3NRQA

Crystal structure of copper-reconstituted fetp from uropathogenic escherichia coli strain f11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
150
Chain Sequence
b'KEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Characterization of a Dipartite Iron Uptake System from Uropathogenic Escherichia coli Strain F11.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 24
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrqA00
3LZRA 2O6EA 5I0XA 3PJLA 3LZNA 3LZQA 3LZPA 5I0WA 2O6FA 3LZOA 5I0VA 3NRQA 3PJNA 3NRPA 5I0YA 2O6DA 3LZLA 2O6CA
chains in the Genus database with same CATH superfamily
1MI5D 3FTGA 2O6PA 5F3HB 3L3DA 1SZNA 5DJ8A 4XN4A 4FFTA 4CMMA 1JZGA 2H45A 3VI3E 4FQXD 5BNXD 2NNCA 2OMXB 4AG4H 3MRGA 2OTUA 5HD8C 2KLRA 2KH2B 4POZD 3VRIB 5JQ6L 2X4OA 4P9HH 5KBKA 4ZUTB 3BWUF 5H8DA 2HMID 4YBQD 3WHE1 4HWEL 3SJVE 2NY6D 3SPVA 3EJRA 3LDBB 3V9EA 1XMEB 1N18A 2KI6A 3A22A 3DJRA 3P3RA 3L81A 3VTTA 2IGTA 4FFWD 5DHXB 3U9PL 2GG1A 2SODB 4JJ5B 4ZG1A 4MMYB 4G8GE 4AWJC 1HYSD 5FHAH 3SGJA 2XVBA 4B9CA 4N2NA 2A6IB 3BDBA 4XCFL 1ZV2A 2OV0A 3L4WA 4WI6A 3ZTDC 1D9KA 1HEZA 3TA3A 5C92A 4W4NA 1J87A 2ZTBA 1CGTA 1XFPA 3ZE0F 1DVFD 3HG4A 3MUGB 1P7KA 4QXTA 5AAMC 5AW3B 4QGYA 2X4UB 2F6AA 2GABA 3KW7A 4M3JA 5D96C 2Y4SA 2C9UA 5T5FA 3TLRA 1UKSA 3T04D 3L4CA 3NIFF 1A0QH 5K59F 5CU9A 2W65B 3DGDA 3NSCA 3ZRSA 3ULVC 1AOZA 1H6UA 3QNZB 4WSGA 2O1AA 2I32A 4PRID 3ARDB 1X9RA 4PS8A 5CS7A 1TENA 5FEBA 2G30A 4U6VH 4KUCD 5EEXA 2ZYRA 1P53A 1P4IL 1NGPH 2FEEI 3CU1A 4WFED 4I4WB 2AHIA 2W9DL 4YLQT 3VNZA 4E41D 3NCBB 4G3YH 1HINH 4XXDA 3VGAC 3O6ML 4FS0A 5HVWA 1MCKA 4NQEA 1GYUA 3WDIA 1RHFA 4EUPA 2A9NH 3TL5A 1PY4A 5AW5B 3HNTH 3TPUB 2W07B 1JK8B 2H6PA 5F0PB 1U8MA 2V3EA 4MVBC 3HMXA 5IJKC 4G8EB 4UV4L 4OM1L 3VG9C 3WE6B 1A25A 4JM2A 5J8OA 3VFSA 2VITA 3ARFA 2B16A 3IKCA 1FPTH 4ZZFA 3PFQA 3GSNB 2VWEC 5DTFB 1NCIA 3K46A 4HK3N 2YWZA 5TE6H 1G94A 4NNPH 3DI2B 1KCSL 1LHZA 2QELA 1UOVA 4X6EA 2WXHA 4XBPA 4U6HB 3SBWA 5D1ZD 3PWJA 4YHIB 1KIQB 1QHQA 2YD5A 4K07A 4G6AD 4NERA 4WHYG 3WO4C 5IMLB 3E80A 3X17A 4B97A 1TPXB 1SXNA 3A4AA 3D6GA 3C5ZC 3NJVA 3QFDA 1AMYA 2P3YA 1FJ1B 1MJ8L 4WO4C 5AALA 5HI5C 5B1CA 4H8HA 3RFZB 4Y4FA 2R2HB 3TC9A 4GAJH 4PMEA 3JV4B 5T3XL 1NM9A 1AQKH 1RUPL 5CJ8A 1LXMA 5FCUH 5CCKH 4M61A 3WD5L 2Q8BH 5E6UB 1AKJA 1T1ZB 3B7YA 3IDYC 5B39G 1OCOB 2DQ6A 4TKWA 4DETA 1FHGA 1O6VA 2D7QA 2VDRL 4WU5B 3TWCL 4ZX6A 1FNAA 4BZ1H 4GOSA 3HJEA 2WSDA 3DDGA 3IMRA 3OG6B 3WUZA 3MBWA 3LKOB 5K9QI 2R29A 3BKYL 5AVRB 1SJEB 5EO1B 1PSKH 4X9HA 4R84A 4HIHA 4EKJA 1EH9A 2V7NA 1CE1L 1B2YA 2CG9X 3KLAB 3EG9B 4MAYD 2HRPL 3NTCH 3V6OC 4GRLB 1TOXA 3IGAA 3FTGB 4OLUL 1FRGH 2W59A 1BBDL 3L3DB 4FFVC 4OF6A 5EC2B 5C6TL 2R83A 5DJ8B 1A7OL 1CB4A 1CFMA 4YHYC 1AZUA 2LLLA 4GXVH 3EOTH 4H2CA 4CMMB 4JPKH 1SEBA 1TJGH 4L1BA 3D85D 3X3GL 1LWHA 3QYCA 4WEMB 3MRGB 2OTUB 3SDDD 4UAOC 3QCUL 4NIKB 1ZA6B 2X4OB 2KPNA 4JDTH 5LBVA 4IRZA 3OXSA 5ESQA 1OGSA 1GKOA 2NY0C 3DVNA 1Q9OA 4XCYA 3UO1H 4CC4C 3CFIC 1MAKA 3FW6A 2MCMA 3SPVB 3O0LA 5D7IF 4BELD 1I3RB 3D18A 3FS9A 4JO5A 3IXAB 1CXFA 4TNGA 4YBHA 5DD6A 5B38A 2IGFH 3OAWA 4XRCA 3BKCH 3NJGA 2V37A 3DX7A 4UWQB 1UA3A 3O45A 4H0IA 2PPFA 1X4ZA 2BNRA 4L4JA 2F9BT 3AGVA 4EIUA 4BH7B 4K5LA 3OZ9H 4HIXL 4P59L 1RUAL 4ABVA 2A83A 1D9KB 1RJYA 1HEZB 3TA3B 5IV2A 4GRWB 1CICC 1RVFL 1ZIBA 1BVNP 2AK4D 1P7KB 4QXTB 3N40P 4P3CH 4XP5L 2Y7MA 3NABL 3O0RH 5DMJB 4HCFA 1ZLEA 2E9BA 5CZVL 2QMKA 4FNRA 3H54A 1S9XA 4OZIA 2EDNA 4RWHA 3C12A 5TTRA 3TJHD 4F37K 4FQPA 2GTWA 4GNKB 4Z7OE 4Y7OC 4HT1L 3ES6A 4DQOL 4ZMWA 1IGJA 2ODHA 4I9XA 5BUAA 1IGTA 1YYMH 4B0MB 3KVDD 1I7TA 4Z7WA 3K6FA 4XXDB 5EO9A 3FQXA 3MNZA 1F4WL 1NMBH 4EUPB 2PNDA 2ZOKA 3VA6A 1YEGH 1CL7L 2H6PB 2NY1C 1U8MB 5EZJA 3QT2A 4G1EA 2B20A 3ELQA 5EULV 1KCUH 4NN7B 3PWVB 4JM2B 3ZTEA 3IK2A 2O5YH 2NY4B 1MNUL 3VFSB 3L6FA 1NDMB 2VITB 3ARFB 3BP6B 3IKCB 5I19L 2P80A 3PWPA 1DDHA 3PPEA 2CLZB 5E5MA 3BKML 3T2NL 5E9NA 4ES9A 1JPFA 3EUUA 2QQNH 4MNQD 4X6EB 4XBPB 4PP1D 5FW7A 4CU8A 3PWJB 3C8DA 1E5ZA 3OKKA 5AOKA 1QX1A 3DOHA 1E27A 1CCZA 3MACH 1FFPA 4YFLF 4P05A 3FFCB 3QFDB 4UT7L 4HMCA 3B7RL 5KSAA 1EHAA 4G6KH 3LD8C 1DZ0A 2WMPA 2NX5D 4Y4FB 4N2MA 3CHPA 2D9CA 1ET5A 4WFHD 5D8JH 1Z5HA 2Q9OA 4BXSV 4V1DE 2QMJA 4M61B 2WQ8A 4N8UA 2R9HD 5AZEH 1AKJB 3APMA 3GXFA 4ZDHA 2AXHA 4WLCA 3L5WA 1RZKH 1KT2A 1GY1A 2XLLA 3MBWB 4IJ3C 4PGCA 4RAHA 3WTXA 1RUMH 3K6SB 4HIHB 2F08A 1AXSA 2V7NB 1E65A 4JDEA 4JQVA 5DMIH 3LHAA 4TULL 4AGLA 1VCAA 2LFEA 5AOJA 3IGAB 3E6FA 4MYWB 5DSCA 4A6YL 5IBUB 1SY6A 4RAVA 3LZNA 1M7IB 3WTYA 5SX4H 5GS3A 5I8CA 1SEBB 1KYOJ 2WZ6A 4I48A 1HHJA 1WHPA 3TYGH 3T1FA 4J3BA 3VDAA 2JI1A 5L88H 2JKWA 3A5VA 2E76C 3CWGA 3TZVA 3EJYC 1KCBA 3OXSB 2H0PA 5ESQB 1KYDA 2WSKA 1PD6A 1NEZG 1Q9OB 3DVNB 4XCYB 4AG4L 4AIXA 2V5RA 4F8NA 2CLRA 1E5UI 1A4KA 3D18B 2EDTA 5ALCH 4OZGA 5B38B 4P9HL 4XRCB 4H25A 1T1WA 3DX7B 3ZYJA 4I1RA 3CFQA 3O45B 4FYRA 4J3OH 3CDFA 4JFEB 4AK1A 2HFGL 2BNRB 1D5MA 1OE2A 3ARGC 5BPPA 2XFGB 2XT1B 2EEBA 5JW3H 5L9DH 3GXIA 2IDUA 4GAFB 2A83B 1RJYB 1PZ5A 5IV2B 4S2SA 2R0LL 4N8PA 2E6QA 5FHAL 4D9QE 4A04A 4MDRA 4AGNA 2ZWKA 2H8PA 3UYOD 1YUHA 4RLDA 3WIIH 1S9XB 3G6AA 4KI1A 4UZUA 4OZIB 3ILEA 3HZMA 2NY2D 3H56A 4NX0A 1MXGA 4PJDA 3AU0A 4U3HA 1DEEA 2Z31C 3MNVA 3HE6A 2GTWB 1A0QL 4FHBD 4NQCD 3ES6B 4PJXE 3UAJC 1ID2A 1F0LA 3BMVA 2GSMB 1IGJB 2XY2A 4OCRH 1IGTB 4OFYD 1I7TB 5HDQH 3RP1A 1TLMA 1YMMD 3SD2A 3TONA 3ZVVA 1I3GH 4Z7WB 1R3LA 3IMSA 5EO9B 2JI3A 2FIRT 3FQXB 4JRXE 1HSBA 5T1KA 3SE9H 3VB8A 3MNZB 2WTRA 1G0XA 5T1MA 4HWBH 4U6VL 2ZOKB 5B3JF 2EC8A 2WSPA 1OD9A 1NGPL 4KQ4H 3ZY7A 3OBAA 2WN2A 1W16A 2ADFH 2XIBA 3L95A 3QRLA 2UX6A 4G3YL 4G1EB 3FRUA 5EZJB 1HINL 3WXWH 1NAKH 4Y2NA 4XNBA 1NJ9A 4X9FA 2ZXBA 1H19A 2A9NL 3UH8A 5FWQA 3TT3H 3V8CA 3HNTL 3OC8A 4N0FB 2C3WA 4DH2A 2XWZA 5B3SB 1DUZA 3PWPB 1DDHB 5E5MB 4C58B 4PD4J 3VD4A 4LCUA 3SPJA 2XX1A 1JPFB 1ZY9A 2X1PA 1MCHA 4P5TC 1BM3H 1FPTL 5DFVD 3OKKB 1F00I 3OWEA 4MFHA 4PJHA 1E27B 1AXTH 2Y3NA 1ODUA 3IYLW 5BVJA 1FFPB 2VSMB 5TE6L 1NBQA 2IDCA 4NNPL 1KWKA 1KCKA 2HWZH 3MA9H 3T0WA 1S9WA 3WTWA 3V4UH 1OXYA 2WMPB 1NKRA 3HC4H 4DJMA 1AXIB 1F97A 4JVWA 5KSUA 1AE6H 2DDQH 4A7GA 1X9QA 3BIBX 1YNTA 4ZDHB 3L5WB 3S3CB 2WV3A 1YSOA 1KT2B 3BZDA 4PJ9A 4GAJL 5CBAA 3MLUL 2NQCA 2V5MA 1AQKL 1A47A 5FCUL 5KJ7E 4CRPA 5CCKL 4LHUD 2DQDL 5MEOA 2Q8BL 4QLWA 1WZ1H 4XPAH 4JDEB 4M7KH 1XB6A 5AKVA 3HFFA 2ZOOA 4K55A 4PJCF 1AY1H 4N3UA 1KCRH 4KKLD 1ASOA 4BZ1L 4IYKA 3Q2LA 3E6FB 5DSCB 3MUJA 2W1NA 3OAYH 2A4ZA 1IKOP 2OI9C 3PV7A 1PSKL 4HGWA 3Q43A 3TBBA 5KOVC 4YS4A 1LP9E 3O11A 1A1MB 1RIVH 2WLLA 5I8CB 2VT0A 1QPKA 3NTCL 1HH6A 1HHJB 1T0MA 2BIQA 3OB0K 4FQXC 5EF3A 1MCOH 3T1FB 1AS6A 4G6FD 1FRGL 3BSZA 3QJFA 2NZIA 3K5SA 4POZC 4MXVE 2XNAA 2YJQA 4GXVL 4XCEA 1RLBA 3EOTL 1X5JA 5GS2H 2DYRB 1JDDA 1S9VA 2BP3A 5AVUB 3TZVB 4CU6A 4JPKL 2ED9A 2HMIC 1TJGL 2PF6A 2WIMA 3A67H 4G5ZH 4YBQC 4A2GA 5IMKB 4AIZA 2NY6C 2CLRB 1A4KB 3JYCA 2APFA 1WFJA 2ZWYA 3CZUB 1JWMA 4OZGB 2GFBA 4JDTL 1I8UA 1WO2A 4F37F 3QWRD 4NXKA 2J55A 4H25B 1T1WB 4FFWC 3FU5A 2J1ZA 2EXTA 2PXYC 4UIKH 4WIQA 3UO1L 1V7MH 4K0OA 1HYSC 1D5MB 2QPUA 2BERA 5C0FA 2AJYH 2IGFL 4PB9H 3NYKA 3BKCL 3D39E 4FQCH 1PZ5B 1KBBA 4S2SB 5F7UA 2YXMA 4K71C 1DVFC 4I7ZC 2MOQA 5FAAA 1CT8A 3EYQD 5J4MA 2MNJB 2P47B 1U8QA 3OZ9L 3C6SA 2WWMC 4BSWA 4N2BA 1QFWI 1YUHB 1QSED 4G72B 1L9RA 4AENA 3VO0A 3HZMB 4PJGA 4PJDB 2D3LA 1S3KH 2QV2A 3O0RL 1DEEB 2WZAA 1SQ2N 3LOWA 2E59A 2IBZY 4L0ZA 3CZSA 3MNVB 1X5IA 2VGLM 3HE6B 3G9VA 4HLZG 3FMGH 3PAVA 1Y1DA 4KGJA 3AQZA 1G1YA 3U7WL 4RQQA 1LO4H 4RSYA 1R47A 1J0HA 2JQAA 1CFSA 3ZRFC 1YEIH 1PNDA 2D2CC 4KWUA 5HYSG 1R3LB 3ILQD 1HSBB 4LBAA 5T1KB 5KVDH 3VXRE 2WTRB 1T5KA 5T1MB 1ROCA 4ELME 2WO2B 4PJEE 5FOJA 2FZ3A 5JIPA 3R8QA 2FJGA 4PWIA 1QFPA 1YYML 4BGDA 3L95B 4IGBD 4AYDC 3G5VA 3FRUB 2DEXX 2FVNA 4P3DA 4S10A 1ODAA 1NJ9B 2Z1KA 3SDXE 3E1ZA 5I6KA 3MLZH 3LQMA 5AVQB 1NMBL 3RZCA 3CC5A 2V2WA 4DEUA 1DUZB 1U3YA 1YEGL 2LQRA 3LB6D 4EAEA 3BP5A 1KB9K 2RIKA 3WJJA 4IJTA 5KUKA 1KCUL 4LCUB 3IS0X 2BH0A 2MFNA 3NZHH 2BJMH 5CJBA 1H8NA 5D1ZC 2B1OA 3UDWC 4ZSOA 5KVEH 4EN2A 2CO6A 4G6AC 5BVJB 1NOLA 2WINA 2X09A 2EDBA 4HCRA 4AZ8A 5DZ9A 1S9WB 1BQRA 2QQNL 5TDOA 3F7YA 2LAAA 3O2VH 4LFHD 2F0CA 5E8DH 5CGMA 5KSUB 3MACL 1WWCA 1I8MA 1YZZA 5C0AD 5IW3A 5IHBA 4HVBA 1YNTB 1ETB1 3L5HA 3NJLA 4G6KL 4NAJA 3UYRH 3R18A 1KBVA 3QZPA 4A7QA 1Z9LA 4PJ9B 5CBAB 4KUCF 5IB4A 4Q9BA 3KBFA 5AVVB 1EERB 5TDPA 3FQTA 5MEOB 2Q87A 3ZMRA 3PV6A 5AZEL 4AT6A 1P9MA 4BCXA 3EOBA 1RZKL 1X5KA 3CXFA 4MAYC 4X5LA 3CD4A 3JVGA 4H88H 1W91A 1H8SA 3S35H 2BVPA 4UDUA 4HGWB 1RUML 4PS7A 4CKQA 4FDWA 5JIKA 5D1QA 5DMIL 3O11B 4YPJA 5CD5D 1FFTB 2WLLB 3E9UA 3DXAE 4HKJA 4QD2E 4PHZA 1IO4C 2OM5A 3B9DA 1HH6B 1T0MB 5GJSH 4ABUA 4EKXA 5C0EA 2DYSB 2WAQA 3QJFB 3RZWA 1M6OA 3SDDC 3AMKA 1C1EH 4TUKH 3PL6D 2VSCA 2XNAB 5DJAA 2FWSA 1T7XA 1S9VB 4P04A 4K3HA 5C9JA 3G5YA 3TYGL 5IJCC 2NLJB 4AIZB 3ABZA 4DN3H 5J12B 5L88L 4MZRA 5KBNC 3HUJA 3L5IA 4ZW5A 1JWMB 1QR4A 2GFBB 4AC4A 3FONA 4XBEH 2XTJE 3F04A 4QKTA 3W82A 4F5CA 4HEMA 2ITDA 4JAMA 1ZLWH 5KS9F 2VN7A 4KX9A 1E4XI 4JPVH 2EVHA 3GMNA 2EDOA 5C0FB 1IM9A 5ALCL 4ECNA 4CDHA 2Y5QA 3MGTA 2V7HB 1MXDA 1UZ6F 3BVTA 3OF6A 4OCYH 4YDMA 5C0GA 5BUGA 2ESVA 2RCSH 1CT8B 3LRMA 3LS5H 1U8QB 1TKWB 3FTVA 5JW3L 3C6SB 5L9DL 5MERA 2NW2A 3VGDA 4BSWB 1JWSA 2XHNA 4AENB 4JY4A 1D5BA 3NIGB 4PJGB 1FFQA 3KBPA 3KJ4B 4AEIH 1FCGA 4NBXB 5DZPA 4ZYKA 4G8AC 4OZFH 4LVHC 1KGWA 2ZX9A 4A7SA 5AAWC 1KUMA 3G5XA 2IAMD 3GUFA 3WIIL 3ZHFA 4RQQB 2A73A 2MCPH 3LKPA 1EZUA 1G5AA 3FHEA 1KMGA 3DX4A 2DB8A 4XMWA 3FH8A 1O75A 3X11A 2ADYA 2YMTA 4HHGA 4BH8A 1UURA 1YYLH 5HDRA 3KPQA 3QJHA 5IUCA 1IIKA 3ZKXC 2FJGB 4OCRL 4ORZC 3QARA 4NZFA 5HDQL 3EJSA 3G5VB 1I3GL 4P3DB 3ULVE 3SE9L 4AH2A 4HWBL 4I1NB 2GJ6E 3RZCB 4F9LC 3CC5B 2V2WB 1GS6X 2O6CA 2R8SH 1BAWA 1DQJA 3IPFA 4KQ4L 4DNLA 3BP5B 2ADFL 3WXWL 1QBMH 2CNYA 4AVKA 1NAKL 1TTUA 2GY7B 3GJEA 3PHOA 3G3LA 3TCXA 4FMFA 3S3JA 3JZ7A 3TT3L 4PP1C 4F33A 1JS4A 4MJ2A 4ZSOB 3LAFA 2Y36H 4JHZA 3AG1B 5IK3A 2CO6B 4P23D 4E9YA 1N6QH 3ML8A 1F41A 4IBZA 1I8LC 1ZTMA 2EEDA 2NY5H 3VXQA 1ILUA 3ROOA 1O6TA 1G7LA 4N0CD 4KXDA 5TDOB 1BM3L 1UENA 3F7YB 2WZPD 4OF0A 5F6HJ 1EXGA 5DD3H 1DN0A 1AXTL 3DX0A 3H9SA 3QW9A 1I8MB 2XXCB 4LCCC 2JIXB 1RZ8A 2MQ3A 5FV1L 2HWZL 3MA9L 2R9HC 4OJAA 2C4FU 3V4UL 1T1YA 2VWEE 3HC4L 4B9YA 2GBTA 1L0YA 3QCTH 1AE6L 1PX3A 2DDQL 3CSFA 3G6JF 3PPSA 3PREA 5IB4B 3WI9A 3NIDF 5TDPB 3SE6A 3FQTB 4MMXC 3ARDD 3PV6B 5HHOE 4AT6B 5EU7C 1UFUA 2QGBA 4MQXD 5GRVL 3QO1A 4U0RB 3EOBB 4WVRA 3K7UA 1K72A 2GBUA 1I7UA 5IFHH 4YMPA 4XOCA 5I6XB 4AW4A 5AB1A 4FQHA 2BVPB 4UDUB 2I7OA 5D1QB 1PBYA 1WZ1L 4L8SC 4M7KL 4XPAL 2AJXH 5D6DC 4F2MA 2QV4A 2HXAA 4HKJB 3VFGH 4OZFG 1AY1L 1CFBA 1KCRL 5F7YC 3GM0A 2WLHA 5FUCC 1QASA 4QRRD 2H5UA 2FB4H 5C0EB 5DEFA 5H37H 4OCLC 3VG0H 1A6PA 1NC4D 5DJAB 3GLAA 3N1GC 1RIVL 3NK4A 5L8JB 3PQYE 4OD1H 5C9JB 1H3PH 3G5YB 4DFHA 1MCOL 1PX4A 2CRZA 4S1RH 1CU4H 5IVXA 1ZJBA 1TQTA 4X5WB 1JZ8A 5ISZE 3HUJB 1GVIA 2OYPA 3V6OE 1Z3GH 3ARVA 4XXCA 3FONB 4G9FA 4PP2A 2ITDB 2HT4C 1BJ1H 3A67L 4JAMB 5E2JA 5J9PA 1P7BA 3FCBA 2EO9A 3G5ZA 3MNDA 5HYJD 3GMNB 1IM9B 4OZHE 1DE4A 3MGTB 3WEXA 3NJNA 4OFVA 4RFOH 4BD4A 4HU2A 4UIKL 3P54A 4OI9A 3OKDA 1V7ML 5J3HC 5C0GB 3KGUA 2ESVB 2Z7WA 4X9BA 3ETBF 5I24A 2IBGA 1B9KA 5L0QB 2C9PA 1M9WA 1QLFA 5I28A 3QR1A 4PJBF 1GCFA 2AJYL 2NW2B 3L48A 1JWSB 4PB9L 3NAAH 1G9MH 1HNFA 4FQCL 3T3MF 4JY4B 1D5BB 1TTBA 1AZCA 2WXKA 2NY2C 3BQUA 4I2XE 3IVKA 4AYMC 1YQVH 2OXHA 4ZYKB 1R4XA 3G5XB 2JKNA 2X4SA 2J8UE 5CXPA 2EH7H 5I1IH 2APSA 1RUKH 1U3HA 3MOAH 2Q3XA 2A73B 5TF1H 1FGNH 3SPHA 3LKPB 3U4KA 1ACZA 1S3KL 3EDEA 1LQSR 5CBEA 3MN8A 3X11B 3FMGL 3F7PC 1IM3D 2NSMA 4W4OC 3N43F 3KPQB 1NANI 3JZYA 5IZ7A 4KJWD 1LO4L 3BAEH 3QJHB 2BVTA 1GIGH 2OSLA 4WUKH 3F83A 3QEGH 3U1PA 1YEIL 2WCSA 1E9OB 3DK0A 4XHQA 2PO6A 2V2XA 3PCYA 5EDXA 3O4OB 3UCRA 3EXLA 1E4JA 5EZOH 5KVDL 5BUPA 4TXVB 5B3NA 5JQHC 5E4AA 4K3JH 2CGYA 5CUSH 1WZKA 3ECUA 5LXGH 4QLRA 1Y0LA 5K9KA 1XF5A 3GJEB 4BCZA 3PHOB 3HS9A 3N1QC 3DECA 3MLZL 3WN5A 3H53A 2XIDA 2E4TA 4F33B 5IWLA 2K6YA 3O2DA 4XBGA 5DFVC 3D3VE 5SWZA 5IK3B 1N3NA 5C0ND 3SBPA 5GGSA 4PI2A 3SYOA 3VXQB 4MXWH 4TMPA 1R3HA 3B5HA 2W60A 4D7BA 3ROOB 1G7LB 3NZHL 2BJML 3ZE1B 5I6NA 2ZF9A 1IAOA 2VDKH 2CO1A 5KVEL 1RERA 4M5SA 3H9SB 4ANXA 4ZMTA 3P69A 3POCA 3WJMA 1RZ8B 3T3PF 4NQEE 4QTIH 3TPKA 5F7FA 1T1YB 1AR2A 1N8ZA 4PJ5E 5F7EH 1GL4B 3DV4A 5ICUA 4F8PA 3O2VL 5E8DL 4TSBH 1XGQA 2AQ2A 4OJFH 1EHNA 1PG7W 1IUZA 4XNDA 3UYRL 3V95A 4QO1A 3QO1B 4WFGD 1Q9LB 5C07D 2FO4A 4Z7QB 1VFBA 5FPIA 5I5IA 5ANMA 4PJ7E 1CUOA 1I7UB 1YEHH 4KKLC 2OSYA 4K73A 3QNYA 5GS0D 4ZMLA 4FQHB 4H1LH 3GZPA 3V0GA 4N6QA 4F2MB 3HE7D 4LL9A 4RX4D 4FYTA 4OIFA 5F1NA 3DHPA 2Z8SA 1DJSA 4H88L 3D33A 4L48A 4I1PA 5J5EA 1G7QA 1MN4A 5DEFB 3S35L 3F2LA 4RZKA 1MCDA 1UM4H 2DM4A 2WLJA 1PIGA 5CM1A 3MFFA 3N3EA 3RIAK 5GJSL 3J07A 5AB9A 2VXQH 5IVXB 4IOSA 1QSFD 1C1EL 4TUKL 1V3JA 3PP3H 3JWNH 1A9EB 4G9FB 4PP2B 3S3DB 4LCWD 3EO0A 4KROB 3N44B 3T6WA 5J9PB 3CVDA 1UC6A 5DXWA 1T2XA 2SEBA 3G5ZB 3N1MC 4DN3L 3FFCD 4IKKA 3HBZA 4GIPD 2C4XA 2YR3A 3RE0A 3ZYZA 1DE4B 3ZE2E 3WEXB 4XBEL 3SZKC 2W94A 1FA4A 2HFEA 3LX9A 5D7KE 3EGSA 1AG6A 3QC6X 5CMAA 3EAKA 3EYQC 4JPVL 1S7VA 1QLFB 3GPSA 4RA3A 1A2YA 1FSKC 3SO3C 2D2OA 3HG3A 4OCYL 4LEBA 2C7UB 4OUOA 3BQUB 3IVKB 2RCSL 3KM2A 3OGOE 4O9HH 3UBGA 3QUKA 1JHTA 2WNKA 2OXHB 3LS5L 3TH4T 1DQVA 2X4SB 3JTTA 2JCCA 4L5FE 1U8PA 4UQ9A 2EVFA 4JPQA 1U3HB 4ABWA 2FBOJ 4Y1SA 5F3BA 3VQ2C 3IJ9A 1ZS2A 4GO6B 5CO1A 3VXSE 4AEIL 2WANA 4M02A 5CBEB 1PEZA 3UBFA 4FJ6A 4QNPF 1IGIH 2WOBA 1JUFA 4ZS6D 3KR3H 5K1NA 4IDLA 1PAZA 1ZT7A 5FYKE 2OSLB 2MCPL 4EN3D 2ETWA 1KTKE 2PO6B 4ZD3H 3JT2A 2V2XB 4IGBC 4M00A 2X05A 2N59A 1A02N 5C0JA 4QAMB 1PVHA 5JOEA 5EUKA 3WNMA 1YYLL 5FLVA 4HUVA 3B9KA 3GLZA 1HHGA 3ZTJG 1SJHA 4FADA 3LB6C 5B1AB 2WLIB 4LKXA 3NPZB 1Y0LB 3ULVH 5D93C 3BRFA 5K9KB 3RIFK 1XF5B 4K9JA 3WN5B 1KLGA 1JDCA 1SRDA 5ANHA 4MXVF 2R8SL 2XTSA 1NCBH 4JFED 1A21A 5IKCA 1N3NB 2D73A 5GGSB 2BS8A 1QBML 2AQ1A 5F9DC 3FSWA 4B95C 3B1UA 1R3HB 1RHHA 2W60B 3V55A 1BF5A 1JZ5A 1J8HA 1D3CA 2I9TA 3PUCA 3POHA 4PJIA 1IAOB 2Y36L 4FHKA 3JWNG 5AW1B 3W9DA 1SN2A 4GSXA 4L4VD 3WJMB 1S7XA 3NGBB 4CW1A 3BVUA 4RFNC 2MTPA 5D7JA 2NY5L 4AC2A 3TFBA 3I9IA 4U1KA 1MW2A 4ZS7H 2KLSA 4LNRA 2ENJA 1N8ZB 4J8QA 3DV4B 3MJ8B 4P2OA 1KIUA 1UKTA 2CCWA 1XGQB 5DD3L 1AGCA 2UXGA 4PJ6A 4QO1B 3MV9E 1E3XA 2FO4B 1VFBB 2JJTC 5ANMB 3GUTA 1CI5A 3QNYB 5AG9A 1PAMA 4RNRB 4QT5A 2Q2EB 5CD5C 3GDCA 5EPMA 5F1NB 5IFHL 3U25A 4D0BA 2P5WA 3P9MA 3N04A 1G7QB 2AJVH 4AGPA 4FNPA 4BRVA 5DVPA 4HJJH 1UWGL 2AJXL 2XZQH 4K8RL 3MFFB 1KEGH 4Q8BA 3VFGL 1CYWA 2ZXDA 2I60H 3IPEA 1WITA 4S1DD 3PWPD 2FB4L 3L4YA 4X9YA 3T8VA 2EIKB 3VG0L 1U2CA 2ARJA 2G75A 3KLHD 2O5ZH 1MI5E 2YGNA 3EO0B 1JD9A 5I0YA 1ZXKA 3IJ7A 4OD1L 1BWMA 1UCBH 1H3PL 2SEBB 4S1RL 1CU4L 4AIOA 4JFFD 3CVHA 4B41A 5HHPA 3TWYA 1JZFA 2G2PA 1Z3GL 3QIBD 1HYRC 2HFEB 2F74A 3EGSB 2A74C 3K1DA 4TQEH 5CMAB 4X6CE 1S7VB 3W3BA 4Y1AE 1A2YB 1FNSH 1CF1A 1FNEA 1QAWA 4RFOL 3GNMH 1I9RH 3IFNH 4NAQA 1E30A 4GB9A 4Y5VB 5GPRA 3UTZA 2K0RA 4U7SA 3TOPA 1ZE3C 3QUKB 1JHTB 2CSPA 4HIJA 1OP9A 1G9ML 3NAAL 3JTTB 4C4UA 2JCCB 1I3VA 1U8PB 1OAZH 4IBYA 5FKPA 5F3BB 2JJWA 4N5ED 2J7LA 2CAKA 3HHMA 1YQVL 1S6NA 2FK9A 2ZNWA 2YFOA 5DC9B 5H35A 2GHWB 1E4KA 3LNHA 1HZLA 3GRGA 4MS6A 4BUHA 2EH7L 4XC1H 3SY0A 5I1IL 1L6PA 1RUKL 1ZT7B 3MOAL 4RRPM 5TF1L 1FGNL 1OL0A 5E4EC 3ZDXE 3VJ6A 4K5OA 1TFPA 3MLYL 4GI9A 4DUWA 4KVNL 3MV01 5C0JB 3UBHA 5EUKB 4GKOA 4HUVB 2FX8H 2MH4A 3B9KB 1NQBA 1AIFB 3BAEL 1GIGL 5IESH 4WUKL 1HHGB 3QEGL 1SJHB 1TZIA 2ICEA 2L04A 4LKXB 2CD0A 2OTWA 1ZIAA 2OMZB 4JFDA 5EZOL 3OSKA 1KLGB 4A1RA 3I2CH 2EE9A 4DUVA 4K3JL 5IKCB 2LHAA 2JQZA 3FQUA 4BHUI 5MEPA 4P23C 2EH8H 5CUSL 5LXGL 1AFVH 1PTZA 1RHHB 3SQOH 1W80A 1J8HB 2ARWA 2I9TB 1O6SA 1QW9A 2ZUQB 3ZX1A 4N0CC 1JVOA 3C6LA 4PJIB 2X5PA 3HOGA 2YRLA 5D2NA 3W9DB 2V9UA 4CW1B 2LOEA 4M6OH 4QGTA 4BQ6A 5D7JB 2WXJA 3UJJH 4GKLA 1B4TA 4L3EA 2OR8A 1KYOK 3HN5A 3ZYOA 4U1KB 1YVLA 3M86A 3T0VA 1U9KA 5E1AA 2VDKL 4P2OB 5E95B 1KIUB 2YEQA 2B5IB 1QLEH 1AGCB 4GFTB 2IMMA 2YGPA 1I8AA 3AABA 4WNQA 5KANG 4HH8A 3RIAF 2JF1A 3ZO0A 1BZ8A 5ECGA 2L7JA 3ARDC 4QTIL 5IJBC 3L45A 1IGMH 3ZJAA 3UYPA 1F4YH 3F00A 1FORH 4MQXC 4O51A 5CP3A 5F7EL 3RBGA 3GUTB 5DJZA 4TSBL 5C09A 2CPUA 1CGUA 5DI8A 4OLVH 4OJFL 1NICA 2ZP8A 5HHMB 5K5YA 1CVRA 4NFCA 4BK5A 5DU7A 2VH5H 1F4AA 4H13C 4QT5B 1QZNA 3P77A 1WK0A 4U7MA 4PJHE 4M62H 3RNQA 5EPMB 4HWUA 3DETD 4HK3J 4K3GA 2P5WB 3P9MB 3VNYA 2TRYA 4BZYA 3O3BA 4RWYH 3U83A 3JWDC 3L3GA 4F8TA 3U0WH 2ADJA 3Q1EA 3GHBH 3B1TA 2R56H 2IPUG 1ADWA 2JTYA 4I5BA 4N90E 2VM3A 2NY3C 4AZUA 2XI9A 2KS0A 4R6UA 3VGBA 1L6XA 4DKDC 3JWOC 3C2SA 2E74C 1UM4L 2ARJB 2G75B 1A6VH 3LRGA 3HKZA 2QVIA 1BD2A 3QXTA 3QYMA 4QR7A 4JKMA 3BMWA 5DVNA 4Q9RH 2XWTA 4F7CA 1ET7A 2VXQL 3LEYH 3R1GH 4R96A 5K1JA 4KZ0A 4N24A 3CVHB 3CN2A 2F53D 4P4KD 2FEDC 5HHPB 1HHIA 1ZWIA 2DJSA 5KBPA 1MELA 1SN0A 2JVUA 1BXVA 1U8KA 2IWFA 5DZVA 5CJXC 3SE4A 1M1XA 1I1AD 1TVHA 3N9GH 2VLJA 2UWEE 4JHWH 5EO0A 1CLCA 4HZLA 4NGHH 3CVIH 1FNEB 3S37H 4ZNCD 4UI2A 4HETA 3ESMA 4NS0A 1GSKA 4ZBJA 1HNYA 4PJ9D 2VSDA 4BFEA 3UTZB 3FQRA 2WKGA 1CD9B 4YH6A 4HIJB 2D31A 1ULVA 1G87A 4OIIH 4WJKB 4AUYA 3CSGA 4JEGB 3RIFF 5I15H 5FKPB 1WAAA 4A2FA 4O9HL 2E9IA 4YSTA 4NNYA 5H35B 3DUUA 1E7UA 1BZ7A 1KENH 3HG0A 5JIDA 1TFHA 3P3YA 3QORA 3SY0B 4Q0XH 2IV8A 2WXMA 4KJWC 2OL3H 2CUHA 2JXMA 3VJ6B 4XVUD 4WV1A 1AG0A 4KTDH 4OB5H 3DK2A 3CHQA 1IGIL 2P43B 3KR3L 2ISDA 3UXFA 4WNJA 3BWSA 3UC0H 3F5WA 1TZIB 2ICEB 3ET9F 4DP0X 1NGZA 4WKXA 2BWIA 5DLMH 4ZD3L 3SDAD 2OTWB 4CBZA 3Q05A 1L3NA 3LSOB 4JFDB 2CZNA 1NUNB 1HESA 2Z7ZA 1OSEA 3BGFC 3H9YA 4OGXH 4KK5D 4NFBA 2FR4A 1PJ9A 2F68X 3HI6H 3FQUB 2ICCA 1DLFH 2FHBA 5DHDA 1DBJH 2I07A 3TV3H 5C0NC 4NQQA 4NPYB 1AGDA 3ULVL 5G55A 3QI9A 3FYIB 3KLLA 5DJCA 1O6SB 5CGTA 4OVUA 2F15A 1PKOA 5AD0A 5JYMA 2A9DA 4ETYA 3QDJA 3VSVA 1NCBL 5D2NB 1W0YT 4ABQA 5H4ZA 2VMEA 3DHUA 4L3EB 2A1WH 2FHCA 1QP1A 5DVLA 1MQ8A 1B4JH 2ZJSH 4W68A 5E1AB 3GMQA 1GPOH 3QPXH 1DBBH 4OFQA 1II4E 5DVMA 1MWOA 2I26N 3MRKA 2BHYA 3Q2NA 1HZHH 1MH5A 4WNQB 5F8RC 2JKIS 2G60H 4Q7DA 1BVOA 5JMRA 2B9AA 3VFMA 4YVUA 2K8QA 1VEOA 1YEFH 1TVBA 4ZS7L 5DUJA 3T9WA 3UYPB 1ZXQA 4LAQH 4O51B 4U4IA 4XVJH 3VGFA 5C09B 5DI8B 5EDSA 1HKFA 1J5CA 2X70A 4PGZA 5GS0C 4JNXA 2EKSA 5JHLA 3T4AA 1MCIA 3P77B 3HE7C 1QTPA 3EJZD 4WFHE 1ZLUK 5HGBA 2EIJB 3O6FC 1OGAD 3RNQB 1Z6JT 4FLOA 1URZA 1L4IA 4OQTH 4U1HA 2QPDB 3P2TA 3O3BB 3L3GB 1A64A 5HGDA 4D0CB 2ADJB 2OW6A 1ZMYA 4HCIA 5B4MC 1MSPA 4I5BB 3PG2A 3PGDA 5HGHA 4UTAH 4X9IA 1OK0A 3UBXA 7PCYA 3ULUD 2AJVL 5C0BD 4FGMA 3BRDA 5CSZA 4HJJL 2XZQL 3NZUA 1AQHA 1BD2B 2I60L 4HIIA 5KBMA 4GRWF 2GIXA 2XWTB 3TCLA 2HZHA 3ARPA 5FS5A 3VU2A 4F7CB 4R96B 1T4KA 1PG7X 3ABMB 4KKCD 3BCDA 1HHIB 1QEWA 1Q94A 1Z5LA 1ZWIB 2O5ZL 1EDYA 1OQOA 4PW3A 4J12A 4JFUA 4BSVA 1UCBL 4PCSA 4GQPH 1U8KB 1I4FA 2DH2A 2JIXD 3M8OH 1FL3A 1M1XB 1TVHB 3HLAA 2VLJB 3EJPA 2ID5A 2DMKA 4HZAA 4IIZA 3K72A 2KHAA 2A9CA 4HZLB 5EO0B 2J72A 5IB2B 2AV7B 4DP7X 4Z3IA 3HS8A 3L7FA 4GUPA 5EG6C 5JNYA 2YPVA 5ACZA 5B22A 1K5WA 1WBXA 4ZMNA 2MNUA 1MJ7H 3FQRB 3AY4A 4J3SA 4C8XA 3K2KA 3UADA 3U48A 5BV7C 1FNSL 3MRPA 4KNQA 2YD3A 5L4IA 1F1DA 3GNML 2WVTA 2JJUA 1I9RL 5CEXB 2E9WA 4MAUH 3IFNL 1T3FA 4QHKI 2DWTA 1CLYH 4NNYB 4GO9A 2DF3A 5D1QD 1MCPH 3FFOA 3DUUB 5SV3A 3FUEA 4HEME 1BZ7B 4ZS6C 3L3JA 3QORB 3D2UD 4JM2F 5KAQF 1OAZL 3QO0A 2FGWH 2JXMB 1KTJA 4PGDA 4EN3C 1XBRA 4WV1B 1WIUA 4FXGA 4DAGH 3NJHA 3EJCA 3H1ZA 4XC1L 1E5YA 2ESVE 3F5WB 2C7FA 4M5YH 3QNXA 4MQTB 3Q8FA 1NGZB 4XI5D 4NQCE 3NZSA 2FBRA 1S7QA 1LEGA 2X88A 2DIBA 4JFVA 2XV0A 4NUGH 2FX8L 3IB4A 4G6MH 1YMME 1OW0C 2FR4B 3KDMA 3A3YB 5IESL 3FO9A 2JK5B 1M7XA 1IQWH 1NSNH 2I07B 5TK2A 4FXTA 3M6DA 2A6DA 4G8IA 1AGDB 1UXMA 4UIMA 3HW7A 3QI9B 4X80H 3ECBA 5DJCB 4PRBB 5K9OA 3I2CL 4OJDH 5AD0B 3QDJB 3F85A 1L9MA 1IT9H 3DMMD 2EH8L 4I0KA 5AOIA 1AFVL 2MQCA 1RY7B 3CBRA 1ZGLM 1XSIA 3GS7A 3SQOL 1WD8A 4MCNA 2FX9H 4ZFOL 3GLDA 5JPMA 2C9AA 2HSIA 3GMQB 1WUZA 1YJDH 2G9HA 2YBRA 3AG3B 3EFDH 4Z9KB 4HSQA 1HE8A 3LKSA 3MRKB 3CLEH 1MH5B 1PZCA 1XEUA 4M6OL 4PV1C 3UJJL 3RA7H 1A4BA 3VFMB 3QIUB 3GMLA 1TVBB 2JJVA 2LGNA 4YQXH 1KZYA 3CG8A 5DWPA 1QLEL 1HAWA 1WBYA 1FO0H 2WQUA 3P4LA 2WVVA 5HSFA 1LD9A 2X70B 2UVEA 4D8OA 1KTRL 2EP6A 2EKSB 3OB8A 4GINA 3T4AB 3MBXH 2WD0A 3NPSB 1F4YL 2NXZB 1FORL 1Z0MA 2KZKA 3FH5A 2N56A 5HGBB 5C0DA 4R83A 3LNGA 3VFTA 4OLVL 4U1HB 2Y7LA 2VH5L 1CLVA 5HGDB 1RH8A 1MFVA 2H41A 3QZWG 3US1A 3ZE1E 1DL7H 5DURB 3PGDB 5HGHB 2D3JA 4M62L 4XP9H 4S1DC 1FZOA 2OP4H 4MJ5A 3O4LA 3UBXB 1E3ZA 4ENED 3D0AA 3T77A 1NOFA 3G5WA 1BF2A 4RWYL 2X41A 5CSZB 1CTOA 3U0WL 1SF5A 2QADD 3O6LH 3GHBL 3PAZA 2R56L 1M42A 3KLHC 2W91A 3SE8H 3A0OA 5DWUH 3F7RA 5EIIA 4HIIB 3TCLB 3QJRB 5KJRH 1S3RA 3GFUA 5GGSY 1AKPA 1MFNA 1T4KB 5CHNA 3ETSA 2VDQB 1Q94B 1A6VL 1F3RB 1Z5LB 5EU5A 4Z1PA 3RPIA 4GFXA 4HEPG 3PF2A 3QIBC 2C5DC 4ZOBA 4BSVB 1SMAA 4XN2A 4Q9RL 4OZIF 5FB8A 1WLHA 4MA8H 3LEYL 1R17A 3R1GL 3ERXA 2MKLC 1FL3B 3S9DB 1FVCA 3HLAB 3WKPA 4MB4A 1S7RA 3K72B 2PABA 3KPRA 5E2UH 5FGCE 43CAA 4BKLA 4NUQA 4P46A 3T8MA 2GY5A 4J6IA 4ES8A 1MAJA 4RMQA 3L7FB 4GUPB 2A6KA 5JNYB 3LJ3A 2X4RA 1WBXB 3MGOA 4FTDA 5E8NA 1OAXH 1R34A 2ZONA 5I8EA 1AZRA 3N9GL 4LOFA 4I13B 3LNEA 4JHWL 4Z7WF 3AVEA 3D52A 3CVIL 3MRPB 4NGHL 3S37L 1BXAA 1KN2H 2JNZA 3QAZC 4GQ9H 4POUB 3SPGA 1DVXA 1T3FB 2XA8H 1WFOA 4FA8A 4WUUA 2J20A 4PJ8D 4TNVK 4WJG3 3D48R 4FC3E 1OLLA 4KV5F 2HRLA 4BK4A 3L3JB 4XAWH 5I15L 1XAUA 3QO0B 4FI7A 3CDGA 5LGKA 4ALAC 4PGDB 3WDHA 4B7IA 1QSEE 3QDAA 4H8PA 1MIEH 3NEXA 4FXGB 4M7JH 4PJAE 4PS3A 3L9BA 3RURA 3SPCA 1E2WA 3LKNA 3HRZC 3PJSA 3D30A 3WS6A 4AM0A 1KENL 4OKDA 2XUWA 4Q0XL 5HJ3A 1U92A 3SCMA 2NDGA 3QNXB 5GGRY 2OL3L 1ZTXH 2ICWA 3HJ0A 4Y5YA 1Q1JH 1S7QB 1ZCRA 3HG1E 4KTDL 4OB5L 1LEGB 3WEAA 5I5RA 2BOCA 1NPJA 2K78A 5EF2A 5CZKA 2WXNA 4PTUA 3NOIA 3TJPA 3QVAA 1FGVH 3UC0L 5D7LA 1W8NA 3DJZA 1FE8H 3KDMB 1WP6A 3FO9B 1JVLA 3DIFA 4Z7UA 1G7MA 4OLXH 5DLML 3FSZA 2A6DB 4G8IB 2XTLA 4UIMB 4NKIH 4NUMA 1NCWH 3ECBB 3FBKA 5K9OB 4OGXL 1VZGA 3NN8A 3ARXA 1E8XA 3HI6L 1KZQA 4RMBA 5HI3D 1DBJL 5MP6H 3TV3L 2K4AA 5LG6A 4JREB 4AIEA 2X28A 4JN2B 1J0KA 3QC5X 4BBWA 5JPMB 1NCDH 3ZDYE 4Z95H 1HZKA 2G9HB 2YBRB 4NDMA 3LCYA 1NDGA 4JRYD 2Y7QA 5E00A 3LKSB 5FO9B 5INDA 5FFGA 1TQSA 2Z93A 3QUZD 5IT2H 2A1WL 1A6TA 3DO4A 4FQLH 3CZEA 3UAFA 2KDGA 1R5VA 2XWBA 3GMLB 1JZ3A 4JO4H 1B4JL 2ZJSL 4JR9H 3FH7A 4JUSA 1GPOL 2BK8A 3QXAA 5I1KH 3QPXL 1DBBL 1VCBC 1WBYB 4UU9A 2WVVB 1LD9B 4I18C 1KGCE 1HZHL 2EZ0D 3PY9A 4UM9A 4RIRA 1KC5H 3WSQH 1XH3A 2G60L 2EILB 1YEFL 5JZ7D 2BX5A 3BD5A 4K5MA 5F44A 4LAQL 4JKNA 4XVJL 2Q3AA 3CN1A 4QUOA 2AI0H 5SWZE 5C0AE 5C0DB 3SB3A 1U33A 2HX7A 3S48A 3VFTB 1G9HA 3DETC 1DVSA 4XE5B 5ELIA 1HAUA 4AVIA 1OHZA 2ZG2A 3LXCA 4Q4IA 2J88H 3IMBA 4S1QH 1VHPA 4OZGF 3M07A 2N0KA 1WZMA 1FZOB 3O4LB 5DQ9A 3KWXA 4RBPK 4OQTL 3T77B 3W1ZA 1XWVA 3TBCA 2I24N 3FCGA 3OR7A 4FAAB 3HS0A 1QUPA 2DQTH 4FQ2H 5DMGD 3WKMH 6PAZA 4K4KA 4XO8A 5EIIB 3CDZA 4UTAL 2H7WA 4PREA 4PYHA 1CC3A 4QHMA 1J5OH 1A3LH 4X8GA 3ESVF 3GJFH 3Q8EA 5IQ9A 3S36H 2LTQC 5CHNB 1K8DA 4P4KC 4N8VG 5EU5B 1RCYA 4P4RA 3RRQA 4A6YA 4B96A 3RPIB 3NT0A 3AITA 1QG3A 1PZBA 2BFVH 4KXCA 3UTSB 4IW4C 3Q44A 5FUZH 1A7RH 1FVCB 4PJDF 4IIQC 1I1AC 2VLRD 1S7RB 2X6AA 1WA2X 4LPUA 3KPRB 43CAB 5MEQA 2CHDA 4BKLB 3VXMD 4P46B 4GQRA 1XL6A 1SYVB 4BA8A 3FUNA 4XCCH 1F3JB 2A6KB 4PJ9C 4NQDA 4NB7A 1HN1A 2X4RB 1KTLA 3M8OL 2E9GA 4PV9B 3D07A 5E8NB 4EIZC 3C5SA 3IJ8A 5EOQH 5I8EB 3T08A 4A2EA 4G9DA 2QT6A 3VXTA 1EXHA 3E1F1 1LO0H 4KKBD 1V8HA 3EJJX 4DK3A 4U1LA 4I8DA 4U0QB 3ETTA 1MVUA 4WUUB 3VMPA 3GHPA 1MJ7L 3V4PH 4G82A 2AEQH 5HDBE 1FN4A 1WG3A 1N6UA 2D0GA 4QHPA 2AFNA 2L8AA 1SUJA 3SQRA 5ACLA 3S3PA 1NCJA 4MAUL 5ADPH 1CLYL 2N3JA 3CDGB 3MLXH 2EJ1A 5B21A 2CO3A 4XVUC 4DGIH 4H5SA 1MCPL 4AM0B 3AC0A 5IROD 3LKNB 3PJSB 3KPMA 3MRCA 3RILA 1JD7A 1MFCH 5HJ3B 2HTKC 4LHQB 1U92B 3SCMB 2RAMA 1GJWA 2XWCA 2EE0A 1FYHB 1AGEA 2FGWL 2ICWB 4K7PY 4UCFA 3ZMEA 2V5YA 1BQHA 1DSYA 4Y5YB 3SDAC 3KM1A 4DAGL 1S9KC 1U8OA 1NWOA 2BOCB 1ES0B 4PY8I 4PTUB 4NM8H 4FJZA 5AVTB 2FL5B 5D7LB 4M5YL 5F7DA 4KK5C 3ASOB 1GOFA 3A47A 4K15A 3DIFB 4KJPC 1G7MB 4Z7UB 5I1CH 5JW4N 1MG2C 4A7GF 4JKWA 1WH0A 5GGTH 5F1IA 4NUGL 1KTBA 4KJQD 1YNTF 1DQLH 4G6ML 4X4ME 3V0AC 4G6JH 2J56A 1BMGA 3NN8B 2YRZA 3K6OA 4A37A 3DO7A 5HDLA 5FCSH 1IQWL 1NSNL 4X80L 1R5WA 3HPJA 5CZRA 5I1DA 5I6LA 4NDMB 5E00B 1NDGB 2Y7QB 1IT9L 5INDB 4S0TD 2Z93B 5EWIH 2EABA 2GSIA 1A6TB 4DWHA 2M83A 1R5VB 2P5EA 2XWBB 3OM3B 4HUKB 1E5BA 2CCVA 1CGXA 2FX9L 2VABA 3L2NA 5I26A 1YJDL 3EFDL 3QXAB 2Z6FA 3WIHH 1WFUA 4UU9B 3QSKB 1RP8A 3CLEL 1RK0A 4M1CD 5AYTA 4UM9B 5KYNA 1JPGA 4RIRB 4JFZH 5LUMA 1XH3B 1EAPA 4LDOB 3RA7L 2DQJH 2UY7A 5E94A 1OCCB 3DNKA 4YQXL 3EJZC 2KL6A 3AAZA 2CBPA 1FO0L 3D7PA 4BHUA 3GRWH 3MBXL 2KLTA 2P28B 1FIGH 5FGBA 4PRNA 4EZJA 3PHAA 4F15C 2WK2A 2Z1PA 1KJVA 1NAMH 2NTFA 4PJIE 2BZDA 5F0LB 5TF0A 5A3ID 1YEJH 5HHQA 5J11B 3VYPA 5DQ9B 5GZOA 3FU3A 4KTGA 3ULUC 2VB5A 4FQ1L 4JM0A 5I6OA 4Y2DD 2J5LC 3KNBA 3HS0B 1KEMH 1DL7L 1FYTA 5D4QA 1CR9H 2VC2H 2YAPA 4XP9L 3FU0A 3CDZB 4MA3A 2YGVA 2OP4L 4PREB 4QHMB 3WL9A 2R15A 3Q01A 3W11D 5IQ9B 2AZUA 2UUDK 4G11A 1K8DB 3O6LL 4KKCC 4P4RB 4TNVF 4A6YB 5E6ZA 4Y4KC 3SE8L 3A6CH 5DWUL 1T83C 2YHGA 5I73C 3QDMA 4BWWA 5KJRL 4YE0A 1WTLA 2V9TA 1PLCA 1PNCA 3NIGF 4PJGF 3ABLB 1KBPA 2AXJA 3CX2A 1LWRA 3MV8A 5MEQB 3WAJA 1P7QD 5L7XL 3AXIA 5GGVH 3EGXA 4NQDB 4MA8L 1PY0A 1KTLB 1S5HA 1OCWH 2ZUSA 4DK6A 3C5SB 1J12A 3FL7A 5I75C 3EH2A 1ZK9A 4G9DB 3VXTB 4BJLA 1N0XH 5E2UL 3N0AA 5D2LE 4OGAD 4M3KB 5HYJE 4NNXA 4U1LB 2FGZA 2IO5A 5D72H 1MVUB 4GMSH 3VQ1C 3MKKA 1OAXL 3F6LA 2JKJA 4HWZA 2EDXA 5IF0A 1IC5H 4Y4HA 1D7BA 3BDYH 1FN4B 2DRUA 1KN2L 4AQ1A 1X5GA 1NC2D 4GQ9L 2XA8L 4B9PA 4M6AA 3DBXA 3LN9A 1R75A 3BPCA 3EF4A 3FUHA 3F7VA 2CLVA 1C5DA 2PWGA 4P9HC 4V33A 4H5SB 1OP5K 3KPMB 3MRCB 3WFZA 4ODTH 4UOJA 2EE3A 4DEPC 1NM4A 1AGEB 3L08A 2FUTA 3LY6A 4XI5C 4M7JL 1BQHB 1MIEL 3MI6A 1SDDA 3D12B 1U8OB 5G2NA 3V5KA 3DUHA 5KJ4A 4AVHA 2EVGA 4MMZC 5DEZA 1WF5A 4FEMA 5F7DB 1YPZA 1ADQH 1ZTXL 4GLRH 4WHCA 4Z7VA 4ZNEA 1P5UC 4ZMOA 5ICYA 4N28A 1Q1JL 3W0WA 1P4UA 4ICWA 5F1IB 1PJWA 3SY6A 2CUAA 5AOMA 3RUGE 1FGVL 3KXFA 3CFEA 3I6LD 1FE8L 2H2PD 1KF9B 2WBKA 2Z91A 3DO7B 4MAZA 3UZVA 4OLXL 1JNLH 1JF1B 1NGQH 2C9XA 3DMMC 3PU7A 5EUOA 3A4FA 4NKIL 4UOZA 1NCWL 5BS0A 2XJKA 4KQ3H 1R5WB 3HPJB 4Q6IC 5I1DB 2RD0A 1THAA 1W72H 2V3DA 1SLVA 2VE6A 1NEZA 3ZQ9A 5MP6L 4OVVA 4BQCA 2UYLA 4Q56A 1MFEH 5FWRA 3HA0A 2VXTH 2P5EB 2BIIA 2OMTA 2VABB 3COOA 1NCDL 5DZLA 2XWXA 3VU1A 4WWOA 4Z95L 2PWFA 4XMZA 4HYTB 2PYFB 1RK0B 3D8MA 3VH8G 1JPGB 1EAPB 3FUJA 5IT2L 3O9WC 2UY7B 2FATH 4FQLL 3WNOA 5E94B 4PS4H 4JO4L 1DJGA 4OY9A 4JR9L 2F7QA 1X3DA 5M94B 5I1KL 3AAZB 4RESB 4X6DE 1NH6A 1KC5L 3F7KA 3WSQL 5JR1H 4A66A 2FECL 3RTQD 3HUJF 3TBWA 1JHLH 1KJVB 2NTFB 2WLNA 2AI0L 1DBMH 5HHQB 2FCBA 4ENEC 1TYRA 2MWCA 4IU3A 5F72S 5DJXA 4XGZA 1I1YA 2CBOA 1IE5A 4X8JA 2YGQA 3F6JA 4WFGE 2J88L 5C07E 4S1QL 4IEFA 2QADC 1K85A 3KNBB 4X83A 1FYTB 3WL9B 4K3DH 4MA3B 2ZX8A 2E7CA 2HX9A 5IB1A 2WXFA 5AL0A 2B59B 3DX3A 3SOTA 3EDJA 2Y7NA 2DQTL 4FQ2L 1XCXA 4HSCX 3WKML 3ZL1A 2BVOA 2PYED 5KYYA 1D6EA 3CH8A 2BSDA 3QDMB 4XXWC 4YUEH 1A3LL 1J5OL 1RK7A 4UNVA 1TEYA 2G4EA 2PPEA 1IGCH 3ULSA 3S36L 5JHDD 2L7UA 2W88A 2ZG3A 1YAIA 3MV8B 3QZBA 1N8OE 5DD5H 4CUCA 4ZW7A 4PRHD 1L0PA 4YHLH 4E9SA 2BFVL 1SNRA 2BCMA 3BVDB 4HJ1A 4KI5C 1QSFE 2EDHA 1X5YA 3JQOB 1S5HB 1MHCB 1T0OA 5FUZL 4L4TD 3W2DH 3Q9PA 2BP5M 4WEEA 4LCWE 4J3XA 3PHQA 2WY3B 2VSKB 5FXCH 3M1CA 1O9WA 4WAFA 3QXDA 3QGVA 1PLAA 1V54B 1WFMA 4PG9A 4RGMB 4WEUD 1KOAA 4XCCL 5C09D 2RALA 4CSPA 1GYCA 4NNXB 3TBTA 4FI6A 4WI4A 2GC4C 3ECQA 1RL1A 3NRQA 1UEYA 3VI4E 3VSUA 4U1IA 3QZOA 4HWZB 4PJ8C 4CSZA 2FH6A 5EOQL 5IF0B 1F6AA 4Y4HB 1LO0L 2VDLB 3FUFA 2ODIA 2X9ZA 2X89A 5F7MC 4KTEH 1ZDSA 3DBXB 1YECH 4H8WC 1F90H 3BPCB 3V4PL 2YD1A 3F7VB 2CLVB 2AEQL 2DKMA 4LVOC 5HXMA 3SKJH 2H6OA 1P1ZA 3FN0H 2BNUA 4HSAC 1WT5A 3TTSA 1KY6A 5ADPL 3MLXL 1JXGA 2C34A 1MJUH 2X4TA 1HL5A 1G84A 2ZWZA 4DGIL 1SDDB 2X3AA 3V5KB 4J3VA 3U4EA 1M6UA 5D7EA 2PR9A 1BD2D 1IBGH 1ZE3H 1MFCL 1YG9A 1YPZB 2Z34A 2CDGA 5DZJA 1AQMA 3NMEA 4MYPA 4Z7VB 5ICYB 1JI1A 1DCLA 1AR1B 2WTOA 3W0WB 2Y22A 2NY7H 4YFDB 4F24A 1I85C 4FD0A 2YA2A 4YHZH 3BPLB 4NM8L 1WAAE 3KXFB 4NC0B 4ZMVA 3CFEB 2Z91B 5K1VA 1HXYA 3UZVB 5I1CL 4IMKC 5EUOB 4GY4A 5HI3C 1ACYH 5LN4A 2ZWNA 1DYZA 5LCVH 5BS0B 5GGTL 5LDUA 1Z32X 2K9FB 1DQLL 1TQBB 4G6JL 2YA0A 4Z7QF 2YUZA 1TIUA 2VE6B 1HWWA 3AACA 3K4ZA 4AUJA 1KXVA 3QUZC 2UYLB 3SOBH 1IBDA 1ZAGA 2HG5A 4WEBH 5AVZB 2OMTB 4ENZA 2XA3A 1XCQA 1GJUA 4YIQA 1DJIA 1MWAA 1AI1H 4IBSA 1BZEA 5EWIL 2EZ0C 2WXRA 3DRTA 3W81A 3Q6GH 4GT7A 5JZ7C 2YPLD 3KMDA 1KNOA 4L4VE 3A23A 4KZEL 4IHBA 3WIHL 3IWVA 1PLBA 4NO0D 4JFZL 3FT2A 1PFCA 1XH1A 5IVXF 2DQJL 5C3IA 3WHXA 3TBWB 3TN0D 4E9WA 1F4XH 4IBLT 3SDYH 3I75A 3N44F 1DTUA 4L29A 4IU3B 4TQIA 2PKDA 1I1YB 2FSDA 4XGZB 2WPGA 3GRWL 4IEFB 1XT5A 1FIGL 4E5XA 1BYNA 1KG0A 3Q8BA 3UROR 4M9PA 2QVTA 1NAML 2X4NA 5GRUH 1QKZH 1YEJL 1UT1A 3M1BA 4ZX3A 3TVMA 4GSQA 5IB1B 1PEWA 5HDOA 3NCYP 2A77H 5D4IA 4BV1A 1UA7A 3VX1A 5FM5O 4AEEA 2BZCA 2J8OA 1KEML 1VZHA 5JLZA 3WHE0 4OFIA 1OM3H 1CR9L 2BVOB 2VC2L 3AM8C 1D6EB 5AEAA 5KYYB 3MXWH 5E6RB 3GSWA 4DP9X 2H6UA 3K6NA 3ULSB 4NEHB 2BXZA 1IX2A 2VW6A 5JPNA 5CLTA 4M7ZC 3VXUE 3A6CL 1BJMA 3DIVA 2DL9A 3UJIH 1QRKA 5J1AA 3QIUD 3PHQB 3QXDB 3KYOA 4KKBC 4PG9B 5GGVL 3JWOH 2WBWB 4YDIH 1X7QA 4F7MA 3ARBC 4JFFE 5K69A 5EF0A 3TBTB 2G3XA 4EQ2A 1BP3B 1OCWL 3KDPB 4U1IB 3TNNA 4XX5A 1F6AB 4YHPA 2I27N 1N0XL 2GEEA 5EOCJ 2NXZD 2XETA 1LE5A 3RDTA 3QWQB 3CFCH 3TU6A 1L0XA 3IGFA 2FH8A 3ZZQA 5D72L 4GMSL 5CZXD 5J1SC 1LO3L 3P4NA 4AL8C 3M88A 3MBEA 3D2TA 3QQDA 3VXNA 2FWLB 1IC5L 2WBJA 2VNCA 3BDYL 4HHWA 4L9LC 1MHPL 5IROC 3FUKA 5ILTL 1M56B 4XMPH 2I5YH 3V7AE 1P1ZB 1HH9A 1Q90A 2HFFA 2BNUB 2A4EA 3LHPH 4JCLA 5MHSD 4X0NA 1MFDH 2X4TB 4BE6A 3RWIB 2WLZA 3R8BB 3D0VA 4PU2A 4G8GB 3S0PA 2X2JA 2WQVA 3U4EB 3ESOA 2O5NA 4ODTL 5FYJD 4XMVA 1JTPA 4QOKD 5CR8A 4RGNB 4APQA 2CDGB 1CBJA 1W6WA 4GAGH 1N10A 2IOOA 1QNIA 3QEUA 3JV5A 3GEFA 1ACCA 3U9WA 5LO7A 1BIIA 4A2DA 1WIOA 2Y1YA 4DFIA 3PGCA 3HLKA 1G9NH 4KJQC 2Y6SD 1LM8V 3PDOA 4WGWB 2DPKA 3AXHA 1ADQL 1HXYB 4UQIM 4WSJA 4A39A 2F8XC 2DIAA 4KK8D 2NOYA 1TYJA 1TNMA 2K3TA 4FI8A 1V27A 2RH0A 2EIEA 2HB0A 4XO3A 4Y5VC 1JNLL 4KKPA 1NGQL 5BRZD 3UACA 4FG6D 5INCA 2QHRH 4U1GB 4JFHD 2HG5B 4KQ3L 1RPKA 3RY6A 1VFOA 3VCLB 3BZEA 1W72L 4ZMAT 1XCQB 4IRJC 3KPSD 1VIWA 4YIQB 4BCYA 5HHVH 1MWAB 1CD0A 1X7TA 2C3VA 4OLEA 4M1CC 1JPSH 3DRTB 5FECA 1MFEL 2OYMA 2VXTL 3FJTA 5I17A 1WWBX 2QFRA 3P30H 4NFDA 4GSRA 1KNOB 4HC1A 1XD1A 2B2XH 4NM4H 3H8NA 2W9EH 2I85A 4U1NA 3FT2B 4U6XA 2YQBA 2FATL 3DA0A 4PS4L 3WHXB 3B2XA 4LLAA 2WP3T 2A9MH 2NPLX 4M93B 2XKUA 3BAIA 3I75B 5A3IC 1MFBH 2VCOA 2ZOLB 4NQXA 4L29B 5A16B 2AXGA 3WN6A 2HLEB 3JUYA 5FFLA 2ORBH 1A6ZB 2EEXA 2ENQA 1MDAA 3APFA 5JR1L 4FE9A 2K4WA 3HBPA 1IBBA 4Y2DC 4C55A 1KG0B 1JHLL 4E5XB 4BFBD 3T0ED 1FNHA 3G04A 4R4BA 2X4NB 1DBML 3M1BB 3TVMB 1QRND 1GGCH 2VXUH 2N7AA 4OBSA 3W11C 4JPSA 5JLZB 1SJXA 4V1DA 5GS0H 5F88A 4LLVA 4K3DL 3FUDA 4ZQTA 1PL3A 1Q9KA 3GSWB 2NTSP 1WUNT 4EUPH 5CKGA 5JPNB 4G80A 4GJTB 2ARJQ 2IH8A 4W9IC 4ADGA 3F12A 2Q86A 1S78D 4W9HC 3E0GA 2IALA 2JCCF 4YUEL 4KKNA 1IGCL 5F1KC 5BO1H 5J1AB 3RIKA 3VUAA 4D3CH 2WGNB 5AVSB 5DD5L 2N01B 4NZJA 3UTTD 3IGKA 3C5JA 4YHLL 3SPIA 4F7MB 1GGUA 1X7QB 4OGAC 3FCTA 2X0WA 2F53E 3W2DL 5FA3A 3TF7C 3TNNB 1TZHA 1XDTT 1NMAH 3VWJD 3N42B 1WCBA 1LE5B 3RDTB 2HKAA 4G7VH 3RY5A 2BSRA 2AJ3A 3DVFA 4MLIA 3P4NB 5IY5B 3MBEB 1BCIA 1R5IA 3QQDB 4R97C 3VXNB 4UNTA 2AGJH 4JO1H 1LMKA 5FF6A 2ZCKH 3ABGA 3OX8A 2F19H 1HH9B 2FBJH 4KGLA 2HFFB 3FXIC 3LH8A 5K33A 1KGIA 3O4LD 2VJ0A 3HR5A 5DFAA 4KTEL 2PPDA 1YECL 1F90L 1GYWA 2DMCA 1A4JA 2GITA 1GS8A 2WN3A 3D0VB 3QIWD 4RMWA 3SKJL 4KXBA 2WM0A 4OV6F 4AV5A 5I0XA 5EEUA 4UB0H 3FN0L 4JO3H 3T2QA 2X44D 2BY1A 3US0A 2B1AH 5BV7H 4APQB 1MDTA 4PJIF 4QIRA 1EO7A 1MJUL 1YNKH 3QEUB 4YHKH 5L2KA 3VYOA 4IQHA 1BIIB 2WIIA 4RMSA 3PGCB 2BDNH 5F7LB 2A38A 1IBGL 1DVQA 3PDOB 1DCEA 2WB1A 3UTSD 4NWUH 4OZFA 2H2PC 3ZHNA 3S3SA 3WTVA 4NRZA 2OFQA 3O3EA 3G08A 4NQUA 4FKKA 4HS3A 4M8QA 2NY7L 1AO7A 2G0KA 4UQCA 3TXAA 4P46D 3DARA 4AGOA 4L8BA 4Z7OB 4PJXA 4K23H 4BFNA 4IRZH 1ACYL 4L1SA 3NK3A 4Y5XC 1OB1A 5LCVL 3RVWD 2XU9A 4EUPG 4R90H 1QO3A 3WY3A 5J13C 5LLIC 4QPEA 4D94A 3BZEB 1VJSA 3BESR 2BSCA 2P8LA 3BPOB 3K81A 4JRXA 1AC6A 4JJHA 4N22A 5B1JC 4CJ1A 4GXFA 1CIDA 2C3VB 3ZO9A 2JH2A 5FECB 3SOBL 1PDKA 3TESA 2AKRB 5I17B 4X9GA 4WEBL 5KAQG 2NNAA 2QHLA 4OZ4A 2Y6TE 2RTTA 4DVBA 1UACH 3AADB 2EXWD 4WSKA 4Y16A 2CHZA 5HVHC 2GJRA 3U82B 5L6YH 5IFJA 5B8CA 3WLWD 1AI1L 2DM2A 1BW8A 4TOYH 4U1NB 3Q6GL 2I9LA 4U6XB 1WZLA 1BZ9A 5EEWA 4WW1A 3RTQC 2CA4A 3IJEA 2VR5A 1YDPA 3SCMD 4E0RA 2AXGB 1U41A 5FHBH 1RV6X 5TE4H 2XQBH 2HJFA 1E42A 4DZBA 4N2OA 3QH3A 1MLBA 4MNGE 2GVYA 2UY6A 4U31A 1F4XL 3NJKA 3DSFH 1LDSA 3G04B 4R4BB 3SDYL 4ZXBA 1TR7A 3BGMA 3F58H 5J7CC 2H1XA 4FFZH 1FH2A 3MTXA 3BUDA 3KL5A 1NGWA 2Z0BA 4TM9A 5DT1H 3SDCA 3U30C 1OGAE 3EYFA 2G3ZA 4RRPA 4V1DB 4IKIA 3H3BC 1P4LA 5GRUL 5F88B 1QKZL 2FNWA 3MROA 4LLVB 4RGOH 4DT2A 3KLDA 1Q9KB 2G5RA 2A77L 1XV8A 2VDPB 3K1KC 2DOCA 1ESOA 1HCVA 1RKRA 3O81A 4G80B 5FM4A 1DZBA 3LIUA 3FN9A 3F12B 3QFJA 1OM3L 2Q86B 5C0BE 2VQTA 1ETZA 2IALB 2WKLA 2XPYA 3MXWL 5E6SB 3N85H 5IBUG 3P3UA 1UFGA 1R3IH 2HVJA 4WWKA 2Y1ZA 4FHJA 5MENE 4J3WA 1LGVA 4JQXA 5DO8A 1MIMH 5H37A 2JB6A 5D55A 3C5JB 4JFOA 1C7TA 3RGVD 1LP9A 3FCTB 4UM9D 4GT0A 5FA3B 2FQEA 3UJIL 1QR1A 2OXGA 1TZHB 4XPHL 1RQ5A 4KU1A 5GIRA 1KPUA 3ETBJ 3EUDA 1WCBB 1IKNC 1XH0A 3DVGA 5DJDA 3NH7H 3JWOL 2IDSA 4YDIL 1EFQA 2BSRB 2AJ3B 4OCWH 4Z3FA 3VMOA 5JXED 3SGKA 2NW3A 1R5IB 2F54D 3KHQA 5B38G 4NHUA 5FF6B 3CFCL 2EUWA 1UQSA 1LK3H 3QUMA 1KB9J 4AKQA 3IKKA 4M43H 3HR5B 4YEEA 4N6RA 5GZNA 4KMLB 5JOFA 1VACA 4XO4A 3S4SA 1A4JB 2GITB 1DJYA 5E23A 4GBXD 2ZZUT 4LDLB 3MLWH 4XMPL 4R4ND 2I5YL 1UD8A 4ODBD 1MCSA 2F8OA 5FYLD 3IAPA 4NXSA 3LHPL 3W57A 4A2HA 4WDIA 4UQEA 1IL1A 1MFDL 5LDSA 3LPOA 1KV3A 4KO5A 2D8KA 1K3ZA 4UILH 2WIIB 3AQYA 2ERJB 1T80A 2J3SA 2YC1A 3LQZA 4IRSC 1DN2A 1SY6H 3L54A 1XR9A 4GAGL 2YEZA 4NRZB 4YK4B 3NFPA 3DROA 1ASQA 3O3EB 3G08B 4G5AA 4HS3B 4M8QB 1AO7B 1X6LA 2A4CA 1JGLH 1G9NL 2DTSA 3PE9A 4NO5A 2DH3A 4ALAH 4B9IA 5DEGA 3MLPA 4L8BB 1IZJA 1WFIA 1IAIH 4PJXB 4NO3A 5CGYD 1HQ4A 1GW0A 4FZ8H 1OB1B 2W95A 4JVUA 4WW2C 1MFUA 1QO3B 4KNSA 3P0GB 2NYKA 2P8LB 4W1TA 3TEZA 4JRXB 3NESA 3VXRA 2IOMA 4ELMA 4PJEA 2VUOA 2QHRL 4BUGA 1PDKB 2UXVA 1L3WA 1W0VA 2DBJA 4QRPD 5D1ZI 2NNAB 4JGJA 1A3ZA 4OZ4B 4DVBB 5BMFH 5KG9A 3FRPA 1ZVYA 1MCWM 4Y16B 5IFJB 4AQ8C 3GBNH 5F7BA 4ETQA 2QPEB 3S88H 3SDXA 5E8EB 5HHVL 5B8CB 3MREA 2WUCH 3T5WA 3IRZA 1JPSL 3QPQD 3T4YA 3TFKC 1A3QA 3BIAX 2I9LB 1BZ9B 4X7DC 4WW1B 3P30L 4XTRD 4F7PA 2YAMA 1TJIH 3TN0C 1IIIA 2K8MA 3DYMA 2B2XL 4NM4L 1YDPB 1M3JA 4E0RB 4ZAKD 2W9EL 2BM3A 2DD8H 3GLEA 4DZBB 5LXVA 2HJFB 2FO8A 2DQEH 4KDVA 4AE0A 3QH3B 1G7IB 1MLBB 4LLWA 4HLEA 2A9ML 2HYMA 3BAKA 3CFJA 4XZUA 1MFBL 1W9XA 3ZYIA 4ZXBB 4X50A 3BGMB 3K4DA 4DW2H 2QPSA 3MCYA 2ORBL 1FH5H 1ZK5A 3QJSB 1NGWB 2P5EE 3QS3A 5F96L 3SDCB 3M1OA 1LMIA 2MQ0A 3EYFB 5GRYA 4KITB 1RI8A 5JORA 1P4LB 5CLXA 4F8OA 3MROB 1KYUA 3P0VH 1GGCL 2VXUL 1DQDH 2QLYA 3E9TA 1IARB 4WF7A 4Y8DC 3KEDA 3N06B 1RZPA 1OTTD 3W5NA 1EFXA 5F9AC 1GJIA 4XOAA 4XNMA 5MI0B 3HAEH 3UMNA 1CZ8H 3QFJB 1NCAH 4ORGB 5GS0L 2VDNB 1ETZB 5L2JB 4H1LA 1U95A 5H2BA 4TQHA 4FTVE 2RFXA 1DJXA 1WAAF 2HVJB 4JFSA 3GTVA 4PY8J 4WWKB 4A68A 2C26A 1IQDA 3SEPA 3QIUC 3CN0A 4QI3A 2JB6B 4JFOB 1XSKA 2DS4A 3KPOA 4NN6C 1CJYA 1LP9B 4KO7A 3DXAA 1QR1B 1JNHA 5BO1L 2OXGB 5GIRB 2QFPA 4D3CL 2GIMA 1KPUB 1E8WA 1JPEA 1CO1A 1OP3H 3PXJA 2OR9H 2NXZC 2XZAH 3DVGB 5DJDB 1C16A 5FDWA 1HHHA 4LHJB 2OAAA 2BSEA 3BOVA 5IQMA 2CJ3A 1J11A 2OBGA 5CZXC 2NW3B 1JZ4A 1N2RA 1NMAL 2ZYIA 1S46A 2R4RH 4YSUA 4KI5E 2VERN 4NHUB 1NTDA 1NEUA 2DQFA 1UQSB 1OTUC 2D3VA 1ZT4A 3QUMB 5I71B 3PFUA 4N6RB 3VQMA 4OLZL 4ONGL 1VACB 3S4SB 3BUQA 5K9JH 2AGJL 4JN1H 3TT1H 2ZCKL 5I74C 1MCBA 4JFPA 2F19L 4XMLH 2FBJL 1YN6B 3HB3B 5JMOC 4WDIB 4XWOC 2ZAIA 4XP6H 4Q9QH 1IL1B 3D39B 2R39A 2IAND 3JTSA 3SHSA 1MZZA 1KIPA 3AB0B 5LNEA 1RAMA 2D4FA 1G5GA 3I9GH 3OKYA 4KPHL 2YC1B 3LQZB 4UB0L 2Y6SC 4JO3L 5EU4A 5FFOA 3UTQA 1E7VA 3IFPA 2B1AL 3LPGA 3SO5A 5BV7L 4XODA 3V6FA 2YEZB 4YHKL 1YNKL 3FPXA 4BIKA 3NFPB 3DROB 4LKCA 4KK8C 3WKYA 3IT8D 3NCMA 2BDNL 2DJMA 4Y9EA 1TDQA 1BVZA 1VB9A 4Q4EA 4C56A 5DEGB 2C1PA 3ZIMA 4NWUL 4GKNB 2JJSC 1HCFX 4NO3B 4NUPA 1PYWA 1DSFH 1CXIA 3MHZA 4FG6C 3DKHA 4XVTH 1QPXA 2K7PA 1BJ1J 2Y06H 1MFMA 4Z7NE 4I0CC 5F6IB 4WFFD 2DLFH 1JN6A 2ZP9A 3QQNA 2KKQA 1FIEA 4DQAA 4Z3HA 3ARED 1NCGA 5I82A 5AAMA 3VXRB 4K23L 5KVGH 4IRZL 4ELMB 4PJEB 4O5LH 3OLIA 3WLBA 1W0VB 4BGLA 3JV0A 4R90L 1MG3C 5GRXG 5KG9B 4W9FC 1FZKA 1MCRA 3FRPB 4JB9H 1INEH 2VMFA 4HK0A 4TLTA 4CMHC 4ETQB 3SDXB 3BUBA 3MREB 2GJ6A 4FA7B 3T4YB 2G2NA 4H8QA 3P11H 5ACMA 2UX7A 3A4DA 4F7PB 4JRYE 1UACL 4X4KA 1SGKA 5L6YL 2Q8AH 4AUUA 1UCTA 3IEAA 4HJTA 2F7RA 3UP6A 3WNLA 4TOYL 3T71A 5IMOA 1ZS8A 1GZHC 2VDKB 1P4BH 3S3BB 4LLWB 5C97A 1FFNA 3QUYD 3CFJB 2FWOA 3T0EC 3CN4A 2WKOA 4XZUB 1KWGA 3DX9A 3QZLA 1A4AA 3O2WH 1WE5A 1RZFH 2EYTA 5FHBL 5TE4L 2XQBL 5KOMC 5IJKA 1TT6A 4YBLC 3F62A 3U6RA 3Q1SH 4EZMA 2ITFA 5F0JB 2VQUA 3FT0A 3DSFL 5JORB 5GRJH 4AOFA 3F05A 1SUHA 3F58L 3KLQA 3DHJA 4FFZL 3IN2A 1FZJB 1YEDA 2E86A 5BS0D 1EFXB 2CHWA 4OR1A 5DT1L 1A7BA 1BWWA 1YC7A 3LNFA 4FQQA 5FO7A 1F86A 4FKEA 1A3RH 5HHOA 1S78C 4H1LB 1J88A 1U95B 4RGOL 5H2BB 2W8CA 2RFXB 4AMXA 1B88A 3C5ZA 4WO4A 4E36A 2ZXAA 3DYOA 4M48H 3ULUH 6PCYA 3BWUC 5EEYA 3TURA 3KPOB 1J7VR 3OHXC 3N85L 5IJVA 2VUKA 1R3IL 3DXAB 1JNHB 5B1BB 1MCCA 1JTTA 2QSCH 1MIML 1VFAA 4W70A 3VWJC 2DWSA 5FDWB 3EHBB 4I3RH 1HHHB 3GQFA 4HJ0C 2QSVA 4HCRH 5T1LD 3QFGA 1VGKA 3L1FA 2P5PA 3TGXA 1ZGLA 4OJCA 2DWXA 2VLRE 3PQYA 2ILLA 3VXME 1N2RB 3V79C 1XIWA 1GR7A 4OLWH 3HEIB 2DQFB 4HGKC 4CADA 5ISZA 3NH7L 3V0WH 1ZT4B 3QQ9C 3V6OA 4OCWL 2XTJB 2MPVA 1TTAA 5CSBA 5ICZA 3JWNC 3PYCA 3QIWC 4TUUA 1X6NA 4JFPB 4QHNA 2BNQE 3CX5K 1TITA 3QDGE 1LK3L 5DK3A 3IDIA 2H47C 4OZHA 4M43L 1XEDA 3KPNA 3ILDA 3JTSB 4EPSA 3ENEA 1FNFA 1KIPB 2ZWLT 1IV8A 1HOEA 4ZUVA 2PR4H 4YE4H 4N26A 3MLWL 3BRGC 4HH9A 4UOW0 1L9PA 2E7HA 3UTQB 2UV3A 1SVZA 4RBPH 1BREA 5EU4B 3TNMA 3IFPB 1N7MH 1BYPA 1L7TH 4CC4A 3V6FB 5D5ME 2E7LC 2J6EA 3O3DA 1TQVA 4LKCB 3ESPA 1G1KA 4UILL 4LOVA 4I2XA 1TSHA 5DJ2A 1RMFH 3QEHA 4C56B 3IPBA 1H3GA 1SY6L 2C1PB 2BS71 4WHYH 2BPBA 1PYWB 2AMUA 2J8UA 5IVZB 2YRBA 3RVWC 1A9BA 1JGLL 4ALAL 1JN6B 2KYIA 4XB7A 1G43A 1CICA 3DDFA 2YN3A 4NZDA 4YDZA 3LQAC 4HXAH 1IAIL 4PVLA 4BFGA 1X5ZA 1IVLA 2AAVA 4J23A 4FZ8L 5D96B 3WLBB 2YOCA 3OWRA 2XWJB 5DUPH 4D0DA 3OXRA 2PPCA 3P9LA 4AYGA 4HK0B 3U6XA 2EXWC 4RGNE 2EDJA 4R8WH 2X89D 3GDBA 4WHDA 1AQDA 5DJ0A 3VVVA 4EEEA 3WLWC 4HV8A 4PH8A 2GJ6B 3L8QA 4JPIA 5ENWA 3EXJA 2G5UA 3SJVD 5BMFL 4TSCH 1ZPUA 1FG2A 4X4YA 1ZHKA 3GBNL 3S88L 5J56B 1ORQA 2WUCL 4ZFOA 4GSDH 5IMOB 1ZS8B 3T6ZA 3TX4A 4CGUB 4PWHA 3D3VA 4G8GD 3VGAB 1INDH 1FFNB 1TJIL 2IG2H 3MRMA 2FJUB 3RBSA 2FWOB 5SX5H 4FCHA 1L9SA 4PGBA 3DX9B 3IN0A 4B50A 4AEHH 5BVPH 3H4FA 2CBQA 5DMYA 2DD8L 1XZ0A 2EYTB 2J25A 4J4PD 4X99A 5LGHH 3CUPA 2DQEL 4WK2B 3WUWA 5ID1A 1KXTA 2DZEA 3VG9B 3U6RB 2CCLA 2HTLC 2ZAGA 5CEYA 1BMWA 2YA1A 1F2QA 4LP4A 2X2YA 4N2HA 3KGTA 1VSCA 2IQ9H 2D3NA 4DP5X 4PJ5A 3C2AH 2A3TA 2PCPA 1FH5L 1YEDB 2LE9A 3BAXA 2KT6A 1IAMA 1MNNA 4J39A 1TQCC 3U0PA 1X5MA 2RA1A 4FQQB 5FO7B 3O8XD 2QL1A 4KRPB 1ZLVH 3CFDA 2AJZA 5HHOB 2A99A 3P0VL 3WOVA 1DQDL 3WO4B 4AE1A 2XWEA 5GSVA 4TUOA 3C5ZB 4PJ7A 3DURA 4ZUSA 4R0LC 4WO4B 4O2FA 4HD9A 1TJMA 4FXLA 5DZAA 1CZ8L 1OPGH 1NCAL 3K6DA 5C1MB 1X5FA 4Z0BH 2BIOA 3RGVC 5IJVB 2QKSA 4Y9FA 1O9ZA 1I8KA 2BCKA 5EIQA 1VFAB 2CR0A 1F58H 3IDYB 4PJFA 1CDGA 3D09A 3HG5A 1WFNA 3IBOA 1VGKB 3ATDA 4GPVA 1VERA 3EJUA 3GEWB 3KPTA 1ZGLB 4LMQE 5JXEC 3PQYB 3N40F 3LRLA 4ISVB 1XIWB 2HX8A 3KGSA 4XVSH 1VRSA 2XZAL 5ISZB 5FO8A 4O02A 3ZDZE 4G2AA 2AXWA 4P2RA 4Z7UF 4KDWA 2R4RL 2ROYA 5ICZB 1TG8A 2CXGA 2FT7A 2PWHA 3J8F7 4GBXC 4JX0A 4YHYB 1EHXA 2VLKD 1OAJA 1GRWA 4QHNB 4KVPA 3IDIB 4OZHB 3GD1C 3WFDH 1TEGA 2QTEA 4MX7A 4JFQA 1JZDC 3KPNB 4MNHA 3LIZA 2KZBA 5K9JL 4UAOB 4GLRI 2GHZA 4ZUVB 3HR6A 2EXYD 3FT3A 4JN1L 3TT1L 1MW3A 4HH9B 4QWWD 4XMLL 1C5BH 3TNMB 5JQIB 2NY0B 4DKTA 1GOGA 2R23A 4Q9QL 4HDIA 4GQZA 1RZGA 3O3DB 4DHLA 4B6ZA 2ALWA 4XOBA 1RZJC 5HGGS 2VXVH 3OPZH 3D25A 4I2XB 3I9GL 1THCA 3M46A 1EO5A 5DJ2B 1U58A 3QEHB 4H8WH 3V0VA 4R3SA 3SKUD 3Q2VA 3RX5A 3NSJA 4GG6E 3APDA 2J8UB 3ARGA 4A63A 1E6JH 4XNQA 5CGYC 1BFVH 2MCG1 4FKHA 3US9A 5GSRA 4HOXA 3VXSA 1S2EA 1A9BB 3ZN6A 5AQ0A 1HIMH 5BZZA 1CICB 5CIPH 5BW7C 3ZKSD 3ILPA 3DLQR 4KOBA 2E7BA 5C08E 1DSFL 2ZOWA 5I9QC 4XVTL 1JFQH 1KGJA 4UT9H 1OGTA 2Y06L 4D0DB 1U93A 3M45A 2DLFL 3OXRB 3BLBA 3P9LB 4PW4A 5LBGA 1FI8C 3X12A 4CAGA 1JRHI 5DJ0B 3V6BR 4HV8B 5KVGL 5B7FA 4FLQA 4JPIB 4O5LL 3QPQC 4W9LC 2Z31A 5DO2D 1KJMA 4QTHA 5ENWB 3NBNA 4QRSA 1EK3A 5GS1C 4XTRC 1FG2B 3UAJA 3DUSA 4X4YB 1INEL 4EI5D 1ZHKB 4CGTA 4M1DH 4TUJA 1VESA 5DRNA 3PAYA 2A5UA 4ZAKC 4XX1G 3CJJA 3L3OC 4QHUA 4PCTA 4WHTA 4ZFOB 2CM5A 3P11L 4MJHA 4ZFQA 3D3VB 3B83A 4QAWA 4W9ZA 8PAZA 4PVBA 4PJCA 4OBRA 3MRMB 1SVBA 2QDWA 1L6ZA 3BXNA 2V8LA 3P0YH 4E9XA 4PGBB 2Q8AL 3ZSSA 1JERA 5KVDE 1TJHH 4I0PC 4APQD 3V9CA 1XZ0B 2NY1B 4X99B 1OP5H 1SLWA 1AH1A 3CUPB 3WUWB 2P45B 1HHKA 2DJ4A 1KXTB 1OSYA