3NRLA

Crystal structure of protein rumgna_01417 from ruminococcus gnavus, northeast structural genomics consortium target ugr76
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVKDVWVPVRIEMGDDWYLVGLNVSRLDGLRVRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target UgR76
rcsb
molecule keywords uncharacterized protein RUMGNA_01417
molecule tags Structural genomics, unknown function
source organism Ruminococcus gnavus
total genus 12
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17295 DUF5348 Domain of unknown function (DUF5348)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.390 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3nrlA00
3NRLA
chains in the Genus database with same CATH superfamily
3SZEA 2Q6FA 3KQCA 2XBXA 3GY8A 1MMJN 3MWIU 4U32A 1UMAH 3BG8A 1KMHB 1OKXA 2WPHS 4ABDA 1DE7H 4RT0A 4D8NA 5EU8A 4WH6A 1EPTA 1TONA 3NWUA 3QGJA 3S7KB 2Z3EA 7GCHG 4Y8ZA 1FLEE 2FYQA 1OHHD 2J5UA 2DUCA 2ZU4A 1W13U 4ABIA 2WINI 5F6MA 1PFXC 2TGAA 1IQFA 5EG4A 1DY8A 3PYHA 2SNWA 4AG2A 1UO6A 1A1RA 1FN8A 2TBSA 1FY4A 2STBE 1HGTH 3SNBA 1KSNA 3R3GB 1FNIA 3K6YA 2W3IA 2V35A 5DP5A 2DE8A 2ZKSA 1OWIA 2BDYA 2ZU5A 4DIHH 2A7HA 1LVBA 1G3EA 4WXVA 1UTNA 4IC6A 1A5IA 1O2IA 1O3JA 2C8XB 3SU1A 2J4IA 1KDQA 2AS9A 2AGEX 4Q63A 3B9FH 4JMYA 1ZMJA 2C93B 2QF3A 2I6SA 3U8TH 3EA9A 3SUEA 1LMWB 3URCA 2G8TA 3E0NB 1V2LT 3SQEE 1F5KU 1O2WA 1YKTA 2VIVA 2FODA 1ZSLA 1LKAA 5C67A 1SGCA 4Z6AH 1E34B 1O32A 3H09A 2HPQH 3VEQB 5DP6A 3M3VA 1JMOH 2UUFB 1RTLA 1KLTA 4ZHLU 2SGQE 1AVWA 2UUJB 1CT0E 5EXNA 1LPZB 4BOHA 2Y7XA 3A86A 2AGGX 1HNEE 1P3CA 1SQRA 4K1TA 5FBEA 2CF9H 3S9CA 1VGCC 1CBWC 1SGPE 3RXBA 2JH0D 2BOHB 1CU1A 5EJLA 2QF5A 1QFKH 4CREA 1SGIB 2OBQA 1RXPA 2TRMA 1UCYE 1V6DA 1E1QD 4H42U 3A8CA 2IPHA 3SU6A 3UQOA 5GPIB 1C2GA 1ZLRA 4I33A 5LGOA 3OTJE 1EP5A 2ODYB 3UNSA 1QJ6B 1GJ8B 2AHME 2EI8A 4MPXA 4XFQA 1H9LB 1HB0B 2KCAA 1P2OA 2HALA 2F3CE 1GMCG 3EDXB 4X6NA 3M37A 3TNTA 5FAHA 3UIRA 1YF4A 1YYY1 2OBOA 5JBBS 4CBOA 2RDEA 2ZQ2A 1UTQA 1N6YA 2FWWA 2PW8H 3UB0A 3RXEA 3PTNA 4XRNA 5C1UA 2OK5A 1S0RA 2ZTZA 4NZLA 3NUMA 4K3JA 2NU3E 3A7WA 2KZ4A 1BDAA 2Z6BD 4A5TS 1HFDA 1VKYA 2C8YB 2V3MA 3VB5A 5I25A 3MNSA 2AYWA 1W11U 1YPGH 1T32A 3SYJA 1ZHPA 3GY6A 3SJ9A 5ESTE 1NU9A 1YLNA 1P06A 1WDIA 3MO6A 2BM2A 1ETSH 2YMSD 4BTUB 1W12U 1HIAB 4Q7ZA 1F0TA 5E8EH 1DOJA 4X1SU 3WW7A 1O3PB 1BMFD 4K69A 1MQ5A 1SLXB 3UQVA 2HOBA 2VIPA 3S0NA 1S5SA 2OP9A 4LZ4B 1AE8H 2A7CA 1SOZA 4JCNA 3SNEA 2SFAA 2ZIQH 3FN8A 1H4WA 2ZFQH 2BB4A 2ZF0H 1S85A 3U1JB 3PLKA 4ISNA 5C5OA 2P8OB 2C8WB 1C5MD 1PQAA 2Z9GA 1GHYH 3SUGA 1RTKA 1T8MA 2ZU3A 2ANMH 2ZDNA 1FIZA 4FUJA 1O39A 3LT3A 4U2WA 1IQLA 3RM0H 3RXFA 2F91A 4AFZA 5AF9H 1O2VA 2A5IA 3BIUH 3FZDA 3DUXH 1UTJA 3TVJB 1UTLM 1AE5A 3GCHB 3U8RH 2GDEH 3ZZAA 2V6NA 1J14A 2LPRA 1OS8A 3MFJA 1ELEE 1GGDB 1S81A 4FU8A 2A2XH 2PTCE 5E0HA 4ZKOU 2R9PA 1BCUH 5JBAS 1BHXF 5L2YH 2OQ5A 2VGCC 4HGCA 3FP6E 4DJZB 3F1SB 2R0KA 2IJOB 1G9IE 1SGYE 1C1SA 2O8WA 3RLYH 1QJ7B 1FIWA 1F0RA 1O2GH 5HIZA 1TOMH 2ZGBH 3S9BA 3QUMP 2C8ZB 4I8GA 1BOQA 1FAKH 1H1BA 2TGTA 1J15A 1AWHB 2PUXB 2A4QA 2FS9A 3RXOA 1BTXA 2QV1A 1BIOA 1NESE 4YTAA 3M5LA 3SV9A 5F8XA 3KEEA 1P11E 2O9QA 3F6UH 4NA7A 3RXHA 5C0UA 4K8YA 3O8RA 3AAVA 3MI4A 2BY7X 4IC5A 2A5KA 4TYDA 2AEIH 2H9HA 1YWUA 1K21H 2IJD1 3PMAB 4E7RG 4K8BA 2QIQA 1A5HA 1GJ9B 2GP9B 1C2FA 2BZ6H 1NFXA 2GKVE 1EB1H 3EE7A 3CENA 2AMPA 4D7GA 3BF6H 3CS7A 1ZTJA 4A6LA 1BTYA 1O36A 3T26A 1O0DH 1XUHA 1P04A 1Y5AT 5K0HA 4RKJB 1ARCA 3RXMA 3S69A 1K1LA 1HAGE 1ZTKA 1MAYA 3PRBA 3RXAA 1O2LA 4XBCA 1O33A 4GPGA 3UR6A 1TNIA 5EW2H 1XXFA 1TB6H 1W0KD 5E2PA 1V2WT 3MTYA 1CQQA 1DWDH 1H8ED 5T6DA 1GVKB 3N7DA 4ZHAA 1D9IA 3T25A 3C1KA 1GG6B 3QTVH 1C5NH 1HAVA 5GCHG 4DW2U 1UVSH 3SW2B 1GBHA 3JZ2B 1UVTH 1G37A 1DLEA 3SV7A 1TA6A 2HNTE 5HIYA 5DN6D 4BNRA 4JK6A 4WF8A 2AMDA 3MHWU 2HNTF 3EE0B 5EJ1A 5EGMA 2FS8A 2PKAB 3F9EA 1DUEA 1ZRBA 1BZXE 4VGCB 2O8LA 3VB7A 5EW1H 3CP7A 2ZZUH 3FP7E 1ELVA 4GSOA 1V2KT 2ALPA 2PP6A 1XUFA 3L3TA 1C5LH 1WYKA 5GIBA 4ZKSU 3LH1A 2VWNA 4ZUHA 1KXCA 1FZZA 5EIYA 1GJDB 1FAXA 1ID5H 2VWLA 1JIMA 2V3HH 4Y0YE 2F9OA 5I46H 2RG3A 4U30A 1AKSB 1QGFA 3WWBA 4OGYA 1FY5A 2ZO3H 5SGAE 1XMNB 2VWMA 3RXLA 1ZTLA 1AFQB 1O3DA 2FYRA 2GCTC 4ZMAH 3PV2A 2K0QA 5EPYA 1GVLA 5B6OA 2ZPRA 2PHBA 2CHAB 2ZDVH 1S6HA 4MPVA 2BHGA 1LHFH 4WMEA 4IMQA 3Q3XA 4XE4A 1TX7A 1DWEH 1QRZA 1LVOA 3KQBA 1N8OC 1FJSA 1NPMA 3LC3A 3NRLA 1MU6B 4RI0A 3SN8A 5GXPA 2ZFPH 1O3EA 3BG4C 4I8KA 5EXLA 2WUCA 1ANCA 1ZGVA 5FPTA 3LGWA 3LGVA 3UREA 2ZCKP 5GDSH 4YOGA 2D1JA 2QXIA 1J9CH 1DY9A 4H4FA 5JDUB 2ZDLA 2PV9B 1ABIH 5FXLA 1GVZA 1RGQA 2HNTC 3SORA 1XX9A 1BRBE 1DUAA 3E6PH 2YMSB 3DT0H 1C4V2 4YLQH 3SUDA 1OYQA 2Y7ZA 1NC6A 2ZG0H 6CHAC 1O2JA 2O8UA 3RXVA 4AZ2B 4B76A 2H5CA 3TGIE 2Y5GA 3ZVAA 4MQAA 2J97A 2WYJA 5C0TA 1N1LA 1IHTH 1O2UA 5CDFE 1M9UA 1TMUH 1KXBA 3Q3YA 3TITA 3GYMA 3KYFA 3LGUA 2AIPA 1HYLA 2JDID 3SV2H 1EKBB 1IHSH 1A46H 2BVSH 1SQOA 1DS2E 3CNRA 5CE1A 1KY9A 1COWD 1LQEA 1O5FH 3KQEA 4X6PA 1TPPA 5C17A 2A0QB 1T8OA 2FTLE 2BQ6B 1O2YA 2ZEBA 3ODFA 2LELA 3ITIA 1Q2WA 2FI3E 1SLVB 3BN9A 4X2XA 1P0SH 3VB4A 3QZQA 1AGJA 1AUJA 1C2EA 1DITH 1ACBE 4GCHF 2F4LA 3OY6U 2KAIA 3E1XB 1IQGA 3EYDA 1IQNA 1VJ9U 2L74A 3FP8E 2FZZA 1C1WH 3N7OA 1AI8H 1AUTC 1GJ6A 4UONA 2CMYA 3HK6B 3MNBA 1OWJA 1EB2A 3V7TA 1HJ9A 4BAHB 2QGRA 3QX5H 1B7XB 3BTDE 2Z9LA 3BTWE 3E8LA 2ZGJA 3KL6A 1EPTB 3QDZB 1K1JA 1QZ8A 4THNH 1JXPA 2J2UA 5DGJA 1GBLA 4XBBA 4IW4E 4KKDA 1F92A 2ODPA 2EY4C 1SFQB 3H7TA 3RXUA 3PWCA 4X1PU 2F9UA 1GMHF 1K28D 1Z6JH 4ZH8A 5J4SA 3TPIZ 1YLDA 1HCGA 1HLTH 3NCLA 4UDWH 1O2HA 2OC8A 1O2OA 2M5TA 4YZUA 1GCTC 3RDZA 4BAMB 2D8WA 2ZHDA 3GY3A 2H5DA 4MTBA 1W10U 1TBQH 1PPBH 1THSH 4FUDA 2ZPQA 3AW1A 1ZHMA 1MTSA 1W2KH 5DP3A 4OS6A 1IQEA 2JETC 1KTSB 1QB1A 1KDQB 3IITA 1FX0B 1V2OT 4LXBH 1KLJH 4B2CA 2FOHA 2VIWA 3E0PB 5H4IB 3SU3A 5FCKA 1WUNH 4FUFA 1TRYA 1EUFA 1WXRA 4TSFD 2F9PA 1GBIA 3ESTA 2JJ1D 2STAE 4B6EA 1IOEA 3UTUH 1MQ6A 1TNLA 4NSYA 3UY9A 2O8MA 2EI7A 5F53A 1TGCA 2EI6A 1BA8B 2ANKH 5HMAA 2ZP0H 2PGBB 4Y71A 1GI9B 2YNAA 1VITH 2VVVA 5TCAA 5C1XA 3P70B 2XXLA 1L1GA 1K1IA 3BEUA 3NK8A 2FTMA 1CGJE 1QL7A 1GBFA 1AVXA 1QY6A 1ZHRA 2HVYB 1TQ7B 2VVUA 1L4DA 4ABGA 1CE5A 4AFUA 1YPJH 4IBLH 2V0BA 1TMTH 1NBME 1QL9A 2XWBI 3W1EA 4TY6A 1WOFA 1FPHH 4NFFA 1S82A 2PSYA 1WSSH 2KX4A 1RIWB 3LJJA 1TX8A 1P57B 3A89A 1UVPA 1C5VA 2Y5FA 4FVBA 3PMHB 2ULLA 2YOLA 4OM9A 1OWHA 1OSSA 1UVOA 1LKBA 1UTPA 3UOPA 5DP9A 1C5TA 2NU1E 1YPEH 2P95A 4AGKA 5FPSA 5PTPA 1CT2E 1W3CA 2P3UB 2UWPA 5T3HA 1L2EA 4D9QA 4IS5A 4J2YB 1CHOF 3ATKA 2P8OC 4MPWA 1O3FA 5J4QA 1UTOA 3A8AA 1ZSKA 2VIDA 1C2KA 2ZGCA 1A3EH 2BLQA 1PPGE 1EFRD 2J98A 3RXCA 1V2UT 4ASUD 1O5EH 3P92A 1GL1A 3PRDA 1KIGH 1HXEH 2V3OH 1AO5A 2VWOA 1IQJA 1EJNA 1EASA 3SO3A 2SNVA 1TOCB 3PMBB 3A8DA 1GGDC 1K1PA 1A3BH 1Z71A 3BTEE 1EJAA 3GISB 3ZZDA 2AMQA 4K1SA 1LHGH 2ZGHA 3GDVA 1QBNA 4YXWD 1GDNA 3UPEA 1TNGA 4RN6A 2PKSC 2Q6DA 4A1TA 2AH4X 2ZQ1A 2VU8E 2B9LA 4QT8C 1E79D 4ABEA 5A0AE 4A92A 3KGPA 3OEHD 5GWZA 1A5GH 2DE9A 2WPIS 4ISOA 3MQKC 1T31A 1RS0A 1EATA 3B23B 4M7GA 5IYTA 3TNSA 2ANWA 4MG3A 2FOFA 2PLXA 4FUBA 1MCVA 4XDEA 3SI3H 2OC0A 3S7HB 2WUBA 3M5MA 1K2I1 1C4Y2 3GDSA 1WV7H 3T27A 2GZ8A 3VGCC 3T28A 1SL3A 4IMZA 3RXQA 3SGQE 5A0CA 2JKHA 8KME2 1VITF 1MUEB 5JBTA 5FBIA 3A88A 5C1YA 3SJOA 1P05A 3RXJA 1KXDA 2BMGB 3EGKH 4DY7B 1H8HD 1XVMA 1ELTA 2L6OA 1SHHB 4AYVB 4NWLA 5E0GA 1XVOA 2WHXA 2GX4A 2ZNKH 2BD7A 3RMNH 2WV9A 2BDCA 6GCHF 3KNXA 2PR3A 1HAOH 3AW0A 1ANBA 1C5SA 1TAWA 5T6GA 4NFEA 2G55A 1O5AB 3ZVEA 2BX4A 4WWYA 1GI4A 2VVCA 2W3KA 1EZXC 4NCYA 3I78A 1P3EA 3D23A 5A2MH 1PQ7A 1P2JA 2VJ1A 1EXFA 1VR1H 1KXAA 5A8YA 3BTFE 1YY3A 3ZVDA 1L0ZA 2XBVA 2XW9A 2K1QA 5C2ZA 1PYTD 3M7QA 1EAWA 3PO1C 4FUIA 4FUCA 4B75A 1WQSA 3UAIC 1AB9C 1C2MA 2FLRH 1YPHE 1G30B 2OXSA 1EOJA 1T7CA 5L6NH 3STIA 1MZDA 2BDAA 2HWLB 1O3GA 2EC9H 5HXFA 1BMMH 3E91A 3ENSB 1FXYA 3OEED 4SGBE 3MO9A 5A8ZA 1PPFE 4ABHA 4LZ1H 1OP8A 3ZVCA 2G00A 2P16A 4Y7AA 4CH2B 4GHTA 1TNKA 1IQIA 2A32A 1MTUA 2VBCA 2ZC9H 4Q4LA 2Y81A 4I7YH 1XXDA 3FKSD 2WV4A 3ZVFA 4FOUC 1O3NA 5FCRA 4X1NU 3N7EA 1C4U2 3F9GA 4Y8YA 1F7ZA 1S6FA 1Z7KA 1QURH 3SU4A 4DURA 5F8ZA 1P2IA 3ODDA 5AFZH 3FOAA 3HGPA 1C2LA 4D7FA 5EJZA 4Y0ZE 3GCTF 4X8UH 3ZYEA 1BUIA 3K9XB 1WAYB 1G2MA 1TGSZ 1LPKB 2HPPH 1GHZA 3GS9A 1C5OH 1TQ0B 1F5LA 3I29A 1C1PA 1Z1JA 3GY7A 1RD3B 3OYPA 1GDUA 5CHAC 3P8NA 5EXMA 1HAVB 2K8IA 3BEFB 1FQ3A 1BRCE 1Y59T 3RXSA 1HJAC 4HFPB 1QQ4A 1AVGH 1C5PA 1GJCB 1P09A 1P12E 1EP6A 2CHAC 3M7UA 5IDKA 2C4FH 4UE7H 4AOQA 2W6ID 4B2BA 1P8VC 4BANB 1MKWH 5AHGH 3EAJA 5F03A 4AYYB 2ALVA 3RUOA 2LP6A 1CT4E 1K1OA 5EQRA 2A1DB 5JYIA 4X6MA 4NIWA 2GV6A 3DCLA 4ISHH 4JZFH 3ZVGA 1FI8A 1W0JD 4O97A 2Z3CA 3VXFH 2ZGXH 1HJ8A 2RA0A 2B8OH 2TGPZ 2J38A 8GCHF 4FU7A 4INLA 2BLVA 1G3DA 1YPHC 2B0FA 5FX6A 4I8HA 2GZ7A 1MD7A 1L1JA 4GCHG 1GCDA 3UNRA 4Z0KA 2J95A 1DANH 1ZPZA 2IN2A 2W7SA 2XWAA 4B74A 1C2IA 1UHBA 3TGKE 1VGCB 1W0YH 2OINA 3E3TA 3F3BA 1ZSJA 5T6FA 2YMSC 1Y3XA 3F0PA 7LPRA 1O2TA 2UWOA 1O3OA 2ZFTA 2BDHA 1D4PB 3GY4A 3GICB 3SU2A 4YOIA 1D3DB 3MU0A 2R2WU 3SNAA 1SPJA 3KQDA 4Q7YA 1H9IE 2A4RA 1HAXB 2QF4A 2B5TB 5A09A 3OE7D 3TH3H 3MU8A 4OS7A 4KTSA 4CHAB 3TGJE 1F0SA 1GBBA 1C5ZB 1NT1A 4R0IA 4X8VH 1EAUA 2FEQH 4YT7H 1AY6H 1GMHG 3FFGA 1VCWA 3PB1E 3FANA 2FI4E 1SB1H 1AQ7A 3GOVB 3Q76A 2G5VA 4YOJA 3LJOA 5BPEA 1C1QA 1SSXA 1GI7B 4Q80A 1PPZA 3SUFA 1GDQA 3STJA 1DWCH 2XBWA 4GUXA 4MPUA 5K7RA 3ZZCA 1ANDA 4ISLA 3RXRA 1ANEA 1BTWA 4CR5A 3ZZ7A 2WPDD 4CRDA 3LPRA 1T4UH 1FPCH 3DSPA 3MU4A 4B73A 3CS0A 3LKWA 5EQQA 1NM6A 2R3UA 1ZZZA 5CHBA 1RRKA 3NPSA 3SOSA 4GLYA 1YCPH 1MTNB 3A82A 2PGQB 1TLDA 2HVXA 5HM9A 1TMBH 2D2DA 1AU8A 1O2SA 3T29A 1CA0C 3ZZ4A 3U98H 2ZI2H 4ZHMU 4A7IB 1C5WB 1FY1A 1NU7B 2JH5D 1LQDB 5AFYH 3SV6A 1SGTA 1CA8B 1UK3A 4NA8A 1EAXA 4IN2A 1E36B 3MH7A 1SLUB 3QK1A 4YLUA 3BSQA 3GYLB 3I77A 1XUJA 1EPTC 1PJPA 2P93A 1EJMA 1SGEE 2GT7A 1KXFA 1E35B 1S6LA 2QXJA 1HAHH 5BRRE 2FDAA 2A5AA 2QY0B 4ABFA 2UUYA 2QF0A 1SG8B 3K2UA 1Z8GA 4AN7A 1W8BH 2EQNA 1EZSC 1O3MA 3MMGA 4F49A 3M3TA 1O2MA 3QO6A 1FONA 1BTUA 1SGDE 2SGFE 3LC5A 2WPLS 1L4ZA 1SFIA 1ZYOA 1DSUA 1HAZB 2KAIB 1UVUH 3M61U 1BQYA 1T8NA 3PLBA 1UK4A 1OWKA 2CN0H 3GY2A 3BIVH 3P8OA 3OU0A 1MKXH 1GHAF 2ZCHP 2QYIA 2FXRA 2Y6TA 4P02A 4DIIH 5LPRA 1YM0A 2VGCB 1TNJA 5DP4A 4ESTE 1GHXH 1GHWH 2Y80A 5C20A 3BTGE 1YP9A 1Z8IB 3QN7A 1LVYA 1C5QA 2JIZD 1CGHA 1L1NA 2VNTA 1CHOG 1K1MA 2CF8H 4UFGH 3OSYA 2ILNA 2FI5E 3RXKA 2FIRH 1Y3WA 1AD8H 4R8TB 3D62A 2WPMS 1P2QA 1TABE 1MAXA 2A4OA 2ZTXA 1O2PA 2XCNA 4TWWA 4Z1MD 4HTCH 3DFLA 1GJAB 4PROA 5B6LA 3MNCA 2H9EH 1ELFA 8ESTE 3DHKH 1V2QT 2XTTB 2Q6GA 1HBTH 1TBZH 2GT8A 1V2TT 2BD4A 2GTBA 2GZ9A 3MU5A 4D9RA 1P03A 2WPKS 2W5EA 2R2MB 3Q3KA 5F8TA 5EPNA 2Z94A 4Q7XA 2ZHFH 2FX4A 4MDSA 2OC1A 2IOTA 1RFNA 4MVNA 3PV4A 3D65E 3KHVA 2AERH 1GMDF 1QB6A 1QB9A 1VCPA 3M5NA 3U1IB 1G3BA 1YLCA 5FX5A 2ZFRH 1PPCE 4B1TA 3RU4D 3K65B 1QQUA 4TWYA 3GDUA 5DP7A 4INHA 3ZZ9A 3BV9B 1X7AC 1HUTH 2FESH 1VITG 4JYUH 2OUAA 4NG9H 4JZIA 1MD8A 3P8FA 1TPSA 1F0UA 3WWFA 1C5XB 1IAUA 1YC0A 1XUGA 4JZ1A 3SGBE 1TFXA 1BHXB 1Z8JB 1O5GH 1Z6EA 3BTKE 3ATIA 1IQKA 3HK3B 3TK6A 6GCHG 1BTHH 2W6JD 3IWMA 2OC7A 3TH2H 3F2GA 3TIUA 1A4WH 4DGJA 2OTVA 1E1RD 4BAKB 4RSPA 1QCPA 2G51A 2ANYA 3PWBA 3A7TA 3JZ1B 2W7UA 4O3UA 1HAYB 1P02A 4Q2KA 4GVUA 1XKBC 5TJXA 2BD3A 2WSSD 3FAOA 3ZZ6A 1S84A 1D3TB 5T1VA 1FMGA 1V2VT 2FOMB 1SGRE 4Y6DA 5TCCA 2OLGA 3QLPH 1A7SA 2ZCLP 1QA0A 3SJIA 1ELDE 1K22H 1BRAA 1RTFB 2THFB 2XOKD 3PMJA 2QN5T 2FLBH 1OXGA 3PROA 4RKOB 3SV8A 2M2AA 1XKAC 4XSKU 1K9OE 2ZPSA 1O34A 2J9NA 1ESBA 2F9NA 2A2QH 2O8TA 2FOGA 3SGAE 3ZIAD 1WU1A 3ZZ5A 2EA3A 1OPHB 1HV7A 5HYOA 4MLFB 5C5NA 4A1XA 2AIQA 2F9BH 3A8BA 2J98B 9LPRA 2ESTE 2GMTB 1NRNH 3T5FH 3Q00A 3RMMH 4B2AA 2LNCA 3L33A 3P6ZB 2HGTH 1DX5M 1ELAA 1YCPM 1D6RA 4B71A 3KQ5A 1N8OB 2ZHQH 3A7XA 4HG6A 3TJVA 2PWXA 1ORFA 4Y7BA 3VXEH 1O3IA 2J92A 4P00A 3RXTA 4NIXA 1GHVH 2VH0A 2CJIA 3BG4B 3GCTG 3LU9B 4U01A 1P9UA 1THPB 1AWFH 1YGCH 2WYGA 3TK5A 7ESTE 1O2NA 1TRNA 3ELAH 3TJOA 2BD8A 2AGIX 3SHAH 1F2SE 5HKKD 1TRMA 4CRBA 1ESAA 2QXGA 2P3FH 3EA8A 3LONA 5FL7D 1LCYA 3ZZ8A 1O2RA 3NZIA 3SU5A 3BTHE 1BITA 1O5BB 6CHAB 2R3YA 1B0EA 2ZU2A 4UFFH 1GJ4H 1LHDH 1TX6A 2G4UA 1NY22 5G4BA 1BMAA 6ESTA 1GBKA 1ZJKA 2QA9E 1XUKA 3FVFB 1INCA 1ABJH 2XNDD 4WMFA 2A31A 2GVFA 1SGQE 4AC9A 1A0LA 1BMLA 1QL8A 4UFDH 2PUQH 3RXPA 8GCHG 5C94A 2BQ7B 1NBMD 4FUGA 1UCYH 4XBDA 1JOUB 2VB0A 1PPHE 1NRPH 3A85A 4JZDH 1C2JA 2Y82A 1QBVH 1TALA 1CSOE 5DSFA 4WMDA 1FDPA 1RJXB 4KELA 1G32B 1LO6A 2VH6A 1TE0A 1V2ST 4CBNA 2XC4A 3G01A 4CR9A 1B0FA 3QTOH 1WTGH 2H9TH 1C1NA 1O5DH 1BRUP 1O2QA 1PPEE 1XM1A 2IPQX 3B8JA 3DA9B 1PQ5A 1E0FD 3GCNA 4NGAH 1H8IH 3HGNA 3OTPA 3PTBA 4H6SB 1C1OA 3GCHC 3OX7U 2TGDA 1LTOA 2OCVB 3L6PA 4BTIB 3OY5U 4HI3A 1MH0A 4YESB 1P01A 3MU1A 3RXDA 1EZUC 2BYAX 1GJBB 1MBQA 2BY6X 4BAQB 1ETTH 4FUEA 1V2NT 2C90B 1C2HA 1J17T 3V13A 1V2RT 1GHBG 3BEIB 4F55A 4YM9A 4WXIA 4BXSA 1YPMH 1QBOA 1W7GH 3UUZA 1DXWA 1G36A 4BXWA 1NRSH 2ZU1A 4XD7D 2QE7D 5LH8A 1WCZA 4X2VA 4JK5A 4NIYA 4DVAU 1AIXH 1V2PT 1BTPA 5KEDA 2NWNA 5CMXH 3F9FA 4AX9H 1TYNA 3SU0A 1BT7A 1P10A 1ZPBA 2FOBA 2BLWA 2QC2A 1NFWA 4MNVA 3TJNA 4OS1A 2VINA 2XNIA 1GCTB 3MH6A 3A7ZA 4K60A 2JETB 3ZZBA 2A4GA 4DOQA 2PSXA 1O3LA 1OWDA 2KCYA 2VIOA 2FMJA 1QRXA 4OS2A 1T4VH 1TPAE 1P2MA 3EA7A 3M36A 5JB8S 2KCOA 1MKWK 3A7VA 1O2XA 1SGNE 1JIRA 3BTME 4Y10E 3SBKA 3RC6A 1P2NA 3V12A 4IN1A 4ZAEA 3TU7H 4I32A 3KF2A 2RDLA 2Z9IA 1C1TA 4CHAC 3SZNA 3LGTA 4NWKA 4TY7A 1J8AA 1EAIA 3QWCH 3RXIA 3T2NA 1GI3A 1GBEA 1TPOA 1ELGA 2BVXH 3UFAA 1LHCH 2BDIA 1Y8TA 3RLWH 1GG6C 4INKA 1G3CA 4ZROA 1GBMA 1UHBB 1O3HA 1GHAG 4AGJA 1TNHA 2BD2A 2G4TA 4FU9A 3C27B 1NO9H 1BB0B 1DXPA 1SBWA 4BAOB 3UOUA 1FY3A 4BTTB 1GI8B 1FY8E 1C9TA 1SGFA 2ZHEH 4Y76A 3FZZA 1MTNC 4LK4A 4Y8XA 3RU4T 3TK9A 2XBYA 1AHTH 1GPZA 1SGFG 4VGCC 8LPRA 1AFEH 2HRVA 2TPIZ 3BTTE 2RFKC 1TGTA 1O37A 1MU8B 4HZHA 1PQ8A 1MBMA 1O2ZA 1DPOA 2BX3A 1KTTB 1GL0E 4DT7B 2BOKA 1S0QA 4JZEH 1EZQA 3EQ0H 1O5CB 3Q77A 5ETXA 3ATMA 2BQWB 1VCQA 4TPIZ 1C1UH 3KYGA 3S9AA 4I31A 1GJ5H 5JBCS 3GY5A 4OS5A 4X8SH 2A7JA 5L2ZH 1AN1E 2BTCE 3MH4A 2BY9X 3P95A 1VZQH 3RP2A 1AFQC 2TIOA 1C5RA 1UK2A 2GD4B 1BBRK 4CRCA 4JYVH 2GCHF 3DSGA 1Q31A 2RCEA 1CO7E 1QNJA 4OS4A 4E7NA 3O8DA 3LGYA 1GMDG 4NIVA 1H9HE 1YCPK 2Y5HA 3QZRA 3VB6A 3RC4A 1NN6A 5JPMH 1WQVH 1GBJA 2BLOA 4WVPE 2BXTH 1GBCA 4I86A 1JBUH 3MO3A 1PYTC 1SVPA 3M7TA 1FUJA 1Y3YA 4FVDA 3UWIA 2FM2A 2PKSB 4NA9H 7KMEH 1ELBA 1NS3A 1MZAA 1O2KA 1E38B 4SGAE 3ZZ3A 2NU4E 3GCOA 1A61H 2Z9JA 7GCHF 4YT6H 1NROH 1UW7A 3VPKA 1CBWB 3N99A 3VGCB 1THRH 4K1EA 1U6QA 1EQ9A 3H7OA 4F4OC 4CRGA 1GI6A 1NTPA 4ABBA 4ACAA 3U28C 4WH8A 4E05H 1BTZA 1NFYA 1C5UA 4F48B 1G2LA 4ABAA 1O3CA 4DCDA 1W14U 1TWXB 1DFPA 4E06H 1OYTH 1BJVA 2BD9A 5JB9S 1BJUA 3VG8A 4YO9A 3ZV8A 1MKXK 5L30H 1A2CH 4MNWA 1ZRKA 2XC0A 3AK5A 1HIAA 5HM2A 3F9HA 2FO9A 2PFEA 4UFEH 1GHBF 1HRTH 3A83A 2KR7A 2V7QD 1YPKH 5E0JA 1V2MT 2G81E 1ZGIA 2Q1JA 5KGOA 2FP7B 3LGIA 1SC8U 2JJ2D 2P3TB 2ZECA 4AB8A 3PO1B 4KGAA 5IK2D 1BBRH 1DM4B 3UR9A 1AB9B 1GI5A 1XUIA 4ASHA 1Y3VA 4D76A 1YPLH 2BY8X 3ZVBA 3SNCA 1Q3XA 4UD9H 5EODA 4GHQA 3RM2H 4JYTA 4I8JA 1GJ7B 1TA2A 2P59A 2VIQA 3PLPA 3A84A 1UTKA 3PV5A 2C3SA 1Z1IA 2F43B 3LIWA 3SNDA 4FETA 2ZDKA 4J1YA 2PTNA 3VB3A 2ZDAH 1C1RA 1NZQH 2H2ZA 4FXGH 1Y5BT 1FN6A 5DO4H 5FPYA 1H8DH 1W0ZU 3DFJA 1A0HB 3RC5A 3V3MA 1NRRH 2JH6D 2B7DH 2H1UA 1C5YB 5ABWA 4ZKNU 4X6OA 1VJAU 1OP2A 2W26A 2BDBA 1SR5C 5HGGA 5A0BA 1O31A 2F83A 3UNQA 2ZWLH 1LVMA 1O3KA 1HAPH 1HAIH 3U69H 1KXEA 1EX3A 1HPGA 1TGNA 2SGAA 1GMCF 4X8TH 2WPJS 3P17H 4ACBA 4AFSA 3SHCH 2ASUB 1QRWA 4TPYA 1KLIH 2FPZA 1O3AA 1AZZA 1ZPCA 4X0WU 2SGPE 5CHAB 2Z3DA 1HJAB 1EOLA 2QAAA 3KIDU 1UJ1A 4CRAA 1C2DA 2ZTYA 1DSTA 1BMNH 4CRFA 4WJG2 2GMTC 4AB9A 3ATLA 4GAWA 4H6TA 1SQAA 4X2WA 1KYNA 1QR3E 1UTMA 4K5ZA 4Y11E 1DT2A 5C3NA 4X1RU 1BBRE 4TT3D 1MCTA 4ISIH 4ZXYH 2J34A 3LOXA 3M35A 3U8OH 2I6QA 3F2FA 4KTCA 3ATWA 3A81A 1P2KA 2F9VA 1DLKB 3LH3A 1W7XH 2BVRH 2H6MA 3NKKA 1TGBA 1ELCA 1JRTA 3AASA 3OFND 1ARBA 1D3QB 1O35A 4Y79A 1MTWA 2HLCA 2HLDD 2SGDE 5DKMA 1FV9A 2GJGA 3E90B 1WTHD 4NZQA 1NRQH 3QGNB 3AAUA 1GI1A 2BY5X 4FUHA 1GBTA 1WBGB 2AFQB 4MNYA 5EQSA 2PKAA 1CHGA 1DVAH 1RIWC 2FOCA 2GDDA 4B6FA 3PM3A 3A87A 3A7YA 4KTUA 1SKYE 3LDXH 1E37B 2OQUA 3RU4E 1ZJDA 3TJUA 4KP0A 1TIOA 1SI5H 1OWEA 3DSOA 4O03A 1LDTT 1Y5UT 1GBDA 2GV7A 2QCYA 3SJKA 1ZMLA 1O38A 2UUKB 3K6ZA 3SJ8A 1SLWB 4MNXA 1Z8RA 4IGDA 2A45B 1K0HA 1C1VH 1ZR0A 3F68H 1GBAA 1SQTA 6LPRA 1AKSA 1OX1A 4LOYH 2BD5A 1QHRB 1TBRH 3A80A 3TLOA 1O30A 1S83A 2ZHWH 2BXUH 1ZOMA 4DG4A 1SHYA 2KCPA 1Y3UA 4WY3A 3MOCA 3F0OA 3AVZA 2WV5A 1B5GH 2FOEA 3UWJH 3W95A 1CVWH 1AMHA 1T8LA 9ESTA 2FOAA 3URDA 1JWTA 3FO8D 2Z7FE 1SMFE 3MNXA 5DP8A 3TH4H 5A8XA 4M9FA 3V0XA 3H5CB 1SOTA 2G52A 3HATH 1F5RA 3MYWA 1CA0B 1QIXB 3KCGH 1AZ8A 3RMLH 2J94A 4DT4A 4AORA 3BTQE 2RA3A 3HKIB 1QJ1B 1J16A 1UCYK 2NU0E 2R0LA 2ODQA 4NSVA 1IQHA 4ZCNA 5DPAA 4CH8B 4O9VA 1NFUA 2CV3A 2BZAA 2YNBA 3W94A 1C9PA 5DK1A 2P94A 4X2YA 2G5NA 5LPEA 4X1QU 3HKJB 1ETRH 2ZFFH 2Z9KA 3F2HA 3NXPA 2FX6A 3RXGA 2GCTB 3ZYDA 3O8CA 1O3BA 3U9AH 5LPFA 1QTFA 1QA7A 1N6XA 1LPGB 2CGAA 3KN2A 1JRSA 3M3SA 5E2OA 3O8BA 1DWBH 2OD3B 3P8GA 3D49H 2KM0A 4AG1A 1A0JA 1IQMA 1D6WA 2CXVA 1MTVA 1OOKB 5AVDA 3E16B 3M5OA 1P9SA 5GCHF 3T62A 5KECA 3VFEA 2XRCA 2ZA5A 1HDTH 2XCFA 2SGEE 1GI2A 2BDGA 1YBWA 4AFQA 2CK3D 4ABJA 1ZMNA 2WZQA 2EEKA 3DD2H 5EOKA 1V3XA 1MABB 4UEHH 3HPTB 2XYAA 1V2JT 5FHTA 3OAAD 4OGXA 2KFWA 4I8LA 3R0FA 1C1MA 2QXHA 4A1VA 1K1NA 2ZDMA 4XOJA 1D3PB 4ZXXH 4RT1A 2GGVB 2UWLA 2GCHG 1OP0A 1ESTA 1LHEH 1HXFH 1DDJA 2NU2E 3SQHE 5DG6A 2D26C 3WY8A 5ESBA 1GWAA 3IG6B 1GI0A 5GJ4B 3ZV9A 1DICA 3SI4H 2ZFSA 4K2YA 4ZKRU 3MH5A 4O3TA 3RMOH 2XC5A 5GNDA 5DJ7A 1CGIE
chains in the Genus database with same CATH topology
3SU6A 4R8TB 5GPIB 3SZEA 4A1TA 2JDID 3SU4A 1E79D 3FO8D 2XCNA 4I33A 4WH8A 4TSFD 3SUFA 4A92A 1WXRA 3FOAA 3OEHD 4Z1MD 2JJ1D 4M9FA 4B6EA 1COWD 1KMHB 5B6LA 2IJOB 3OTPA 3ZIAD 5C17A 2AHME 1DXPA 3L6PA 2O8MA 4WH6A 3GS9A 5F53A 2OC0A 2KCAA 3M5MA 3VG8A 4A1XA 2WPDD 4DT4A 3DSPA 4B73A 2LELA 3OYPA 3LKWA 3P8NA 5EQQA 1OHHD 3AK5A 2OBOA 5CHBA 2K8IA 2J5UA 5EPNA 3WWBA 4ZCNA 2A4QA 3UB0A 2KR7A 2V7QD 2OC1A 1DY8A 2QV1A 4F55A 4B71A 4TT3D 1H8HD 2OK5A 3M5LA 3SV9A 2L6OA 3KEEA 1A1RA 2F4LA 5IDKA 3EYDA 3PV2A 4NWLA 1DXWA 2K0QA 3LOXA 2WHXA 5EPYA 3M5NA 3F2HA 3U1IB 4XD7D 2QE7D 2W6ID 5C0UA 2FP7B 3F2FA 3SV6A 4KTCA 3O8RA 2WV9A 2JJ2D 4U01A 2F9VA 3KNXA 2KZ4A 1NBME 4TYDA 3W1EA 3O8CA 5IK2D 5ETXA 2IJD1 4K8BA 5EQRA 4I31A 3DCLA 3KN2A 3O8BA 1W0JD 2KM0A 3SU0A 3OFND 3SU1A 5HKKD 1BT7A 1S6LA 3NRLA 4Q63A 3SYJA 2YOLA 4OM9A 2HLDD 3M5OA 4RI0A 2P59A 2XNIA 3LONA 4JMYA 5FL7D 2YMSD 3E90B 3PV5A 1JXPA 2F43B 3WWFA 2XCFA 2K1QA 3SU5A 3SUEA 3O8DA 4FETA 3WW7A 5EQSA 4B75A 1BMFD 5FPSA 5FPTA 2CK3D 1W3CA 2A4GA 3RC4A 2WZQA 3PRBA 5FPYA 4B6FA 2F9UA 4B74A 1MABB 3H09A 2W6JD 1DY9A 3RC5A 2KCYA 2OC7A 2OINA 1SKYE 3F2GA 3FN8A 1RTLA 3F3BA 2YMSC 3OAAD 2KFWA 1E1RD 3F0PA 2XNDD 1RGQA 2OC8A 1W0KD 3U1JB 2KCOA 2GVFA 1H8ED 3DSOA 3P8OA 3SUGA 2YMSB 3N7DA 4A1VA 1EFRD 2FM2A 3OEED 3SUDA 3SU2A 4ASUD 1NS3A 1NBMD 3RC6A 2GGVB 2WSSD 4I32A 3KF2A 3PRDA 5T1VA 2A4RA 2QF4A 4B76A 2FOMB 4NWKA 1FX0B 3OE7D 3SV7A 5DSFA 2VBCA 4Q4LA 5ESBA 3FKSD 5DN6D 2KCPA 1CU1A 5GJ4B 2QF5A 2JIZD 4WF8A 5C0TA 2XOKD 1N1LA 3N7EA 2OBQA 3F0OA 3N99A 5CDFE 4YXWD 5H4IB 5GNDA 3SU3A 3SV8A 2M2AA 1E1QD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRL A; 
#chains in the Genus database with same CATH topology
 3SZE A;  2Q6F A;  3KQC A;  2XBX A;  3GY8 A;  1MMJ N;  3MWI U;  4U32 A;  1UMA H;  3BG8 A;  1KMH B;  1OKX A;  2WPH S;  4ABD A;  1DE7 H;  4RT0 A;  4D8N A;  5EU8 A;  4WH6 A;  1EPT A;  1TON A;  3NWU A;  3QGJ A;  3S7K B;  2Z3E A;  7GCH G;  4Y8Z A;  1FLE E;  2FYQ A;  1OHH D;  2J5U A;  2DUC A;  2ZU4 A;  1W13 U;  4ABI A;  2WIN I;  5F6M A;  1PFX C;  2TGA A;  1IQF A;  5EG4 A;  1DY8 A;  3PYH A;  2SNW A;  4AG2 A;  1UO6 A;  1A1R A;  1FN8 A;  2TBS A;  1FY4 A;  2STB E;  1HGT H;  3SNB A;  1KSN A;  3R3G B;  1FNI A;  3K6Y A;  2W3I A;  2V35 A;  5DP5 A;  2DE8 A;  2ZKS A;  1OWI A;  2BDY A;  2ZU5 A;  4DIH H;  2A7H A;  1LVB A;  1G3E A;  4WXV A;  1UTN A;  4IC6 A;  1A5I A;  1O2I A;  1O3J A;  2C8X B;  3SU1 A;  2J4I A;  1KDQ A;  2AS9 A;  2AGE X;  4Q63 A;  3B9F H;  4JMY A;  1ZMJ A;  2C93 B;  2QF3 A;  2I6S A;  3U8T H;  3EA9 A;  3SUE A;  1LMW B;  3URC A;  2G8T A;  3E0N B;  1V2L T;  3SQE E;  1F5K U;  1O2W A;  1YKT A;  2VIV A;  2FOD A;  1ZSL A;  1LKA A;  5C67 A;  1SGC A;  4Z6A H;  1E34 B;  1O32 A;  3H09 A;  2HPQ H;  3VEQ B;  5DP6 A;  3M3V A;  1JMO H;  2UUF B;  1RTL A;  1KLT A;  4ZHL U;  2SGQ E;  1AVW A;  2UUJ B;  1CT0 E;  5EXN A;  1LPZ B;  4BOH A;  2Y7X A;  3A86 A;  2AGG X;  1HNE E;  1P3C A;  1SQR A;  4K1T A;  5FBE A;  2CF9 H;  3S9C A;  1VGC C;  1CBW C;  1SGP E;  3RXB A;  2JH0 D;  2BOH B;  1CU1 A;  5EJL A;  2QF5 A;  1QFK H;  4CRE A;  1SGI B;  2OBQ A;  1RXP A;  2TRM A;  1UCY E;  1V6D A;  1E1Q D;  4H42 U;  3A8C A;  2IPH A;  3SU6 A;  3UQO A;  5GPI B;  1C2G A;  1ZLR A;  4I33 A;  5LGO A;  3OTJ E;  1EP5 A;  2ODY B;  3UNS A;  1QJ6 B;  1GJ8 B;  2AHM E;  2EI8 A;  4MPX A;  4XFQ A;  1H9L B;  1HB0 B;  2KCA A;  1P2O A;  2HAL A;  2F3C E;  1GMC G;  3EDX B;  4X6N A;  3M37 A;  3TNT A;  5FAH A;  3UIR A;  1YF4 A;  1YYY 1;  2OBO A;  5JBB S;  4CBO A;  2RDE A;  2ZQ2 A;  1UTQ A;  1N6Y A;  2FWW A;  2PW8 H;  3UB0 A;  3RXE A;  3PTN A;  4XRN A;  5C1U A;  2OK5 A;  1S0R A;  2ZTZ A;  4NZL A;  3NUM A;  4K3J A;  2NU3 E;  3A7W A;  2KZ4 A;  1BDA A;  2Z6B D;  4A5T S;  1HFD A;  1VKY A;  2C8Y B;  2V3M A;  3VB5 A;  5I25 A;  3MNS A;  2AYW A;  1W11 U;  1YPG H;  1T32 A;  3SYJ A;  1ZHP A;  3GY6 A;  3SJ9 A;  5EST E;  1NU9 A;  1YLN A;  1P06 A;  1WDI A;  3MO6 A;  2BM2 A;  1ETS H;  2YMS D;  4BTU B;  1W12 U;  1HIA B;  4Q7Z A;  1F0T A;  5E8E H;  1DOJ A;  4X1S U;  3WW7 A;  1O3P B;  1BMF D;  4K69 A;  1MQ5 A;  1SLX B;  3UQV A;  2HOB A;  2VIP A;  3S0N A;  1S5S A;  2OP9 A;  4LZ4 B;  1AE8 H;  2A7C A;  1SOZ A;  4JCN A;  3SNE A;  2SFA A;  2ZIQ H;  3FN8 A;  1H4W A;  2ZFQ H;  2BB4 A;  2ZF0 H;  1S85 A;  3U1J B;  3PLK A;  4ISN A;  5C5O A;  2P8O B;  2C8W B;  1C5M D;  1PQA A;  2Z9G A;  1GHY H;  3SUG A;  1RTK A;  1T8M A;  2ZU3 A;  2ANM H;  2ZDN A;  1FIZ A;  4FUJ A;  1O39 A;  3LT3 A;  4U2W A;  1IQL A;  3RM0 H;  3RXF A;  2F91 A;  4AFZ A;  5AF9 H;  1O2V A;  2A5I A;  3BIU H;  3FZD A;  3DUX H;  1UTJ A;  3TVJ B;  1UTL M;  1AE5 A;  3GCH B;  3U8R H;  2GDE H;  3ZZA A;  2V6N A;  1J14 A;  2LPR A;  1OS8 A;  3MFJ A;  1ELE E;  1GGD B;  1S81 A;  4FU8 A;  2A2X H;  2PTC E;  5E0H A;  4ZKO U;  2R9P A;  1BCU H;  5JBA S;  1BHX F;  5L2Y H;  2OQ5 A;  2VGC C;  4HGC A;  3FP6 E;  4DJZ B;  3F1S B;  2R0K A;  2IJO B;  1G9I E;  1SGY E;  1C1S A;  2O8W A;  3RLY H;  1QJ7 B;  1FIW A;  1F0R A;  1O2G H;  5HIZ A;  1TOM H;  2ZGB H;  3S9B A;  3QUM P;  2C8Z B;  4I8G A;  1BOQ A;  1FAK H;  1H1B A;  2TGT A;  1J15 A;  1AWH B;  2PUX B;  2A4Q A;  2FS9 A;  3RXO A;  1BTX A;  2QV1 A;  1BIO A;  1NES E;  4YTA A;  3M5L A;  3SV9 A;  5F8X A;  3KEE A;  1P11 E;  2O9Q A;  3F6U H;  4NA7 A;  3RXH A;  5C0U A;  4K8Y A;  3O8R A;  3AAV A;  3MI4 A;  2BY7 X;  4IC5 A;  2A5K A;  4TYD A;  2AEI H;  2H9H A;  1YWU A;  1K21 H;  2IJD 1;  3PMA B;  4E7R G;  4K8B A;  2QIQ A;  1A5H A;  1GJ9 B;  2GP9 B;  1C2F A;  2BZ6 H;  1NFX A;  2GKV E;  1EB1 H;  3EE7 A;  3CEN A;  2AMP A;  4D7G A;  3BF6 H;  3CS7 A;  1ZTJ A;  4A6L A;  1BTY A;  1O36 A;  3T26 A;  1O0D H;  1XUH A;  1P04 A;  1Y5A T;  5K0H A;  4RKJ B;  1ARC A;  3RXM A;  3S69 A;  1K1L A;  1HAG E;  1ZTK A;  1MAY A;  3PRB A;  3RXA A;  1O2L A;  4XBC A;  1O33 A;  4GPG A;  3UR6 A;  1TNI A;  5EW2 H;  1XXF A;  1TB6 H;  1W0K D;  5E2P A;  1V2W T;  3MTY A;  1CQQ A;  1DWD H;  1H8E D;  5T6D A;  1GVK B;  3N7D A;  4ZHA A;  1D9I A;  3T25 A;  3C1K A;  1GG6 B;  3QTV H;  1C5N H;  1HAV A;  5GCH G;  4DW2 U;  1UVS H;  3SW2 B;  1GBH A;  3JZ2 B;  1UVT H;  1G37 A;  1DLE A;  3SV7 A;  1TA6 A;  2HNT E;  5HIY A;  5DN6 D;  4BNR A;  4JK6 A;  4WF8 A;  2AMD A;  3MHW U;  2HNT F;  3EE0 B;  5EJ1 A;  5EGM A;  2FS8 A;  2PKA B;  3F9E A;  1DUE A;  1ZRB A;  1BZX E;  4VGC B;  2O8L A;  3VB7 A;  5EW1 H;  3CP7 A;  2ZZU H;  3FP7 E;  1ELV A;  4GSO A;  1V2K T;  2ALP A;  2PP6 A;  1XUF A;  3L3T A;  1C5L H;  1WYK A;  5GIB A;  4ZKS U;  3LH1 A;  2VWN A;  4ZUH A;  1KXC A;  1FZZ A;  5EIY A;  1GJD B;  1FAX A;  1ID5 H;  2VWL A;  1JIM A;  2V3H H;  4Y0Y E;  2F9O A;  5I46 H;  2RG3 A;  4U30 A;  1AKS B;  1QGF A;  3WWB A;  4OGY A;  1FY5 A;  2ZO3 H;  5SGA E;  1XMN B;  2VWM A;  3RXL A;  1ZTL A;  1AFQ B;  1O3D A;  2FYR A;  2GCT C;  4ZMA H;  3PV2 A;  2K0Q A;  5EPY A;  1GVL A;  5B6O A;  2ZPR A;  2PHB A;  2CHA B;  2ZDV H;  1S6H A;  4MPV A;  2BHG A;  1LHF H;  4WME A;  4IMQ A;  3Q3X A;  4XE4 A;  1TX7 A;  1DWE H;  1QRZ A;  1LVO A;  3KQB A;  1N8O C;  1FJS A;  1NPM A;  3LC3 A;  3NRL A;  1MU6 B;  4RI0 A;  3SN8 A;  5GXP A;  2ZFP H;  1O3E A;  3BG4 C;  4I8K A;  5EXL A;  2WUC A;  1ANC A;  1ZGV A;  5FPT A;  3LGW A;  3LGV A;  3URE A;  2ZCK P;  5GDS H;  4YOG A;  2D1J A;  2QXI A;  1J9C H;  1DY9 A;  4H4F A;  5JDU B;  2ZDL A;  2PV9 B;  1ABI H;  5FXL A;  1GVZ A;  1RGQ A;  2HNT C;  3SOR A;  1XX9 A;  1BRB E;  1DUA A;  3E6P H;  2YMS B;  3DT0 H;  1C4V 2;  4YLQ H;  3SUD A;  1OYQ A;  2Y7Z A;  1NC6 A;  2ZG0 H;  6CHA C;  1O2J A;  2O8U A;  3RXV A;  4AZ2 B;  4B76 A;  2H5C A;  3TGI E;  2Y5G A;  3ZVA A;  4MQA A;  2J97 A;  2WYJ A;  5C0T A;  1N1L A;  1IHT H;  1O2U A;  5CDF E;  1M9U A;  1TMU H;  1KXB A;  3Q3Y A;  3TIT A;  3GYM A;  3KYF A;  3LGU A;  2AIP A;  1HYL A;  2JDI D;  3SV2 H;  1EKB B;  1IHS H;  1A46 H;  2BVS H;  1SQO A;  1DS2 E;  3CNR A;  5CE1 A;  1KY9 A;  1COW D;  1LQE A;  1O5F H;  3KQE A;  4X6P A;  1TPP A;  5C17 A;  2A0Q B;  1T8O A;  2FTL E;  2BQ6 B;  1O2Y A;  2ZEB A;  3ODF A;  2LEL A;  3ITI A;  1Q2W A;  2FI3 E;  1SLV B;  3BN9 A;  4X2X A;  1P0S H;  3VB4 A;  3QZQ A;  1AGJ A;  1AUJ A;  1C2E A;  1DIT H;  1ACB E;  4GCH F;  2F4L A;  3OY6 U;  2KAI A;  3E1X B;  1IQG A;  3EYD A;  1IQN A;  1VJ9 U;  2L74 A;  3FP8 E;  2FZZ A;  1C1W H;  3N7O A;  1AI8 H;  1AUT C;  1GJ6 A;  4UON A;  2CMY A;  3HK6 B;  3MNB A;  1OWJ A;  1EB2 A;  3V7T A;  1HJ9 A;  4BAH B;  2QGR A;  3QX5 H;  1B7X B;  3BTD E;  2Z9L A;  3BTW E;  3E8L A;  2ZGJ A;  3KL6 A;  1EPT B;  3QDZ B;  1K1J A;  1QZ8 A;  4THN H;  1JXP A;  2J2U A;  5DGJ A;  1GBL A;  4XBB A;  4IW4 E;  4KKD A;  1F92 A;  2ODP A;  2EY4 C;  1SFQ B;  3H7T A;  3RXU A;  3PWC A;  4X1P U;  2F9U A;  1GMH F;  1K28 D;  1Z6J H;  4ZH8 A;  5J4S A;  3TPI Z;  1YLD A;  1HCG A;  1HLT H;  3NCL A;  4UDW H;  1O2H A;  2OC8 A;  1O2O A;  2M5T A;  4YZU A;  1GCT C;  3RDZ A;  4BAM B;  2D8W A;  2ZHD A;  3GY3 A;  2H5D A;  4MTB A;  1W10 U;  1TBQ H;  1PPB H;  1THS H;  4FUD A;  2ZPQ A;  3AW1 A;  1ZHM A;  1MTS A;  1W2K H;  5DP3 A;  4OS6 A;  1IQE A;  2JET C;  1KTS B;  1QB1 A;  1KDQ B;  3IIT A;  1FX0 B;  1V2O T;  4LXB H;  1KLJ H;  4B2C A;  2FOH A;  2VIW A;  3E0P B;  5H4I B;  3SU3 A;  5FCK A;  1WUN H;  4FUF A;  1TRY A;  1EUF A;  1WXR A;  4TSF D;  2F9P A;  1GBI A;  3EST A;  2JJ1 D;  2STA E;  4B6E A;  1IOE A;  3UTU H;  1MQ6 A;  1TNL A;  4NSY A;  3UY9 A;  2O8M A;  2EI7 A;  5F53 A;  1TGC A;  2EI6 A;  1BA8 B;  2ANK H;  5HMA A;  2ZP0 H;  2PGB B;  4Y71 A;  1GI9 B;  2YNA A;  1VIT H;  2VVV A;  5TCA A;  5C1X A;  3P70 B;  2XXL A;  1L1G A;  1K1I A;  3BEU A;  3NK8 A;  2FTM A;  1CGJ E;  1QL7 A;  1GBF A;  1AVX A;  1QY6 A;  1ZHR A;  2HVY B;  1TQ7 B;  2VVU A;  1L4D A;  4ABG A;  1CE5 A;  4AFU A;  1YPJ H;  4IBL H;  2V0B A;  1TMT H;  1NBM E;  1QL9 A;  2XWB I;  3W1E A;  4TY6 A;  1WOF A;  1FPH H;  4NFF A;  1S82 A;  2PSY A;  1WSS H;  2KX4 A;  1RIW B;  3LJJ A;  1TX8 A;  1P57 B;  3A89 A;  1UVP A;  1C5V A;  2Y5F A;  4FVB A;  3PMH B;  2ULL A;  2YOL A;  4OM9 A;  1OWH A;  1OSS A;  1UVO A;  1LKB A;  1UTP A;  3UOP A;  5DP9 A;  1C5T A;  2NU1 E;  1YPE H;  2P95 A;  4AGK A;  5FPS A;  5PTP A;  1CT2 E;  1W3C A;  2P3U B;  2UWP A;  5T3H A;  1L2E A;  4D9Q A;  4IS5 A;  4J2Y B;  1CHO F;  3ATK A;  2P8O C;  4MPW A;  1O3F A;  5J4Q A;  1UTO A;  3A8A A;  1ZSK A;  2VID A;  1C2K A;  2ZGC A;  1A3E H;  2BLQ A;  1PPG E;  1EFR D;  2J98 A;  3RXC A;  1V2U T;  4ASU D;  1O5E H;  3P92 A;  1GL1 A;  3PRD A;  1KIG H;  1HXE H;  2V3O H;  1AO5 A;  2VWO A;  1IQJ A;  1EJN A;  1EAS A;  3SO3 A;  2SNV A;  1TOC B;  3PMB B;  3A8D A;  1GGD C;  1K1P A;  1A3B H;  1Z71 A;  3BTE E;  1EJA A;  3GIS B;  3ZZD A;  2AMQ A;  4K1S A;  1LHG H;  2ZGH A;  3GDV A;  1QBN A;  4YXW D;  1GDN A;  3UPE A;  1TNG A;  4RN6 A;  2PKS C;  2Q6D A;  4A1T A;  2AH4 X;  2ZQ1 A;  2VU8 E;  2B9L A;  4QT8 C;  1E79 D;  4ABE A;  5A0A E;  4A92 A;  3KGP A;  3OEH D;  5GWZ A;  1A5G H;  2DE9 A;  2WPI S;  4ISO A;  3MQK C;  1T31 A;  1RS0 A;  1EAT A;  3B23 B;  4M7G A;  5IYT A;  3TNS A;  2ANW A;  4MG3 A;  2FOF A;  2PLX A;  4FUB A;  1MCV A;  4XDE A;  3SI3 H;  2OC0 A;  3S7H B;  2WUB A;  3M5M A;  1K2I 1;  1C4Y 2;  3GDS A;  1WV7 H;  3T27 A;  2GZ8 A;  3VGC C;  3T28 A;  1SL3 A;  4IMZ A;  3RXQ A;  3SGQ E;  5A0C A;  2JKH A;  8KME 2;  1VIT F;  1MUE B;  5JBT A;  5FBI A;  3A88 A;  5C1Y A;  3SJO A;  1P05 A;  3RXJ A;  1KXD A;  2BMG B;  3EGK H;  4DY7 B;  1H8H D;  1XVM A;  1ELT A;  2L6O A;  1SHH B;  4AYV B;  4NWL A;  5E0G A;  1XVO A;  2WHX A;  2GX4 A;  2ZNK H;  2BD7 A;  3RMN H;  2WV9 A;  2BDC A;  6GCH F;  3KNX A;  2PR3 A;  1HAO H;  3AW0 A;  1ANB A;  1C5S A;  1TAW A;  5T6G A;  4NFE A;  2G55 A;  1O5A B;  3ZVE A;  2BX4 A;  4WWY A;  1GI4 A;  2VVC A;  2W3K A;  1EZX C;  4NCY A;  3I78 A;  1P3E A;  3D23 A;  5A2M H;  1PQ7 A;  1P2J A;  2VJ1 A;  1EXF A;  1VR1 H;  1KXA A;  5A8Y A;  3BTF E;  1YY3 A;  3ZVD A;  1L0Z A;  2XBV A;  2XW9 A;  2K1Q A;  5C2Z A;  1PYT D;  3M7Q A;  1EAW A;  3PO1 C;  4FUI A;  4FUC A;  4B75 A;  1WQS A;  3UAI C;  1AB9 C;  1C2M A;  2FLR H;  1YPH E;  1G30 B;  2OXS A;  1EOJ A;  1T7C A;  5L6N H;  3STI A;  1MZD A;  2BDA A;  2HWL B;  1O3G A;  2EC9 H;  5HXF A;  1BMM H;  3E91 A;  3ENS B;  1FXY A;  3OEE D;  4SGB E;  3MO9 A;  5A8Z A;  1PPF E;  4ABH A;  4LZ1 H;  1OP8 A;  3ZVC A;  2G00 A;  2P16 A;  4Y7A A;  4CH2 B;  4GHT A;  1TNK A;  1IQI A;  2A32 A;  1MTU A;  2VBC A;  2ZC9 H;  4Q4L A;  2Y81 A;  4I7Y H;  1XXD A;  3FKS D;  2WV4 A;  3ZVF A;  4FOU C;  1O3N A;  5FCR A;  4X1N U;  3N7E A;  1C4U 2;  3F9G A;  4Y8Y A;  1F7Z A;  1S6F A;  1Z7K A;  1QUR H;  3SU4 A;  4DUR A;  5F8Z A;  1P2I A;  3ODD A;  5AFZ H;  3FOA A;  3HGP A;  1C2L A;  4D7F A;  5EJZ A;  4Y0Z E;  3GCT F;  4X8U H;  3ZYE A;  1BUI A;  3K9X B;  1WAY B;  1G2M A;  1TGS Z;  1LPK B;  2HPP H;  1GHZ A;  3GS9 A;  1C5O H;  1TQ0 B;  1F5L A;  3I29 A;  1C1P A;  1Z1J A;  3GY7 A;  1RD3 B;  3OYP A;  1GDU A;  5CHA C;  3P8N A;  5EXM A;  1HAV B;  2K8I A;  3BEF B;  1FQ3 A;  1BRC E;  1Y59 T;  3RXS A;  1HJA C;  4HFP B;  1QQ4 A;  1AVG H;  1C5P A;  1GJC B;  1P09 A;  1P12 E;  1EP6 A;  2CHA C;  3M7U A;  5IDK A;  2C4F H;  4UE7 H;  4AOQ A;  2W6I D;  4B2B A;  1P8V C;  4BAN B;  1MKW H;  5AHG H;  3EAJ A;  5F03 A;  4AYY B;  2ALV A;  3RUO A;  2LP6 A;  1CT4 E;  1K1O A;  5EQR A;  2A1D B;  5JYI A;  4X6M A;  4NIW A;  2GV6 A;  3DCL A;  4ISH H;  4JZF H;  3ZVG A;  1FI8 A;  1W0J D;  4O97 A;  2Z3C A;  3VXF H;  2ZGX H;  1HJ8 A;  2RA0 A;  2B8O H;  2TGP Z;  2J38 A;  8GCH F;  4FU7 A;  4INL A;  2BLV A;  1G3D A;  1YPH C;  2B0F A;  5FX6 A;  4I8H A;  2GZ7 A;  1MD7 A;  1L1J A;  4GCH G;  1GCD A;  3UNR A;  4Z0K A;  2J95 A;  1DAN H;  1ZPZ A;  2IN2 A;  2W7S A;  2XWA A;  4B74 A;  1C2I A;  1UHB A;  3TGK E;  1VGC B;  1W0Y H;  2OIN A;  3E3T A;  3F3B A;  1ZSJ A;  5T6F A;  2YMS C;  1Y3X A;  3F0P A;  7LPR A;  1O2T A;  2UWO A;  1O3O A;  2ZFT A;  2BDH A;  1D4P B;  3GY4 A;  3GIC B;  3SU2 A;  4YOI A;  1D3D B;  3MU0 A;  2R2W U;  3SNA A;  1SPJ A;  3KQD A;  4Q7Y A;  1H9I E;  2A4R A;  1HAX B;  2QF4 A;  2B5T B;  5A09 A;  3OE7 D;  3TH3 H;  3MU8 A;  4OS7 A;  4KTS A;  4CHA B;  3TGJ E;  1F0S A;  1GBB A;  1C5Z B;  1NT1 A;  4R0I A;  4X8V H;  1EAU A;  2FEQ H;  4YT7 H;  1AY6 H;  1GMH G;  3FFG A;  1VCW A;  3PB1 E;  3FAN A;  2FI4 E;  1SB1 H;  1AQ7 A;  3GOV B;  3Q76 A;  2G5V A;  4YOJ A;  3LJO A;  5BPE A;  1C1Q A;  1SSX A;  1GI7 B;  4Q80 A;  1PPZ A;  3SUF A;  1GDQ A;  3STJ A;  1DWC H;  2XBW A;  4GUX A;  4MPU A;  5K7R A;  3ZZC A;  1AND A;  4ISL A;  3RXR A;  1ANE A;  1BTW A;  4CR5 A;  3ZZ7 A;  2WPD D;  4CRD A;  3LPR A;  1T4U H;  1FPC H;  3DSP A;  3MU4 A;  4B73 A;  3CS0 A;  3LKW A;  5EQQ A;  1NM6 A;  2R3U A;  1ZZZ A;  5CHB A;  1RRK A;  3NPS A;  3SOS A;  4GLY A;  1YCP H;  1MTN B;  3A82 A;  2PGQ B;  1TLD A;  2HVX A;  5HM9 A;  1TMB H;  2D2D A;  1AU8 A;  1O2S A;  3T29 A;  1CA0 C;  3ZZ4 A;  3U98 H;  2ZI2 H;  4ZHM U;  4A7I B;  1C5W B;  1FY1 A;  1NU7 B;  2JH5 D;  1LQD B;  5AFY H;  3SV6 A;  1SGT A;  1CA8 B;  1UK3 A;  4NA8 A;  1EAX A;  4IN2 A;  1E36 B;  3MH7 A;  1SLU B;  3QK1 A;  4YLU A;  3BSQ A;  3GYL B;  3I77 A;  1XUJ A;  1EPT C;  1PJP A;  2P93 A;  1EJM A;  1SGE E;  2GT7 A;  1KXF A;  1E35 B;  1S6L A;  2QXJ A;  1HAH H;  5BRR E;  2FDA A;  2A5A A;  2QY0 B;  4ABF A;  2UUY A;  2QF0 A;  1SG8 B;  3K2U A;  1Z8G A;  4AN7 A;  1W8B H;  2EQN A;  1EZS C;  1O3M A;  3MMG A;  4F49 A;  3M3T A;  1O2M A;  3QO6 A;  1FON A;  1BTU A;  1SGD E;  2SGF E;  3LC5 A;  2WPL S;  1L4Z A;  1SFI A;  1ZYO A;  1DSU A;  1HAZ B;  2KAI B;  1UVU H;  3M61 U;  1BQY A;  1T8N A;  3PLB A;  1UK4 A;  1OWK A;  2CN0 H;  3GY2 A;  3BIV H;  3P8O A;  3OU0 A;  1MKX H;  1GHA F;  2ZCH P;  2QYI A;  2FXR A;  2Y6T A;  4P02 A;  4DII H;  5LPR A;  1YM0 A;  2VGC B;  1TNJ A;  5DP4 A;  4EST E;  1GHX H;  1GHW H;  2Y80 A;  5C20 A;  3BTG E;  1YP9 A;  1Z8I B;  3QN7 A;  1LVY A;  1C5Q A;  2JIZ D;  1CGH A;  1L1N A;  2VNT A;  1CHO G;  1K1M A;  2CF8 H;  4UFG H;  3OSY A;  2ILN A;  2FI5 E;  3RXK A;  2FIR H;  1Y3W A;  1AD8 H;  4R8T B;  3D62 A;  2WPM S;  1P2Q A;  1TAB E;  1MAX A;  2A4O A;  2ZTX A;  1O2P A;  2XCN A;  4TWW A;  4Z1M D;  4HTC H;  3DFL A;  1GJA B;  4PRO A;  5B6L A;  3MNC A;  2H9E H;  1ELF A;  8EST E;  3DHK H;  1V2Q T;  2XTT B;  2Q6G A;  1HBT H;  1TBZ H;  2GT8 A;  1V2T T;  2BD4 A;  2GTB A;  2GZ9 A;  3MU5 A;  4D9R A;  1P03 A;  2WPK S;  2W5E A;  2R2M B;  3Q3K A;  5F8T A;  5EPN A;  2Z94 A;  4Q7X A;  2ZHF H;  2FX4 A;  4MDS A;  2OC1 A;  2IOT A;  1RFN A;  4MVN A;  3PV4 A;  3D65 E;  3KHV A;  2AER H;  1GMD F;  1QB6 A;  1QB9 A;  1VCP A;  3M5N A;  3U1I B;  1G3B A;  1YLC A;  5FX5 A;  2ZFR H;  1PPC E;  4B1T A;  3RU4 D;  3K65 B;  1QQU A;  4TWY A;  3GDU A;  5DP7 A;  4INH A;  3ZZ9 A;  3BV9 B;  1X7A C;  1HUT H;  2FES H;  1VIT G;  4JYU H;  2OUA A;  4NG9 H;  4JZI A;  1MD8 A;  3P8F A;  1TPS A;  1F0U A;  3WWF A;  1C5X B;  1IAU A;  1YC0 A;  1XUG A;  4JZ1 A;  3SGB E;  1TFX A;  1BHX B;  1Z8J B;  1O5G H;  1Z6E A;  3BTK E;  3ATI A;  1IQK A;  3HK3 B;  3TK6 A;  6GCH G;  1BTH H;  2W6J D;  3IWM A;  2OC7 A;  3TH2 H;  3F2G A;  3TIU A;  1A4W H;  4DGJ A;  2OTV A;  1E1R D;  4BAK B;  4RSP A;  1QCP A;  2G51 A;  2ANY A;  3PWB A;  3A7T A;  3JZ1 B;  2W7U A;  4O3U A;  1HAY B;  1P02 A;  4Q2K A;  4GVU A;  1XKB C;  5TJX A;  2BD3 A;  2WSS D;  3FAO A;  3ZZ6 A;  1S84 A;  1D3T B;  5T1V A;  1FMG A;  1V2V T;  2FOM B;  1SGR E;  4Y6D A;  5TCC A;  2OLG A;  3QLP H;  1A7S A;  2ZCL P;  1QA0 A;  3SJI A;  1ELD E;  1K22 H;  1BRA A;  1RTF B;  2THF B;  2XOK D;  3PMJ A;  2QN5 T;  2FLB H;  1OXG A;  3PRO A;  4RKO B;  3SV8 A;  2M2A A;  1XKA C;  4XSK U;  1K9O E;  2ZPS A;  1O34 A;  2J9N A;  1ESB A;  2F9N A;  2A2Q H;  2O8T A;  2FOG A;  3SGA E;  3ZIA D;  1WU1 A;  3ZZ5 A;  2EA3 A;  1OPH B;  1HV7 A;  5HYO A;  4MLF B;  5C5N A;  4A1X A;  2AIQ A;  2F9B H;  3A8B A;  2J98 B;  9LPR A;  2EST E;  2GMT B;  1NRN H;  3T5F H;  3Q00 A;  3RMM H;  4B2A A;  2LNC A;  3L33 A;  3P6Z B;  2HGT H;  1DX5 M;  1ELA A;  1YCP M;  1D6R A;  4B71 A;  3KQ5 A;  1N8O B;  2ZHQ H;  3A7X A;  4HG6 A;  3TJV A;  2PWX A;  1ORF A;  4Y7B A;  3VXE H;  1O3I A;  2J92 A;  4P00 A;  3RXT A;  4NIX A;  1GHV H;  2VH0 A;  2CJI A;  3BG4 B;  3GCT G;  3LU9 B;  4U01 A;  1P9U A;  1THP B;  1AWF H;  1YGC H;  2WYG A;  3TK5 A;  7EST E;  1O2N A;  1TRN A;  3ELA H;  3TJO A;  2BD8 A;  2AGI X;  3SHA H;  1F2S E;  5HKK D;  1TRM A;  4CRB A;  1ESA A;  2QXG A;  2P3F H;  3EA8 A;  3LON A;  5FL7 D;  1LCY A;  3ZZ8 A;  1O2R A;  3NZI A;  3SU5 A;  3BTH E;  1BIT A;  1O5B B;  6CHA B;  2R3Y A;  1B0E A;  2ZU2 A;  4UFF H;  1GJ4 H;  1LHD H;  1TX6 A;  2G4U A;  1NY2 2;  5G4B A;  1BMA A;  6EST A;  1GBK A;  1ZJK A;  2QA9 E;  1XUK A;  3FVF B;  1INC A;  1ABJ H;  2XND D;  4WMF A;  2A31 A;  2GVF A;  1SGQ E;  4AC9 A;  1A0L A;  1BML A;  1QL8 A;  4UFD H;  2PUQ H;  3RXP A;  8GCH G;  5C94 A;  2BQ7 B;  1NBM D;  4FUG A;  1UCY H;  4XBD A;  1JOU B;  2VB0 A;  1PPH E;  1NRP H;  3A85 A;  4JZD H;  1C2J A;  2Y82 A;  1QBV H;  1TAL A;  1CSO E;  5DSF A;  4WMD A;  1FDP A;  1RJX B;  4KEL A;  1G32 B;  1LO6 A;  2VH6 A;  1TE0 A;  1V2S T;  4CBN A;  2XC4 A;  3G01 A;  4CR9 A;  1B0F A;  3QTO H;  1WTG H;  2H9T H;  1C1N A;  1O5D H;  1BRU P;  1O2Q A;  1PPE E;  1XM1 A;  2IPQ X;  3B8J A;  3DA9 B;  1PQ5 A;  1E0F D;  3GCN A;  4NGA H;  1H8I H;  3HGN A;  3OTP A;  3PTB A;  4H6S B;  1C1O A;  3GCH C;  3OX7 U;  2TGD A;  1LTO A;  2OCV B;  3L6P A;  4BTI B;  3OY5 U;  4HI3 A;  1MH0 A;  4YES B;  1P01 A;  3MU1 A;  3RXD A;  1EZU C;  2BYA X;  1GJB B;  1MBQ A;  2BY6 X;  4BAQ B;  1ETT H;  4FUE A;  1V2N T;  2C90 B;  1C2H A;  1J17 T;  3V13 A;  1V2R T;  1GHB G;  3BEI B;  4F55 A;  4YM9 A;  4WXI A;  4BXS A;  1YPM H;  1QBO A;  1W7G H;  3UUZ A;  1DXW A;  1G36 A;  4BXW A;  1NRS H;  2ZU1 A;  4XD7 D;  2QE7 D;  5LH8 A;  1WCZ A;  4X2V A;  4JK5 A;  4NIY A;  4DVA U;  1AIX H;  1V2P T;  1BTP A;  5KED A;  2NWN A;  5CMX H;  3F9F A;  4AX9 H;  1TYN A;  3SU0 A;  1BT7 A;  1P10 A;  1ZPB A;  2FOB A;  2BLW A;  2QC2 A;  1NFW A;  4MNV A;  3TJN A;  4OS1 A;  2VIN A;  2XNI A;  1GCT B;  3MH6 A;  3A7Z A;  4K60 A;  2JET B;  3ZZB A;  2A4G A;  4DOQ A;  2PSX A;  1O3L A;  1OWD A;  2KCY A;  2VIO A;  2FMJ A;  1QRX A;  4OS2 A;  1T4V H;  1TPA E;  1P2M A;  3EA7 A;  3M36 A;  5JB8 S;  2KCO A;  1MKW K;  3A7V A;  1O2X A;  1SGN E;  1JIR A;  3BTM E;  4Y10 E;  3SBK A;  3RC6 A;  1P2N A;  3V12 A;  4IN1 A;  4ZAE A;  3TU7 H;  4I32 A;  3KF2 A;  2RDL A;  2Z9I A;  1C1T A;  4CHA C;  3SZN A;  3LGT A;  4NWK A;  4TY7 A;  1J8A A;  1EAI A;  3QWC H;  3RXI A;  3T2N A;  1GI3 A;  1GBE A;  1TPO A;  1ELG A;  2BVX H;  3UFA A;  1LHC H;  2BDI A;  1Y8T A;  3RLW H;  1GG6 C;  4INK A;  1G3C A;  4ZRO A;  1GBM A;  1UHB B;  1O3H A;  1GHA G;  4AGJ A;  1TNH A;  2BD2 A;  2G4T A;  4FU9 A;  3C27 B;  1NO9 H;  1BB0 B;  1DXP A;  1SBW A;  4BAO B;  3UOU A;  1FY3 A;  4BTT B;  1GI8 B;  1FY8 E;  1C9T A;  1SGF A;  2ZHE H;  4Y76 A;  3FZZ A;  1MTN C;  4LK4 A;  4Y8X A;  3RU4 T;  3TK9 A;  2XBY A;  1AHT H;  1GPZ A;  1SGF G;  4VGC C;  8LPR A;  1AFE H;  2HRV A;  2TPI Z;  3BTT E;  2RFK C;  1TGT A;  1O37 A;  1MU8 B;  4HZH A;  1PQ8 A;  1MBM A;  1O2Z A;  1DPO A;  2BX3 A;  1KTT B;  1GL0 E;  4DT7 B;  2BOK A;  1S0Q A;  4JZE H;  1EZQ A;  3EQ0 H;  1O5C B;  3Q77 A;  5ETX A;  3ATM A;  2BQW B;  1VCQ A;  4TPI Z;  1C1U H;  3KYG A;  3S9A A;  4I31 A;  1GJ5 H;  5JBC S;  3GY5 A;  4OS5 A;  4X8S H;  2A7J A;  5L2Z H;  1AN1 E;  2BTC E;  3MH4 A;  2BY9 X;  3P95 A;  1VZQ H;  3RP2 A;  1AFQ C;  2TIO A;  1C5R A;  1UK2 A;  2GD4 B;  1BBR K;  4CRC A;  4JYV H;  2GCH F;  3DSG A;  1Q31 A;  2RCE A;  1CO7 E;  1QNJ A;  4OS4 A;  4E7N A;  3O8D A;  3LGY A;  1GMD G;  4NIV A;  1H9H E;  1YCP K;  2Y5H A;  3QZR A;  3VB6 A;  3RC4 A;  1NN6 A;  5JPM H;  1WQV H;  1GBJ A;  2BLO A;  4WVP E;  2BXT H;  1GBC A;  4I86 A;  1JBU H;  3MO3 A;  1PYT C;  1SVP A;  3M7T A;  1FUJ A;  1Y3Y A;  4FVD A;  3UWI A;  2FM2 A;  2PKS B;  4NA9 H;  7KME H;  1ELB A;  1NS3 A;  1MZA A;  1O2K A;  1E38 B;  4SGA E;  3ZZ3 A;  2NU4 E;  3GCO A;  1A61 H;  2Z9J A;  7GCH F;  4YT6 H;  1NRO H;  1UW7 A;  3VPK A;  1CBW B;  3N99 A;  3VGC B;  1THR H;  4K1E A;  1U6Q A;  1EQ9 A;  3H7O A;  4F4O C;  4CRG A;  1GI6 A;  1NTP A;  4ABB A;  4ACA A;  3U28 C;  4WH8 A;  4E05 H;  1BTZ A;  1NFY A;  1C5U A;  4F48 B;  1G2L A;  4ABA A;  1O3C A;  4DCD A;  1W14 U;  1TWX B;  1DFP A;  4E06 H;  1OYT H;  1BJV A;  2BD9 A;  5JB9 S;  1BJU A;  3VG8 A;  4YO9 A;  3ZV8 A;  1MKX K;  5L30 H;  1A2C H;  4MNW A;  1ZRK A;  2XC0 A;  3AK5 A;  1HIA A;  5HM2 A;  3F9H A;  2FO9 A;  2PFE A;  4UFE H;  1GHB F;  1HRT H;  3A83 A;  2KR7 A;  2V7Q D;  1YPK H;  5E0J A;  1V2M T;  2G81 E;  1ZGI A;  2Q1J A;  5KGO A;  2FP7 B;  3LGI A;  1SC8 U;  2JJ2 D;  2P3T B;  2ZEC A;  4AB8 A;  3PO1 B;  4KGA A;  5IK2 D;  1BBR H;  1DM4 B;  3UR9 A;  1AB9 B;  1GI5 A;  1XUI A;  4ASH A;  1Y3V A;  4D76 A;  1YPL H;  2BY8 X;  3ZVB A;  3SNC A;  1Q3X A;  4UD9 H;  5EOD A;  4GHQ A;  3RM2 H;  4JYT A;  4I8J A;  1GJ7 B;  1TA2 A;  2P59 A;  2VIQ A;  3PLP A;  3A84 A;  1UTK A;  3PV5 A;  2C3S A;  1Z1I A;  2F43 B;  3LIW A;  3SND A;  4FET A;  2ZDK A;  4J1Y A;  2PTN A;  3VB3 A;  2ZDA H;  1C1R A;  1NZQ H;  2H2Z A;  4FXG H;  1Y5B T;  1FN6 A;  5DO4 H;  5FPY A;  1H8D H;  1W0Z U;  3DFJ A;  1A0H B;  3RC5 A;  3V3M A;  1NRR H;  2JH6 D;  2B7D H;  2H1U A;  1C5Y B;  5ABW A;  4ZKN U;  4X6O A;  1VJA U;  1OP2 A;  2W26 A;  2BDB A;  1SR5 C;  5HGG A;  5A0B A;  1O31 A;  2F83 A;  3UNQ A;  2ZWL H;  1LVM A;  1O3K A;  1HAP H;  1HAI H;  3U69 H;  1KXE A;  1EX3 A;  1HPG A;  1TGN A;  2SGA A;  1GMC F;  4X8T H;  2WPJ S;  3P17 H;  4ACB A;  4AFS A;  3SHC H;  2ASU B;  1QRW A;  4TPY A;  1KLI H;  2FPZ A;  1O3A A;  1AZZ A;  1ZPC A;  4X0W U;  2SGP E;  5CHA B;  2Z3D A;  1HJA B;  1EOL A;  2QAA A;  3KID U;  1UJ1 A;  4CRA A;  1C2D A;  2ZTY A;  1DST A;  1BMN H;  4CRF A;  4WJG 2;  2GMT C;  4AB9 A;  3ATL A;  4GAW A;  4H6T A;  1SQA A;  4X2W A;  1KYN A;  1QR3 E;  1UTM A;  4K5Z A;  4Y11 E;  1DT2 A;  5C3N A;  4X1R U;  1BBR E;  4TT3 D;  1MCT A;  4ISI H;  4ZXY H;  2J34 A;  3LOX A;  3M35 A;  3U8O H;  2I6Q A;  3F2F A;  4KTC A;  3ATW A;  3A81 A;  1P2K A;  2F9V A;  1DLK B;  3LH3 A;  1W7X H;  2BVR H;  2H6M A;  3NKK A;  1TGB A;  1ELC A;  1JRT A;  3AAS A;  3OFN D;  1ARB A;  1D3Q B;  1O35 A;  4Y79 A;  1MTW A;  2HLC A;  2HLD D;  2SGD E;  5DKM A;  1FV9 A;  2GJG A;  3E90 B;  1WTH D;  4NZQ A;  1NRQ H;  3QGN B;  3AAU A;  1GI1 A;  2BY5 X;  4FUH A;  1GBT A;  1WBG B;  2AFQ B;  4MNY A;  5EQS A;  2PKA A;  1CHG A;  1DVA H;  1RIW C;  2FOC A;  2GDD A;  4B6F A;  3PM3 A;  3A87 A;  3A7Y A;  4KTU A;  1SKY E;  3LDX H;  1E37 B;  2OQU A;  3RU4 E;  1ZJD A;  3TJU A;  4KP0 A;  1TIO A;  1SI5 H;  1OWE A;  3DSO A;  4O03 A;  1LDT T;  1Y5U T;  1GBD A;  2GV7 A;  2QCY A;  3SJK A;  1ZML A;  1O38 A;  2UUK B;  3K6Z A;  3SJ8 A;  1SLW B;  4MNX A;  1Z8R A;  4IGD A;  2A45 B;  1K0H A;  1C1V H;  1ZR0 A;  3F68 H;  1GBA A;  1SQT A;  6LPR A;  1AKS A;  1OX1 A;  4LOY H;  2BD5 A;  1QHR B;  1TBR H;  3A80 A;  3TLO A;  1O30 A;  1S83 A;  2ZHW H;  2BXU H;  1ZOM A;  4DG4 A;  1SHY A;  2KCP A;  1Y3U A;  4WY3 A;  3MOC A;  3F0O A;  3AVZ A;  2WV5 A;  1B5G H;  2FOE A;  3UWJ H;  3W95 A;  1CVW H;  1AMH A;  1T8L A;  9EST A;  2FOA A;  3URD A;  1JWT A;  3FO8 D;  2Z7F E;  1SMF E;  3MNX A;  5DP8 A;  3TH4 H;  5A8X A;  4M9F A;  3V0X A;  3H5C B;  1SOT A;  2G52 A;  3HAT H;  1F5R A;  3MYW A;  1CA0 B;  1QIX B;  3KCG H;  1AZ8 A;  3RML H;  2J94 A;  4DT4 A;  4AOR A;  3BTQ E;  2RA3 A;  3HKI B;  1QJ1 B;  1J16 A;  1UCY K;  2NU0 E;  2R0L A;  2ODQ A;  4NSV A;  1IQH A;  4ZCN A;  5DPA A;  4CH8 B;  4O9V A;  1NFU A;  2CV3 A;  2BZA A;  2YNB A;  3W94 A;  1C9P A;  5DK1 A;  2P94 A;  4X2Y A;  2G5N A;  5LPE A;  4X1Q U;  3HKJ B;  1ETR H;  2ZFF H;  2Z9K A;  3F2H A;  3NXP A;  2FX6 A;  3RXG A;  2GCT B;  3ZYD A;  3O8C A;  1O3B A;  3U9A H;  5LPF A;  1QTF A;  1QA7 A;  1N6X A;  1LPG B;  2CGA A;  3KN2 A;  1JRS A;  3M3S A;  5E2O A;  3O8B A;  1DWB H;  2OD3 B;  3P8G A;  3D49 H;  2KM0 A;  4AG1 A;  1A0J A;  1IQM A;  1D6W A;  2CXV A;  1MTV A;  1OOK B;  5AVD A;  3E16 B;  3M5O A;  1P9S A;  5GCH F;  3T62 A;  5KEC A;  3VFE A;  2XRC A;  2ZA5 A;  1HDT H;  2XCF A;  2SGE E;  1GI2 A;  2BDG A;  1YBW A;  4AFQ A;  2CK3 D;  4ABJ A;  1ZMN A;  2WZQ A;  2EEK A;  3DD2 H;  5EOK A;  1V3X A;  1MAB B;  4UEH H;  3HPT B;  2XYA A;  1V2J T;  5FHT A;  3OAA D;  4OGX A;  2KFW A;  4I8L A;  3R0F A;  1C1M A;  2QXH A;  4A1V A;  1K1N A;  2ZDM A;  4XOJ A;  1D3P B;  4ZXX H;  4RT1 A;  2GGV B;  2UWL A;  2GCH G;  1OP0 A;  1EST A;  1LHE H;  1HXF H;  1DDJ A;  2NU2 E;  3SQH E;  5DG6 A;  2D26 C;  3WY8 A;  5ESB A;  1GWA A;  3IG6 B;  1GI0 A;  5GJ4 B;  3ZV9 A;  1DIC A;  3SI4 H;  2ZFS A;  4K2Y A;  4ZKR U;  3MH5 A;  4O3T A;  3RMO H;  2XC5 A;  5GND A;  5DJ7 A;  1CGI E; 
#chains in the Genus database with same CATH homology
 3SU6 A;  4R8T B;  5GPI B;  3SZE A;  4A1T A;  2JDI D;  3SU4 A;  1E79 D;  3FO8 D;  2XCN A;  4I33 A;  4WH8 A;  4TSF D;  3SUF A;  4A92 A;  1WXR A;  3FOA A;  3OEH D;  4Z1M D;  2JJ1 D;  4M9F A;  4B6E A;  1COW D;  1KMH B;  5B6L A;  2IJO B;  3OTP A;  3ZIA D;  5C17 A;  2AHM E;  1DXP A;  3L6P A;  2O8M A;  4WH6 A;  3GS9 A;  5F53 A;  2OC0 A;  2KCA A;  3M5M A;  3VG8 A;  4A1X A;  2WPD D;  4DT4 A;  3DSP A;  4B73 A;  2LEL A;  3OYP A;  3LKW A;  3P8N A;  5EQQ A;  1OHH D;  3AK5 A;  2OBO A;  5CHB A;  2K8I A;  2J5U A;  5EPN A;  3WWB A;  4ZCN A;  2A4Q A;  3UB0 A;  2KR7 A;  2V7Q D;  2OC1 A;  1DY8 A;  2QV1 A;  4F55 A;  4B71 A;  4TT3 D;  1H8H D;  2OK5 A;  3M5L A;  3SV9 A;  2L6O A;  3KEE A;  1A1R A;  2F4L A;  5IDK A;  3EYD A;  3PV2 A;  4NWL A;  1DXW A;  2K0Q A;  3LOX A;  2WHX A;  5EPY A;  3M5N A;  3F2H A;  3U1I B;  4XD7 D;  2QE7 D;  2W6I D;  5C0U A;  2FP7 B;  3F2F A;  3SV6 A;  4KTC A;  3O8R A;  2WV9 A;  2JJ2 D;  4U01 A;  2F9V A;  3KNX A;  2KZ4 A;  1NBM E;  4TYD A;  3W1E A;  3O8C A;  5IK2 D;  5ETX A;  2IJD 1;  4K8B A;  5EQR A;  4I31 A;  3DCL A;  3KN2 A;  3O8B A;  1W0J D;  2KM0 A;  3SU0 A;  3OFN D;  3SU1 A;  5HKK D;  1BT7 A;  1S6L A;  3NRL A;  4Q63 A;  3SYJ A;  2YOL A;  4OM9 A;  2HLD D;  3M5O A;  4RI0 A;  2P59 A;  2XNI A;  3LON A;  4JMY A;  5FL7 D;  2YMS D;  3E90 B;  3PV5 A;  1JXP A;  2F43 B;  3WWF A;  2XCF A;  2K1Q A;  3SU5 A;  3SUE A;  3O8D A;  4FET A;  3WW7 A;  5EQS A;  4B75 A;  1BMF D;  5FPS A;  5FPT A;  2CK3 D;  1W3C A;  2A4G A;  3RC4 A;  2WZQ A;  3PRB A;  5FPY A;  4B6F A;  2F9U A;  4B74 A;  1MAB B;  3H09 A;  2W6J D;  1DY9 A;  3RC5 A;  2KCY A;  2OC7 A;  2OIN A;  1SKY E;  3F2G A;  3FN8 A;  1RTL A;  3F3B A;  2YMS C;  3OAA D;  2KFW A;  1E1R D;  3F0P A;  2XND D;  1RGQ A;  2OC8 A;  1W0K D;  3U1J B;  2KCO A;  2GVF A;  1H8E D;  3DSO A;  3P8O A;  3SUG A;  2YMS B;  3N7D A;  4A1V A;  1EFR D;  2FM2 A;  3OEE D;  3SUD A;  3SU2 A;  4ASU D;  1NS3 A;  1NBM D;  3RC6 A;  2GGV B;  2WSS D;  4I32 A;  3KF2 A;  3PRD A;  5T1V A;  2A4R A;  2QF4 A;  4B76 A;  2FOM B;  4NWK A;  1FX0 B;  3OE7 D;  3SV7 A;  5DSF A;  2VBC A;  4Q4L A;  5ESB A;  3FKS D;  5DN6 D;  2KCP A;  1CU1 A;  5GJ4 B;  2QF5 A;  2JIZ D;  4WF8 A;  5C0T A;  2XOK D;  1N1L A;  3N7E A;  2OBQ A;  3F0O A;  3N99 A;  5CDF E;  4YXW D;  5H4I B;  5GND A;  3SU3 A;  3SV8 A;  2M2A A;  1E1Q D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...