;  4O6N A;  5F28 E;  4LDQ A;  4O6Y A;  2R7U A;  4IRU A;  3GAN A;  2EPO A;  5A6A A;  4KNW A;  3W2V A;  4ZLC A;  2A6H F;  3IQ5 A;  4BG0 A;  1T6I A;  1E83 A;  3RFY A;  1Z63 A;  4E7Z A;  3UGP A;  3LNR A;  1YA7 O;  4MVR A;  3GOR A;  1E2X A;  2EPN A;  1LI5 A;  1RKE A;  5TJ5 E;  3RYL A;  4OIP F;  1SYQ A;  3HNL A;  2CNW D;  3TQO A;  3POV A;  2LSE A;  2VCB A;  4JTD B;  5JVE A;  2QTV A;  5F5H A;  5L0J A;  2O9X A;  2MHR A;  3IHU A;  1BDJ B;  2KGO A;  2Q00 A;  1B68 A;  4DBQ A;  2EPM X;  2OOC A;  1BZ4 A;  1QKR A;  2A1D D;  2BE5 F;  2BC5 A;  2IXO A;  3DE8 A;  5F5F A;  2F22 A;  3IEE A;  3US6 A;  2ASR A;  4E18 A;  2L9J A;  4QI2 A;  1MMD A;  4YL3 A;  4I3M A;  5DS5 A;  1DOW A;  1HMO A;  2YKZ A;  3EZI A;  2Q3T A;  3ZQY A;  1JMW A;  5DS6 A;  4CSA C;  2P7V A;  5COM A;  1H6G A;  3G4Z A;  4YT5 A;  3LS0 A;  4CDA A;  4JEB A;  2GA0 A;  4LAC B;  2PF4 E;  5GPG B;  4BJ5 A;  3H65 A;  3KYI A;  4YJW A;  1V4A A;  1I4Z A;  4CJG A;  1NZE A;  1SF8 A;  2A69 F;  2D5R B;  4YT2 A;  4PJL A;  1YYX A;  2FFH A;  4JZA A;  2VCA A;  4YWQ A;  2HFI A;  4G78 A;  1YAR O;  1JPN A;  2AP3 A;  4CS9 A;  1ORS C;  4AL1 A;  2J0X A;  1ZU5 A;  1VLT A;  3MLG A;  2A0U A;  3ZTM A;  1T5O A;  2AWY A;  4C3E A;  4CS7 A;  3GM3 A;  3U9J A;  4ULV A;  4J32 B;  3UMH A;  2R7V A;  3C8G B;  4HFF B;  2OQM A;  3QW0 A;  4WAB A;  2HUJ A;  2NUP A;  4MTG A;  2B0H A;  3DE9 A;  2MWQ A;  3K1I A;  4K0D A;  2P61 A;  4A2N B;  2GAQ A;  1TWG A;  4OIN F;  1HE1 A;  4CBE A;  3FVY A;  4JKV A;  4GQH A;  2IXN A;  4NTF A;  3CEX A;  4EBK A;  1WN0 A;  2XLW A;  3DI5 A;  1MMN A;  1O87 A;  2XM0 A;  3TJ6 A;  1LM3 B;  3U5S A;  1ORJ A;  2OU6 A;  3V7O A;  3DD7 A;  1RMV A; 
#chains in the Genus database with same CATH homology
 3ASN C;  2CDQ A;  2CNW A;  4AK9 A;  2Y3D A;  3ZG1 A;  2KQ9 A;  2X51 A;  2EIJ C;  2MYS A;  3K6B A;  2H7O A;  1ZHY A;  4BJ6 C;  4AX2 A;  3JRT A;  3AG4 C;  4W8K A;  4PK4 A;  1PCX A;  3DMD A;  3OEO A;  4IAO A;  1JPJ A;  1ST6 A;  1OCO C;  1FFH A;  1OCR C;  3Q7G A;  3UGO A;  3LJB A;  1MMG A;  1MNE A;  4BJT A;  4Q7C A;  3B9Q A;  5IY5 C;  4LLC A;  1BR2 A;  4ZLD A;  2J45 A;  2NG1 A;  3SP1 A;  4O79 A;  4PFO A;  2YEV A;  1O5H A;  2Q9A A;  4GYT A;  1V55 C;  3DXJ F;  3O39 A;  3RH3 A;  2EIN C;  3M1C B;  1PD0 A;  3DJN B;  3EFO A;  4FWV A;  5KYW B;  1D0Y A;  3I4U A;  2H7B A;  2JD3 A;  1Z5Z A;  2IXP A;  2PX0 A;  4U5F E;  3KL4 A;  3NYM A;  4HEA J;  3E70 C;  3DM5 A;  2HV7 A;  2OCC C;  3EFO B;  3LLK A;  3Q7L A;  2R7R A;  4OIO F;  1OCZ C;  1FMV A;  2A68 F;  1KU2 A;  4JUR I;  5D92 A;  1ZU4 A;  2C04 A;  3K66 A;  3LLI A;  2Y3G A;  2ZPA A;  5DVW A;  4YT4 A;  3HTK C;  3FDQ A;  4B6I A;  1M2O A;  4JJF A;  3CQZ A;  2WZF A;  2L81 A;  4EWC A;  3HLZ A;  4PJN A;  2E87 A;  3L34 A;  4I1O B;  1FTS A;  4Q4Z F;  4RBN A;  4EBB A;  2W4M A;  3SEO A;  3OWT A;  4C3B A;  1OKK D;  2VAS A;  4XTK A;  4I44 A;  1RJ9 B;  1QZX A;  3AG2 C;  1LKX A;  1G8X A;  4C7O B;  2Y69 C;  1BR1 A;  1VK5 A;  4KC9 A;  2W9Y A;  2WZL A;  4BJ1 A;  1FFT C;  5E33 A;  3N0T A;  2IXM A;  3JYH A;  3N2Z B;  4FES A;  4U5C E;  4GEH A;  2R7X A;  3EH1 A;  4DOZ A;  3WG7 C;  5CI8 A;  2M4E A;  4CS8 C;  2WVQ A;  1TKN A;  3EGD B;  4HFK B;  3ZVR A;  3S29 A;  4BJ6 A;  1M56 C;  3DAG A;  5KYN A;  3HJC A;  2IOQ A;  1NU7 D;  2FGY A;  1D1C A;  3EHN A;  4ANJ A;  5L3Q A;  1NU9 C;  2DYR C;  2WB7 A;  1Z6A A;  1M57 C;  3DAF A;  3EHM A;  4OD4 A;  2XRH A;  2J7P D;  4JVS A;  2A6E F;  3SNH A;  5EGY A;  2PFD A;  1D0X A;  2J9W A;  5E2Q A;  3B0U X;  1IZM A;  3I5Q A;  1OKK A;  2XL4 A;  3T6B A;  3WOD F;  2EIK C;  4XLN F;  3B0V C;  3NKE A;  4IWB A;  1D0Z A;  3UR3 C;  2ZXO A;  5B1B C;  4KI2 A;  5KYX B;  1VYK A;  2J9U A;  5D91 A;  2EIM C;  3F47 A;  5HSW A;  4OIQ F;  1TWH A;  2J0W A;  3DM9 B;  1VMA A;  5KYW A;  2OG2 A;  4G7O F;  3ITF A;  3LS1 A;  3X1O A;  3T6J A;  1OCC C;  4LER A;  5DQZ A;  4H4K C;  5CI9 A;  4YT8 A;  5KYU B;  4XLP F;  4DBR A;  3NRH A;  5E3C A;  3AQB A;  3L0I A;  4AE4 B;  3RIP A;  3OA1 A;  5KYY B;  3ECS A;  2J7P A;  3T4R A;  2IYL D;  1SZI A;  2J46 A;  2W4B A;  1TWC A;  3EJN A;  2KJG A;  3K1H A;  2R7O A;  4MND A;  3CZ6 A;  1MMA A;  3AG1 C;  3KH2 A;  1N1C A;  4U5H A;  4CSA A;  3UMI A;  4K7B A;  4KBL A;  2CW0 F;  2V26 A;  1M2V B;  1LVK A;  1J8Y F;  2WZG A;  5T1D B;  1RJ9 A;  2NUT B;  3FAJ A;  4U5D E;  4E7S A;  1NG1 A;  1PD1 A;  4C7O A;  2WVO A;  3K7D A;  4ULW A;  3LEV A;  2H7V C;  3PMR A;  1V54 C;  1Z23 A;  4N06 A;  3JCU Q;  4DVZ A;  3QMK A;  1ZHX A;  3EPV A;  3MX3 A;  4BEJ A;  3E9V A;  4DVY P;  2P6V A;  4O6M A;  4F4B A;  3EGD A;  4NY3 A;  3DZA A;  1VOM A;  2WVN A;  5EHH A;  2CGE A;  2PX3 A;  2R7W A;  3B0P A;  4Q5S F;  3NDB B;  4JW1 A;  1ZHT A;  4PJJ A;  2V3C C;  4XWJ A;  5T3T A;  3N24 A;  2G62 A;  3ZC4 A;  3EG9 B;  2XXA B;  2W45 A;  3W8I A;  3EQL F;  3ABK C;  3Q6N A;  3EGX B;  3VAY A;  4WJ0 A;  3ABM C;  3ZIB A;  1ZYR F;  2GFH A;  3DJU B;  3KKB A;  4OIR F;  5L3V A;  4QDL A;  2VH3 A;  3AQC A;  3AG3 C;  4LLE A;  4G7H F;  3O6X A;  3UMK A;  2R7S A;  3NYJ A;  4M63 A;  2YHS A;  1ZHW A;  3JSZ A;  2WL8 A;  2R7Q A;  3LAY A;  1MND A;  2Y3B A;  3UNG C;  5E3A A;  2YZS A;  1BR4 A;  2Q9B A;  3QZC A;  2ZXP A;  4U5E E;  2G3K A;  2I8B A;  5T3W A;  2KNH A;  3ZSU A;  1LS1 A;  3FHD A;  2Q9C A;  2EIL C;  5KYX A;  1FMW A;  3SZR A;  2ZXW C;  2B0J A;  2Y39 A;  4IJJ A;  1TR2 A;  2PP4 A;  1VYI A;  5DS4 A;  1TWA A;  3TD7 A;  5KYU A;  4PFP A;  1ZHZ A;  4RDA A;  2QY9 A;  2NUP B;  2R7T A;  3CSK A;  5B3S C;  4X0R A;  4BJ5 C;  4AE4 A;  5KYY A;  2KW3 C;  4FX5 A;  2Z15 A;  3W2W A;  4G7Z F;  4U5B E;  3I5P A;  3NKD A;  4CS9 C;  3SYN A;  1J8M F;  4CIH A;  3X2Q C;  3JT1 A;  5DQT A;  2XSE A;  3K1I C;  3ASO C;  2DGJ A;  4YN0 B;  4JCH A;  3KMI A;  4I1M A;  1D1B A;  1M2V A;  4KNV A;  3NG1 A;  4C3D A;  4U5G A;  5BUO A;  2NUT A;  3W8H A;  1Z3I X;  2HV6 A;  3LES A;  4MQ9 F;  3EH2 A;  2ZXR A;  4O7G A;  4QI0 A;  4CS8 A;  3S0X A;  5FCL A;  4G0H A;  1IW7 F;  4P6I C;  1WGW A;  3GOD A;  4PJM A;  1W2W A;  4RD9 A;  2C03 A;  3VYW A;  4HE8 D;  5B1A C;  5DLJ A;  3PHF 2;  3K33 A;  4JJG A;  3Q6M A;  2J9V A;  4OD5 A;  2G3V A;  2VB6 A;  3EG9 A;  3EZH A;  3NYL A;  2XXA A;  3ABL C;  3S27 A;  2DYS C;  3RKO F;  1S7Z A;  1D1A A;  1SMY F;  2Y3H A;  3EGX A;  3F46 A;  1QLE C;  4J30 B;  3S28 A;  4O6N A;  2R7U A;  4O6Y A;  4IRU A;  3GAN A;  4KNW A;  3W2V A;  4ZLC A;  2A6H F;  4BG0 A;  3RFY A;  1Z63 A;  4E7Z A;  3UGP A;  3LNR A;  3RYL A;  4OIP F;  2CNW D;  3POV A;  2LSE A;  2QTV A;  5F5H A;  2O9X A;  2KGO A;  4DBQ A;  2A1D D;  2BE5 F;  2IXO A;  5F5F A;  3IEE A;  2L9J A;  4QI2 A;  1MMD A;  5DS5 A;  4I3M A;  3EZI A;  2Q3T A;  5DS6 A;  4CSA C;  2P7V A;  4YT5 A;  3LS0 A;  4LAC B;  2PF4 E;  4BJ5 A;  3H65 A;  4YJW A;  1NZE A;  1SF8 A;  2A69 F;  2D5R B;  4YT2 A;  4PJL A;  4JZA A;  2FFH A;  4YWQ A;  1JPN A;  4CS9 A;  2J0X A;  1ZU5 A;  3MLG A;  4C3E A;  4CS7 A;  2R7V A;  3UMH A;  4J32 B;  4HFF B;  2NUP A;  4A2N B;  2MWQ A;  4K0D A;  1TWG A;  4OIN F;  4CBE A;  3FVY A;  2IXN A;  1MMN A;  1O87 A;  3V7O A;  3DD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...