3NRLA

Crystal structure of protein rumgna_01417 from ruminococcus gnavus, northeast structural genomics consortium target ugr76
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEMGDDWYLVGLNVSRLDGLRVRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein RUMGNA_01417
publication title Northeast Structural Genomics Consortium Target UgR76
rcsb
source organism Ruminococcus gnavus
molecule tags Structural genomics, unknown function
total genus 12
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17295 DUF5348 Domain of unknown function (DUF5348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.390 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3nrlA00
3NRLA
chains in the Genus database with same CATH superfamily
5F03A 3SNDA 1OP8A 1HBTH 5HIZA 3Q3XA 2PHBA 1UMAH 2QF4A 1MABB 1K1OA 1O2XA 1GHAF 2PWXA 4BAQB 4WXVA 4Y76A 1OPHB 1S82A 1LHFH 4CR5A 1SQTA 3M5MA 2QYIA 2TRMA 4AB8A 3D65E 2YOLA 3M5OA 2Z3DA 3UIRA 2CJIA 2XTTB 3WW7A 3E6PH 2ZPQA 4D7FA 4GUXA 1O3NA 6CHAB 2HVYB 4YLQH 4HTCH 5T6DA 4O3TA 3K2UA 2FYRA 3S69A 2PKSC 2GD4B 5T6GA 3PV2A 3SZEA 1ESTA 2BY6X 1C1PA 3BTGE 1EZUC 3RLYH 4A92A 2PKSB 2PKAA 3MNBA 1CT2E 2GV6A 2A5KA 1L1NA 4MDSA 1V2WT 3BG8A 3PROA 1O3MA 4ZHMU 5CHAC 1DUAA 3LPRA 3P6ZB 3SV2H 1FN6A 1BB0B 2FOCA 1JMOH 1FZZA 3BTHE 2VIWA 2RCEA 3M36A 1K9OE 1Z1IA 2GCHF 1QFKH 3SU1A 4A1VA 2XBYA 1AO5A 5C94A 2XC0A 2Z3EA 1ZPBA 3BV9B 4WF8A 5FPTA 2ZU4A 2FOMB 1W7GH 3U9AH 1TGCA 8LPRA 5F53A 4PROA 1XUFA 2F9UA 2VU8E 3WWBA 2G4UA 2IPHA 1E1RD 1TRNA 2PTCE 3PTBA 3GY5A 1J17T 2AIPA 3BTEE 3ODDA 3VG8A 3ZZ5A 3VGCC 3E1XB 1G32B 1J15A 2ZC9H 5DP4A 1AI8H 1L4DA 1JOUB 3GY7A 4ZMAH 1QRWA 1QB9A 1GJCB 2C4FH 3ATLA 3U1JB 5FCKA 2G81E 2J94A 3VGCB 4CRAA 2A32A 1P3EA 3QO6A 3LU9B 3SYJA 4ZXXH 1BOQA 2C90B 3U8RH 2GP9B 1F5LA 1TWXB 1S81A 1K1IA 4IS5A 3SNEA 1HXEH 3BEIB 1XUKA 2ANWA 4WH6A 3BTME 2GGVB 4SGBE 4Q7YA 1NBMD 1BT7A 2D26C 1E34B 1AFEH 8GCHG 3OTJE 3MH5A 4AFSA 4RT0A 4D9QA 3ZZ4A 1WYKA 3RXAA 1P12E 1P9SA 1O2NA 1HB0B 1A1RA 2GDEH 4NSYA 3DSOA 4OS7A 3NUMA 9LPRA 2BVXH 2THFB 2XXLA 3QTOH 3BTFE 1G30B 4CHAC 5TJXA 4JYUH 4IGDA 4K69A 1DY8A 2OCVB 1KSNA 2SNVA 1HPGA 1S0QA 1ORFA 4YTAA 1GPZA 3BG4C 1NBME 2HRVA 3HK3B 4IN1A 4CHAB 2A5AA 3ATWA 2BDIA 1XXFA 4HG6A 3T26A 3DFLA 1BTPA 5A0CA 1K2I1 4NA7A 2C3SA 2B0FA 4P02A 1CVWH 2O9QA 3QWCH 3BG4B 3SORA 3BEUA 2A4OA 4XBDA 3UNRA 3RXIA 5HM2A 1P2OA 1YPLH 2RDEA 3HGPA 3ODFA 3M37A 1S6FA 3KYGA 1AZZA 5A8ZA 2V7QD 3LC3A 3KHVA 4UDWH 1O2TA 1BZXE 2Z7FE 3OAAD 3E0NB 1O0DH 1QB1A 2WV9A 3KQ5A 5JBBS 1GBJA 1GVKB 1O2LA 2I6QA 4GAWA 2TPIZ 2M2AA 4THNH 5FX5A 1SR5C 4WJG2 1HAVA 2GT7A 2ZDNA 5F8XA 3L33A 4JZIA 4R8TB 4Y79A 1SGYE 1ABIH 2SFAA 1ANEA 4I8JA 4CH2B 5GXPA 2BZAA 1SBWA 2Z9IA 3LGWA 2UWPA 1OWKA 1GMCF 3PO1C 3TJNA 2HPPH 5IYTA 1GBAA 1K1PA 1UO6A 1HJAC 1SG8B 2ANKH 2XWAA 4Y11E 3LKWA 3ZZCA 1QJ6B 3ZZ6A 2BY9X 4MLFB 1ZTKA 4ZHLU 5HKKD 2ZU5A 1S85A 2J34A 1A3BH 4JYTA 5HXFA 3FP8E 4ABHA 3UWJH 3R3GB 2SGQE 1KLIH 2YMSC 1KXCA 1N8OC 3PB1E 4XRNA 4VGCC 1GGDC 1T8MA 5F8ZA 4LZ1H 1RIWB 2FLBH 1P3CA 1HFDA 4O03A 2WPHS 4MNWA 2ZDMA 1ZLRA 3QN7A 3SQHE 2V0BA 1F5KU 1N8OB 1ESBA 1G9IE 2AS9A 5A8XA 5GIBA 3GCTG 1C1MA 1XKBC 3LC5A 5EJZA 4YOIA 3RXRA 3P70B 2OQ5A 3VFEA 1Z6JH 4MVNA 2Z9KA 4AFQA 2LP6A 1SFQB 1AHTH 1KMHB 1CQQA 2UWOA 2XOKD 4MQAA 3K65B 5FPYA 4I8KA 3KCGH 1GBBA 1D6WA 5CDFE 2JETB 4B2CA 3DA9B 4FUEA 5SGAE 1ETRH 2Y80A 5C2ZA 3V3MA 2PR3A 3VB5A 1ELEE 4GCHG 1C2HA 2WPMS 1ZHPA 2P16A 1CHGA 4K3JA 2FXRA 2OC1A 3RM2H 2PLXA 2WHXA 2H5CA 2WPKS 3E0PB 1TQ7B 5DN6D 2M5TA 2EEKA 3S7KB 1DY9A 4CH8B 1Y8TA 2VH6A 1NESE 1O2UA 3PMAB 4IC6A 4NG9H 4ISHH 3SU5A 4INHA 3A8BA 1AUTC 3SUEA 1S83A 4MG3A 1SMFE 1TNIA 3A89A 3BIUH 3Q76A 5CHBA 3GCNA 1GHBG 4ABDA 3S0NA 1RRKA 2ZDKA 1C4Y2 1NFYA 3FVFB 3MO3A 3RXTA 4YXWD 1W7XH 2SGFE 1QRXA 2BD9A 5A2MH 1GDQA 4RKOB 2BDBA 1GJDB 5HGGA 2Q6DA 2ZFPH 1C5RA 3PRDA 2JDID 1TBZH 2QV1A 3AAUA 3MH7A 1O37A 6GCHF 3VXEH 3A81A 3TJVA 1XKAC 1HAGE 2L74A 1NFUA 3F9FA 1MTUA 3FN8A 4JCNA 1QB6A 1KTTB 1IQHA 3U98H 2KCOA 3UR6A 2VWMA 5JBAS 4I7YH 2F9BH 1CHOF 1BJUA 1KXFA 1GI6A 2VNTA 3QGNB 1F0TA 1A5IA 3T28A 1O5AB 1Y3UA 3SUFA 4OGYA 1O3AA 1SGIB 4ZH8A 1O5FH 1FPHH 4XE4A 3ZV9A 5C0UA 4NFEA 2WSSD 1TOCB 4I31A 4YESB 3RC6A 3SV6A 1JBUH 4KGAA 3RXLA 2BY5X 1GBDA 3MO9A 1GHAG 3RXUA 4ISIH 1V2JT 3U8TH 4ISNA 1TNJA 4A6LA 2KAIB 3UNQA 1TA6A 1ETTH 4GHTA 2WUCA 3CP7A 3HATH 3SW2B 1O5BB 1AVGH 4D7GA 2KM0A 5JPMH 3OY6U 1TX8A 1VCPA 1C2IA 1GG6C 2BHGA 5F6MA 1FN8A 1SGDE 3PV5A 4X8UH 4K8BA 3QDZB 1SFIA 2XBXA 2FP7B 4J1YA 4AGJA 3ZVFA 2F9PA 3SO3A 4CREA 1KLTA 4OS1A 1DUEA 2CV3A 3RXJA 4DCDA 2AH4X 2W6ID 1G3BA 2FOHA 2A1DB 4U01A 1WU1A 1W14U 4UONA 2QXIA 2D8WA 2BDAA 3SU2A 4IN2A 4D76A 2P3UB 4BAOB 4ZXYH 1QQ4A 4H4FA 2LNCA 3BTTE 3H7TA 2BLWA 1QCPA 1TOMH 5EODA 3P92A 2NWNA 2GCHG 2BDCA 3TLOA 3KQBA 1MTNB 5DSFA 1BQYA 1PPHE 2GZ9A 1WQVH 1TGSZ 1UVSH 4I32A 1PJPA 3RXDA 1V6DA 1C1VH 3BTWE 3D23A 2V3OH 3ZYDA 3LGVA 4ISLA 1VITH 1VJ9U 1QL8A 1IQKA 3QTVH 4OGXA 2W5EA 3WY8A 1P9UA 4AG2A 4H6TA 3KN2A 1ELDE 3RXPA 3RC4A 4JMYA 2F43B 4IC5A 4O97A 1O3JA 1L2EA 3MOCA 3SJ8A 1C1QA 2BDHA 3SV9A 2STBE 3F2FA 1TX6A 5AHGH 1YPEH 2RFKC 5G4BA 1AY6H 1GCDA 2FYQA 2ZGBH 1GI4A 1UK4A 2D1JA 3EA8A 4ZHAA 3OYPA 1G3EA 1GBHA 1VITF 2OQUA 1J8AA 2GCTC 4JZDH 1TMUH 1P2KA 5GCHF 4Y10E 2QCYA 4X1RU 3OX7U 1FNIA 3M7TA 4ABFA 1ZPZA 3MU4A 2J97A 1EXFA 1GMHF 1YP9A 1V3XA 2K0QA 1QQUA 5TCCA 1G37A 2GCTB 3H7OA 1Q2WA 1QBVH 2ZHEH 2FWWA 1DLKB 1ELAA 3D49H 1C2GA 1C9PA 3E16B 4X0WU 1GBFA 3DHKH 1O2RA 2HWLB 1C1SA 2KCYA 1ANCA 3SOSA 3SNAA 5DP7A 2KCAA 3LGIA 3TJOA 1A2CH 3M7UA 4ABEA 1H9IE 3MO6A 4A1XA 1F0RA 1BDAA 5HM9A 1W0JD 3A7YA 2HNTE 4K1TA 1HNEE 1TNHA 3PLKA 5ESBA 3MWIU 1SGPE 3SHAH 4X2YA 5C17A 2FZZA 1EUFA 5ESTE 1GBIA 3QZQA 2EI6A 2WYJA 3SN8A 4XSKU 5EW1H 1XUIA 1WUNH 3RXKA 3KF2A 3SI4H 1C1OA 1ZJDA 1YCPH 3F0PA 2F9NA 4F48B 1INCA 1GJAB 1FV9A 3BF6H 1WQSA 3A7WA 2ZGXH 2FLRH 1MKWH 1YLCA 1L1JA 2ZNKH 2BD5A 4Y0YE 1DX5M 1UK3A 1UVTH 4X6MA 3UQVA 4MPUA 1FDPA 3SGBE 5A0AE 3ZZBA 3SZNA 2RG3A 2WINI 2NU2E 2PSXA 1CT4E 1QBNA 1P06A 3SJIA 4BXWA 1O3DA 1MAYA 3CS0A 1GJ7B 2QXJA 1V2MT 1TE0A 1CBWB 5E2OA 1GMCG 4BTIB 1CT0E 3RDZA 4B2AA 2XNIA 3SQEE 1GI7B 1LDTT 1AE8H 1GBTA 2BX4A 2B9LA 1TBQH 2PGBB 3MHWU 3M3TA 4BAHB 1JIRA 1GI0A 1D3PB 1SGRE 3GDUA 1EFRD 1OWDA 3ZZDA 1H8HD 2ZDVH 1L1GA 2RA0A 3ZVGA 1ANBA 2C8WB 2Q1JA 4B1TA 4B2BA 3GDSA 3OFND 3E90B 4WVPE 1O3OA 3O8BA 4ZKOU 3EGKH 1LHCH 1OHHD 3QLPH 1TBRH 2Z3CA 2ZDLA 1THSH 3SBKA 2RDLA 2RA3A 4BNRA 3TNSA 2R2MB 3ELAH 2FPZA 3OEHD 1DDJA 1IQMA 1QRZA 1WOFA 2A7JA 1WV7H 5L6NH 2ZI2H 2H1UA 4F55A 2A5IA 3S9BA 1LHDH 2Y5FA 1UVPA 1SOZA 4K2YA 2BYAX 3M3SA 1E79D 1UTMA 3OTPA 1XM1A 2JH6D 2GV7A 2OK5A 1O5DH 4MPXA 1MZAA 1Y5BT 1C5VA 1O39A 1GJ8B 1NT1A 2UUJB 3A7TA 1ARBA 1YBWA 1ZR0A 2JKHA 2O8UA 2ZPSA 2QA9E 1EAIA 3GY3A 5KGOA 1VGCC 1K1MA 2AEIH 2FS9A 1UTLM 1AIXH 1P2JA 2ZZUH 2JJ1D 3NRLA 2Z9GA 2JIZD 1O33A 3EDXB 1LKAA 1NM6A 4B6EA 4B76A 4NZLA 4Q2KA 1SGNE 3EYDA 1ZTJA 1DWDH 1LHGH 1AMHA 1VJAU 3FAOA 5E0JA 3W95A 1ZGIA 2FM2A 4BANB 2QE7D 1BMNH 4OS4A 5K0HA 1GMDF 1FIZA 4X8VH 4FUFA 1G3DA 1YGCH 4Z6AH 1P2NA 1SB1H 3LT3A 5L2YH 4TPIZ 5FPSA 1GDUA 3N7EA 2HALA 2WV4A 2ZHFH 1CA0C 1LCYA 3HGNA 1C5UA 1O5GH 3EE7A 1WTGH 1W2KH 2W3IA 5DKMA 3PMHB 1GVZA 5K7RA 5CHAB 2DE9A 1ELGA 1HDTH 2H9EH 2WV5A 3BIVH 1C2MA 3TGIE 3N7DA 1BRCE 4RI0A 1AKSA 1FY5A 2P95A 3PMBB 4HGCA 1KDQA 1YC0A 4NFFA 3UTUH 2V3MA 2B7DH 1HYLA 2CF9H 3A86A 1FIWA 2WPJS 1NU7B 2GZ7A 1Q31A 1E35B 4E05H 1D3TB 5C67A 2FODA 1P57B 2PFEA 3ZZAA 3RU4T 2AGEX 1AB9C 4YOGA 5E2PA 1GL1A 2ODPA 2OC0A 3DT0H 1BMMH 2ZTYA 1P0SH 1Z6EA 1MBQA 5DP8A 1CHOG 1ZZZA 3RXBA 1KXBA 2PW8H 4FOUC 1BRAA 1L4ZA 1GJ5H 5H4IB 1C2KA 3AVZA 1SQRA 4K60A 5C5NA 1GBEA 2A31A 2R3YA 7LPRA 1DOJA 1V2LT 1ZRKA 3F9HA 1M9UA 5EPYA 1A5HA 5AVDA 1YPKH 2CHAC 1QA7A 3BTKE 1TMBH 3UAIC 4Y0ZE 1PPBH 4TWWA 2OXSA 5A8YA 1C5WB 1TALA 1EPTA 1GBLA 2P8OC 4ABBA 1V2NT 1C5SA 5EXLA 1BTHH 2BY8X 3W1EA 4A5TS 1O2QA 3TH2H 1EJMA 3NPSA 3T27A 2J98A 2BD2A 1ZMNA 1HIAB 1GHWH 1V2RT 4U32A 1DVAH 4RKJB 1AFQC 3HKJB 4U2WA 2YNAA 4AX9H 2F83A 2ZG0H 3UWIA 1LKBA 5GDSH 2JJ2D 3SNBA 3Q77A 1VZQH 1V2ST 3I78A 2ZCKP 2FMJA 2FOFA 3O8CA 2G51A 1SPJA 1TGBA 3H5CB 1BMLA 1RFNA 5DP6A 3KL6A 2WUBA 4E06H 3FANA 4OS5A 1C5NH 1F0UA 4AOQA 1H1BA 1AE5A 3W94A 4Y71A 2J5UA 3F1SB 1JRTA 3A7VA 4INLA 1AGJA 4ZCNA 4Q7ZA 1GBCA 1PPZA 1BTYA 1HJ9A 3GCHC 1KXAA 1IQFA 1WTHD 1OWIA 7GCHF 4ABAA 1ZPCA 3M7QA 1Z8RA 1MBMA 1AD8H 1Z8IB 3F6UH 2VVCA 3KQCA 1LQEA 1C5LH 2TGDA 3TPIZ 2QN5T 1AN1E 3TK5A 3FFGA 1EP6A 4WXIA 1LVBA 2EI7A 3O8RA 4JZEH 8KME2 1GHVH 4O3UA 1IHTH 5C5OA 5C1UA 3FO8D 3EQ0H 3JZ1B 5AFZH 4YLUA 1HGTH 3PO1B 2ZHQH 2BQWB 3P8OA 1XMNB 1Z1JA 2PTNA 1OXGA 1HJAB 3EA9A 1FMGA 1C9TA 3MNCA 1MTWA 4HI3A 2QF3A 1O3EA 1RJXB 1FQ3A 2OC7A 1ZSKA 2XRCA 3C27B 3I77A 4KTCA 1BTWA 4NIWA 1CGIE 3SNCA 1U6QA 2GZ8A 3RXVA 1BRBE 2FTMA 4X6NA 2ZFQH 4LZ4B 5HMAA 1XXDA 3T25A 2GJGA 2YMSB 2VBCA 2J4IA 1VITG 1AZ8A 3V12A 4VGCB 3RC5A 1GGDB 5GCHG 4OS2A 2PKAB 3VB4A 2W6JD 1GMHG 2IOTA 2GX4A 1IOEA 4ABIA 2ZTXA 1SGFG 1RTFB 2WPLS 1N6YA 1T8NA 2R9PA 2V6NA 1FY1A 5F8TA 1YYY1 1NROH 3RXSA 4DY7B 2Q6FA 2KFWA 4E7NA 2Y6TA 2J2UA 4Q7XA 2R2WU 3MU8A 1TYNA 3A82A 3OEED 1AKSB 4K8YA 5FX6A 1EZSC 1GHYH 2A4RA 2FX6A 2ZA5A 4KKDA 4X2WA 4XBCA 1P2QA 1KDQB 1DITH 3MNXA 3FOAA 6ESTA 1MCVA 3TVJB 1GI9B 1ZGVA 9ESTA 5JDUB 2G8TA 1EP5A 1ELVA 4UFDH 1NFXA 3MU0A 3TIUA 4Y7BA 1MUEB 1Y5AT 4IMQA 4D9RA 1O5EH 5CE1A 3PRBA 3OY5U 1Z8JB 2AMQA 1O3CA 3E3TA 1SGQE 2PSYA 3RXMA 1GI3A 1OSSA 4WMDA 1H8ED 1O3PB 4KP0A 1HAZB 1ZSJA 4FUBA 1NY22 1AWHB 1C4U2 1BTUA 4NA9H 3F3BA 2BTCE 5GJ4B 4UEHH 1EPTC 1RXPA 1GVLA 4YZUA 2O8MA 4JZ1A 3RP2A 1LPZB 1W13U 4UFEH 2IJOB 5JB9S 2BD3A 2BZ6H 5AFYH 1S6LA 1DM4B 2FI4E 1FX0B 1RGQA 1BBRH 4I33A 6LPRA 4BTTB 2CMYA 2BQ6B 3GISB 2Z6BD 1DICA 4ACAA 5ETXA 4KTUA 1BTXA 5FBIA 1BCUH 4SGAE 1T8LA 1D3QB 1MQ5A 2ZIQH 4GLYA 1ELTA 3IG6B 2BM2A 2SGAA 2P59A 1OS8A 2VWNA 1MTSA 3LH3A 3PWCA 1FJSA 1SLUB 5IDKA 1HAPH 3FZDA 1DT2A 1QZ8A 1C1UH 3ZV8A 4X6PA 3ZZ7A 1O5CB 2OC8A 1IQNA 1BJVA 2O8WA 3Q3KA 1JWTA 4J2YB 5T3HA 1O2HA 1ETSH 4I8HA 1BHXF 4TY6A 1SGCA 4YO9A 1MMJN 4E7RG 3LGUA 1Q3XA 3NK8A 3ZVCA 4FU9A 4MNYA 4AB9A 3NCLA 1BHXB 5DK1A 2TGTA 3UB0A 1WSSH 1K1NA 1GJBB 8GCHF 2PP6A 3GCOA 3P95A 1C4V2 4ABGA 3MH6A 2ZFTA 1H4WA 4P00A 2L6OA 4AG1A 1HAVB 2CF8H 2R0KA 2OD3B 1KXDA 3BTDE 4A1TA 5EU8A 2FOEA 3E8LA 1GG6B 3T62A 2EI8A 1FAXA 2H2ZA 3A8CA 3AAVA 5DGJA 3P8FA 2ZO3H 5JBCS 4ASHA 2OINA 2IN2A 1GMDG 4GPGA 2Y7ZA 1SLWB 3HPTB 5L30H 5EGMA 1EX3A 2A7CA 1COWD 1ACBE 1OWHA 1T4VH 1YY3A 5DP9A 1Y3XA 1O35A 1O3HA 4R0IA 4TT3D 3URCA 3E91A 1TMTH 1HAYB 3GICB 2OBOA 2F3CE 1P01A 2HVXA 1KXEA 1HAOH 1V2OT 3DSGA 4NIYA 5E8EH 1O3BA 2KX4A 2SGPE 1O3LA 1P11E 1S0RA 4FU8A 3VB7A 5PTPA 2G52A 2P93A 2VWOA 1P05A 1XVOA 1DWEH 2LPRA 3VXFH 4HZHA 3CENA 1CSOE 2ZF0H 1Z7KA 1PPCE 3GY8A 1C5PA 1GJ9B 3QX5H 1W3CA 2ESTE 1YLDA 1GDNA 1Y3YA 3GY2A 2ZTZA 1YPGH 2FOAA 1UCYH 1DANH 1SC8U 2ZFSA 5FBEA 5JYIA 2TIOA 5HYOA 1OOKB 1TONA 1ELCA 1EQ9A 2NU1E 4Y8YA 1MH0A 2PUQH 4X2XA 1EZXC 4WMEA 1TPSA 3UUZA 1NRNH 4YT7H 1ZTLA 3R0FA 2UUYA 1AUJA 2P94A 2Y5HA 2CN0H 4MTBA 2QIQA 1BRUP 1OWJA 2FI5E 3A83A 4A7IB 2BVRH 1YLNA 1W0YH 1QHRB 4DIHH 1MCTA 4RT1A 1PPFE 3MU1A 2GKVE 1MAXA 1P02A 4CBOA 3WWFA 3SJKA 2KR7A 2AERH 1OX1A 1SVPA 1OYTH 1FAKH 3FP6E 2VIOA 1A7SA 1MKXK 1SGEE 4ACBA 5C1XA 1PYTD 2A45B 3TH4H 1ZYOA 1UJ1A 2GVFA 5B6OA 3SUDA 2F9VA 2FTLE 3NKKA 2BDYA 2ZFFH 4RSPA 1B0FA 4AZ2B 4ZKSU 5DJ7A 2HLCA 2BOHB 2GTBA 1W0KD 3ZVAA 1F92A 2P3FH 4RN6A 1KY9A 3RM0H 3MQKC 1UTQA 4TSFD 4M9FA 4CRGA 5EW2H 1A0LA 4JK5A 4WMFA 4DGJA 1B0EA 4DVAU 4DJZB 3QUMP 3KGPA 3LJOA 1O34A 3HKIB 5EG4A 2I6SA 4X6OA 1TLDA 1ZMJA 1DFPA 2G5VA 1TNGA 4FETA 1QA0A 3TU7H 3A85A 3GDVA 1GCTC 7GCHG 4UE7H 1SI5H 3FZZA 1S6HA 2O8TA 1QJ1B 4FVDA 2HNTC 1YM0A 5T6FA 1B5GH 1O2MA 1V2KT 1UW7A 1WBGB 4FUDA 4WH8A 3VB6A 4Z0KA 1HXFH 1LPKB 1C5OH 1C5MD 2XNDD 2LELA 2VIDA 1QTFA 3F9GA 2OP9A 1O3GA 4AORA 2GDDA 4ABJA 2QY0B 3UREA 4XD7D 1QR3E 2AHME 4TYDA 1TPAE 2CK3D 5J4QA 1C2EA 2FESH 2G00A 3VEQB 1G2MA 4O9VA 4XFQA 3PYHA 5T1VA 4MPVA 5FCRA 1LVOA 1MU8B 1SKYE 1ELFA 1FXYA 4INKA 5LPFA 1LQDB 3ENSB 1YCPK 1RD3B 1C2LA 2VJ1A 2ZHWH 1MKWK 1H8IH 1CGJE 2BLOA 1P2IA 2W26A 1UTJA 3RXHA 4NZQA 1IAUA 3A8DA 3MU5A 2ZGHA 2KZ4A 3RMNH 6CHAC 3P8NA 1BTZA 1SSXA 1G36A 1CGHA 3M3VA 1O2PA 2Y5GA 1C5ZB 2C93B 4HFPB 1VGCB 1E0FD 2A0QB 4DG4A 3BEFB 2AFQB 1RS0A 4LXBH 1H9HE 5CMXH 3OE7D 4CRCA 1DXPA 2NU4E 2V3HH 3MTYA 1QIXB 4FU7A 5DP3A 2ZDAH 1W10U 1FONA 3C1KA 4AFZA 1YPMH 1C1WH 1O36A 1D3DB 3K9XB 5BRRE 2VIQA 1BMAA 1TFXA 1AWFH 5FL7D 4NWKA 3AW0A 5C3NA 4DT7B 3TJUA 2A4GA 2ZFRH 4MNXA 5FXLA 1W12U 1L0ZA 3MMGA 2QGRA 5E0GA 1CA0B 1NPMA 2FO9A 5I46H 1TA2A 4IMZA 4OM9A 1QJ7B 1IQGA 3MI4A 5FHTA 3SHCH 1EAXA 1O3IA 2UUKB 2GMTC 5B6LA 3UY9A 2Q6GA 1EASA 8ESTE 3FP7E 1GJ6A 1UHBA 4IW4E 1TGNA 1A4WH 4TY7A 1J14A 1TAWA 6GCHG 2HPQH 2NU3E 4NIXA 4Q4LA 3ESTA 1ID5H 2ZCHP 3A80A 3ZZ9A 2GMTB 3AW1A 1K1JA 2AYWA 3GYLB 3K6YA 2H6MA 2VVUA 2J38A 1NFWA 2AMPA 1THPB 4K1SA 3LONA 1C2FA 3Q3YA 3TK6A 4H6SB 1AB9B 3SUGA 2QF0A 3ATKA 3SJ9A 2FDAA 3U28C 4FXGH 1Y59T 4Y7AA 1E37B 2K1QA 1HV7A 1FY3A 4X8SH 3RXQA 1BA8B 2UWLA 2H9HA 1OWEA 4Y8XA 2VIPA 2BLQA 1LO6A 3M5LA 4MNVA 1DS2E 2AIQA 2QC2A 1WCZA 1DWBH 4ZROA 1LPGB 1RTLA 2CHAB 5FAHA 4K5ZA 2VH0A 1J16A 2BY7X 3QK1A 1PFXC 4B71A 1KYNA 1D9IA 5C0TA 4DOQA 1SLXB 4LOYH 5LH8A 1H8DH 3PTNA 1YKTA 2EQNA 2P8OB 4ESTE 3O8DA 1OYQA 4FUHA 2O8LA 5ABWA 2FOGA 1NU9A 1QL9A 5DPAA 1VCQA 1CU1A 5EXMA 4I86A 1ZHRA 4B74A 1FY8E 2H9TH 2OTVA 3RMLH 3PM3A 1O2OA 1K0HA 1AFQB 3ZIAD 2YMSD 3F0OA 3PWBA 1KIGH 3BTQE 4JK6A 4WY3A 1TIOA 1GHZA 1XX9A 5IK2D 1C5TA 1TB6H 1O2YA 3MNSA 1HLTH 2OBQA 4AYYB 2KCPA 5EOKA 1NTPA 4BTUB 3SU0A 4AGKA 1CA8B 5A0BA 2ZGCA 1S84A 1N1LA 2F4LA 3ZZ3A 5EPNA 5J4SA 1F5RA 5JB8S 1TNLA 1XUGA 3B23B 3RXGA 5C20A 2KAIA 3CS7A 4ASUD 2Y7XA 3KEEA 4H42U 5EXNA 4CRDA 2GT8A 1A46H 3NZIA 1VCWA 2VB0A 3GCHB 3AK5A 2Z94A 1FPCH 1SHYA 3JZ2B 4X1SU 4YOJA 1P03A 3S9CA 1HJ8A 2BVSH 2TBSA 4B75A 1DPOA 3P8GA 4M7GA 1THRH 4GVUA 1ESAA 4FUGA 1O30A 1UTPA 1QGFA 3G01A 4ZKNU 2IPQX 5EJLA 1ZSLA 4Q80A 1WDIA 1ELBA 4JZFH 2ZEBA 3F9EA 1O2GH 3LIWA 1ANDA 5TCAA 1BITA 1HAHH 2ALVA 4FVBA 2ASUB 2A2XH 1T7CA 3F2GA 3QZRA 1O2VA 1TRMA 1AVWA 1P8VC 4X1NU 1FY4A 5KECA 1RIWC 3UFAA 2Y81A 3ZZ8A 3LOXA 3L6PA 5I25A 1C2DA 3IITA 4F49A 4NSVA 3BN9A 7ESTE 2BDGA 3ZVDA 4AYVB 1WAYB 1EZQA 2OUAA 4DIIH 2WZQA 1EATA 1ZMLA 3GYMA 1D6RA 2W7UA 5GNDA 1ZOMA 1T4UH 4ZUHA 1TGTA 2SGEE 1IQLA 2ZWLH 3CNRA 1V2UT 1JRSA 1ABJH 3LDXH 2JETC 2WPIS 3GOVB 3L3TA 5HIYA 1J9CH 1G2LA 1GI5A 2XBWA 3BSQA 4LK4A 5DG6A 2PV9B 2BLVA 1GWAA 3RU4D 1NRSH 3VB3A 1EAWA 2AMDA 1V2VT 3N99A 1UHBB 5GWZA 2BD4A 1C5YB 3M61U 3T2NA 2C8YB 3UPEA 1QNJA 1E38B 1EOJA 2J92A 4AC9A 5JBTA 2BX3A 4BAMB 4AFUA 1XUJA 3MYWA 1O3KA 4Q63A 1LMWB 1IQIA 3DCLA 1MZDA 1V2TT 3DFJA 1F7ZA 3IWMA 1DSUA 1TABE 1W11U 3EE0B 2Y82A 3Q00A 2Z9JA 1K22H 2PUXB 2G5NA 3RU4E 1S5SA 2ZQ2A 1WXRA 1O2JA 2UUFB 1FLEE 4I8GA 7KMEH 2XC4A 2C8ZB 3GY6A 4FUCA 1SGFA 1JIMA 1TPOA 3TK9A 4BOHA 1Z71A 4B73A 1CO7E 2BD7A 1HRTH 1O2SA 2A7HA 4AN7A 2FOBA 3EAJA 3SJOA 3A7XA 2G55A 3RXFA 3RXOA 3SGQE 2QF5A 2FEQH 3UOPA 1EPTB 2EY4C 4UFGH 1BMFD 5C1YA 5LGOA 3V0XA 2C8XB 2SNWA 2BB4A 2VIVA 2BD8A 4DURA 2CXVA 1C1TA 2NU0E 1F0SA 4UD9H 1FUJA 1V2QT 3SU3A 1HAXB 1QL7A 2J98B 3PV4A 1BBRE 1TX7A 1NZQH 1GI2A 1ZRBA 5EQSA 2JH5D 3TNTA 1O2ZA 3DD2H 2XYAA 1SQAA 2XWBI 3OSYA 1C5QA 4Y6DA 4KELA 2R0LA 2HLDD 4X1PU 1CE5A 3U8OH 1BUIA 3A84A 2W7SA 2EA3A 2XC5A 1O2IA 1VR1H 3F2HA 2ZP0H 1GL0E 1IHSH 2SGDE 4FUIA 3OU0A 1HAIH 2CGAA 2ULLA 1W8BH 1MD8A 3PLPA 4ZAEA 2ANMH 2B5TB 3RXEA 1EJNA 1PQ5A 1EAUA 3STIA 1EKBB 1B7XB 2BXUH 2Z9LA 1YF4A 3LH1A 2VINA 1P10A 4X2VA 1NN6A 1Y5UT 3LGYA 2ZCLP 3SGAE 4K1EA 4XDEA 1GBMA 3PLBA 4FUJA 1NRPH 3S9AA 1K1LA 3RLWH 1O2WA 3B8JA 4WWYA 1T32A 1V2PT 3EA7A 4XOJA 3SU6A 1PQ7A 3ATMA 1BBRK 1TNKA 3UR9A 4MPWA 2R3UA 2B8OH 3U1IB 2XBVA 4OS6A 4Y8ZA 3KQDA 1EJAA 1ARCA 2QAAA 3D62A 4CRBA 1UK2A 4DW2U 2STAE 1YCPM 1P09A 4DT4A 2ZHDA 4BAKB 5E0HA 1A0JA 1DSTA 1OKXA 3PMJA 3RXCA 4GSOA 1YWUA 3ZYEA 1YPHE 1EB2A 1E36B 1MTNC 1N6XA 2J9NA 1JXPA 1P04A 2VWLA 4KTSA 5DO4H 3UQOA 2ZGJA 2A4QA 1LTOA 1SGTA 2XCNA 3UNSA 1SQOA 3ATIA 3HK6B 2TGPZ 1QY6A 2WPDD 4ISOA 4B6FA 2ZU3A 2ZU2A 1KTSB 3SV8A 1YPJH 2ZU1A 1O2KA 5EQQA 2TGAA 1TPPA 3A8AA 4CR9A 2FS8A 2A2QH 1SOTA 1MKXH 1UCYE 2D2DA 1SLVB 3UOUA 4IBLH 2F91A 1A3EH 4JYVH 2F9OA 1TQ0B 3A88A 2EC9H 2VVVA 2ODYB 3DSPA 1HCGA 2PGQB 5EIYA 3K6ZA 3TGKE 2P3TB 3RUOA 3S7HB 1X7AC 1MU6B 1UTKA 2YNBA 1A5GH 1ZJKA 5AF9H 2ZPRA 3AASA 2G4TA 2XCFA 4UFFH 1YPHC 1OP0A 1C5XB 1UTOA 3LGTA 3P17H 1BIOA 1C1NA 3M35A 1T8OA 2FI3E 1F2SE 3GS9A 3MH4A 1QBOA 1AVXA 3ITIA 1DXWA 3U69H 3H09A 5EQRA 3FKSD 5KEDA 5EJ1A 1LHEH 2ZKSA 1AQ7A 2K8IA 1DE7H 1Y3WA 4TWYA 2W3KA 3GCTF 1D4PB 1PPEE 2BXTH 3STJA 4ZKRU 1UTNA 1LVYA 1TRYA 1Y3VA 5A09A 3V13A 3F68H 4NCYA 2ILNA 3KYFA 1QURH 4NA8A 3T29A 4X1QU 4YM9A 1DLEA 1DWCH 2AGIX 3SU4A 1EB1H 3N7OA 3QGJA 1PQAA 1UCYK 3LJJA 1MD7A 2VGCC 1O32A 1H9LB 1VKYA 1SHHB 3NWUA 5BPEA 1SL3A 1UVUH 2DE8A 4U30A 1GJ4H 4GCHF 1NO9H 4D8NA 4F4OC 3GY4A 3I29A 1NRRH 2BMGB 1T31A 3A7ZA 2VGCB 1NS3A 1AU8A 3KQEA 4CRFA 3RMMH 2BOKA 2HGTH 2HOBA 2AGGX 2BQ7B 5LPEA 3A87A 2FIRH 2ALPA 1XUHA 2FX4A 1IQEA 1GI1A 3RMOH 3T5FH 3DUXH 3V7TA 2OLGA 1GCTB 3SI3H 1GHBF 1HIAA 2J95A 2HNTF 5GPIB 1CBWC 3ZVEA 3TGJE 1GBKA 2JH0D 1O31A 2DUCA 3TH3H 1GHXH 1GI8B 4CBNA 1Z8GA 4I8LA 4NWLA 3SV7A 3VPKA 1EOLA 2ANYA 2ZECA 5DP5A 3KIDU 1K28D 2QXHA 1OP2A 4TPYA 3KNXA 1ZHMA 2H5DA 1A0HB 4YT6H 4QT8C 1W0ZU 2ODQA 1PYTC 2XW9A 2ZQ1A 4X8TH 4XBBA 3ZVBA 2IJD1 5LPRA 3URDA 3M5NA 1PPGE 4NGAH 1C1RA 1O3FA 1KLJH 1XVMA 1G3CA 1UVOA 4BXSA 2QXGA 4Z1MD 1NC6A 1PQ8A 3MFJA 1A61H 2WYGA 1FI8A 1IQJA 1MTVA 1MQ6A 1E1QD 1P2MA 1O38A 4GHQA 1NRQH 5L2ZH 1K21H 3NXPA 4NIVA 1RTKA 3B9FH 1C2JA 3TITA 1HUTH 2V35A 1LVMA
chains in the Genus database with same CATH topology
4WH6A 3ZIAD 1H8ED 2GGVB 2YMSD 2OBOA 3SUFA 3SV9A 3F0OA 3N99A 3F2FA 2QF4A 1EFRD 1MABB 1NBMD 4NWKA 5FL7D 3O8RA 1BT7A 3F3BA 5IK2D 1H8HD 3FO8D 5GJ4B 3SU4A 2A4GA 4FETA 3M5MA 3SU6A 2OBQA 5C0UA 2KCPA 2OC0A 2YOLA 3M5OA 3OFND 2WSSD 2O8MA 3E90B 3OYPA 3P8OA 3U1IB 4I31A 3WW7A 3O8BA 3RC6A 1A1RA 2IJOB 3SV6A 3SU0A 3DSOA 4Q63A 4OM9A 1OHHD 1N1LA 2F4LA 1S6LA 5EPNA 3DCLA 2OC7A 1KMHB 1W3CA 1RGQA 1FX0B 5B6LA 2XOKD 4KTCA 5H4IB 3OEHD 4WH8A 5FPYA 4I33A 4ASUD 2K0QA 2XNDD 3KEEA 2LELA 1DY8A 3PV2A 4F55A 3SZEA 1NS3A 5ETXA 5CDFE 4DT4A 1WXRA 3AK5A 4Q4LA 1E79D 3OTPA 1NBME 2YMSB 2VBCA 5EPYA 4XD7D 2AHME 4TYDA 2OK5A 4B75A 2KM0A 2CK3D 4B73A 4A92A 3RC5A 2P59A 1JXPA 2W6JD 3PV5A 5IDKA 4K8BA 3LONA 2A4QA 2KCYA 2FP7B 2QF5A 2XCNA 5T1VA 2OC1A 2KCAA 2WHXA 2WPDD 3W1EA 3SUGA 1BMFD 2OC8A 4B6FA 4A1XA 1SKYE 5DN6D 3SV8A 2JJ1D 3NRLA 1W0JD 2JIZD 2V7QD 1DY9A 2W6ID 5EQQA 5GPIB 2K1QA 3SU3A 4B6EA 4U01A 3SU1A 4B76A 4NWLA 3OAAD 3SV7A 5EQSA 3EYDA 5ESBA 3SU2A 4A1VA 3UB0A 2WV9A 3SU5A 2KFWA 3F2GA 4WF8A 5C17A 5FPTA 3WWFA 2FOMB 3SUEA 2KR7A 2FM2A 2HLDD 3M5LA 2M2AA 3OEED 3KNXA 3DSPA 2QE7D 2A4RA 5F53A 5CHBA 2JJ2D 3KF2A 2F9UA 3L6PA 3LOXA 3WWBA 2L6OA 4R8TB 3F0PA 2IJD1 1E1RD 1RTLA 5FPSA 4YXWD 3N7EA 3FOAA 3M5NA 3O8CA 4A1TA 2KZ4A 5DSFA 3F2HA 2GVFA 3VG8A 2XCFA 2WZQA 3P8NA 4B71A 4Z1MD 3SUDA 5C0TA 3LKWA 5GNDA 4I32A 3PRDA 2JDID 2F9VA 1E1QD 2J5UA 2OINA 2QV1A 3O8DA 5HKKD 3U1JB 3GS9A 3N7DA 4RI0A 1DXWA 3FN8A 3PRBA 3H09A 5EQRA 1W0KD 3FKSD 4ZCNA 3KN2A 3SYJA 1COWD 3OE7D 2KCOA 1CU1A 3RC4A 2K8IA 1DXPA 4JMYA 2F43B 2XNIA 4TT3D 2YMSC 4B74A 4TSFD 4M9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRL A; 
#chains in the Genus database with same CATH topology
 5F03 A;  3SND A;  1OP8 A;  1HBT H;  5HIZ A;  3Q3X A;  2PHB A;  1UMA H;  2QF4 A;  1MAB B;  1K1O A;  1O2X A;  1GHA F;  2PWX A;  4BAQ B;  4WXV A;  4Y76 A;  1OPH B;  1S82 A;  1LHF H;  4CR5 A;  1SQT A;  3M5M A;  2QYI A;  2TRM A;  4AB8 A;  3D65 E;  2YOL A;  3M5O A;  2Z3D A;  3UIR A;  2CJI A;  2XTT B;  3WW7 A;  3E6P H;  2ZPQ A;  4D7F A;  4GUX A;  1O3N A;  6CHA B;  2HVY B;  4YLQ H;  4HTC H;  5T6D A;  4O3T A;  3K2U A;  2FYR A;  3S69 A;  2PKS C;  2GD4 B;  5T6G A;  3PV2 A;  3SZE A;  1EST A;  2BY6 X;  1C1P A;  3BTG E;  1EZU C;  3RLY H;  4A92 A;  2PKS B;  2PKA A;  3MNB A;  1CT2 E;  2GV6 A;  2A5K A;  1L1N A;  4MDS A;  1V2W T;  3BG8 A;  3PRO A;  1O3M A;  4ZHM U;  5CHA C;  1DUA A;  3LPR A;  3P6Z B;  3SV2 H;  1FN6 A;  1BB0 B;  2FOC A;  1JMO H;  1FZZ A;  3BTH E;  2VIW A;  2RCE A;  3M36 A;  1K9O E;  1Z1I A;  2GCH F;  1QFK H;  3SU1 A;  4A1V A;  2XBY A;  1AO5 A;  5C94 A;  2XC0 A;  2Z3E A;  1ZPB A;  3BV9 B;  4WF8 A;  5FPT A;  2ZU4 A;  2FOM B;  1W7G H;  3U9A H;  1TGC A;  8LPR A;  5F53 A;  4PRO A;  1XUF A;  2F9U A;  2VU8 E;  3WWB A;  2G4U A;  2IPH A;  1E1R D;  1TRN A;  2PTC E;  3PTB A;  3GY5 A;  1J17 T;  2AIP A;  3BTE E;  3ODD A;  3VG8 A;  3ZZ5 A;  3VGC C;  3E1X B;  1G32 B;  1J15 A;  2ZC9 H;  5DP4 A;  1AI8 H;  1L4D A;  1JOU B;  3GY7 A;  4ZMA H;  1QRW A;  1QB9 A;  1GJC B;  2C4F H;  3ATL A;  3U1J B;  5FCK A;  2G81 E;  2J94 A;  3VGC B;  4CRA A;  2A32 A;  1P3E A;  3QO6 A;  3LU9 B;  3SYJ A;  4ZXX H;  1BOQ A;  2C90 B;  3U8R H;  2GP9 B;  1F5L A;  1TWX B;  1S81 A;  1K1I A;  4IS5 A;  3SNE A;  1HXE H;  3BEI B;  1XUK A;  2ANW A;  4WH6 A;  3BTM E;  2GGV B;  4SGB E;  4Q7Y A;  1NBM D;  1BT7 A;  2D26 C;  1E34 B;  1AFE H;  8GCH G;  3OTJ E;  3MH5 A;  4AFS A;  4RT0 A;  4D9Q A;  3ZZ4 A;  1WYK A;  3RXA A;  1P12 E;  1P9S A;  1O2N A;  1HB0 B;  1A1R A;  2GDE H;  4NSY A;  3DSO A;  4OS7 A;  3NUM A;  9LPR A;  2BVX H;  2THF B;  2XXL A;  3QTO H;  3BTF E;  1G30 B;  4CHA C;  5TJX A;  4JYU H;  4IGD A;  4K69 A;  1DY8 A;  2OCV B;  1KSN A;  2SNV A;  1HPG A;  1S0Q A;  1ORF A;  4YTA A;  1GPZ A;  3BG4 C;  1NBM E;  2HRV A;  3HK3 B;  4IN1 A;  4CHA B;  2A5A A;  3ATW A;  2BDI A;  1XXF A;  4HG6 A;  3T26 A;  3DFL A;  1BTP A;  5A0C A;  1K2I 1;  4NA7 A;  2C3S A;  2B0F A;  4P02 A;  1CVW H;  2O9Q A;  3QWC H;  3BG4 B;  3SOR A;  3BEU A;  2A4O A;  4XBD A;  3UNR A;  3RXI A;  5HM2 A;  1P2O A;  1YPL H;  2RDE A;  3HGP A;  3ODF A;  3M37 A;  1S6F A;  3KYG A;  1AZZ A;  5A8Z A;  2V7Q D;  3LC3 A;  3KHV A;  4UDW H;  1O2T A;  1BZX E;  2Z7F E;  3OAA D;  3E0N B;  1O0D H;  1QB1 A;  2WV9 A;  3KQ5 A;  5JBB S;  1GBJ A;  1GVK B;  1O2L A;  2I6Q A;  4GAW A;  2TPI Z;  2M2A A;  4THN H;  5FX5 A;  1SR5 C;  4WJG 2;  1HAV A;  2GT7 A;  2ZDN A;  5F8X A;  3L33 A;  4JZI A;  4R8T B;  4Y79 A;  1SGY E;  1ABI H;  2SFA A;  1ANE A;  4I8J A;  4CH2 B;  5GXP A;  2BZA A;  1SBW A;  2Z9I A;  3LGW A;  2UWP A;  1OWK A;  1GMC F;  3PO1 C;  3TJN A;  2HPP H;  5IYT A;  1GBA A;  1K1P A;  1UO6 A;  1HJA C;  1SG8 B;  2ANK H;  2XWA A;  4Y11 E;  3LKW A;  3ZZC A;  1QJ6 B;  3ZZ6 A;  2BY9 X;  4MLF B;  1ZTK A;  4ZHL U;  5HKK D;  2ZU5 A;  1S85 A;  2J34 A;  1A3B H;  4JYT A;  5HXF A;  3FP8 E;  4ABH A;  3UWJ H;  3R3G B;  2SGQ E;  1KLI H;  2YMS C;  1KXC A;  1N8O C;  3PB1 E;  4XRN A;  4VGC C;  1GGD C;  1T8M A;  5F8Z A;  4LZ1 H;  1RIW B;  2FLB H;  1P3C A;  1HFD A;  4O03 A;  2WPH S;  4MNW A;  2ZDM A;  1ZLR A;  3QN7 A;  3SQH E;  2V0B A;  1F5K U;  1N8O B;  1ESB A;  1G9I E;  2AS9 A;  5A8X A;  5GIB A;  3GCT G;  1C1M A;  1XKB C;  3LC5 A;  5EJZ A;  4YOI A;  3RXR A;  3P70 B;  2OQ5 A;  3VFE A;  1Z6J H;  4MVN A;  2Z9K A;  4AFQ A;  2LP6 A;  1SFQ B;  1AHT H;  1KMH B;  1CQQ A;  2UWO A;  2XOK D;  4MQA A;  3K65 B;  5FPY A;  4I8K A;  3KCG H;  1GBB A;  1D6W A;  5CDF E;  2JET B;  4B2C A;  3DA9 B;  4FUE A;  5SGA E;  1ETR H;  2Y80 A;  5C2Z A;  3V3M A;  2PR3 A;  3VB5 A;  1ELE E;  4GCH G;  1C2H A;  2WPM S;  1ZHP A;  2P16 A;  1CHG A;  4K3J A;  2FXR A;  2OC1 A;  3RM2 H;  2PLX A;  2WHX A;  2H5C A;  2WPK S;  3E0P B;  1TQ7 B;  5DN6 D;  2M5T A;  2EEK A;  3S7K B;  1DY9 A;  4CH8 B;  1Y8T A;  2VH6 A;  1NES E;  1O2U A;  3PMA B;  4IC6 A;  4NG9 H;  4ISH H;  3SU5 A;  4INH A;  3A8B A;  1AUT C;  3SUE A;  1S83 A;  4MG3 A;  1SMF E;  1TNI A;  3A89 A;  3BIU H;  3Q76 A;  5CHB A;  3GCN A;  1GHB G;  4ABD A;  3S0N A;  1RRK A;  2ZDK A;  1C4Y 2;  1NFY A;  3FVF B;  3MO3 A;  3RXT A;  4YXW D;  1W7X H;  2SGF E;  1QRX A;  2BD9 A;  5A2M H;  1GDQ A;  4RKO B;  2BDB A;  1GJD B;  5HGG A;  2Q6D A;  2ZFP H;  1C5R A;  3PRD A;  2JDI D;  1TBZ H;  2QV1 A;  3AAU A;  3MH7 A;  1O37 A;  6GCH F;  3VXE H;  3A81 A;  3TJV A;  1XKA C;  1HAG E;  2L74 A;  1NFU A;  3F9F A;  1MTU A;  3FN8 A;  4JCN A;  1QB6 A;  1KTT B;  1IQH A;  3U98 H;  2KCO A;  3UR6 A;  2VWM A;  5JBA S;  4I7Y H;  2F9B H;  1CHO F;  1BJU A;  1KXF A;  1GI6 A;  2VNT A;  3QGN B;  1F0T A;  1A5I A;  3T28 A;  1O5A B;  1Y3U A;  3SUF A;  4OGY A;  1O3A A;  1SGI B;  4ZH8 A;  1O5F H;  1FPH H;  4XE4 A;  3ZV9 A;  5C0U A;  4NFE A;  2WSS D;  1TOC B;  4I31 A;  4YES B;  3RC6 A;  3SV6 A;  1JBU H;  4KGA A;  3RXL A;  2BY5 X;  1GBD A;  3MO9 A;  1GHA G;  3RXU A;  4ISI H;  1V2J T;  3U8T H;  4ISN A;  1TNJ A;  4A6L A;  2KAI B;  3UNQ A;  1TA6 A;  1ETT H;  4GHT A;  2WUC A;  3CP7 A;  3HAT H;  3SW2 B;  1O5B B;  1AVG H;  4D7G A;  2KM0 A;  5JPM H;  3OY6 U;  1TX8 A;  1VCP A;  1C2I A;  1GG6 C;  2BHG A;  5F6M A;  1FN8 A;  1SGD E;  3PV5 A;  4X8U H;  4K8B A;  3QDZ B;  1SFI A;  2XBX A;  2FP7 B;  4J1Y A;  4AGJ A;  3ZVF A;  2F9P A;  3SO3 A;  4CRE A;  1KLT A;  4OS1 A;  1DUE A;  2CV3 A;  3RXJ A;  4DCD A;  2AH4 X;  2W6I D;  1G3B A;  2FOH A;  2A1D B;  4U01 A;  1WU1 A;  1W14 U;  4UON A;  2QXI A;  2D8W A;  2BDA A;  3SU2 A;  4IN2 A;  4D76 A;  2P3U B;  4BAO B;  4ZXY H;  1QQ4 A;  4H4F A;  2LNC A;  3BTT E;  3H7T A;  2BLW A;  1QCP A;  1TOM H;  5EOD A;  3P92 A;  2NWN A;  2GCH G;  2BDC A;  3TLO A;  3KQB A;  1MTN B;  5DSF A;  1BQY A;  1PPH E;  2GZ9 A;  1WQV H;  1TGS Z;  1UVS H;  4I32 A;  1PJP A;  3RXD A;  1V6D A;  1C1V H;  3BTW E;  3D23 A;  2V3O H;  3ZYD A;  3LGV A;  4ISL A;  1VIT H;  1VJ9 U;  1QL8 A;  1IQK A;  3QTV H;  4OGX A;  2W5E A;  3WY8 A;  1P9U A;  4AG2 A;  4H6T A;  3KN2 A;  1ELD E;  3RXP A;  3RC4 A;  4JMY A;  2F43 B;  4IC5 A;  4O97 A;  1O3J A;  1L2E A;  3MOC A;  3SJ8 A;  1C1Q A;  2BDH A;  3SV9 A;  2STB E;  3F2F A;  1TX6 A;  5AHG H;  1YPE H;  2RFK C;  5G4B A;  1AY6 H;  1GCD A;  2FYQ A;  2ZGB H;  1GI4 A;  1UK4 A;  2D1J A;  3EA8 A;  4ZHA A;  3OYP A;  1G3E A;  1GBH A;  1VIT F;  2OQU A;  1J8A A;  2GCT C;  4JZD H;  1TMU H;  1P2K A;  5GCH F;  4Y10 E;  2QCY A;  4X1R U;  3OX7 U;  1FNI A;  3M7T A;  4ABF A;  1ZPZ A;  3MU4 A;  2J97 A;  1EXF A;  1GMH F;  1YP9 A;  1V3X A;  2K0Q A;  1QQU A;  5TCC A;  1G37 A;  2GCT B;  3H7O A;  1Q2W A;  1QBV H;  2ZHE H;  2FWW A;  1DLK B;  1ELA A;  3D49 H;  1C2G A;  1C9P A;  3E16 B;  4X0W U;  1GBF A;  3DHK H;  1O2R A;  2HWL B;  1C1S A;  2KCY A;  1ANC A;  3SOS A;  3SNA A;  5DP7 A;  2KCA A;  3LGI A;  3TJO A;  1A2C H;  3M7U A;  4ABE A;  1H9I E;  3MO6 A;  4A1X A;  1F0R A;  1BDA A;  5HM9 A;  1W0J D;  3A7Y A;  2HNT E;  4K1T A;  1HNE E;  1TNH A;  3PLK A;  5ESB A;  3MWI U;  1SGP E;  3SHA H;  4X2Y A;  5C17 A;  2FZZ A;  1EUF A;  5EST E;  1GBI A;  3QZQ A;  2EI6 A;  2WYJ A;  3SN8 A;  4XSK U;  5EW1 H;  1XUI A;  1WUN H;  3RXK A;  3KF2 A;  3SI4 H;  1C1O A;  1ZJD A;  1YCP H;  3F0P A;  2F9N A;  4F48 B;  1INC A;  1GJA B;  1FV9 A;  3BF6 H;  1WQS A;  3A7W A;  2ZGX H;  2FLR H;  1MKW H;  1YLC A;  1L1J A;  2ZNK H;  2BD5 A;  4Y0Y E;  1DX5 M;  1UK3 A;  1UVT H;  4X6M A;  3UQV A;  4MPU A;  1FDP A;  3SGB E;  5A0A E;  3ZZB A;  3SZN A;  2RG3 A;  2WIN I;  2NU2 E;  2PSX A;  1CT4 E;  1QBN A;  1P06 A;  3SJI A;  4BXW A;  1O3D A;  1MAY A;  3CS0 A;  1GJ7 B;  2QXJ A;  1V2M T;  1TE0 A;  1CBW B;  5E2O A;  1GMC G;  4BTI B;  1CT0 E;  3RDZ A;  4B2A A;  2XNI A;  3SQE E;  1GI7 B;  1LDT T;  1AE8 H;  1GBT A;  2BX4 A;  2B9L A;  1TBQ H;  2PGB B;  3MHW U;  3M3T A;  4BAH B;  1JIR A;  1GI0 A;  1D3P B;  1SGR E;  3GDU A;  1EFR D;  1OWD A;  3ZZD A;  1H8H D;  2ZDV H;  1L1G A;  2RA0 A;  3ZVG A;  1ANB A;  2C8W B;  2Q1J A;  4B1T A;  4B2B A;  3GDS A;  3OFN D;  3E90 B;  4WVP E;  1O3O A;  3O8B A;  4ZKO U;  3EGK H;  1LHC H;  1OHH D;  3QLP H;  1TBR H;  2Z3C A;  2ZDL A;  1THS H;  3SBK A;  2RDL A;  2RA3 A;  4BNR A;  3TNS A;  2R2M B;  3ELA H;  2FPZ A;  3OEH D;  1DDJ A;  1IQM A;  1QRZ A;  1WOF A;  2A7J A;  1WV7 H;  5L6N H;  2ZI2 H;  2H1U A;  4F55 A;  2A5I A;  3S9B A;  1LHD H;  2Y5F A;  1UVP A;  1SOZ A;  4K2Y A;  2BYA X;  3M3S A;  1E79 D;  1UTM A;  3OTP A;  1XM1 A;  2JH6 D;  2GV7 A;  2OK5 A;  1O5D H;  4MPX A;  1MZA A;  1Y5B T;  1C5V A;  1O39 A;  1GJ8 B;  1NT1 A;  2UUJ B;  3A7T A;  1ARB A;  1YBW A;  1ZR0 A;  2JKH A;  2O8U A;  2ZPS A;  2QA9 E;  1EAI A;  3GY3 A;  5KGO A;  1VGC C;  1K1M A;  2AEI H;  2FS9 A;  1UTL M;  1AIX H;  1P2J A;  2ZZU H;  2JJ1 D;  3NRL A;  2Z9G A;  2JIZ D;  1O33 A;  3EDX B;  1LKA A;  1NM6 A;  4B6E A;  4B76 A;  4NZL A;  4Q2K A;  1SGN E;  3EYD A;  1ZTJ A;  1DWD H;  1LHG H;  1AMH A;  1VJA U;  3FAO A;  5E0J A;  3W95 A;  1ZGI A;  2FM2 A;  4BAN B;  2QE7 D;  1BMN H;  4OS4 A;  5K0H A;  1GMD F;  1FIZ A;  4X8V H;  4FUF A;  1G3D A;  1YGC H;  4Z6A H;  1P2N A;  1SB1 H;  3LT3 A;  5L2Y H;  4TPI Z;  5FPS A;  1GDU A;  3N7E A;  2HAL A;  2WV4 A;  2ZHF H;  1CA0 C;  1LCY A;  3HGN A;  1C5U A;  1O5G H;  3EE7 A;  1WTG H;  1W2K H;  2W3I A;  5DKM A;  3PMH B;  1GVZ A;  5K7R A;  5CHA B;  2DE9 A;  1ELG A;  1HDT H;  2H9E H;  2WV5 A;  3BIV H;  1C2M A;  3TGI E;  3N7D A;  1BRC E;  4RI0 A;  1AKS A;  1FY5 A;  2P95 A;  3PMB B;  4HGC A;  1KDQ A;  1YC0 A;  4NFF A;  3UTU H;  2V3M A;  2B7D H;  1HYL A;  2CF9 H;  3A86 A;  1FIW A;  2WPJ S;  1NU7 B;  2GZ7 A;  1Q31 A;  1E35 B;  4E05 H;  1D3T B;  5C67 A;  2FOD A;  1P57 B;  2PFE A;  3ZZA A;  3RU4 T;  2AGE X;  1AB9 C;  4YOG A;  5E2P A;  1GL1 A;  2ODP A;  2OC0 A;  3DT0 H;  1BMM H;  2ZTY A;  1P0S H;  1Z6E A;  1MBQ A;  5DP8 A;  1CHO G;  1ZZZ A;  3RXB A;  1KXB A;  2PW8 H;  4FOU C;  1BRA A;  1L4Z A;  1GJ5 H;  5H4I B;  1C2K A;  3AVZ A;  1SQR A;  4K60 A;  5C5N A;  1GBE A;  2A31 A;  2R3Y A;  7LPR A;  1DOJ A;  1V2L T;  1ZRK A;  3F9H A;  1M9U A;  5EPY A;  1A5H A;  5AVD A;  1YPK H;  2CHA C;  1QA7 A;  3BTK E;  1TMB H;  3UAI C;  4Y0Z E;  1PPB H;  4TWW A;  2OXS A;  5A8Y A;  1C5W B;  1TAL A;  1EPT A;  1GBL A;  2P8O C;  4ABB A;  1V2N T;  1C5S A;  5EXL A;  1BTH H;  2BY8 X;  3W1E A;  4A5T S;  1O2Q A;  3TH2 H;  1EJM A;  3NPS A;  3T27 A;  2J98 A;  2BD2 A;  1ZMN A;  1HIA B;  1GHW H;  1V2R T;  4U32 A;  1DVA H;  4RKJ B;  1AFQ C;  3HKJ B;  4U2W A;  2YNA A;  4AX9 H;  2F83 A;  2ZG0 H;  3UWI A;  1LKB A;  5GDS H;  2JJ2 D;  3SNB A;  3Q77 A;  1VZQ H;  1V2S T;  3I78 A;  2ZCK P;  2FMJ A;  2FOF A;  3O8C A;  2G51 A;  1SPJ A;  1TGB A;  3H5C B;  1BML A;  1RFN A;  5DP6 A;  3KL6 A;  2WUB A;  4E06 H;  3FAN A;  4OS5 A;  1C5N H;  1F0U A;  4AOQ A;  1H1B A;  1AE5 A;  3W94 A;  4Y71 A;  2J5U A;  3F1S B;  1JRT A;  3A7V A;  4INL A;  1AGJ A;  4ZCN A;  4Q7Z A;  1GBC A;  1PPZ A;  1BTY A;  1HJ9 A;  3GCH C;  1KXA A;  1IQF A;  1WTH D;  1OWI A;  7GCH F;  4ABA A;  1ZPC A;  3M7Q A;  1Z8R A;  1MBM A;  1AD8 H;  1Z8I B;  3F6U H;  2VVC A;  3KQC A;  1LQE A;  1C5L H;  2TGD A;  3TPI Z;  2QN5 T;  1AN1 E;  3TK5 A;  3FFG A;  1EP6 A;  4WXI A;  1LVB A;  2EI7 A;  3O8R A;  4JZE H;  8KME 2;  1GHV H;  4O3U A;  1IHT H;  5C5O A;  5C1U A;  3FO8 D;  3EQ0 H;  3JZ1 B;  5AFZ H;  4YLU A;  1HGT H;  3PO1 B;  2ZHQ H;  2BQW B;  3P8O A;  1XMN B;  1Z1J A;  2PTN A;  1OXG A;  1HJA B;  3EA9 A;  1FMG A;  1C9T A;  3MNC A;  1MTW A;  4HI3 A;  2QF3 A;  1O3E A;  1RJX B;  1FQ3 A;  2OC7 A;  1ZSK A;  2XRC A;  3C27 B;  3I77 A;  4KTC A;  1BTW A;  4NIW A;  1CGI E;  3SNC A;  1U6Q A;  2GZ8 A;  3RXV A;  1BRB E;  2FTM A;  4X6N A;  2ZFQ H;  4LZ4 B;  5HMA A;  1XXD A;  3T25 A;  2GJG A;  2YMS B;  2VBC A;  2J4I A;  1VIT G;  1AZ8 A;  3V12 A;  4VGC B;  3RC5 A;  1GGD B;  5GCH G;  4OS2 A;  2PKA B;  3VB4 A;  2W6J D;  1GMH G;  2IOT A;  2GX4 A;  1IOE A;  4ABI A;  2ZTX A;  1SGF G;  1RTF B;  2WPL S;  1N6Y A;  1T8N A;  2R9P A;  2V6N A;  1FY1 A;  5F8T A;  1YYY 1;  1NRO H;  3RXS A;  4DY7 B;  2Q6F A;  2KFW A;  4E7N A;  2Y6T A;  2J2U A;  4Q7X A;  2R2W U;  3MU8 A;  1TYN A;  3A82 A;  3OEE D;  1AKS B;  4K8Y A;  5FX6 A;  1EZS C;  1GHY H;  2A4R A;  2FX6 A;  2ZA5 A;  4KKD A;  4X2W A;  4XBC A;  1P2Q A;  1KDQ B;  1DIT H;  3MNX A;  3FOA A;  6EST A;  1MCV A;  3TVJ B;  1GI9 B;  1ZGV A;  9EST A;  5JDU B;  2G8T A;  1EP5 A;  1ELV A;  4UFD H;  1NFX A;  3MU0 A;  3TIU A;  4Y7B A;  1MUE B;  1Y5A T;  4IMQ A;  4D9R A;  1O5E H;  5CE1 A;  3PRB A;  3OY5 U;  1Z8J B;  2AMQ A;  1O3C A;  3E3T A;  1SGQ E;  2PSY A;  3RXM A;  1GI3 A;  1OSS A;  4WMD A;  1H8E D;  1O3P B;  4KP0 A;  1HAZ B;  1ZSJ A;  4FUB A;  1NY2 2;  1AWH B;  1C4U 2;  1BTU A;  4NA9 H;  3F3B A;  2BTC E;  5GJ4 B;  4UEH H;  1EPT C;  1RXP A;  1GVL A;  4YZU A;  2O8M A;  4JZ1 A;  3RP2 A;  1LPZ B;  1W13 U;  4UFE H;  2IJO B;  5JB9 S;  2BD3 A;  2BZ6 H;  5AFY H;  1S6L A;  1DM4 B;  2FI4 E;  1FX0 B;  1RGQ A;  1BBR H;  4I33 A;  6LPR A;  4BTT B;  2CMY A;  2BQ6 B;  3GIS B;  2Z6B D;  1DIC A;  4ACA A;  5ETX A;  4KTU A;  1BTX A;  5FBI A;  1BCU H;  4SGA E;  1T8L A;  1D3Q B;  1MQ5 A;  2ZIQ H;  4GLY A;  1ELT A;  3IG6 B;  2BM2 A;  2SGA A;  2P59 A;  1OS8 A;  2VWN A;  1MTS A;  3LH3 A;  3PWC A;  1FJS A;  1SLU B;  5IDK A;  1HAP H;  3FZD A;  1DT2 A;  1QZ8 A;  1C1U H;  3ZV8 A;  4X6P A;  3ZZ7 A;  1O5C B;  2OC8 A;  1IQN A;  1BJV A;  2O8W A;  3Q3K A;  1JWT A;  4J2Y B;  5T3H A;  1O2H A;  1ETS H;  4I8H A;  1BHX F;  4TY6 A;  1SGC A;  4YO9 A;  1MMJ N;  4E7R G;  3LGU A;  1Q3X A;  3NK8 A;  3ZVC A;  4FU9 A;  4MNY A;  4AB9 A;  3NCL A;  1BHX B;  5DK1 A;  2TGT A;  3UB0 A;  1WSS H;  1K1N A;  1GJB B;  8GCH F;  2PP6 A;  3GCO A;  3P95 A;  1C4V 2;  4ABG A;  3MH6 A;  2ZFT A;  1H4W A;  4P00 A;  2L6O A;  4AG1 A;  1HAV B;  2CF8 H;  2R0K A;  2OD3 B;  1KXD A;  3BTD E;  4A1T A;  5EU8 A;  2FOE A;  3E8L A;  1GG6 B;  3T62 A;  2EI8 A;  1FAX A;  2H2Z A;  3A8C A;  3AAV A;  5DGJ A;  3P8F A;  2ZO3 H;  5JBC S;  4ASH A;  2OIN A;  2IN2 A;  1GMD G;  4GPG A;  2Y7Z A;  1SLW B;  3HPT B;  5L30 H;  5EGM A;  1EX3 A;  2A7C A;  1COW D;  1ACB E;  1OWH A;  1T4V H;  1YY3 A;  5DP9 A;  1Y3X A;  1O35 A;  1O3H A;  4R0I A;  4TT3 D;  3URC A;  3E91 A;  1TMT H;  1HAY B;  3GIC B;  2OBO A;  2F3C E;  1P01 A;  2HVX A;  1KXE A;  1HAO H;  1V2O T;  3DSG A;  4NIY A;  5E8E H;  1O3B A;  2KX4 A;  2SGP E;  1O3L A;  1P11 E;  1S0R A;  4FU8 A;  3VB7 A;  5PTP A;  2G52 A;  2P93 A;  2VWO A;  1P05 A;  1XVO A;  1DWE H;  2LPR A;  3VXF H;  4HZH A;  3CEN A;  1CSO E;  2ZF0 H;  1Z7K A;  1PPC E;  3GY8 A;  1C5P A;  1GJ9 B;  3QX5 H;  1W3C A;  2EST E;  1YLD A;  1GDN A;  1Y3Y A;  3GY2 A;  2ZTZ A;  1YPG H;  2FOA A;  1UCY H;  1DAN H;  1SC8 U;  2ZFS A;  5FBE A;  5JYI A;  2TIO A;  5HYO A;  1OOK B;  1TON A;  1ELC A;  1EQ9 A;  2NU1 E;  4Y8Y A;  1MH0 A;  2PUQ H;  4X2X A;  1EZX C;  4WME A;  1TPS A;  3UUZ A;  1NRN H;  4YT7 H;  1ZTL A;  3R0F A;  2UUY A;  1AUJ A;  2P94 A;  2Y5H A;  2CN0 H;  4MTB A;  2QIQ A;  1BRU P;  1OWJ A;  2FI5 E;  3A83 A;  4A7I B;  2BVR H;  1YLN A;  1W0Y H;  1QHR B;  4DIH H;  1MCT A;  4RT1 A;  1PPF E;  3MU1 A;  2GKV E;  1MAX A;  1P02 A;  4CBO A;  3WWF A;  3SJK A;  2KR7 A;  2AER H;  1OX1 A;  1SVP A;  1OYT H;  1FAK H;  3FP6 E;  2VIO A;  1A7S A;  1MKX K;  1SGE E;  4ACB A;  5C1X A;  1PYT D;  2A45 B;  3TH4 H;  1ZYO A;  1UJ1 A;  2GVF A;  5B6O A;  3SUD A;  2F9V A;  2FTL E;  3NKK A;  2BDY A;  2ZFF H;  4RSP A;  1B0F A;  4AZ2 B;  4ZKS U;  5DJ7 A;  2HLC A;  2BOH B;  2GTB A;  1W0K D;  3ZVA A;  1F92 A;  2P3F H;  4RN6 A;  1KY9 A;  3RM0 H;  3MQK C;  1UTQ A;  4TSF D;  4M9F A;  4CRG A;  5EW2 H;  1A0L A;  4JK5 A;  4WMF A;  4DGJ A;  1B0E A;  4DVA U;  4DJZ B;  3QUM P;  3KGP A;  3LJO A;  1O34 A;  3HKI B;  5EG4 A;  2I6S A;  4X6O A;  1TLD A;  1ZMJ A;  1DFP A;  2G5V A;  1TNG A;  4FET A;  1QA0 A;  3TU7 H;  3A85 A;  3GDV A;  1GCT C;  7GCH G;  4UE7 H;  1SI5 H;  3FZZ A;  1S6H A;  2O8T A;  1QJ1 B;  4FVD A;  2HNT C;  1YM0 A;  5T6F A;  1B5G H;  1O2M A;  1V2K T;  1UW7 A;  1WBG B;  4FUD A;  4WH8 A;  3VB6 A;  4Z0K A;  1HXF H;  1LPK B;  1C5O H;  1C5M D;  2XND D;  2LEL A;  2VID A;  1QTF A;  3F9G A;  2OP9 A;  1O3G A;  4AOR A;  2GDD A;  4ABJ A;  2QY0 B;  3URE A;  4XD7 D;  1QR3 E;  2AHM E;  4TYD A;  1TPA E;  2CK3 D;  5J4Q A;  1C2E A;  2FES H;  2G00 A;  3VEQ B;  1G2M A;  4O9V A;  4XFQ A;  3PYH A;  5T1V A;  4MPV A;  5FCR A;  1LVO A;  1MU8 B;  1SKY E;  1ELF A;  1FXY A;  4INK A;  5LPF A;  1LQD B;  3ENS B;  1YCP K;  1RD3 B;  1C2L A;  2VJ1 A;  2ZHW H;  1MKW K;  1H8I H;  1CGJ E;  2BLO A;  1P2I A;  2W26 A;  1UTJ A;  3RXH A;  4NZQ A;  1IAU A;  3A8D A;  3MU5 A;  2ZGH A;  2KZ4 A;  3RMN H;  6CHA C;  3P8N A;  1BTZ A;  1SSX A;  1G36 A;  1CGH A;  3M3V A;  1O2P A;  2Y5G A;  1C5Z B;  2C93 B;  4HFP B;  1VGC B;  1E0F D;  2A0Q B;  4DG4 A;  3BEF B;  2AFQ B;  1RS0 A;  4LXB H;  1H9H E;  5CMX H;  3OE7 D;  4CRC A;  1DXP A;  2NU4 E;  2V3H H;  3MTY A;  1QIX B;  4FU7 A;  5DP3 A;  2ZDA H;  1W10 U;  1FON A;  3C1K A;  4AFZ A;  1YPM H;  1C1W H;  1O36 A;  1D3D B;  3K9X B;  5BRR E;  2VIQ A;  1BMA A;  1TFX A;  1AWF H;  5FL7 D;  4NWK A;  3AW0 A;  5C3N A;  4DT7 B;  3TJU A;  2A4G A;  2ZFR H;  4MNX A;  5FXL A;  1W12 U;  1L0Z A;  3MMG A;  2QGR A;  5E0G A;  1CA0 B;  1NPM A;  2FO9 A;  5I46 H;  1TA2 A;  4IMZ A;  4OM9 A;  1QJ7 B;  1IQG A;  3MI4 A;  5FHT A;  3SHC H;  1EAX A;  1O3I A;  2UUK B;  2GMT C;  5B6L A;  3UY9 A;  2Q6G A;  1EAS A;  8EST E;  3FP7 E;  1GJ6 A;  1UHB A;  4IW4 E;  1TGN A;  1A4W H;  4TY7 A;  1J14 A;  1TAW A;  6GCH G;  2HPQ H;  2NU3 E;  4NIX A;  4Q4L A;  3EST A;  1ID5 H;  2ZCH P;  3A80 A;  3ZZ9 A;  2GMT B;  3AW1 A;  1K1J A;  2AYW A;  3GYL B;  3K6Y A;  2H6M A;  2VVU A;  2J38 A;  1NFW A;  2AMP A;  1THP B;  4K1S A;  3LON A;  1C2F A;  3Q3Y A;  3TK6 A;  4H6S B;  1AB9 B;  3SUG A;  2QF0 A;  3ATK A;  3SJ9 A;  2FDA A;  3U28 C;  4FXG H;  1Y59 T;  4Y7A A;  1E37 B;  2K1Q A;  1HV7 A;  1FY3 A;  4X8S H;  3RXQ A;  1BA8 B;  2UWL A;  2H9H A;  1OWE A;  4Y8X A;  2VIP A;  2BLQ A;  1LO6 A;  3M5L A;  4MNV A;  1DS2 E;  2AIQ A;  2QC2 A;  1WCZ A;  1DWB H;  4ZRO A;  1LPG B;  1RTL A;  2CHA B;  5FAH A;  4K5Z A;  2VH0 A;  1J16 A;  2BY7 X;  3QK1 A;  1PFX C;  4B71 A;  1KYN A;  1D9I A;  5C0T A;  4DOQ A;  1SLX B;  4LOY H;  5LH8 A;  1H8D H;  3PTN A;  1YKT A;  2EQN A;  2P8O B;  4EST E;  3O8D A;  1OYQ A;  4FUH A;  2O8L A;  5ABW A;  2FOG A;  1NU9 A;  1QL9 A;  5DPA A;  1VCQ A;  1CU1 A;  5EXM A;  4I86 A;  1ZHR A;  4B74 A;  1FY8 E;  2H9T H;  2OTV A;  3RML H;  3PM3 A;  1O2O A;  1K0H A;  1AFQ B;  3ZIA D;  2YMS D;  3F0O A;  3PWB A;  1KIG H;  3BTQ E;  4JK6 A;  4WY3 A;  1TIO A;  1GHZ A;  1XX9 A;  5IK2 D;  1C5T A;  1TB6 H;  1O2Y A;  3MNS A;  1HLT H;  2OBQ A;  4AYY B;  2KCP A;  5EOK A;  1NTP A;  4BTU B;  3SU0 A;  4AGK A;  1CA8 B;  5A0B A;  2ZGC A;  1S84 A;  1N1L A;  2F4L A;  3ZZ3 A;  5EPN A;  5J4S A;  1F5R A;  5JB8 S;  1TNL A;  1XUG A;  3B23 B;  3RXG A;  5C20 A;  2KAI A;  3CS7 A;  4ASU D;  2Y7X A;  3KEE A;  4H42 U;  5EXN A;  4CRD A;  2GT8 A;  1A46 H;  3NZI A;  1VCW A;  2VB0 A;  3GCH B;  3AK5 A;  2Z94 A;  1FPC H;  1SHY A;  3JZ2 B;  4X1S U;  4YOJ A;  1P03 A;  3S9C A;  1HJ8 A;  2BVS H;  2TBS A;  4B75 A;  1DPO A;  3P8G A;  4M7G A;  1THR H;  4GVU A;  1ESA A;  4FUG A;  1O30 A;  1UTP A;  1QGF A;  3G01 A;  4ZKN U;  2IPQ X;  5EJL A;  1ZSL A;  4Q80 A;  1WDI A;  1ELB A;  4JZF H;  2ZEB A;  3F9E A;  1O2G H;  3LIW A;  1AND A;  5TCA A;  1BIT A;  1HAH H;  2ALV A;  4FVB A;  2ASU B;  2A2X H;  1T7C A;  3F2G A;  3QZR A;  1O2V A;  1TRM A;  1AVW A;  1P8V C;  4X1N U;  1FY4 A;  5KEC A;  1RIW C;  3UFA A;  2Y81 A;  3ZZ8 A;  3LOX A;  3L6P A;  5I25 A;  1C2D A;  3IIT A;  4F49 A;  4NSV A;  3BN9 A;  7EST E;  2BDG A;  3ZVD A;  4AYV B;  1WAY B;  1EZQ A;  2OUA A;  4DII H;  2WZQ A;  1EAT A;  1ZML A;  3GYM A;  1D6R A;  2W7U A;  5GND A;  1ZOM A;  1T4U H;  4ZUH A;  1TGT A;  2SGE E;  1IQL A;  2ZWL H;  3CNR A;  1V2U T;  1JRS A;  1ABJ H;  3LDX H;  2JET C;  2WPI S;  3GOV B;  3L3T A;  5HIY A;  1J9C H;  1G2L A;  1GI5 A;  2XBW A;  3BSQ A;  4LK4 A;  5DG6 A;  2PV9 B;  2BLV A;  1GWA A;  3RU4 D;  1NRS H;  3VB3 A;  1EAW A;  2AMD A;  1V2V T;  3N99 A;  1UHB B;  5GWZ A;  2BD4 A;  1C5Y B;  3M61 U;  3T2N A;  2C8Y B;  3UPE A;  1QNJ A;  1E38 B;  1EOJ A;  2J92 A;  4AC9 A;  5JBT A;  2BX3 A;  4BAM B;  4AFU A;  1XUJ A;  3MYW A;  1O3K A;  4Q63 A;  1LMW B;  1IQI A;  3DCL A;  1MZD A;  1V2T T;  3DFJ A;  1F7Z A;  3IWM A;  1DSU A;  1TAB E;  1W11 U;  3EE0 B;  2Y82 A;  3Q00 A;  2Z9J A;  1K22 H;  2PUX B;  2G5N A;  3RU4 E;  1S5S A;  2ZQ2 A;  1WXR A;  1O2J A;  2UUF B;  1FLE E;  4I8G A;  7KME H;  2XC4 A;  2C8Z B;  3GY6 A;  4FUC A;  1SGF A;  1JIM A;  1TPO A;  3TK9 A;  4BOH A;  1Z71 A;  4B73 A;  1CO7 E;  2BD7 A;  1HRT H;  1O2S A;  2A7H A;  4AN7 A;  2FOB A;  3EAJ A;  3SJO A;  3A7X A;  2G55 A;  3RXF A;  3RXO A;  3SGQ E;  2QF5 A;  2FEQ H;  3UOP A;  1EPT B;  2EY4 C;  4UFG H;  1BMF D;  5C1Y A;  5LGO A;  3V0X A;  2C8X B;  2SNW A;  2BB4 A;  2VIV A;  2BD8 A;  4DUR A;  2CXV A;  1C1T A;  2NU0 E;  1F0S A;  4UD9 H;  1FUJ A;  1V2Q T;  3SU3 A;  1HAX B;  1QL7 A;  2J98 B;  3PV4 A;  1BBR E;  1TX7 A;  1NZQ H;  1GI2 A;  1ZRB A;  5EQS A;  2JH5 D;  3TNT A;  1O2Z A;  3DD2 H;  2XYA A;  1SQA A;  2XWB I;  3OSY A;  1C5Q A;  4Y6D A;  4KEL A;  2R0L A;  2HLD D;  4X1P U;  1CE5 A;  3U8O H;  1BUI A;  3A84 A;  2W7S A;  2EA3 A;  2XC5 A;  1O2I A;  1VR1 H;  3F2H A;  2ZP0 H;  1GL0 E;  1IHS H;  2SGD E;  4FUI A;  3OU0 A;  1HAI H;  2CGA A;  2ULL A;  1W8B H;  1MD8 A;  3PLP A;  4ZAE A;  2ANM H;  2B5T B;  3RXE A;  1EJN A;  1PQ5 A;  1EAU A;  3STI A;  1EKB B;  1B7X B;  2BXU H;  2Z9L A;  1YF4 A;  3LH1 A;  2VIN A;  1P10 A;  4X2V A;  1NN6 A;  1Y5U T;  3LGY A;  2ZCL P;  3SGA E;  4K1E A;  4XDE A;  1GBM A;  3PLB A;  4FUJ A;  1NRP H;  3S9A A;  1K1L A;  3RLW H;  1O2W A;  3B8J A;  4WWY A;  1T32 A;  1V2P T;  3EA7 A;  4XOJ A;  3SU6 A;  1PQ7 A;  3ATM A;  1BBR K;  1TNK A;  3UR9 A;  4MPW A;  2R3U A;  2B8O H;  3U1I B;  2XBV A;  4OS6 A;  4Y8Z A;  3KQD A;  1EJA A;  1ARC A;  2QAA A;  3D62 A;  4CRB A;  1UK2 A;  4DW2 U;  2STA E;  1YCP M;  1P09 A;  4DT4 A;  2ZHD A;  4BAK B;  5E0H A;  1A0J A;  1DST A;  1OKX A;  3PMJ A;  3RXC A;  4GSO A;  1YWU A;  3ZYE A;  1YPH E;  1EB2 A;  1E36 B;  1MTN C;  1N6X A;  2J9N A;  1JXP A;  1P04 A;  2VWL A;  4KTS A;  5DO4 H;  3UQO A;  2ZGJ A;  2A4Q A;  1LTO A;  1SGT A;  2XCN A;  3UNS A;  1SQO A;  3ATI A;  3HK6 B;  2TGP Z;  1QY6 A;  2WPD D;  4ISO A;  4B6F A;  2ZU3 A;  2ZU2 A;  1KTS B;  3SV8 A;  1YPJ H;  2ZU1 A;  1O2K A;  5EQQ A;  2TGA A;  1TPP A;  3A8A A;  4CR9 A;  2FS8 A;  2A2Q H;  1SOT A;  1MKX H;  1UCY E;  2D2D A;  1SLV B;  3UOU A;  4IBL H;  2F91 A;  1A3E H;  4JYV H;  2F9O A;  1TQ0 B;  3A88 A;  2EC9 H;  2VVV A;  2ODY B;  3DSP A;  1HCG A;  2PGQ B;  5EIY A;  3K6Z A;  3TGK E;  2P3T B;  3RUO A;  3S7H B;  1X7A C;  1MU6 B;  1UTK A;  2YNB A;  1A5G H;  1ZJK A;  5AF9 H;  2ZPR A;  3AAS A;  2G4T A;  2XCF A;  4UFF H;  1YPH C;  1OP0 A;  1C5X B;  1UTO A;  3LGT A;  3P17 H;  1BIO A;  1C1N A;  3M35 A;  1T8O A;  2FI3 E;  1F2S E;  3GS9 A;  3MH4 A;  1QBO A;  1AVX A;  3ITI A;  1DXW A;  3U69 H;  3H09 A;  5EQR A;  3FKS D;  5KED A;  5EJ1 A;  1LHE H;  2ZKS A;  1AQ7 A;  2K8I A;  1DE7 H;  1Y3W A;  4TWY A;  2W3K A;  3GCT F;  1D4P B;  1PPE E;  2BXT H;  3STJ A;  4ZKR U;  1UTN A;  1LVY A;  1TRY A;  1Y3V A;  5A09 A;  3V13 A;  3F68 H;  4NCY A;  2ILN A;  3KYF A;  1QUR H;  4NA8 A;  3T29 A;  4X1Q U;  4YM9 A;  1DLE A;  1DWC H;  2AGI X;  3SU4 A;  1EB1 H;  3N7O A;  3QGJ A;  1PQA A;  1UCY K;  3LJJ A;  1MD7 A;  2VGC C;  1O32 A;  1H9L B;  1VKY A;  1SHH B;  3NWU A;  5BPE A;  1SL3 A;  1UVU H;  2DE8 A;  4U30 A;  1GJ4 H;  4GCH F;  1NO9 H;  4D8N A;  4F4O C;  3GY4 A;  3I29 A;  1NRR H;  2BMG B;  1T31 A;  3A7Z A;  2VGC B;  1NS3 A;  1AU8 A;  3KQE A;  4CRF A;  3RMM H;  2BOK A;  2HGT H;  2HOB A;  2AGG X;  2BQ7 B;  5LPE A;  3A87 A;  2FIR H;  2ALP A;  1XUH A;  2FX4 A;  1IQE A;  1GI1 A;  3RMO H;  3T5F H;  3DUX H;  3V7T A;  2OLG A;  1GCT B;  3SI3 H;  1GHB F;  1HIA A;  2J95 A;  2HNT F;  5GPI B;  1CBW C;  3ZVE A;  3TGJ E;  1GBK A;  2JH0 D;  1O31 A;  2DUC A;  3TH3 H;  1GHX H;  1GI8 B;  4CBN A;  1Z8G A;  4I8L A;  4NWL A;  3SV7 A;  3VPK A;  1EOL A;  2ANY A;  2ZEC A;  5DP5 A;  3KID U;  1K28 D;  2QXH A;  1OP2 A;  4TPY A;  3KNX A;  1ZHM A;  2H5D A;  1A0H B;  4YT6 H;  4QT8 C;  1W0Z U;  2ODQ A;  1PYT C;  2XW9 A;  2ZQ1 A;  4X8T H;  4XBB A;  3ZVB A;  2IJD 1;  5LPR A;  3URD A;  3M5N A;  1PPG E;  4NGA H;  1C1R A;  1O3F A;  1KLJ H;  1XVM A;  1G3C A;  1UVO A;  4BXS A;  2QXG A;  4Z1M D;  1NC6 A;  1PQ8 A;  3MFJ A;  1A61 H;  2WYG A;  1FI8 A;  1IQJ A;  1MTV A;  1MQ6 A;  1E1Q D;  1P2M A;  1O38 A;  4GHQ A;  1NRQ H;  5L2Z H;  1K21 H;  3NXP A;  4NIV A;  1RTK A;  3B9F H;  1C2J A;  3TIT A;  1HUT H;  2V35 A;  1LVM A; 
#chains in the Genus database with same CATH homology
 4WH6 A;  3ZIA D;  1H8E D;  2GGV B;  2YMS D;  2OBO A;  3SUF A;  3SV9 A;  3F0O A;  3N99 A;  3F2F A;  2QF4 A;  1EFR D;  1MAB B;  1NBM D;  4NWK A;  5FL7 D;  3O8R A;  1BT7 A;  3F3B A;  5IK2 D;  1H8H D;  3FO8 D;  5GJ4 B;  3SU4 A;  2A4G A;  4FET A;  3M5M A;  3SU6 A;  2OBQ A;  5C0U A;  2KCP A;  2OC0 A;  2YOL A;  3M5O A;  3OFN D;  2WSS D;  2O8M A;  3E90 B;  3OYP A;  3P8O A;  3U1I B;  4I31 A;  3WW7 A;  3O8B A;  3RC6 A;  1A1R A;  2IJO B;  3SV6 A;  3SU0 A;  3DSO A;  4Q63 A;  4OM9 A;  1OHH D;  1N1L A;  2F4L A;  1S6L A;  5EPN A;  3DCL A;  2OC7 A;  1KMH B;  1W3C A;  1RGQ A;  1FX0 B;  5B6L A;  2XOK D;  4KTC A;  5H4I B;  3OEH D;  4WH8 A;  5FPY A;  4I33 A;  4ASU D;  2K0Q A;  2XND D;  3KEE A;  2LEL A;  1DY8 A;  3PV2 A;  4F55 A;  3SZE A;  1NS3 A;  5ETX A;  5CDF E;  4DT4 A;  1WXR A;  3AK5 A;  4Q4L A;  1E79 D;  3OTP A;  1NBM E;  2YMS B;  2VBC A;  5EPY A;  4XD7 D;  2AHM E;  4TYD A;  2OK5 A;  4B75 A;  2KM0 A;  2CK3 D;  4B73 A;  4A92 A;  3RC5 A;  2P59 A;  1JXP A;  2W6J D;  3PV5 A;  5IDK A;  4K8B A;  3LON A;  2A4Q A;  2KCY A;  2FP7 B;  2QF5 A;  2XCN A;  5T1V A;  2OC1 A;  2KCA A;  2WHX A;  2WPD D;  3W1E A;  3SUG A;  1BMF D;  2OC8 A;  4B6F A;  4A1X A;  1SKY E;  5DN6 D;  3SV8 A;  2JJ1 D;  3NRL A;  1W0J D;  2JIZ D;  2V7Q D;  1DY9 A;  2W6I D;  5EQQ A;  5GPI B;  2K1Q A;  3SU3 A;  4B6E A;  4U01 A;  3SU1 A;  4B76 A;  4NWL A;  3OAA D;  3SV7 A;  5EQS A;  3EYD A;  5ESB A;  3SU2 A;  4A1V A;  3UB0 A;  2WV9 A;  3SU5 A;  2KFW A;  3F2G A;  4WF8 A;  5C17 A;  5FPT A;  3WWF A;  2FOM B;  3SUE A;  2KR7 A;  2FM2 A;  2HLD D;  3M5L A;  2M2A A;  3OEE D;  3KNX A;  3DSP A;  2QE7 D;  2A4R A;  5F53 A;  5CHB A;  2JJ2 D;  3KF2 A;  2F9U A;  3L6P A;  3LOX A;  3WWB A;  2L6O A;  4R8T B;  3F0P A;  2IJD 1;  1E1R D;  1RTL A;  5FPS A;  4YXW D;  3N7E A;  3FOA A;  3M5N A;  3O8C A;  4A1T A;  2KZ4 A;  5DSF A;  3F2H A;  2GVF A;  3VG8 A;  2XCF A;  2WZQ A;  3P8N A;  4B71 A;  4Z1M D;  3SUD A;  5C0T A;  3LKW A;  5GND A;  4I32 A;  3PRD A;  2JDI D;  2F9V A;  1E1Q D;  2J5U A;  2OIN A;  2QV1 A;  3O8D A;  5HKK D;  3U1J B;  3GS9 A;  3N7D A;  4RI0 A;  1DXW A;  3FN8 A;  3PRB A;  3H09 A;  5EQR A;  1W0K D;  3FKS D;  4ZCN A;  3KN2 A;  3SYJ A;  1COW D;  3OE7 D;  2KCO A;  1CU1 A;  3RC4 A;  2K8I A;  1DXP A;  4JMY A;  2F43 B;  2XNI A;  4TT3 D;  2YMS C;  4B74 A;  4TSF D;  4M9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...