3NRHA

Crystal structure of protein bf1032 from bacteroides fragilis, northeast structural genomics consortium target bfr309
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
158
Chain Sequence
QVIFDKNVIEFVTVAAEFCAFLERAESMKRSTFVDTTLKILPLLYLKASMLPKCEMIGDESPETYVTEEIYEVLRINLASILAEKDDYLEIKKNISEDLADIYQDIKDFIFVFQLGLNETMNDSLAICQENFGLLWGQKLVNTMRALHDVKYSPKARL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target BfR309
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein BF1032
total genus 54
structure length 158
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16702 DUF5063 Domain of unknown function (DUF5063)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nrhA00
3NRHA
chains in the Genus database with same CATH superfamily
4PJNA 3VF0A 3AQCA 3FAJA 5FZTA 4XEVA 4FAPB 2OJED 2X51A 1WGWA 4E7SA 3M4CA 1YA9A 5A6JA 4JTCB 2A0BA 3AG3C 4YK5A 4KC9A 3VAYA 5BUOA 1HW2A 1JR8A 3JSZA 4U9EA 1QVXA 1Z5ZA 2F22A 3L1MA 3IHUA 1R5ID 4P6IC 2KK1A 3DZAA 1CPQA 1OKKD 1L3PA 1YJGA 4CSAA 3KKBA 4C7OA 5COGA 3LAYA 1M56C 2XXAB 3B71A 4MVRA 3KPHA 2KW3C 1XZQA 1E85A 2XXAA 4QI2A 4Q5SF 4G7ZF 5HSWA 3IQCA 4Z9HA 2XLMA 2YLDA 2ZXPA 3AGUA 4MW3A 5E2QA 3TJ6A 2A0UA 3ITFA 2YL7A 4NTFA 3NKEA 5A6BD 1J8MF 256BA 3WG7C 1NSGB 3ZC4A 2NPUA 4YL0A 4E18A 1RKEB 4DBQA 1G5ZA 3OEOA 2DI3A 3CQZA 3LLKA 4JEAA 4OINF 3H65A 1RKCA 1QKRA 4U5EE 4BJ6C 3UGOA 2HS5A 1CPRA 3LJBA 5L0IA 1SMYF 4HEAJ 4MVMA 3ABMC 3ABKC 3JT1A 5L3VA 2Q3TA 3L0IA 3EZHA 1TWAA 3K33A 1O87A 3EGDB 3QW1A 1BR1A 2IBFA 1OCZC 3RVZA 3S28A 3TD7A 5BQIA 3ZWIA 2P61A 2RSEB 1OW6A 2PX0A 2R9RB 3K1HA 4OIRF 2BL2A 5JUAA 4H54A 4JTAB 1JPNA 4P9FA 2YLGA 2L7AA 1LVKA 4AL0A 3EG9B 1L7CA 1A7EA 5L0HA 3B0UX 2ICWG 4XTKA 3S27A 2R7OA 3K6BA 4CJOA 4U5FE 1H9TA 1M2VB 1K05A 2J45A 2Y3HA 2JPUA 3DJNB 4KBLA 4U5CE 3UGPA 1EA8A 2R7UA 2HSBA 5JSLA 4JW1A 3JTLO 1GM5A 2PP4A 2A69F 3O6XA 4XPWA 4DVZA 3SXKA 3ATPA 3F46A 4FX5A 4IWBA 3JCUQ 4JC7A 1IZMA 1R4TA 3IQTA 1HE1A 5D91A 4DBRA 1ZW3A 2H7BA 1G8XA 2O9XA 2WZGA 2Y3DA 3OWTA 2PX3A 2X0CA 3JZ0A 2R7RA 4P9TA 1JMWA 1FAPB 1N1CA 2Q00A 1RCPA 3EHNA 5KYYB 5DQZA 3RH3A 5L0FA 4DRJB 1D1BA 3FVYA 3EFOA 2R7VA 2HV7A 2QY9A 3RQFA 3QVYA 4PR9A 2H7VC 4G0HA 3H2VA 1FMWA 2VC9A 3PCVA 4KNVA 1K04A 2NUTA 4WJ0A 4C3BA 2BE5F 2VCCA 3JRTA 3EH2A 3KMIA 2M64A 4PACA 3X2QC 5AC4A 1KU2A 2LQGA 1HMDA 4MVQA 2TMVP 3LUTB 1NFOA 1RJ9A 1Q0FA 1VYKA 1MMAA 1WOLA 3TK0A 4AX2A 1WASA 1NG1A 2L6FA 3M1CB 3AJMA 2KC3A 1PV3A 1D1AA 4JE9A 2YL3A 5KYNA 4EIYA 3B9QA 2Z15A 3C8GB 3U3FA 3T6BA 5JT4A 4BEJA 2IXNA 4PJMA 4PJJA 4E7ZA 3C7JA 4NCQA 1MNDA 3KL4A 3FOOA 4I1MA 1ZVZA 4MTOA 5JS5A 1Z63A 2R02A 1NFNA 2R7SA 5L3QA 1Y6DA 4RD9A 3W2VA 4OIOF 4IB4A 2FGYA 2W4BA 3JYYA 2EPKX 1LE2A 1TWGA 4GYTA 2YLIA 4ER9A 4NY3A 3EZIA 3FDQA 3QMKA 2Q9AA 3UMHA 1FMVA 2PF4E 2Y39A 2OG2A 2A6HF 4AL1A 5DS6A 3ZG1A 2KNHA 4O6NA 3ZSUA 5HV9A 4CSAC 2EPNA 3I5QA 2IXMA 3LEOA 3NMKA 3T6JA 2LSEA 4EHPA 2Q9CA 5JLIA 2XLHA 4F4BA 3HNKA 4Z9IA 5KYWB 1RKEA 2Q7RA 1FNTc 3Q7GA 4NTAA 3PHF2 3I4UA 3G50A 3QZCA 4L6RA 1SR2A 2VH3A 2B0HA 3I5PA 4IAOA 2GFHA 1E2XA 1ZZPA 2IXPA 2DYSC 4N06A 2YKZA 2DYRC 2LCHA 4PJLA 5EGYA 2EIMC 3EG9A 2Q9BA 4I3MA 2J9BA 1NBBA 4JRZA 1LE4A 2G62A 3FMSA 1Q0DA 2IOQA 1H6GA 2CNWA 3S90A 2L6HA 2EPOA 5F5FA 3CZ6A 4KNWA 2XSEA 4YT5A 2QUPA 2LFDA 3GWNA 3ZQYA 4CJGA 2J9VA 1YYXA 2V26A 5AC5A 4LDKA 4AE4A 2R7XA 3GEHA 1Z3IX 4MS2A 3RIPA 4ULWA 5CI9A 1M6TA 1O3UA 4XWJA 1D0ZA 1OR3A 1YLMA 4OD4A 2LFFA 2WL8A 5CIVA 1ZU4A 1TFKB 3QTHA 3ZIBA 4U9DA 2DB4A 4CS8C 3TULA 2AU5A 1H7IA 3DM5A 4EBJA 1D0XA 3W2WA 3ECSA 5DQTA 2XLWA 1VMAA 4U5DE 3T6GB 5JVEA 3LNRA 1OQCA 4KI2A 1CGOA 3VM6A 4CIPA 2J0WA 4A2NB 2PBEA 2UUHA 1TFOB 4ULVA 3SYNA 1PD1A 3SEOA 3U9JA 4DRIB 3HJCA 1XWJA 4J7YA 5KYWA 1G4US 1VB5A 3L8IA 3U3BA 1VYIA 2AP3A 2OU6A 2WZFA 2NSGA 4XEKA 4N6HA 2H7OA 1OCOC 2CW0F 2L9JA 3EQLF 4IRUA 3DE9A 3RQEA 4AK9A 4JTDB 3SXMA 2Y69C 3Q6NA 4PFOA 4JZAA 2UUIA 3TOLA 2HV6A 2JX0A 4OIPF 1TQGA 1HMOA 3SZRA 3GWLA 2HZ8A 4G7HF 3QW0A 2XS1A 4XPYA 1U89A 3B0VC 3S0XA 2EPMX 3C62A 1WWPA 1FR0A 1BZ4A 3DD7A 1VLSA 2LP4A 1JOGA 1LS1A 1LS4A 2WVOA 4JCHA 1Q0GA 4LDQA 4XLPF 1D1CA 4HE8D 5JRAA 1S05A 3M15A 1VLTA 3EGXA 1RMVA 3EPVA 3R2PA 5A69A 1AUEA 4B6IA 4Q4ZF 1MNEA 1U0BB 1T6QA 1K40A 1A41A 1I5NA 1LPEA 2VASA 3LESA 4YN0B 4EKWA 4ZLCA 2W9YA 4ANJA 3NRHA 1I4ZA 3EH1A 2R7TA 2CGEA 4OD5A 3DJUB 3JRMO 3LS1A 5E3CA 4DOZA 3HNJA 1ZHWA 3POVA 3ZDLA 3CSKA 1J8YF 3NMIA 2DGJA 4Z9JA 3B29A 3ZVRA 5F28E 1SF8A 1E83A 1BR4A 1NZEA 3J06A 4IAQA 4NC3A 3BRJA 4JJGA 3CEXA 3SXZA 2FFHA 2J9WA 4AE4B 3ASOC 4D4NA 5D92A 2XL8A 3MBGA 4CS9A 3U8VA 1YZCA 5A6KA 2KSFA 3VYWA 2BC5A 2OOCA 3LLIA 1YYJA 5A6AA 2J7PD 2V3CC 5KYUB 4RDAA 1FFTC 4LACB 1YAUO 4IJJA 2KQ9A 5T3WA 3V5ZA 3LEVA 4YWQA 1T6IA 2A6EF 1TR2A 1YDIA 2W4MA 3WAQA 3SNHA 1CGNA 1RJ9B 3ZQVA 4BJ6A 3N24A 4NTBA 4MW8A 3DAFA 1BBHA 1CGME 1A7DA 3U0CA 2AWYA 1M2OA 1YA7O 3UNGC 3RF3A 4MQ9F 1MMNA 5L0CA 1APCA 2YVKA 3ASNC 2R7WA 2KYHA 3G4XA 3DM9B 5L0GA 4CDVA 1SYQA 2W45A 2HMZA 4W8PA 2XS8A 1G4WR 2C03A 1OXKA 3K66A 3AG1C 1WN0A 2R05A 4YL3A 4I44A 5B1BC 1ZW2A 4WABA 2LK4A 2OKUA 1V74B 3RYLA 1ORSC 1ZYRF 3FOPA 1JAFA 4CS8A 2MYSA 5DS4A 2IXOA 4MVSA 2ETSA 5DVWA 2GAQA 5IY5C 2EPLX 4EBBA 1Q0KA 4BJ5C 1QZXA 2QE9A 4WGYA 1AEPA 2MHRA 1C02A 2YQYA 3PMRA 4XEFA 5CI8A 3JSEO 3IEEA 1QLEC 4M63A 3VRCA 1RXQA 4CS9C 2FAPB 1QPUA 4K1OA 3UMKA 1M2VA 3MFNA 3O10A 3IQ6A 3RFYA 4C3DA 3S84A 3AG4C 2EINC 2G3VA 4C7OB 1WATA 2NSFA 4CBEA 4GEHA 3WODF 4MNDA 4D4XA 5T3TA 2HSQA 3W4YA 1IW7F 2E87A 2OJQA 4LLCA 2J0XA 1EQ1A 3EHMA 4I1OB 2A68F 2OCCC 2OQMA 4BJ5A 5K0IA 1I4YA 3WHNA 3DE8A 4DRHB 1Z7Qc 3DAGA 2WVQA 1YVIA 2HMQA 3F47A 3B0PA 2ZXRA 2ASRA 2GWWA 3HNLA 2XLEA 1TWCA 2WB7A 2YWAA 2YHSA 1MQVA 4PK4A 3DMDA 1T6UA 3U2LA 5GPGB 3DXJF 3LS0A 3RKOF 2IYLD 4IARA 3U8PA 4HFKB 3IPMO 3EJNA 1VK5A 3T9OA 3QVZA 1O5HA 3GODA 3MYFA 1U6HA 2I8BA 3N2ZB 3A11A 3S29A 1OXBA 2QNLA 1PD0A 3NMJA 3AOUA 2IM8A 4K0DA 3A9CA 5COMA 5KYXB 4DVYP 3EGXB 1ZHZA 3EGDA 1FFHA 4JIOA 3G4ZA 3W8IA 3FXHA 3W8HA 2HFIA 4G78A 2YZSA 2CNWD 3K1IC 2C04A 2EILC 3V5XA 3LNMB 1MMDA 4FESA 4U5BE 3C18A 5DLJA 1W2WA 5L0DA 3GM2A 1FTSA 2H8AA 2J8WA 2OEVA 3GEEA 1V4AA 3TQOA 5BQGA 2PNOA 4GQHA 1QSPA 4N6CA 1BR2A 3M4BA 3C8ZA 1ORJA 4PFPA 3AQBA 1NU7D 1LKXA 5B3SC 3ZTZA 5KYXA 1ZHTA 1NU9C 1OW7A 2HUJA 2XLDA 2VCAA 4YT8A 1Z6AA 3DI5A 4YJWA 4XQ1A 1ORYA 2YL1A 3AG2C 4YT4A 2CDQA 2M4EA 4BJ1A 1LIHA 3KH2A 4BPMA 2HJ3A 1V55C 1C17M 2L81A 3U5SA 4E17A 2Q4FA 3HKKA 2XL6A 1GQAA 2GA0A 3KYIA 3T4RA 1H9GA 2JD3A 2L6GA 4JURI 2J46A 2EIJC 2R03A 4MVUA 4CIHA 5L0JA 4U5HA 4JCZA 4JVSA 1Q0MA 1ZHYA 1S7ZA 2WVNA 3OA1A 4J30B 1LI7A 2P6VA 2ZPAA 3E9VA 3C8GA 3H2UA 2AWCA 3L8JA 5B1AC 1T9KA 1WTYA 4O79A 3V7OA 2XM4A 3AGTA 3ZTMA 1GS9A 4MTFA 1E86A 1OW8A 4QI0A 4EBKA 3E70C 4JEBA 2R7QA 4LDRA 2YL0A 1C03A 1OCRC 2R25A 1UG7A 3RQGA 3NKDA 4C3EA 4EUKB 4R32A 4O7GA 4A4AA 2YRFA 5TJ5E 5EK0A 1DOWA 4E0IA 3JYHA 3MX3A 1LM3B 3NYLA 1F1MA 3NG1A 1M57C 3DWWA 3SXYA 3NDBB 2GDCA 1E84A 3GEIA 1T01A 5KYUA 4QDLA 3N0TA 4YL1A 2QLAA 3R7CA 3C63A 5COFA 1ZU5A 3EFOB 2Y3BA 5AGFA 2MWQA 2AVKA 2CYDA 2NUTB 3GANA 3IQ5A 3U9MA 4ZLDA 5E3AA 3DKAA 4J7TA 1OR2A 2NUPA 4ONSA 2A1DD 3UR3C 1Y4CA 3S9OA 4CDYA 2B0JA 4EWCA 2KGOA 4BG0A 1LI5A 1OKKA 1VTMP 4MTGA 3MYIA 3TOMA 5EHHA 3FAPB 4XPXA 4H4KC 2ZXWC 1EI7A 2VB6A 3C8GD 3HTKC 4UDVA 1MMGA 2Y3GA 2XM0A 4DXWA 3CAXA 4IGGA 3NYMA 4WGZA 1JRAA 2HJMA 3NYJA 4Q7CA 1KNYA 1GGQA 2OEXA 2QTVA 4YT2A 4K7BA 1HE9A 1QQ3A 3UMIA 3KYJA 1SZIA 5B3IA 4G7OF 4U5GA 4O6MA 1OCCC 2NG1A 5FCLA 2D5RB 3X1OA 2XLOA 1T5OA 2KJGA 2XL4A 1A7VA 4JJFA 4W8KA 1NLXA 2XRHA 3GM3A 3L34A 3GM1A 4DJ9A 3FHDA 4BEMJ 4X0RA 1TWHA 1KTMA 3HLZA 5DS5A 4N4WA 1JPJA 5KYYA 1DOVA 3PDMP 3SP1A 1YARO 2RD9A 4E0HA 2J9UA 5F5HA 1Z23A 4CX9A 2PFDA 3U2MA 2ZXOA 5JP7A 1B68A 2LIGA 3K7DA 3MLGA 3O55A 5A6BA 1BDJB 4CDAA 5T1DB 4LLEA 1A0BA 3GORA 2G3KA 4RBNA 1VOMA 2J7PA 3ABLC 3RW0A 2NUPB 4MVOA 1ST6A 1D0YA 2EIKC 4OIQF 2YEVA 2D4UA 1XZPA 4J32B 1EKYA 3K1IA 2XLVA 2HKVA 3O39A 3Q7LA 4JKVA 4MVZA 4BJTA 1UFBA 2LD6A 3RVYA 2VCBA 3US6A 4CS7A 1AVOB 1HW1A 1HY5A 2P1AA 2I15A 4XLNF 3V5YA 4HFFB 2P7VA 4O6YA 4LERA 3M79A 1PCXA 3BEHA 1V54C 2ZD9A 5BQHA 2WZLA 3Q6MA 3HNIA 1TKNA 4NQFA 3TJ5A 2P0NA 1YZAA 5E33A 4FWVA 1ZHXA 2CCYA
chains in the Genus database with same CATH topology
4PJNA 3AQCA 3FAJA 2X51A 1WGWA 4E7SA 3AG3C 3VAYA 5BUOA 4KC9A 3JSZA 1Z5ZA 4P6IC 3DZAA 1OKKD 4CSAA 3KKBA 4C7OA 3LAYA 1M56C 2XXAB 2KW3C 2XXAA 4QI2A 4Q5SF 4G7ZF 5HSWA 2ZXPA 5E2QA 3ITFA 3NKEA 1J8MF 3WG7C 3ZC4A 3NDBB 4DBQA 3OEOA 3CQZA 3LLKA 4OINF 3H65A 4U5EE 4BJ6C 3UGOA 3LJBA 1SMYF 4HEAJ 5L3VA 3ABMC 3ABKC 3JT1A 2Q3TA 3L0IA 3EZHA 1TWAA 3K33A 1O87A 3EGDB 1BR1A 1OCZC 3S28A 3TD7A 2PX0A 3K1HA 4OIRF 1JPNA 1LVKA 3EG9B 3B0UX 4XTKA 3S27A 2R7OA 3K6BA 4U5FE 1M2VB 2J45A 2Y3HA 3DJNB 4KBLA 4U5CE 3UGPA 2R7UA 4JW1A 2PP4A 2A69F 3O6XA 4DVZA 3F46A 4FX5A 4IWBA 3JCUQ 1IZMA 5D91A 4DBRA 2H7BA 1G8XA 2O9XA 2WZGA 2Y3DA 3OWTA 2PX3A 2R7RA 1N1CA 5KYYB 3EHNA 5DQZA 3RH3A 1D1BA 3FVYA 3EFOA 2HV7A 2QY9A 2H7VC 4G0HA 4KNVA 1FMWA 2NUTA 4WJ0A 4C3BA 3KMIA 2BE5F 3JRTA 3EH2A 3X2QC 1KU2A 1VYKA 1RJ9A 1MMAA 4AX2A 1NG1A 3M1CB 5KYNA 1D1AA 3B9QA 2Z15A 3T6BA 4BEJA 2IXNA 4PJMA 4PJJA 4E7ZA 1MNDA 3KL4A 1Z63A 4I1MA 2R7SA 5L3QA 3W2VA 4RD9A 4OIOF 2FGYA 2W4BA 1TWGA 4GYTA 4NY3A 3EZIA 3FDQA 3QMKA 2Q9AA 3UMHA 1FMVA 2PF4E 2Y39A 2OG2A 2A6HF 5DS6A 3ZG1A 2KNHA 4O6NA 3ZSUA 4CSAC 3I5QA 2IXMA 3T6JA 2LSEA 2Q9CA 4F4BA 5KYWB 3PHF2 3Q7GA 3I4UA 3QZCA 2VH3A 3I5PA 4IAOA 2GFHA 2IXPA 2DYSC 4N06A 4PJLA 2DYRC 5EGYA 3B0VC 2EIMC 3EG9A 2Q9BA 4I3MA 2G62A 5F5FA 2IOQA 2CNWA 3CZ6A 4KNWA 2XSEA 4YT5A 2J9VA 2V26A 4AE4A 2R7XA 1Z3IX 3RIPA 4ULWA 5CI9A 4XWJA 1D0ZA 4OD4A 2WL8A 1ZU4A 3ZIBA 4CS8C 3DM5A 1D0XA 3W2WA 3ECSA 5DQTA 1VMAA 4U5DE 3LNRA 4KI2A 2J0WA 4A2NB 3SYNA 5KYWA 1PD1A 3SEOA 3HJCA 1VYIA 2WZFA 2H7OA 1OCOC 2CW0F 2L9JA 3EQLF 4IRUA 4AK9A 2Y69C 3Q6NA 4PFOA 4JZAA 2HV6A 4OIPF 3SZRA 4G7HF 3S0XA 3DD7A 2WVOA 4JCHA 1LS1A 4XLPF 1D1CA 4HE8D 3EGXA 3EPVA 4B6IA 4Q4ZF 1MNEA 3LESA 2VASA 4YN0B 4ZLCA 2W9YA 4ANJA 3NRHA 2R7TA 3EH1A 2CGEA 4OD5A 3DJUB 3LS1A 5E3CA 4DOZA 1ZHWA 3POVA 3CSKA 1J8YF 3ZVRA 2DGJA 1SF8A 1BR4A 1NZEA 4JJGA 2FFHA 2J9WA 4AE4B 3ASOC 5D92A 4CS9A 3VYWA 3LLIA 2J7PD 2V3CC 5KYUB 4RDAA 1FFTC 4LACB 4IJJA 2KQ9A 5T3WA 3LEVA 4YWQA 2A6EF 1TR2A 2W4MA 3SNHA 1RJ9B 4BJ6A 3N24A 3DAFA 1M2OA 3UNGC 4MQ9F 1MMNA 3ASNC 2R7WA 3DM9B 2W45A 2C03A 3K66A 3AG1C 4I44A 5B1BC 3RYLA 1ZYRF 4CS8A 2MYSA 5DS4A 2IXOA 5DVWA 5IY5C 4EBBA 4BJ5C 1QZXA 3PMRA 5CI8A 3IEEA 1QLEC 4M63A 4CS9C 2R7VA 3UMKA 1M2VA 4C3DA 3RFYA 3AG4C 2EINC 2G3VA 4C7OB 4CBEA 4GEHA 3WODF 4MNDA 5T3TA 1IW7F 2E87A 4LLCA 2J0XA 3EHMA 4I1OB 2A68F 2OCCC 4BJ5A 3DAGA 2WVQA 3F47A 3B0PA 2ZXRA 1TWCA 2WB7A 2YHSA 4PK4A 3DMDA 3DXJF 3LS0A 3RKOF 2IYLD 4HFKB 3EJNA 1VK5A 1O5HA 3GODA 2I8BA 3N2ZB 3S29A 1PD0A 4K0DA 5KYXB 4DVYP 3EGXB 1ZHZA 3EGDA 1FFHA 3W8IA 3W8HA 3K1IC 2CNWD 2YZSA 2C04A 2EILC 1MMDA 4FESA 4U5BE 5DLJA 1W2WA 1FTSA 1BR2A 4PFPA 3AQBA 1NU7D 1LKXA 5B3SC 5KYXA 1ZHTA 1NU9C 4YT8A 1Z6AA 4YJWA 3AG2C 4YT4A 2CDQA 2M4EA 4BJ1A 3KH2A 2L81A 1V55C 3T4RA 2JD3A 4JURI 2J46A 2EIJC 4CIHA 4U5HA 4JVSA 1ZHYA 1S7ZA 2WVNA 3OA1A 4J30B 2P6VA 2ZPAA 3E9VA 5B1AC 4O79A 3V7OA 4QI0A 3E70C 2R7QA 1OCRC 4C3EA 3NKDA 4O7GA 3JYHA 3MX3A 3NYLA 3NG1A 1M57C 5KYUA 4QDLA 3N0TA 1ZU5A 3EFOB 2Y3BA 2MWQA 2NUTB 3GANA 4ZLDA 5E3AA 2NUPA 2A1DD 3UR3C 2B0JA 4EWCA 2KGOA 4BG0A 1OKKA 5EHHA 4H4KC 2ZXWC 2VB6A 3HTKC 1MMGA 2Y3GA 3NYMA 3NYJA 4Q7CA 2QTVA 4YT2A 4K7BA 3UMIA 1SZIA 4G7OF 4U5GA 4O6MA 1OCCC 2NG1A 5FCLA 2D5RB 3X1OA 2KJGA 2XL4A 4JJFA 4W8KA 2XRHA 3L34A 3FHDA 4X0RA 1TWHA 3HLZA 5DS5A 1JPJA 5KYYA 3SP1A 2J9UA 5F5HA 1Z23A 2PFDA 2ZXOA 3K7DA 3MLGA 5T1DB 4LLEA 2G3KA 4RBNA 1VOMA 2J7PA 3ABLC 2NUPB 1ST6A 1D0YA 2EIKC 4OIQF 2YEVA 4J32B 3O39A 3Q7LA 4BJTA 4CS7A 4XLNF 4HFFB 2P7VA 4O6YA 4LERA 1PCXA 1V54C 2WZLA 3Q6MA 1TKNA 5E33A 4FWVA 1ZHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRH A; 
#chains in the Genus database with same CATH topology
 4PJN A;  3VF0 A;  3AQC A;  3FAJ A;  5FZT A;  4XEV A;  4FAP B;  2OJE D;  2X51 A;  1WGW A;  4E7S A;  3M4C A;  1YA9 A;  5A6J A;  4JTC B;  2A0B A;  3AG3 C;  4YK5 A;  4KC9 A;  3VAY A;  5BUO A;  1HW2 A;  1JR8 A;  3JSZ A;  4U9E A;  1QVX A;  1Z5Z A;  2F22 A;  3L1M A;  3IHU A;  1R5I D;  4P6I C;  2KK1 A;  3DZA A;  1CPQ A;  1OKK D;  1L3P A;  1YJG A;  4CSA A;  3KKB A;  4C7O A;  5COG A;  3LAY A;  1M56 C;  2XXA B;  3B71 A;  4MVR A;  3KPH A;  2KW3 C;  1XZQ A;  1E85 A;  2XXA A;  4QI2 A;  4Q5S F;  4G7Z F;  5HSW A;  3IQC A;  4Z9H A;  2XLM A;  2YLD A;  2ZXP A;  3AGU A;  4MW3 A;  5E2Q A;  3TJ6 A;  2A0U A;  3ITF A;  2YL7 A;  4NTF A;  3NKE A;  5A6B D;  1J8M F;  256B A;  3WG7 C;  1NSG B;  3ZC4 A;  2NPU A;  4YL0 A;  4E18 A;  1RKE B;  4DBQ A;  1G5Z A;  3OEO A;  2DI3 A;  3CQZ A;  3LLK A;  4JEA A;  4OIN F;  3H65 A;  1RKC A;  1QKR A;  4U5E E;  4BJ6 C;  3UGO A;  2HS5 A;  1CPR A;  3LJB A;  5L0I A;  1SMY F;  4HEA J;  4MVM A;  3ABM C;  3ABK C;  3JT1 A;  5L3V A;  2Q3T A;  3L0I A;  3EZH A;  1TWA A;  3K33 A;  1O87 A;  3EGD B;  3QW1 A;  1BR1 A;  2IBF A;  1OCZ C;  3RVZ A;  3S28 A;  3TD7 A;  5BQI A;  3ZWI A;  2P61 A;  2RSE B;  1OW6 A;  2PX0 A;  2R9R B;  3K1H A;  4OIR F;  2BL2 A;  5JUA A;  4H54 A;  4JTA B;  1JPN A;  4P9F A;  2YLG A;  2L7A A;  1LVK A;  4AL0 A;  3EG9 B;  1L7C A;  1A7E A;  5L0H A;  3B0U X;  2ICW G;  4XTK A;  3S27 A;  2R7O A;  3K6B A;  4CJO A;  4U5F E;  1H9T A;  1M2V B;  1K05 A;  2J45 A;  2Y3H A;  2JPU A;  3DJN B;  4KBL A;  4U5C E;  3UGP A;  1EA8 A;  2R7U A;  2HSB A;  5JSL A;  4JW1 A;  3JTL O;  1GM5 A;  2PP4 A;  2A69 F;  3O6X A;  4XPW A;  4DVZ A;  3SXK A;  3ATP A;  3F46 A;  4FX5 A;  4IWB A;  3JCU Q;  4JC7 A;  1IZM A;  1R4T A;  3IQT A;  1HE1 A;  5D91 A;  4DBR A;  1ZW3 A;  2H7B A;  1G8X A;  2O9X A;  2WZG A;  2Y3D A;  3OWT A;  2PX3 A;  2X0C A;  3JZ0 A;  2R7R A;  4P9T A;  1JMW A;  1FAP B;  1N1C A;  2Q00 A;  1RCP A;  3EHN A;  5KYY B;  5DQZ A;  3RH3 A;  5L0F A;  4DRJ B;  1D1B A;  3FVY A;  3EFO A;  2R7V A;  2HV7 A;  2QY9 A;  3RQF A;  3QVY A;  4PR9 A;  2H7V C;  4G0H A;  3H2V A;  1FMW A;  2VC9 A;  3PCV A;  4KNV A;  1K04 A;  2NUT A;  4WJ0 A;  4C3B A;  2BE5 F;  2VCC A;  3JRT A;  3EH2 A;  3KMI A;  2M64 A;  4PAC A;  3X2Q C;  5AC4 A;  1KU2 A;  2LQG A;  1HMD A;  4MVQ A;  2TMV P;  3LUT B;  1NFO A;  1RJ9 A;  1Q0F A;  1VYK A;  1MMA A;  1WOL A;  3TK0 A;  4AX2 A;  1WAS A;  1NG1 A;  2L6F A;  3M1C B;  3AJM A;  2KC3 A;  1PV3 A;  1D1A A;  4JE9 A;  2YL3 A;  5KYN A;  4EIY A;  3B9Q A;  2Z15 A;  3C8G B;  3U3F A;  3T6B A;  5JT4 A;  4BEJ A;  2IXN A;  4PJM A;  4PJJ A;  4E7Z A;  3C7J A;  4NCQ A;  1MND A;  3KL4 A;  3FOO A;  4I1M A;  1ZVZ A;  4MTO A;  5JS5 A;  1Z63 A;  2R02 A;  1NFN A;  2R7S A;  5L3Q A;  1Y6D A;  4RD9 A;  3W2V A;  4OIO F;  4IB4 A;  2FGY A;  2W4B A;  3JYY A;  2EPK X;  1LE2 A;  1TWG A;  4GYT A;  2YLI A;  4ER9 A;  4NY3 A;  3EZI A;  3FDQ A;  3QMK A;  2Q9A A;  3UMH A;  1FMV A;  2PF4 E;  2Y39 A;  2OG2 A;  2A6H F;  4AL1 A;  5DS6 A;  3ZG1 A;  2KNH A;  4O6N A;  3ZSU A;  5HV9 A;  4CSA C;  2EPN A;  3I5Q A;  2IXM A;  3LEO A;  3NMK A;  3T6J A;  2LSE A;  4EHP A;  2Q9C A;  5JLI A;  2XLH A;  4F4B A;  3HNK A;  4Z9I A;  5KYW B;  1RKE A;  2Q7R A;  1FNT c;  3Q7G A;  4NTA A;  3PHF 2;  3I4U A;  3G50 A;  3QZC A;  4L6R A;  1SR2 A;  2VH3 A;  2B0H A;  3I5P A;  4IAO A;  2GFH A;  1E2X A;  1ZZP A;  2IXP A;  2DYS C;  4N06 A;  2YKZ A;  2DYR C;  2LCH A;  4PJL A;  5EGY A;  2EIM C;  3EG9 A;  2Q9B A;  4I3M A;  2J9B A;  1NBB A;  4JRZ A;  1LE4 A;  2G62 A;  3FMS A;  1Q0D A;  2IOQ A;  1H6G A;  2CNW A;  3S90 A;  2L6H A;  2EPO A;  5F5F A;  3CZ6 A;  4KNW A;  2XSE A;  4YT5 A;  2QUP A;  2LFD A;  3GWN A;  3ZQY A;  4CJG A;  2J9V A;  1YYX A;  2V26 A;  5AC5 A;  4LDK A;  4AE4 A;  2R7X A;  3GEH A;  1Z3I X;  4MS2 A;  3RIP A;  4ULW A;  5CI9 A;  1M6T A;  1O3U A;  4XWJ A;  1D0Z A;  1OR3 A;  1YLM A;  4OD4 A;  2LFF A;  2WL8 A;  5CIV A;  1ZU4 A;  1TFK B;  3QTH A;  3ZIB A;  4U9D A;  2DB4 A;  4CS8 C;  3TUL A;  2AU5 A;  1H7I A;  3DM5 A;  4EBJ A;  1D0X A;  3W2W A;  3ECS A;  5DQT A;  2XLW A;  1VMA A;  4U5D E;  3T6G B;  5JVE A;  3LNR A;  1OQC A;  4KI2 A;  1CGO A;  3VM6 A;  4CIP A;  2J0W A;  4A2N B;  2PBE A;  2UUH A;  1TFO B;  4ULV A;  3SYN A;  1PD1 A;  3SEO A;  3U9J A;  4DRI B;  3HJC A;  1XWJ A;  4J7Y A;  5KYW A;  1G4U S;  1VB5 A;  3L8I A;  3U3B A;  1VYI A;  2AP3 A;  2OU6 A;  2WZF A;  2NSG A;  4XEK A;  4N6H A;  2H7O A;  1OCO C;  2CW0 F;  2L9J A;  3EQL F;  4IRU A;  3DE9 A;  3RQE A;  4AK9 A;  4JTD B;  3SXM A;  2Y69 C;  3Q6N A;  4PFO A;  4JZA A;  2UUI A;  3TOL A;  2HV6 A;  2JX0 A;  4OIP F;  1TQG A;  1HMO A;  3SZR A;  3GWL A;  2HZ8 A;  4G7H F;  3QW0 A;  2XS1 A;  4XPY A;  1U89 A;  3B0V C;  3S0X A;  2EPM X;  3C62 A;  1WWP A;  1FR0 A;  1BZ4 A;  3DD7 A;  1VLS A;  2LP4 A;  1JOG A;  1LS1 A;  1LS4 A;  2WVO A;  4JCH A;  1Q0G A;  4LDQ A;  4XLP F;  1D1C A;  4HE8 D;  5JRA A;  1S05 A;  3M15 A;  1VLT A;  3EGX A;  1RMV A;  3EPV A;  3R2P A;  5A69 A;  1AUE A;  4B6I A;  4Q4Z F;  1MNE A;  1U0B B;  1T6Q A;  1K40 A;  1A41 A;  1I5N A;  1LPE A;  2VAS A;  3LES A;  4YN0 B;  4EKW A;  4ZLC A;  2W9Y A;  4ANJ A;  3NRH A;  1I4Z A;  3EH1 A;  2R7T A;  2CGE A;  4OD5 A;  3DJU B;  3JRM O;  3LS1 A;  5E3C A;  4DOZ A;  3HNJ A;  1ZHW A;  3POV A;  3ZDL A;  3CSK A;  1J8Y F;  3NMI A;  2DGJ A;  4Z9J A;  3B29 A;  3ZVR A;  5F28 E;  1SF8 A;  1E83 A;  1BR4 A;  1NZE A;  3J06 A;  4IAQ A;  4NC3 A;  3BRJ A;  4JJG A;  3CEX A;  3SXZ A;  2FFH A;  2J9W A;  4AE4 B;  3ASO C;  4D4N A;  5D92 A;  2XL8 A;  3MBG A;  4CS9 A;  3U8V A;  1YZC A;  5A6K A;  2KSF A;  3VYW A;  2BC5 A;  2OOC A;  3LLI A;  1YYJ A;  5A6A A;  2J7P D;  2V3C C;  5KYU B;  4RDA A;  1FFT C;  4LAC B;  1YAU O;  4IJJ A;  2KQ9 A;  5T3W A;  3V5Z A;  3LEV A;  4YWQ A;  1T6I A;  2A6E F;  1TR2 A;  1YDI A;  2W4M A;  3WAQ A;  3SNH A;  1CGN A;  1RJ9 B;  3ZQV A;  4BJ6 A;  3N24 A;  4NTB A;  4MW8 A;  3DAF A;  1BBH A;  1CGM E;  1A7D A;  3U0C A;  2AWY A;  1M2O A;  1YA7 O;  3UNG C;  3RF3 A;  4MQ9 F;  1MMN A;  5L0C A;  1APC A;  2YVK A;  3ASN C;  2R7W A;  2KYH A;  3G4X A;  3DM9 B;  5L0G A;  4CDV A;  1SYQ A;  2W45 A;  2HMZ A;  4W8P A;  2XS8 A;  1G4W R;  2C03 A;  1OXK A;  3K66 A;  3AG1 C;  1WN0 A;  2R05 A;  4YL3 A;  4I44 A;  5B1B C;  1ZW2 A;  4WAB A;  2LK4 A;  2OKU A;  1V74 B;  3RYL A;  1ORS C;  1ZYR F;  3FOP A;  1JAF A;  4CS8 A;  2MYS A;  5DS4 A;  2IXO A;  4MVS A;  2ETS A;  5DVW A;  2GAQ A;  5IY5 C;  2EPL X;  4EBB A;  1Q0K A;  4BJ5 C;  1QZX A;  2QE9 A;  4WGY A;  1AEP A;  2MHR A;  1C02 A;  2YQY A;  3PMR A;  4XEF A;  5CI8 A;  3JSE O;  3IEE A;  1QLE C;  4M63 A;  3VRC A;  1RXQ A;  4CS9 C;  2FAP B;  1QPU A;  4K1O A;  3UMK A;  1M2V A;  3MFN A;  3O10 A;  3IQ6 A;  3RFY A;  4C3D A;  3S84 A;  3AG4 C;  2EIN C;  2G3V A;  4C7O B;  1WAT A;  2NSF A;  4CBE A;  4GEH A;  3WOD F;  4MND A;  4D4X A;  5T3T A;  2HSQ A;  3W4Y A;  1IW7 F;  2E87 A;  2OJQ A;  4LLC A;  2J0X A;  1EQ1 A;  3EHM A;  4I1O B;  2A68 F;  2OCC C;  2OQM A;  4BJ5 A;  5K0I A;  1I4Y A;  3WHN A;  3DE8 A;  4DRH B;  1Z7Q c;  3DAG A;  2WVQ A;  1YVI A;  2HMQ A;  3F47 A;  3B0P A;  2ZXR A;  2ASR A;  2GWW A;  3HNL A;  2XLE A;  1TWC A;  2WB7 A;  2YWA A;  2YHS A;  1MQV A;  4PK4 A;  3DMD A;  1T6U A;  3U2L A;  5GPG B;  3DXJ F;  3LS0 A;  3RKO F;  2IYL D;  4IAR A;  3U8P A;  4HFK B;  3IPM O;  3EJN A;  1VK5 A;  3T9O A;  3QVZ A;  1O5H A;  3GOD A;  3MYF A;  1U6H A;  2I8B A;  3N2Z B;  3A11 A;  3S29 A;  1OXB A;  2QNL A;  1PD0 A;  3NMJ A;  3AOU A;  2IM8 A;  4K0D A;  3A9C A;  5COM A;  5KYX B;  4DVY P;  3EGX B;  1ZHZ A;  3EGD A;  1FFH A;  4JIO A;  3G4Z A;  3W8I A;  3FXH A;  3W8H A;  2HFI A;  4G78 A;  2YZS A;  2CNW D;  3K1I C;  2C04 A;  2EIL C;  3V5X A;  3LNM B;  1MMD A;  4FES A;  4U5B E;  3C18 A;  5DLJ A;  1W2W A;  5L0D A;  3GM2 A;  1FTS A;  2H8A A;  2J8W A;  2OEV A;  3GEE A;  1V4A A;  3TQO A;  5BQG A;  2PNO A;  4GQH A;  1QSP A;  4N6C A;  1BR2 A;  3M4B A;  3C8Z A;  1ORJ A;  4PFP A;  3AQB A;  1NU7 D;  1LKX A;  5B3S C;  3ZTZ A;  5KYX A;  1ZHT A;  1NU9 C;  1OW7 A;  2HUJ A;  2XLD A;  2VCA A;  4YT8 A;  1Z6A A;  3DI5 A;  4YJW A;  4XQ1 A;  1ORY A;  2YL1 A;  3AG2 C;  4YT4 A;  2CDQ A;  2M4E A;  4BJ1 A;  1LIH A;  3KH2 A;  4BPM A;  2HJ3 A;  1V55 C;  1C17 M;  2L81 A;  3U5S A;  4E17 A;  2Q4F A;  3HKK A;  2XL6 A;  1GQA A;  2GA0 A;  3KYI A;  3T4R A;  1H9G A;  2JD3 A;  2L6G A;  4JUR I;  2J46 A;  2EIJ C;  2R03 A;  4MVU A;  4CIH A;  5L0J A;  4U5H A;  4JCZ A;  4JVS A;  1Q0M A;  1ZHY A;  1S7Z A;  2WVN A;  3OA1 A;  4J30 B;  1LI7 A;  2P6V A;  2ZPA A;  3E9V A;  3C8G A;  3H2U A;  2AWC A;  3L8J A;  5B1A C;  1T9K A;  1WTY A;  4O79 A;  3V7O A;  2XM4 A;  3AGT A;  3ZTM A;  1GS9 A;  4MTF A;  1E86 A;  1OW8 A;  4QI0 A;  4EBK A;  3E70 C;  4JEB A;  2R7Q A;  4LDR A;  2YL0 A;  1C03 A;  1OCR C;  2R25 A;  1UG7 A;  3RQG A;  3NKD A;  4C3E A;  4EUK B;  4R32 A;  4O7G A;  4A4A A;  2YRF A;  5TJ5 E;  5EK0 A;  1DOW A;  4E0I A;  3JYH A;  3MX3 A;  1LM3 B;  3NYL A;  1F1M A;  3NG1 A;  1M57 C;  3DWW A;  3SXY A;  3NDB B;  2GDC A;  1E84 A;  3GEI A;  1T01 A;  5KYU A;  4QDL A;  3N0T A;  4YL1 A;  2QLA A;  3R7C A;  3C63 A;  5COF A;  1ZU5 A;  3EFO B;  2Y3B A;  5AGF A;  2MWQ A;  2AVK A;  2CYD A;  2NUT B;  3GAN A;  3IQ5 A;  3U9M A;  4ZLD A;  5E3A A;  3DKA A;  4J7T A;  1OR2 A;  2NUP A;  4ONS A;  2A1D D;  3UR3 C;  1Y4C A;  3S9O A;  4CDY A;  2B0J A;  4EWC A;  2KGO A;  4BG0 A;  1LI5 A;  1OKK A;  1VTM P;  4MTG A;  3MYI A;  3TOM A;  5EHH A;  3FAP B;  4XPX A;  4H4K C;  2ZXW C;  1EI7 A;  2VB6 A;  3C8G D;  3HTK C;  4UDV A;  1MMG A;  2Y3G A;  2XM0 A;  4DXW A;  3CAX A;  4IGG A;  3NYM A;  4WGZ A;  1JRA A;  2HJM A;  3NYJ A;  4Q7C A;  1KNY A;  1GGQ A;  2OEX A;  2QTV A;  4YT2 A;  4K7B A;  1HE9 A;  1QQ3 A;  3UMI A;  3KYJ A;  1SZI A;  5B3I A;  4G7O F;  4U5G A;  4O6M A;  1OCC C;  2NG1 A;  5FCL A;  2D5R B;  3X1O A;  2XLO A;  1T5O A;  2KJG A;  2XL4 A;  1A7V A;  4JJF A;  4W8K A;  1NLX A;  2XRH A;  3GM3 A;  3L34 A;  3GM1 A;  4DJ9 A;  3FHD A;  4BEM J;  4X0R A;  1TWH A;  1KTM A;  3HLZ A;  5DS5 A;  4N4W A;  1JPJ A;  5KYY A;  1DOV A;  3PDM P;  3SP1 A;  1YAR O;  2RD9 A;  4E0H A;  2J9U A;  5F5H A;  1Z23 A;  4CX9 A;  2PFD A;  3U2M A;  2ZXO A;  5JP7 A;  1B68 A;  2LIG A;  3K7D A;  3MLG A;  3O55 A;  5A6B A;  1BDJ B;  4CDA A;  5T1D B;  4LLE A;  1A0B A;  3GOR A;  2G3K A;  4RBN A;  1VOM A;  2J7P A;  3ABL C;  3RW0 A;  2NUP B;  4MVO A;  1ST6 A;  1D0Y A;  2EIK C;  4OIQ F;  2YEV A;  2D4U A;  1XZP A;  4J32 B;  1EKY A;  3K1I A;  2XLV A;  2HKV A;  3O39 A;  3Q7L A;  4JKV A;  4MVZ A;  4BJT A;  1UFB A;  2LD6 A;  3RVY A;  2VCB A;  3US6 A;  4CS7 A;  1AVO B;  1HW1 A;  1HY5 A;  2P1A A;  2I15 A;  4XLN F;  3V5Y A;  4HFF B;  2P7V A;  4O6Y A;  4LER A;  3M79 A;  1PCX A;  3BEH A;  1V54 C;  2ZD9 A;  5BQH A;  2WZL A;  3Q6M A;  3HNI A;  1TKN A;  4NQF A;  3TJ5 A;  2P0N A;  1YZA A;  5E33 A;  4FWV A;  1ZHX A;  2CCY A; 
#chains in the Genus database with same CATH homology
 4PJN A;  3AQC A;  3FAJ A;  2X51 A;  1WGW A;  4E7S A;  3AG3 C;  3VAY A;  5BUO A;  4KC9 A;  3JSZ A;  1Z5Z A;  4P6I C;  3DZA A;  1OKK D;  4CSA A;  3KKB A;  4C7O A;  3LAY A;  1M56 C;  2XXA B;  2KW3 C;  2XXA A;  4QI2 A;  4Q5S F;  4G7Z F;  5HSW A;  2ZXP A;  5E2Q A;  3ITF A;  3NKE A;  1J8M F;  3WG7 C;  3ZC4 A;  3NDB B;  4DBQ A;  3OEO A;  3CQZ A;  3LLK A;  4OIN F;  3H65 A;  4U5E E;  4BJ6 C;  3UGO A;  3LJB A;  1SMY F;  4HEA J;  5L3V A;  3ABM C;  3ABK C;  3JT1 A;  2Q3T A;  3L0I A;  3EZH A;  1TWA A;  3K33 A;  1O87 A;  3EGD B;  1BR1 A;  1OCZ C;  3S28 A;  3TD7 A;  2PX0 A;  3K1H A;  4OIR F;  1JPN A;  1LVK A;  3EG9 B;  3B0U X;  4XTK A;  3S27 A;  2R7O A;  3K6B A;  4U5F E;  1M2V B;  2J45 A;  2Y3H A;  3DJN B;  4KBL A;  4U5C E;  3UGP A;  2R7U A;  4JW1 A;  2PP4 A;  2A69 F;  3O6X A;  4DVZ A;  3F46 A;  4FX5 A;  4IWB A;  3JCU Q;  1IZM A;  5D91 A;  4DBR A;  2H7B A;  1G8X A;  2O9X A;  2WZG A;  2Y3D A;  3OWT A;  2PX3 A;  2R7R A;  1N1C A;  5KYY B;  3EHN A;  5DQZ A;  3RH3 A;  1D1B A;  3FVY A;  3EFO A;  2HV7 A;  2QY9 A;  2H7V C;  4G0H A;  4KNV A;  1FMW A;  2NUT A;  4WJ0 A;  4C3B A;  3KMI A;  2BE5 F;  3JRT A;  3EH2 A;  3X2Q C;  1KU2 A;  1VYK A;  1RJ9 A;  1MMA A;  4AX2 A;  1NG1 A;  3M1C B;  5KYN A;  1D1A A;  3B9Q A;  2Z15 A;  3T6B A;  4BEJ A;  2IXN A;  4PJM A;  4PJJ A;  4E7Z A;  1MND A;  3KL4 A;  1Z63 A;  4I1M A;  2R7S A;  5L3Q A;  3W2V A;  4RD9 A;  4OIO F;  2FGY A;  2W4B A;  1TWG A;  4GYT A;  4NY3 A;  3EZI A;  3FDQ A;  3QMK A;  2Q9A A;  3UMH A;  1FMV A;  2PF4 E;  2Y39 A;  2OG2 A;  2A6H F;  5DS6 A;  3ZG1 A;  2KNH A;  4O6N A;  3ZSU A;  4CSA C;  3I5Q A;  2IXM A;  3T6J A;  2LSE A;  2Q9C A;  4F4B A;  5KYW B;  3PHF 2;  3Q7G A;  3I4U A;  3QZC A;  2VH3 A;  3I5P A;  4IAO A;  2GFH A;  2IXP A;  2DYS C;  4N06 A;  4PJL A;  2DYR C;  5EGY A;  3B0V C;  2EIM C;  3EG9 A;  2Q9B A;  4I3M A;  2G62 A;  5F5F A;  2IOQ A;  2CNW A;  3CZ6 A;  4KNW A;  2XSE A;  4YT5 A;  2J9V A;  2V26 A;  4AE4 A;  2R7X A;  1Z3I X;  3RIP A;  4ULW A;  5CI9 A;  4XWJ A;  1D0Z A;  4OD4 A;  2WL8 A;  1ZU4 A;  3ZIB A;  4CS8 C;  3DM5 A;  1D0X A;  3W2W A;  3ECS A;  5DQT A;  1VMA A;  4U5D E;  3LNR A;  4KI2 A;  2J0W A;  4A2N B;  3SYN A;  5KYW A;  1PD1 A;  3SEO A;  3HJC A;  1VYI A;  2WZF A;  2H7O A;  1OCO C;  2CW0 F;  2L9J A;  3EQL F;  4IRU A;  4AK9 A;  2Y69 C;  3Q6N A;  4PFO A;  4JZA A;  2HV6 A;  4OIP F;  3SZR A;  4G7H F;  3S0X A;  3DD7 A;  2WVO A;  4JCH A;  1LS1 A;  4XLP F;  1D1C A;  4HE8 D;  3EGX A;  3EPV A;  4B6I A;  4Q4Z F;  1MNE A;  3LES A;  2VAS A;  4YN0 B;  4ZLC A;  2W9Y A;  4ANJ A;  3NRH A;  2R7T A;  3EH1 A;  2CGE A;  4OD5 A;  3DJU B;  3LS1 A;  5E3C A;  4DOZ A;  1ZHW A;  3POV A;  3CSK A;  1J8Y F;  3ZVR A;  2DGJ A;  1SF8 A;  1BR4 A;  1NZE A;  4JJG A;  2FFH A;  2J9W A;  4AE4 B;  3ASO C;  5D92 A;  4CS9 A;  3VYW A;  3LLI A;  2J7P D;  2V3C C;  5KYU B;  4RDA A;  1FFT C;  4LAC B;  4IJJ A;  2KQ9 A;  5T3W A;  3LEV A;  4YWQ A;  2A6E F;  1TR2 A;  2W4M A;  3SNH A;  1RJ9 B;  4BJ6 A;  3N24 A;  3DAF A;  1M2O A;  3UNG C;  4MQ9 F;  1MMN A;  3ASN C;  2R7W A;  3DM9 B;  2W45 A;  2C03 A;  3K66 A;  3AG1 C;  4I44 A;  5B1B C;  3RYL A;  1ZYR F;  4CS8 A;  2MYS A;  5DS4 A;  2IXO A;  5DVW A;  5IY5 C;  4EBB A;  4BJ5 C;  1QZX A;  3PMR A;  5CI8 A;  3IEE A;  1QLE C;  4M63 A;  4CS9 C;  2R7V A;  3UMK A;  1M2V A;  4C3D A;  3RFY A;  3AG4 C;  2EIN C;  2G3V A;  4C7O B;  4CBE A;  4GEH A;  3WOD F;  4MND A;  5T3T A;  1IW7 F;  2E87 A;  4LLC A;  2J0X A;  3EHM A;  4I1O B;  2A68 F;  2OCC C;  4BJ5 A;  3DAG A;  2WVQ A;  3F47 A;  3B0P A;  2ZXR A;  1TWC A;  2WB7 A;  2YHS A;  4PK4 A;  3DMD A;  3DXJ F;  3LS0 A;  3RKO F;  2IYL D;  4HFK B;  3EJN A;  1VK5 A;  1O5H A;  3GOD A;  2I8B A;  3N2Z B;  3S29 A;  1PD0 A;  4K0D A;  5KYX B;  4DVY P;  3EGX B;  1ZHZ A;  3EGD A;  1FFH A;  3W8I A;  3W8H A;  3K1I C;  2CNW D;  2YZS A;  2C04 A;  2EIL C;  1MMD A;  4FES A;  4U5B E;  5DLJ A;  1W2W A;  1FTS A;  1BR2 A;  4PFP A;  3AQB A;  1NU7 D;  1LKX A;  5B3S C;  5KYX A;  1ZHT A;  1NU9 C;  4YT8 A;  1Z6A A;  4YJW A;  3AG2 C;  4YT4 A;  2CDQ A;  2M4E A;  4BJ1 A;  3KH2 A;  2L81 A;  1V55 C;  3T4R A;  2JD3 A;  4JUR I;  2J46 A;  2EIJ C;  4CIH A;  4U5H A;  4JVS A;  1ZHY A;  1S7Z A;  2WVN A;  3OA1 A;  4J30 B;  2P6V A;  2ZPA A;  3E9V A;  5B1A C;  4O79 A;  3V7O A;  4QI0 A;  3E70 C;  2R7Q A;  1OCR C;  4C3E A;  3NKD A;  4O7G A;  3JYH A;  3MX3 A;  3NYL A;  3NG1 A;  1M57 C;  5KYU A;  4QDL A;  3N0T A;  1ZU5 A;  3EFO B;  2Y3B A;  2MWQ A;  2NUT B;  3GAN A;  4ZLD A;  5E3A A;  2NUP A;  2A1D D;  3UR3 C;  2B0J A;  4EWC A;  2KGO A;  4BG0 A;  1OKK A;  5EHH A;  4H4K C;  2ZXW C;  2VB6 A;  3HTK C;  1MMG A;  2Y3G A;  3NYM A;  3NYJ A;  4Q7C A;  2QTV A;  4YT2 A;  4K7B A;  3UMI A;  1SZI A;  4G7O F;  4U5G A;  4O6M A;  1OCC C;  2NG1 A;  5FCL A;  2D5R B;  3X1O A;  2KJG A;  2XL4 A;  4JJF A;  4W8K A;  2XRH A;  3L34 A;  3FHD A;  4X0R A;  1TWH A;  3HLZ A;  5DS5 A;  1JPJ A;  5KYY A;  3SP1 A;  2J9U A;  5F5H A;  1Z23 A;  2PFD A;  2ZXO A;  3K7D A;  3MLG A;  5T1D B;  4LLE A;  2G3K A;  4RBN A;  1VOM A;  2J7P A;  3ABL C;  2NUP B;  1ST6 A;  1D0Y A;  2EIK C;  4OIQ F;  2YEV A;  4J32 B;  3O39 A;  3Q7L A;  4BJT A;  4CS7 A;  4XLN F;  4HFF B;  2P7V A;  4O6Y A;  4LER A;  1PCX A;  1V54 C;  2WZL A;  3Q6M A;  1TKN A;  5E33 A;  4FWV A;  1ZHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...