3NRQA

Crystal structure of copper-reconstituted fetp from uropathogenic escherichia coli strain f11
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
150
structure length
150
Chain Sequence
KEYPAGEPVTMNEMELAAVYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTGEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWWKPFDVSYEFKYVGLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic protein-probably involved in high-affinity Fe2+
publication title Characterization of a Dipartite Iron Uptake System from Uropathogenic Escherichia coli Strain F11.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 24
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3nrqA00
3NRQA 2O6DA 3LZQA 3NRPA 5I0WA 5I0VA 2O6FA 3LZPA 3LZRA 3PJNA 5I0YA 3PJLA 3LZLA 2O6CA 2O6EA 3LZOA 5I0XA 3LZNA
chains in the Genus database with same CATH superfamily
4ZW5A 5DC9B 4RGMB 3D30A 4FFYH 4HK0B 2R0KL 5DFTA 4KI5D 1RVFL 5JQ6L 1OF2B 4BQ8A 5HGBA 4UANA 4JJOA 1F4XL 1VPOL 1FAIH 2ICEB 2QLYA 5F1SA 3WTUA 4MXQC 2ZKMX 3NCXA 4HGKC 4ZW6A 4G11A 3FT2A 1FYTB 2GBVA 5DC2A 5IMKB 1SHWA 3K0YA 3QIUB 2WXGA 1TVBA 5FW7A 4OLYL 1VACA 2ADJB 2Y7LA 4MZRA 3VFPA 3OGCA 4H0IA 2XXGA 4EN3B 2CGZA 1KBWA 3V4PB 4BQ6A 5I1CH 1XR8B 4NN5C 1KJVB 4ZTOH 1KYAA 5MI0C 1V27A 4I4WB 1EHLL 4NQVB 3IFOA 1NCAH 4MYWB 3CFKB 3IXTB 4CN1A 2VCOA 2BVOB 3QG6B 1JPFB 1G7IA 3D4YA 5D7SL 2MTPA 4UM9B 2EKSB 3RVXD 5EUKB 1LK2B 4IGBB 4G6JL 3AGVA 3BWAB 3GSXB 1OARL 1AO7D 5IEHB 1ZHKB 2IH8A 5EEZA 1KUMA 1U4EA 4AXWB 1TQTA 3DVNB 3CSTA 2YAHA 3R0MA 1F1DA 1KG0B 1JWMB 1ET7A 1GYCA 3BWSA 1FLRL 1I3RB 2BSEA 4FLQA 3WDHA 4DUWA 1VERA 5I1DB 5FWQA 3SGEH 3VRJA 3ULVC 2YD1A 3QUHA 4IRJC 3ZKQD 3OLIA 5B3SB 1K85A 2NY3C 4NBYB 5FDWB 1G4MA 5JDSB 3MROA 1HIML 3BH8A 1S78C 4UT9H 1DFBH 1OV8A 5I6LA 2WO3B 4CADB 2CR0A 3D8MA 5DJ8B 2HVJB 2UY6A 4HOWA 4GRMA 3MJ9L 3MNVB 5BUGA 3NCYS 3T1FB 3QFDB 2NPLX 1IQDA 4YDLB 2P44B 3RWEB 2P24A 5ITFA 3Q6GH 3MJ6A 4X5QA 2C34A 4LLYA 1QBLL 2J5LB 5CZRA 4JM2B 2X4QB 1RMFH 1SOSA 3FB6A 1IGFH 3BSHA 4RWYL 5KYYB 4P4KD 5C8JA 4Y5VB 3VXQB 4B27A 2UYLB 2VLRB 3QDJA 4MASA 4MMZB 5FYJD 1FYTD 3B3IB 3VXUE 3MLWH 4GS7C 1KLUA 5B4MC 4LF3B 1CURA 2XA8H 4EN3D 1MH5A 1AHWA 1GA2A 4JDEB 2X1OA 1WFIA 3SE3A 2ZOWA 5LVEA 1HTYA 1WT5A 5J8OA 1EFQA 1N0XL 4M8UA 5BZWA 4K8RH 1U3HD 2J20A 3T6XA 1BEXA 4FQ2H 4FQ1H 3PP3H 3RKDC 4M7JH 2W8CA 3BT2L 4JQXC 1UOWA 1I9JL 4UM9D 4P05A 4YGVB 4YHPA 5HPMB 1J18A 2VDRL 3OKMA 4A38A 4IIQB 5EC1B 4IGBD 4MXVE 4P2QB 4WK0B 2DI9A 4RSYA 3MNMA 3CG8A 2MRYA 3RLSA 2AQNA 1Q0XL 2IMMA 2V7NB 3LN5B 1CZ8L 3ESPA 3MRPB 4JVPA 4LCYB 1JTPA 4NPYB 3ZE2B 1R9FA 2AXJA 4QCIB 2GJZA 5EEYA 1Z2KA 1MAKA 5HHMD 5JIQA 4XAKE 3PHQB 5E0QA 5KVFL 5EEXA 5M94B 3KZ8A 2DQJH 3U4KA 2DY2A 4JFXA 1EEYA 3KPQB 3DV6A 5DJCB 5IQ7H 4H1LG 4IBYA 2JNZA 4TSAH 1WA2X 4LT7A 1ZV9A 2IH9A 2C8NA 4HOXA 3MJ7B 4HKBB 1A4JA 4TYUA 5F96H 3NGBB 3KVDD 3IWVA 2WSPA 2WQVA 4PJFE 5F71A 3QA3B 2VWEC 1DL7H 1QOKA 3M17B 4MJ6A 5F21B 1JTTA 1GC1C 1H3XA 4W93A 5F7LB 1MDTA 4OY9A 5F3HA 2PN5A 4GG6B 1F13A 1H6EA 4JM2D 3VYNA 1JXDA 1CS6A 2XU9A 3AG3B 3SGDI 1HHKA 1HEZA 4BFFA 1TTRA 5CLWA 1NCJA 1OQOA 2FIKA 3C6LB 4U7MA 5FF6B 1QYGL 4K94L 4ORZC 4WWOA 3WS3A 4RVBA 3QQ9D 5F7EL 4V2BA 5T1KA 4ELKA 4ZMLA 4OZFG 3SKNB 3C5ZC 4W70A 5CGBA 1NMAL 5D7JB 1ZLVH 1CFSA 1MCWM 3QXDB 4NQCA 2RIKA 4Q14A 1DQKA 5CIPH 2H8PA 3G6DL 1IBDA 2IPTH 2X89A 3H3PH 2PR4L 4YBHA 4M1DH 4AOFA 4OZIE 4G7VL 5EU7E 3V6OE 1NBVH 3QHFH 1I82A 2A73B 3DJRA 4X4KA 5ESQA 4EMZA 1A6AB 1DVXA 2GTWB 1IC5H 4JPKL 5DA0B 3ZDWA 5BOJA 2IWKA 3MLZL 3W38A 3CDZB 2E7BA 1BX2A 2A9CA 4D0BA 1NKOA 1F6FB 1FFPA 2X4TA 5H35A 4O02A 4P2QD 2BSRB 1BAFH 1TQSA 2AABL 3VH8A 3GXPA 2CHWA 2FWSA 3MO1A 3FH8A 4L1HA 4L0ZA 3U0WL 3IJ9A 4JHAH 3BWUC 4KROD 1P1VA 4IS6A 4E42B 2HLAA 1KGCD 2JELL 2K70A 1NUFA 1G6RA 4RAUA 2OSLA 5HGAA 2DM4A 4CN6A 1HWHB 4D9QE 3ARFA 3A23A 4IMLB 2WJ7A 3TO4B 1FZKB 1KJ2L 4TL5A 3CNKA 4FNRA 4X7SL 1BZ7A 3VVVA 1U8JA 3DUSB 2VXTH 5J6GB 5FCUL 1I8LC 1T0NB 3G6AA 1NCDL 1CTMA 1TZHB 2H0PA 2YQBA 1E6OL 4M93B 4ZS6D 2XNAA 4PUBH 4PGBA 3TNMA 1O6VA 5C07B 5L2JB 1MUJB 3GI8L 2PTUA 3WN5B 5CBEB 5LG6A 4MHHG 1DVQA 2DJSA 1QLRB 1VADB 4JQXA 3C6LD 1SUJA 1LWJA 4RX4A 2DI7A 1S7TB 4JFFA 1MWAA 1QQDB 4LSSL 4BH8B 2X9ZA 5CFAA 2NY0C 1QUNA 2YPVA 1CGYA 4P2CG 5T1LD 1XB3A 2BRQA 1HKLH 5D7JD 5GJTL 2BP0A 2FB4L 2E56A 4BFGA 5LNDA 3AQXA 1KXQE 2ADGA 3WIIL 2DM3A 3D3VE 4XN4A 3MOAL 1N6QL 7TAAA 4FQJH 1OPGL 2X3CA 4DP2X 4GKOA 3CZGA 3NJKA 3WEXB 2VOTA 4JQVC 5IW6A 4DVBB 1TCRA 3FCBA 1M71B 5E2UH 2LLGA 3Q3GA 2E59A 4TPRL 2VDMB 4KKBC 2ZX5A 1CF1A 2OMYB 1LLAA 1HI6A 1CE1H 2F53B 5I17B 1ZHLB 2D31A 2YAPA 5KSBF 3C2AL 5CLYA 3LQZA 3S98A 2B1OA 4ONHA 2A4CA 1MCKA 2ZG3A 3DSNA 3DOHA 3C6SB 1I1RA 2NYYC 2RGSA 1RZJL 2O5YL 3BDXA 4L4VB 4MQSB 5E1GA 5TTRA 4UV4L 1WBZA 4ZO8A 3OXSB 2MHAA 4R7VA 1MCSA 1ZSDA 2X1XR 1QNIA 1T1YA 4FFVC 2DBJA 2BNRB 1GZPB 1ILSA 5GS1C 4GSQA 3EIFA 4ZW7A 5DMJB 2V3DA 3C5ZA 4PGCA 1GGBL 4RETB 4RMTA 3TO4D 1U92B 3ALPA 3AB0B 2Z8VC 3BAXA 3O9WA 3WKQA 1JPGA 2DQTH 2YWZA 1W0WB 3FYEB 1J05B 3P0GB 2W95A 2A77L 4R0LC 2YLKA 1U58B 5F0MB 3ZUCA 1MCPL 3EHBB 3PGDB 3QYCA 4LCWD 3EGDB 1SDDA 3PWPE 5HVHC 4PD4J 3Q9QA 1SOKA 1QAWA 2Q0ZX 3OJDA 2OL3B 3GF8A 3LQAL 2DS4A 4NENB 4M4PA 3LH2L 4KJYB 4XHJD 4WHYG 5C2UB 3GHBH 4U1KA 2WHVA 3X1NA 1Z0MA 4N86A 1AGBA 5HYSB 4G59C 5AALA 3ARWA 3QIBC 5C6PB 3WJMB 3I74A 1N5AB 1TLMA 1TQBB 3K46A 1KCWA 5DZJA 2BHFA 2JQMA 1FH2A 4LP4A 4OZGA 4XCCL 2VSKB 5DJYB 5ESAB 2BY0A 4YAQA 1PL3A 4HG4K 4L18A 1UCBL 1YC7A 3S96A 3T1WA 5AZUA 5EBWB 3GIVB 1A7RL 1U0QA 1EEUA 4JY6A 5KW9H 3GC3A 1E5AA 1CDIA 5I1AA 3WD5L 2OX5B 1AR1C 2AMGA 5FECA 3BO8B 3BHBB 4B9FA 1VFUA 1JWSA 3MNDA 5IW1B 3BX7C 1AGDA 3L9EA 4PB9H 3AXLA 2F53D 2NY1D 4P3CH 1N19A 2CXKA 5BV7H 5CZVL 4DEPB 3B7YA 3BP4A 3EO9L 5F6IC 3G6JE 1A14H 4MNHB 4GAYA 4NQTA 1FFOB 2P4AB 5B7EA 2DN7A 4J4PC 4N6QA 4Y4FA 4YVUA 2OJEB 1I3GL 1SYVB 4L4VD 1UM4L 4L2LA 5E6IB 3SE4A 5TF1L 3ZHKA 3KL0A 4LP5A 1I31A 4X6BB 1I7TA 1AD9A 1JGVL 2HT2C 2BNRD 3O6LL 2QQLL 4OLZH 4O2CB 5B1JA 3FMGL 4KWUA 3D07A 3VI4E 3UMTA 3AADB 5I24A 5HY9A 4Z5RB 1DEEB 1GPOL 4U6HB 4PJCF 2AEPH 1MVUA 3RWJB 3GZKA 1V7NH 3IAPA 3FRUB 4J6IA 4W6YB 3EJYC 2APVA 1S8DA 1ZLVK 3VG0H 3ZZSA 2AI0H 4X5WA 3L5WB 4AV5A 1KXHA 3LNEA 2Y7OA 3CVHH 5MENE 3PGFH 1JZ8A 1XEDA 3D0LA 1FZOB 1X5KA 2B15A 3EHBD 4OIIH 3ZXAC 4AQ8C 4Q9RL 4Y19A 3ZDYE 4OQTA 3WUWA 3LNIA 1QHPA 1F3DJ 1RUKL 2APSA 3VA2C 1DSYA 2R51A 4MQXC 2ZWKA 3LN4A 3HS0C 4JL2A 3UL4A 2R7EA 4J1UA 4Y5YC 5JNYA 3H56A 4Q0XL 1MHCB 2EEBA 2HPOA 3EO1B 1HL5A 3HR5B 1BZ9B 2ATKA 1ZS8A 3FO9A 1KLFA 4K55A 1PG7L 1AANA 1QHQA 3FQNA 4CUCA 2B5IC 1MLBB 2N4IA 2FQGA 1SEQL 1XF1A 3ZZQA 3HB3C 4JANA 1DUYA 5TJWK 1B88A 4A7TA 1W6LA 4DKEH 1CK0L 2GI0A 4QHUB 4HGWB 1T1WA 1AGEA 2WVTA 3NTCL 3Q8CA 2CGRL 3P2DA 4OLVH 1IUZA 1OK0A 1ZMYA 2IQAB 3JTSB 4GXVH 5FA3B 1B6DA 4O4YL 5GS1A 2Z0BA 4KKQA 4YHNB 3S2AA 5I1IL 4B3EA 3AREC 4U7SA 1OO2A 4QRSA 3RGVB 2XXMB 1KB5B 3CHSA 1RUQL 2J8UA 3QXTA 1Q9KA 2W59A 3VX0A 1LO5A 4BRVA 1UZGA 4NO5A 2XHNA 3D52A 4P9ML 4XMVA 5D70H 5T8IA 5JPNA 2DICA 1XFPA 2VLKB 1G7PA 5E6ID 3WJLC 3W2DL 1MFEL 2DQCL 5JUEL 1WV7T 2D7MA 4PJDE 5DRNA 3SDXF 12E8H 4WENB 1SUHA 4WTWA 2NQDA 2EILB 1AFVH 5F0LB 4CAGA 4E41B 3UXFA 1MQKH 2Y24A 3QIBA 1TG8A 3G5WA 4CJ1A 1B9ZA 2JK5B 2F68X 1AIFB 2F8OA 4ALAC 1IBGH 3GSNL 2FJFA 1XQ4A 5TE4H 3W0WB 1MCLA 1HQRA 1NJ9A 3RFZB 2A9NH 4GUPB 3H2QA 4FJ6A 3DMMC 2VW6A 3KPSA 4JDZB 1ETB1 1WAEA 5TPWH 2C9RA 3LHPH 5LLIC 3GTTA 2H2SC 2A83B 5HI3D 1H3PL 1IGIL 2LTQB 1NGPH 3X11B 1N59B 3RB7A 3D08A 3TBVB 3BKJL 3V0VB 4X4YB 3T4AC 3BSZH 4JZNB 3VXME 5IGXH 4MWFA 3E6FA 3QH3B 3O4OC 4HUUA 4QWWD 2AANA 2VC2L 1G5AA 1UM5L 1PZ5A 4EI0A 1SXZA 3WNMA 3ZN6A 4KMQA 4J4PA 4QLWA 4Z76B 4TUUA 4DTGH 1PLBA 5TE7L 4ZMNA 1GGCH 4FC3E 2AEWA 3IN0A 1KEGH 1PG7W 4KHTH 2BSBA 2AK4A 3MNZA 1QSEE 5AB0A 3BEWB 2I60H 4B0MB 1NMBH 5AVXB 4OAWB 1HHJA 2CMRL 1OGTA 5I0XA 3MN8A 3SSGA 3OTTA 2X6BA 5GGRA 5C09E 3SY0A 5D1ZB 4ZPVA 2ZYIA 2NNAB 2ZWZA 4IKNA 2B14A 2ZOTA 5GISL 1WFUA 2VLLB 3SE8L 3VMOA 4BFIB 1LXMA 2NY7H 2PWDA 3GBLA 5IMOB 1TJGL 1UG9A 5I5MA 5D1QE 2IAMC 1L0QA 4JN2A 4X7EC 1RH8A 2VLKD 3F7KA 1DLHA 1EO8H 1PDKB 2K9FB 1RQ5A 1AMXA 4BFKA 5JPMA 2IPUK 3O2DL 3HS0A 2GQHA 4JRXE 1UZ6F 2O26U 2OS7A 4Y5YA 4DAGL 3NFSL 4S1DC 1NBYB 1KNOB 1N70A 4U2ZA 4LOUC 4ZOEA 4EOWL 4M48H 4E41D 5DQJA 1QLFA 3ULUF 5EU3A 1A6VL 3X17A 1KN2H 1O7VA 4OKVB 4J3OH 3Q9PA 5FDYA 4M5TA 1SNRA 4Z3TA 3W0WD 5JXEA 3AAZB 3VRIA 3X12B 1GTNA 3OKOA 4DFHA 2PO6C 3GFUA 5IVXF 3LIZL 5DF0A 1L4IA 3D06A 3SJVA 2D7TH 3OJMB 4JUTA 4NM8L 5E70A 4ZSOA 1XSIA 3U1QA 3HG1E 4GI9A 4IBZA 3U30B 4WUUD 1FO0B 2H0JA 4ZMOA 1CFNB 4GXFA 3AREA 3EFOB 4KI1A 3QS3A 3PHOB 1JHTB 3ZKSD 1MLCB 3EGSA 5SWSA 3P0VH 1QVOB 2Y2WA 3O3DA 1CXEA 4UILL 4OD3H 5HGDA 3BT0A 4I7ZC 4LAQH 3UADA 3WJLA 4X7DC 3FB8B 3W37A 2EIMB 1W80A 3UTZA 4FKKA 2B08A 2DQFA 4OT1H 5DS1A 4OV5A 4NGHL 4JVUA 3LKRB 4YDKL 4YL4A 3E38A 5C0IA 5GS0L 4GIOA 3NCMA 5D1ZD 4JGJA 1FPTH 3U0PA 4LCCC 3LS4H 1CE6A 4QXGH 4B9ZA 1TIUA 2G2NA 2QHRH 4HPYL 1S2EA 4L3AA 4FEIA 3H0TB 3ZSTA 1G9NL 2Z91A 3DMMA 3RWGB 1MW3A 4IDJL 4ZTEA 4BCYA 5TDPB 5HI4C 2W91A 3B1TA 1UXSA 1Q9WA 1Q1JL 4GKNB 1BFOA 4PY8J 1E5CA 2VN6A 4WSGA 1DUZB 2H5UA 3T4AA 1SY6A 4Z18A 4DP9X 4MJ5A 1CF8L 1SZNA 3GSOB 2DF3A 1JZEA 3DYOA 3PDOA 5DRXA 2XPGA 3PXJA 32C2B 3ZTJH 2CBQA 2O72A 1PIGA 4JM0A 3WCYA 1KIUB 3M1OA 1E5YA 3BVDB 4K9EC 4XO9A 4ZUVB 3S3BB 2P5ED 5IV2B 2CKBA 4S1SL 3GSUA 1TETH 1A2YA 1RJLB 4X9FA 1VGEL 5E8OB 2EDWA 1HCVA 3NN8A 4PW9A 1MHHB 15C8H 4Z3HA 1TTBA 2E27L 1H9DA 2XWEA 1O6SA 2XZQH 1UJ3C 2EDYA 1FNSH 3FFCD 3QO1A 2JCWA 4GRLB 4ERSL 2QDWA 5F88A 5DHVA 1ZVSA 3FQUB 5I75C 2X87A 5JOPE 4RMBA 1XIWA 3GJEA 5FB8A 4OCYL 5HI5D 1KYUA 1K9TA 1OB1B 2YA1A 4DK6A 3KYOB 4FQQB 3NFNA 2ZP8A 1SN5A 2Q8AL 2CBPA 3O3AB 4JMXA 3NJNA 4ALAH 2V17H 4PRDA 2GI7A 4QRPB 5IF0B 3ATBA 2IAMA 4LESA 3EF7A 4AQ1A 1K2DA 3GXUB 4RISH 4GLRH 5CBAA 3ARGD 5D96C 1VDGA 3IBOA 1IU1A 3RTQB 4DPCX 4ACTA 2EEXA 5DZLA 3UIZA 1V5JA 4FFYL 3IU3A 5GXBB 3DIFA 3R19A 2LVEA 2IOIA 5DI8A 2VSMB 2XVBA 3AXHA 5DZVA 3OMAB 4PJ7B 3V52H 2GJRA 1A1NA 2BWDA 3D6GA 4J12A 4BD4A 4YLQT 5KVEE 2NSQA 3BJLA 2F8IA 4PJEE 1NBCA 3TIDA 4QT5B 4JKNA 1E8YA 3GTNA 1FG9C 3CFBB 2H32B 1ND0B 2WNXA 2YC1A 4Q52A 3JWNG 1NCCL 2GTZB 3ZDZF 3BZ5A 4K0OA 3W39A 2IWGA 2X4PA 4PRHE 3UBXG 5F3BB 1F8TH 4OJAA 1YNKH 4PVLA 5TE6H 2VQ1A 4LLDA 5I1CL 3DVGA 5LGJA 4F33B 3N0AA 1NFIB 1WITA 3G04B 5FYKL 1BEYH 1YYML 3VX1A 1NCAL 1UATA 5CD3A 3QORC 4NC2B 4X80L 5CJQH 5DZOA 3BZFB 5LBVA 3AU1A 5KOMC 1R0AH 3WHXA 2WTRA 3X1FA 2XY1A 4AQEB 1R5IB 4PGDA 4FKEA 5BXFB 1R3IH 1PKQA 4KRLB 1W8EA 1W2KT 2F0CA 5KSAC 3I6GA 2O4EA 2Q86A 3RIKA 4NSKA 3K8LA 2ZXBA 5LWYH 4GIAA 5E2TH 1W72H 3FONA 4FLOA 2AW2A 2YQGA 3QJXA 2N0MA 2PR9A 4FZEL 4U4BA 2IDCA 5C0GA 4NKDB 4WF7A 2XG4B 3DARA 5EBLA 3VD4A 4FG6C 2UZYB 5DJ6B 1VB9A 4QRPD 4UT9L 2OCFD 5CR1A 1JK9A 5ICZB 4GB9A 3IJSB 3N1FC 1DJGA 1A4CA 2NZ9D 4OM1H 2XDHA 4QOKA 1LL1A 4RNRB 5F72S 2KZWA 1WICA 4QO1B 4XX1G 4Z7NB 1AOZA 4HIEB 3NVQA 4HUKB 5DQ9A 1QLEL 1QP1A 3Q6GL 2HJKB 1C5CH 3VQ1C 3U1SH 4FTVA 5CEZD 4Y2LA 1LMIA 1BW8A 3QG7L 3K6DA 2ICWB 3QIWA 4H5SA 4MB3A 1S9WA 4UDTA 5C3TA 2OCCB 2O6EA 4JFEA 1VZHA 4CC1A 3T2PA 1HCZA 3AQZA 2VQTA 3Q8AA 2QPEB 3H9HB 3MUHL 4ZT1A 5DU7A 3MLWL 5IY5B 4FQXB 4XPBH 4UM8B 4OGAC 4P46A 1BM3H 5CJXC 2X4OA 3V0AC 1WZKA 1UJ3A 4LGRB 3B2VL 5CMAB 2A1WL 4UTBA 1HVXA 1U93B 3KDMB 3NQIA 4L4JA 4N2FA 4OD2A 3GLEA 4WI4A 3OZ9H 2FZ3A 5EU4B 5I15H 1EXUB 2BJMH 3BVXA 3HCVA 4XE5B 5I76A 1S7QA 3WHE0 3FB5A 3HRPA 1QFOA 1FGVL 4BEIA 4F7PA 3L2LA 3SPHA 2N7BA 3T65A 1PZSA 2YN5A 3GXMA 4KRNA 4L9LB 4GAFB 2FATH 1F4YH 5E8PA 2FJHB 1U9KA 1UFGA 5AQ0A 1IAIM 1FL5B 4Z7WF 1NAMB 4OCMC 2MFNA 1HHIA 2FECI 5C08E 4A7UA 4C56E 1FAKT 1LK3L 1JZ5A 4LRIC 1WUZA 4TRPH 5C0AA 1CLCA 2VUKA 3MC0A 3Q5YA 2RQEA 2WZ5A 3H54A 2NMSA 1U8OA 2VSDA 4TSAL 5EIQA 3DRQA 1H0DB 5F96L 1EEZB 2R59A 4GPVA 1PX8A 5DUBA 4N20A 4NAJA 3VJ6A 4D8OA 3HLAB 1ED3A 4ZUSB 1EUUA 3QC5X 4NNYA 2AC0A 3U6RB 2IPKB 3TA3B 3QORA 3CK0H 3T0EE 2H9GB 5D5MF 3I6KA 3FU6A 1ZGLA 2Y6SC 1ACZA 1PJ9A 3IXAB 1BQRA 3L3JA 5DHYA 3IDXH 1UCTA 2GIYA 2W07B 3EYFA 4K5MA 2DWTA 3O3UN 1XF3B 4FQXD 5C0CB 3VXNA 5M95B 1TJIH 3M7OA 5GZNC 5F2FA 4IEFB 3VD0A 4BWWA 4X5RA 5KSAA 3DOSA 3KWWA 1CL7H 5AW5B 2D3NA 4G7RB 1BBJA 1D3CA 2IPTL 5FGBC 2XQYG 3H3PL 4DCQA 3J2PA 1A6UH 4M1DL 3RNQA 2CDGA 3H2WA 4S2SB 3VG9C 2YLHA 3L17A 3CFQA 1AVAA 4WNQA 3MV9E 1EWHA 3FQ2A 3LS5L 4UQBA 5KVFE 1IC5L 4IBSA 1XTLA 2NY4C 2HP4A 5E5LA 2ZX9A 4F57H 4XT1C 4EZKA 3I9GL 3JT0A 4XBMA 5H4ZA 4AGMA 3IFPA 1G7HB 4I3RH 1RHHA 2J44A 2W9DH 3F5WB 5J1AB 5JHMA 2HVKA 4UZSA 1MCBA 4C54A 1BAFL 2VZSA 3SYCA 4HWUA 2OZ4A 4PBWD 3CXDH 3UROR 5FV1L 4MCYB 1AKJA 3TEYA 5ETUB 2D0FA 2A6DA 3SPVB 5ID0A 4DNLA 5H37A 1DSFH 3ZTCC 5CAYB 1BLIA 4HEME 5MEOB 2HB0A 4YEFA 1CD1A 2YPLB 1GSKA 4DQOH 3V0WH 1LO0H 2DH3A 2BMKA 2MWCA 1CC3A 2MH4A 1EH9A 2O5ZH 2GG1A 4POYA 5IKCB 5CJXA 4JHWH 3FC8A 4HCGA 4W9FC 1YMME 2RA1A 2WANA 2VXTL 3KGUA 3L13A 3QEHB 1WLHA 3TVMA 4QRRE 4EKJA 1RJZA 4PUBL 1GYWA 2CO6B 3FT3A 2WLHA 4R2GC 3ULVL 1ZT4B 3LD8C 3MX0B 4HHGA 4WTXA 3VFTA 4XNYH 1FF5A 4TQPA 2VDOH 1RJCA 2UWEF 4JMNA 4P57B 3DTDA 1TJXA 3FS9A 2EUWA 4U6VH 3P77A 1VJSA 1N6VA 4I48A 5C0CD 4Y1AB 1XBRA 1HH9A 2QQQA 3GSVB 2YAOA 1HKLL 5C7XH 1IGYB 3PDGA 5FHBH 2J8OA 1P7QD 3HMWH 3HBPA 4WEMB 1EVTC 3CCHB 4R7XA 1AC6A 3FO2B 4KKAD 4FQJL 2VR7A 4GXUN 3KPOA 4KRMB 3LKPA 4M7LT 4LRIA 4W9KC 2C9SA 2FO8A 1JNHB 2YRZA 3L4VA 1HSAB 3HC2A 3DKHA 2DLIA 2V9RA 4E9YA 5INDB 5JHDE 2X42A 1U8NA 4RZCB 4XPGH 4P07A 4APQC 3TIEA 1KDJA 1CE1L 3C60C 3P9LB 2YOCA 3THMH 4F8OA 1FFNB 2PCPB 5L8LB 1V3JA 1RPUA 4H25A 2DJMA 2I85A 4HISA 3C5JA 3KL5A 3H7BB 4TULL 3CIAA 5IFJA 4ODBD 1LJMA 2OMXB 2Y3NA 2ZYRA 4G6FD 5D4QA 3VWKA 5C0ND 1A7OH 4PV9B 3BAYA 3QJFA 1FNEA 5D6CB 5JYLA 3WU1A 3IF1A 4F8NA 4YPJA 3UTTB 1OALA 2ZP9A 2ZPKH 4MTMA 1QRKA 3PWUB 1QRNA 4ZNCD 2WXLA 1A1OA 1AACA 3O4LA 1LQSR 3EYQD 3MKGA 4FLHA 2MCPH 5GZNA 4J8RA 1CPUA 2P52A 3FNKA 1VAHA 5EIIB 4Y4HB 4QNPF 2QVFB 4FA7B 3VTMA 4YX2H 4HVBA 4DPBX 4KNUA 5FGBA 4YC2B 4L8SC 4OH2A 5I0DA 4TQIA 1S9VB 1BVZA 3DX8B 1GYUA 4F7MA 4K07A 2NTFA 2CO3A 3F7PC 4AK1A 1KTCA 5EIIG 4U7KA 3ZL4L 1WFJA 3OQRA 3OMIB 3UJIH 3DURA 4JEGB 3CPLA 4MNGE 2R9HD 4AZ8B 3RAJH 1J0HA 4JFOA 4XTRD 3ZR6A 1Y7VA 5HGHB 2E9IA 4Y1AD 3HZVB 4HWEH 5ANHA 1KTRL 4QMEA 1SVZA 3FU0A 2A9ML 3HRZA 3MQIA 3QPQD 2UZIH 3D2UB 4JRLA 4ZDHA 5IJVB 4CBZA 4MNQE 5IT2H 1FVEA 2A2QT 5B3NA 2FHBA 3OZLA 4YXKH 3TN0C 3CZLA 3V6ZA 3SGKC 5A2BA 5DLMH 4WWKD 4P0DA 3PL6D 4S1QH 5D2LE 4ZFZB 3U4EB 4ELMA 3PJSA 3ROLA 1IJ9A 2UXFA 4GRWB 4ORGB 5TDOB 4LCUB 4BYHA 2MNJB 4PB9L 5LXVA 1TMCB 1ORSB 5BV7L 3VQLA 5F9OH 3HI6H 3MA7A 1OAQH 2P8PA 2V2XB 2WIIA 2WKLA 1AQDA 1KTKE 3IJYB 4NRZA 4R97B 3V9EA 1OCZB 2NLJA 1VZGA 2TRYA 3OKKB 3R06B 5BRZA 1P1ZB 1T1XB 3NRQA 3ZL1A 4UNTA 5H2BA 1J8HA 4LQ1A 3O8XB 1PZCA 1TSHA 3QNYB 3U2JA 5CCKH 3IGAA 4WHTB 5IQLA 4YFLI 2A0LD 1C8QA 5IUSA 4OLZL 4WFGD 4LSUH 4Y9GA 2E7HA 2FYYA 3LXCA 1AR2A 3DROB 2AEPL 4PJ5E 4X4MA 2CHNA 2WJ5A 4Y4HD 5BOPA 3ZKNC 1LM8V 3O6ML 4DGYH 1H15A 2VSCA 3CVHL 2YSTA 3PGFL 4XP1H 1BVKA 2QMKA 3QRLA 4FX5A 4OIIL 4PCKA 1W0VA 4DO5A 1TO4A 4R8WH 2GB2A 2A74A 3US9A 1HILA 3QFJA 2AJUH 4KTEH 1EANA 3BRDA 4O2FB 3RWCB 5JR1H 1CLZL 2JIXA 3VE0A 3A0OA 1E3XA 5CCJA 3BPLB 3VD7A 1UT9A 3B2MA 5HYQA 1A9VA 2ITDA 3HE6C 2YKKA 1XF2B 3OXRA 4RMRA 3S5ZA 3D2UD 4P48A 3FKUS 4WTZG 2JH2A 3V5KB 2X4UA 3QW9A 2OPCA 1GGIH 3CFCH 3EFFB 1DN0B 4DKEL 1SBBA 3LTVA 3EYSH 4O00A 2FBJL 3IJ7A 3WDJA 2OQJB 1MJJB 3CLEL 3EJRA 2CM5A 3FUDA 2G30A 3O3BB 5KSBE 3C08H 4OLVL 4Z3EA 4GXVL 2YK1L 5D1XA 3HG2A 3HA0A 1JF1B 4TLUA 3TT1L 2MIZA 5EU6A 3DX7A 3RJDA 3RPIB 3UYOD 3F58L 4MS8C 4ANVA 4JNXA 4XCEA 5E5MB 2VM3A 5D70L 1TEYA 2BIQA 1A1MA 3FQTB 1BVNP 4P2YA 3S48A 5K39B 5K9OA 3JVGC 4MJJA 4MHHI 2Q6WB 5IEKA 4MJIE 3PG2A 3KLQA 4QXUH 4OQTL 1YUHB 3O8XD 5IBLC 2XIIA 12E8L 1KZQA 5KBPA 2MQCA 1KCLA 1IKOP 2DWDB 5T3XD 1MY5A 3SO3B 2ZSVB 1HJBC 4NRYA 4PHZA 2EAEA 3U6XS 2BC4A 2QQKH 4J3OF 2PW1B 3NIDE 1FQ9C 1MQKL 1MVFA 4N0YH 1OTUD 2C3XA 2LGNA 4EUPA 3KWXA 1X5YA 5FR3A 3A6BH 4MMYA 2H26B 3WLBB 1Z9OA 2WINB 4U05A 3OVUB 3JXAA 1GCFA 2C1OB 2ARJB 4TM9A 8PAZA 3QUZC 1SYSB 4J3SA 4TVPD 2A9NL 3CVDA 4ZUWA 4Q8BA 1BMZA 2AGJH 2Z31B 2ZX6A 5PAZA 4LRNH 5I71C 1FIGH 4UT6A 3VXUB 1QI5A 4Y2OB 3ZDXE 2DMGA 4ZMXA 1BIIB 1WBYB 4WKZA 1NGPL 1BQUA 4H44C 3K72A 1MIEL 1FHNA 1VKXB 5I6MA 5CZXC 4Q9CA 5IGXL 3ARUA 3FU3A 2CCLA 2L8AA 3HZYA 4HJ1A 4HWBA 1BG9A 2OXHA 4AW4A 4ZUUA 2XN1A 5IFHH 4BRJA 1IT9H 4KXZI 5AOLA 2RR3A 1QATA 3AJ7A 1OQXA 4OF0A 5I2IA 4XO8A 4YZFE 4UOZA 4DTGL 2GJ6A 5EUOE 3E8UL 3H85A 4KHTL 4Y4KA 4K2UH 4V1DA 5I26A 3NQKA 5FUOH 3UGUA 3CLFL 3D33A 3VRLF 1UZ8B 2I60L 3HFML 4QHLA 1NMBL 1EZUA 1ZV2A 3CZNA 2V5YA 1Y1UA 3VXRE 1E5BA 2CRIA 1ACYL 4G6KH 5AOMA 2YMTA 4L8CA 1OAKH 1XD1A 2V6HA 2ZG2A 4HJSA 4FQHB 5IHBA 2XKNA 3P1VA 1G7JA 4GG8B 4ZQKB 1DQQB 1D9KA 3R7QA 2ALAA 2N7AA 4PJCE 1EO8L 1INQB 4BFEA 3BUPA 1B0RB 2WV3A 1HL9A 3LKOA 5LCVH 2YSSB 3RUGE 4KI5C 2FQEA 1IEAA 1UB6A 1HHGA 3VU1A 3T8XA 3STLA 5HYJE 4PJFB 4Z7OF 4M48L 3FSWA 3CH1B 3ZK0A 2XBZA 1KN2L 1OW0C 2OYKA 2OAAA 4HU8A 4WW1B 2CR3A 2X7LB 1EJOH 2HH0H 4G2AA 3TBWA 1QO3A 4P5KB 4PAZA 2DH2A 3S36H 4R4ND 3FCUB 3AWEA 1FI8C 4NFCA 1IVTA 4RQQB 4TQHA 5E4IA 3VGGA 3GBEA 4NN6C 4U1LA 1KENH 2Z31D 4K5OA 4D9RE 3MMEB 3OSVA 4X0NA 3VXUD 3NABH 4S10A 2XXCB 1XO8A 4GO8A 4YSEA 3WNLA 4AENA 5IB5A 2YD6A 4JPIB 1JZ3A 2DTSA 2ZYHA 3TH3T 4BZ1A 4HX1B 5E24E 4K3DL 3WFEH 1VCBC 4NI6A 5SWZE 2F54E 5HVWA 1D5BA 4HIIB 4L4TA 1IEBB 3OQ3B 4YZWA 3RVXC 3LPGA 2BSTA 1ACXA 4OZIB 3MUGB 4LAQL 3GT6A 4YHZH 4DUVA 3JVGA 3RVTD 3MRNA 1BVLA 2Y7MA 2YO3A 4XZ4A 3GS4A 2ZOLB 4ODXA 2JJWA 2D4DA 1G7LB 2R27A 3L5XH 1EVUA 4PM1A 3OJ2C 4NIYE 1DE4A 4NM4L 1OGAE 5F1OB 1QBMH 4Q6YA 4HAKA 1M2VB 2CAKA 2LHAA 3R18A 1FPTL 3P69A 4YDJB 3BUQA 3SDXE 1PKOA 3LS4L 3U4AA 1F41A 4Z7WA 1A3QA 4QXGL 1IE4A 3WO4C 1QA9A 3GSWA 3N06B 1DQML 4YBLC 4P3WA 4WY7H 1FORL 4LBEA 2Q2LA 4FA6A 1HT6A 5I1LB 3BKYH 4RGMC 2WBXA 2B4CC 1WIPA 4OLXH 4AVJA 3H6AA 4AGLA 4XE0A 1E5UI 1WHPA 4ZX5A 2LE9A 4LVHB 4YHKH 4DN4H 2GBTA 2ICEC 2MQ0A 1HNFA 2R1WA 1CCZA 2XSKA 4HS6B 4NQXA 3S5LA 1WP6A 3C2SA 4KQ3H 4PWGA 1HWWA 1X3DA 3FF7A 4P4KC 4QXVA 2F8XC 4LKCB 4BZ1H 2LOEA 5K1JA 5IJBC 4BQ9A 3OX8A 2VITA 2APFA 4XC1H 4X98A 5AW0B 3ZO9A 1T5WB 2O30A 2F5AH 4FN0A 2X0WA 3T6QC 2KUTA 2WCGA 4PV1C 2DAVA 1QEXA 1FC1A 5D5MA 3U1PA 2VNCA 4EN3C 2VDKB 1N8ZA 3GNML 4BIKA 3HG4A 4OM0L 3WE1A 1INEH 4GKLA 15C8L 2DTML 2OMNA 2Z35A 1B3JA 4UU9A 5H94A 3EJSA 4P23A 5EMYA 5D7HA 1YN6A 1FNSL 1U3HC 2I26N 3P9WB 3QZWA 4QHKJ 1KCSH 4MX7A 1I4FA 2K3HA 3BEVB 4OFQA 1CWVA 4P49A 4UQ3B 1V7MH 3W57A 5C0DB 5I8CA 1X9UA 5E8EB 4QYOB 1O9WA 2WN3A 3AQDA 3D3VB 1QW9A 2I24N 4JLRB 3L3HB 3SHSA 4X7TB 2SEBA 4ALAL 2V17L 4AKPA 4LMQI 2EKJA 1KT2A 2BDNH 2VZ3A 4IGBC 1RXLA 1KEMH 2JKSA 3CU1A 1BJ1H 4BCZA 2P8MB 1QFWM 1BD2E 3BVTA 4OCWH 1N12A 2R4RH 3MDJA 4QRQA 2X44D 3TBTB 3QQ3A 4ZFFB 2ZXCA 4MJHA 1IFGA 1AXSB 3IS0X 5DURB 4QKTA 1N4XH 4PJXE 2QJDA 2DEWX 2HVBA 4MA1B 1T21A 3N44F 3NSJA 4RWHA 1GRWA 1UZ6E 4FNLL 3RE0A 1FHGA 4LP8A 4FGMA 4WJ5B 4CW1A 3Q01A 2WBJB 2YXWA 4O51B 5ERWB 4G1MA 4NP4L 4UDUB 3P4NA 1Z9PA 3HNVH 4XRCB 5J4MA 4IBQA 5GRUH 2CKBL 2ZD0A 1RL1A 2EIZB 2X5PA 4PGZA 4E68A 3HC0B 2IAAC 1F8TL 2J5LC 2P9RA 2P80A 1ILUA 4JM2C 5F8RC 3UC0H 1DVZA 1XGQB 5D4JA 4KK8D 4TOYH 5IVXE 4XXCA 5DEGB 1BEYL 1QSFA 3CFDB 4HCRH 1WA1X 4KH9A 5ICYB 2EYRB 1OSPH 1EHNA 4Y5VC 4MMZC 1R0AL 5J6HA 1ITCA 3UC2A 1K6QH 3QDME 2VISA 3PWPB 4X6DA 3MV8D 4U6YB 3QQ9C 1AO7A 3QXUA 1Z9SA 3BMVA 1NBZA 3U9WA 4P9HC 3JV6A 1XGPB 3FQWB 5IHLB 2VZVA 4M7KH 4NCC1 1R3IL 2UWEA 2ICCA 2Q76A 3BAJA 3LEXA 2IADB 3MLRH 1HXKA 4PYHA 5DWPA 3TPKA 1R24A 2GUOB 5LWYL 3D85D 3K5SA 2AK1L 5FO8A 2GT9B 5AD0A 1C1EH 3NJVA 1KTJA 4NKIL 3UYRH 4I2XE 4AIXA 4PJ8C 5HJ3A 4PRPE 1E4KA 3ARTA 3D3VD 1L9OA 3MUJA 4G8EA 4JCWA 2VDQH 3PLYA 5DEFA 2M26A 3E6HA 5GHWH 1VFMA 1K8IB 2KC0A 4OGXH 4RDQG 4A6YB 4OM1L 1HZLA 1E67A 2WWMD 4H88H 4HK0A 4WHCA 1OF2A 3DTUB 5D1ZI 5I6XB 1HL8A 2HA1A 2RACA 2NNRA 5DJAB 1E50A 2ICEA 2R69A 3JWDH 4ZQTA 4KROC 2TSAA 1YY9D 1IFRA 4PBVC 3BVUA 2DBLH 4XZUB 5DHXB 3TV8A 3HUJE 2PKDA 1TMQA 1G0XA 1FYTA 2PXYB 2VO5A 3G6JB 5IMKA 3TBCA 1X6NA 4ZNEE 3QIUA 1XZ0B 1IVLA 3JZ7A 3IGKA 1IFHH 2ADJA 2UZPA 1U42A 5JTWA 2WBJD 5CM1A 4EN3A 3GSQB 3V4PA 4OB5H 4XPBL 4OTXH 3ASNB 1XR8A 1AHMA 2D0HA 1HZHH 1KJVA 2G4GA 2BY2A 4ZS6C 1U33A 5DD0H 1RZ8B 1ADQH 3KPMB 4I4WA 4N25A 3VI4B 5JMOC 4NQVA 3Q1SH 3OZ9L 2FBOJ 1HH6B 3CFKA 1AS6A 1IC1A 2BJML 1JGIA 3ARSA 2JKXA 3IXTA 3LV3B 2BVOA 3QG6A 3C6LC 4TNFA 1JPFA 1PFOA 5IOPB 3A67H 4UM9A 5EB9A 5C70A 5MENB 2EKSA 4PR5B 5EUKA 3PWPD 1LK2A 4IGBA 3VFSB 3BWAA 3ZDYB 3GSXA 3L5JA 5IEHA 1DN2A 1ZHKA 4D9LH 1U8PB 3DBSA 5CGTA 4B9KC 4AXWA 1TFPA 5D7JC 1PEWA 1KG0A 1JWMA 2FATL 1F4YL 3P02A 5DK0B 2VXUH 1I3RA 3SEPA 4N28A 2FHFA 2P49B 5I1DA 1MEXH 1X4YA 3EUDA 1TUPA 2HT3D 1ZT7B 4DZ8B 1OP3H 5FDWA 5JDSA 1Q9OB 1HSBB 1XWVA 3MLPA 1SVCP 1CFTB 1C7TA 3CXFA 3U7WH 4CADA 5DVLA 5DJ8A 4XP9H 2YMXL 2HVJA 3LPOA 1ET8A 5DO2C 1DJZA 3VD5A 3MNVA 3HMXA 3T1FA 4CVXB 5BJTB 2AXGB 3QFDA 1CICC 2FRGP 5HDQH 5CCGE 5I8EB 1AQHA 5DMGD 3RWEA 1O5PA 5IBTH 2XXFA 2ENSA 4NJAH 2F9BT 3UTSE 3QDHA 3TJPA 2X4QA 2LR4A 3WAKA 2FIRT 4WFFD 4UTBL 1O7DC 5KYYA 4GKZB 1FFRA 1IKFH 4Y5VA 3VXQA 2UYLA 2VLRA 2WTPA 3ZDZE 4MMZA 2ZONA 2PXYD 3B3IA 1QZ1A 1A7NL 1LEGB 1T7WA 3AT8A 4UOW0 2XWRA 5ELIA 5B39B 4LF3A 3IDXL 2MOVA 2KERA 1PZ2A 4I77H 4JDEA 4NZFA 2R2BB 1ZJBA 4PJDB 1DLFH 2BOBB 4NZJA 4D8PB 4M93C 1MHPH 2AV1B 4LAJH 4AIZB 4MMXB 3A3YB 4NJ9H 1CL7L 1G5GA 4ETYA 1O75A 4O9HL 1Y6MR 4XVUD 5ADPH 1NIBA 4G9FE 4MZ2A 1A6UL 3VTTA 1M57B 2CA3A 4UYQA 2H47C 2GC4C 5MEND 4XHJC 1TTAA 4YGVA 1OP4A 3FRPB 5HPMA 1T80A 5CSZB 4IIQA 1GS8A 2BSED 4N2CA 5EC1A 1AGCB 2EINB 4M29A 5I28A 4P2QA 1Q9LB 4QGTA 3WIFB 3DVFA 1P53A 2Q8BL 4JFSA 1X7TA 3A4EA 2MOQA 2W9DL 4I3RL 4P2RE 2V7NA 4AGOA 4LCYA 4UWQB 3LN5A 1EEYB 1MN4A 3MRPA 4TUJB 1GTFA 4NPYA 4LOVA 1JZDC 3CXDL 4QCIA 3FRPG 2EE3A 4HP5A 2VDNH 2YRLA 3OKEB 1TVDA 3PHQA 3VXMB 4I89A 5T1DH 5E2VL 3T2QA 3KPQA 2EDBA 5DJCA 4AYFB 1ORQB 4GUQA 3MJ7A 4HKBA 2EDQA 5TGBB 1FA4A 3P4OB 4H8WC 1HZKA 3WGVB 4XPFH 4DQOL 3QA3A 1LO0L 2NY1C 3ARQA 3ZE0E 4P9HH 1FNLA 3M17A 1WS7A 2F18A 4YDMA 3H9SE 1HEHC 4GG6A 4K73A 3BZDA 5C09B 5C0EB 4MGXA 4GAJH 3U83A 3VXOB 3ZLQC 2OFQA 3QQ4B 2OCJA 5L4JA 1E9PB 3C6LA 3VDCA 5FF6A 1KGIA 4JPQA 4UMGA 2VR5A 1S7VB 5EEVA 2VDOL 1TTFA 5AOIA 4U1NB 4DP8X 5D1QB 1TQWA 5GS2D 3RI5K 3SKNA 1WFNA 2XWJB 4ZO6A 3EZ8A 3H9YA 4JPVL 5MEQB 5D7JA 1H6FA 5L6YL 1T2XA 4D2NA 3QXDA 1AZCA 1B90A 3AB0C 2JJUA 4JHBA 4JRXB 4TNWK 4H1LH 1ZTXH 1V10A 4WTQA 1PAMA 4JFZH 5C7XL 1E7VA 2DL9A 4LIQH 5FHBL 4KGJA 4HGMA 4GY4A 3HMWL 4XP5L 4QHNB 4AH2B 4IRZA 3EHBC 4ABWA 2BOCB 1XL6A 3BZ4B 5F1IB 3ENEA 1YEHH 2A73A 4CSPA 4HQQH 4N2EA 2EO1A 3BFQG 1A6AA 1C08B 5FGCE 2GTWA 4BZ2A 1E4XI 4WVRA 3KPLB 5GGUB 5MP6H 2TRHA 3GXDA 3CDZA 4JFVA 1GCYA 1JZIA 3WMQA 2VL5B 4XPGL 5C0BE 2BSRA 4PJ7F 3HG1B 4DO4A 3Q2VA 1TQBC 2XVKA 3THML 3SQBB 1E27B 2X05A 5LHDA 3LH8A 1ECYA 1MJ8H 2O6CA 4OZFH 4LOEA 5INCB 3VXMD 5AWNH 4E42A 5KZCB 1FH5H 2JB6B 1A7OL 4J39A 4MFHA 4W9DC 1ZIBA 5ALBH 3OMNB 3TV3L 5AAPA 5KS9F 3CZKA 4GI6A 4ZAKB 2AJSH 4IMLA 1I8KB 2AJZB 4BHUI 3TO4A 1FZKA 1G9EA 1OP5K 4LSVH 3DUSA 1Z9NA 5J6GA 2MCPL 5I1GH 3UPCA 1T0NA 4DEPC 4P2OB 1PBYA 1TZHA 2IF7A 4GJTB 1IL1B 1NTDA 2GVYA 5DJZB 4EQ3A 2PWFA 5I74B 3B9DA 1JGEB 2G2RB 2ICWI 3K1KC 1XSKA 3NCWA 5C07A 5L2JA 1MUJA 5CBEA 3WN5A 5C09D 4YSDA 4ABQA 3LAFA 1KZYA 1QLRA 1VADA 3KW8A 5E6IC 1A0QH 3MU3A 3ZOAA 5IB3B 2ZIDA 1J5OH 3K80A 1E8WA 3DX1A 3BAWA 1S7TA 2E6QA 3K5RA 3TYGH 1QQDA 1RJYB 5D1QD 4BH8A 2E5EA 4LHQB 2H0FA 4ODHH 3N42B 4PS4L 1T4WA 4FAAB 1QI3A 4PVMA 1MQ8A 1OCCB 4IOIB 3ZJAA 4HWEL 1Y18B 1XXFC 3QAQA 4Z3JA 3ZKXB 1KYOK 4ZFOB 2Z9TA 2UZIL 4ZMZA 5CKGA 5GGVY 2D7QA 5IT2L 2WAQA 1BHGA 3FHAA 3WEXA 2C7UB 1UWXH 3DSFL 2AAAA 4KX7A 1WRFA 4DVBA 4OZ4B 1M71A 5F9AC 4RA3A 2QV4A 1XAKA 1EGJA 1L9SA 1D2PA 4S1QL 5GGSB 4HD5A 5HI3C 2OMYA 5BZDB 3RPBA 1YMHB 4WGVB 5F97E 3VGBA 5LO7A 2H1PH 2F53A 1I7RB 5E1HB 5I17A 1YN7B 1ZHLA 4OCXH 3HG1D 4XCYB 2VW4A 4QWWC 4AI7A 5JLZB 1PLGH 1GH7A 1P4IL 1JZJA 3HI6L 4UOQA 1GY2A 1G1KA 1BBDH 3PF2A 1OAQL 5ALCH 3C6SA 2BW5A 4QKXB 2C3VB 4L4VA 1RPKA 1ZOXA 2DIBA 5KZCD 3OXSA 5HHOE 4LL4A 1AP2B 2BNRA 2G75B 1GZPA 3LEYH 1FDLH 2GAZB 1YYLH 5CCKL 4BKLB 4FG2A 1SJHB 4XCNB 4OW6A 1U92A 2VN4A 3ARZA 1JZ7A 2VMJA 3FXIC 2AKRB 4Y0GA 2Y72A 1W0WA 5CD5D 4LSUL 4P2OD 1J05A 3LRSB 1FNGB 3ZE1E 4EI6B 4LDEB 3ZHDA 2CIKB 2HJFB 1U58A 2KHAA 4HS3B 4XR8C 5GSVB 3PGDA 3ZX1A 3NPSC 3EGDA 5J57B 1NLBL 1TQCB 4ADIA 2X53A 2VWEE 3QUMH 4JFFD 3US0A 1TENA 2OL3A 1QASA 5CN1A 4RBPH 4YSPA 1G43A 4NENA 4KJYA 2C3GA 4R8WL 1KFGA 2HG5B 4PJEB 3WNKA 2AJUL 4KJQD 5JR1L 3ARRA 3H2PA 3IFLL 3Q48A 5HYSA 3WKPA 2Z8SA 4N9GB 1KCKA 1G1CA 1N5AA 1PZ3A 2R0WL 3DYMA 2RJMA 4FLRA 4PFEA 4PRHB 5DJYA 5ESAA 4BK4A 2BY1A 4JB9H 3TWCH 5IJCC 1K5NB 3L5HA 5EBWA 4KZEH 1WZMA 1L9MA 3GIVA 3RX5A 1U6AH 3UGEA 4OD1L 1GGIL 3CFCL 4MKTA 2OX5A 2MCAA 2YS4A 4BWTA 3O6KH 2CLZB 5BQDA 3T08A 5BS0E 1XEUA 3BHBA 3BO8A 1ETZB 1BZOA 1LMKA 4FS0A 8FABB 2LTQC 5IW1A 2CNZA 3BI9X 4WCYH 5EBGA 5KVMC 1KB9J 3ULUC 1UTDA 1BSIA 1NKRA 2YAMA 3NJHA 4NPJA 4LU5L 4ATTA 5FKPB 4QI3A 1UACH 1IIIA 3A4DA 2VRAA 4WHYH 3ZT5A 3TXAA 4MNHA 4C55A 1FFOA 2O6FA 4JFQB 3IPFA 2A6JB 2OJEA 1N10A 1SYVA 4MBRA 5E6IA 1AQMA 3BAEH 1SLVA 3FL7A 4X6BA 5HHNB 1ZK9A 1W91A 3O9WD 4QNPE 4QXUL 3BKML 1ZS2A 2H1XA 4O2CA 2AJ3B 2BO0A 4Z5RA 3RU8H 1DEEA 4U6HA 1SF5A 4NO3B 3RWJA 5D1ZC 3P54A 3EOAB 1AC0A 3FRUA 1YEEH 2UVFA 3EGXB 4N0YL 4BSWB 3L5WA 1D5IH 1RURH 3A6BL 1FZOA 1KC5L 2BVPB 1BOGB 3FFOA 5B8CB 3MREB 5E1AB 3R4DA 2P43B 3ZBMA 1WWBX 4IMKC 3ZMEA 2BP5M 3JQOB 4JQIA 1ZLWH 3C5SB 4RLDA 5I73B 2QV2A 3WUWG 4K23L 2B59B 3TU6A 1F3DH 3MODH 3C8DA 4FNSA 4LRNL 4FULA 2WD0A 3KBHE 1JERA 1MHCA 3EUUA 1MCIA 3EO1A 3C75A 2AQ1A 3HR5A 1BZ9A 1G9HA 4X83A 5IG7B 5J12C 5C0RH 1M6OB 2V9TA 1MLBA 2CJSA 3B34A 4KUZH 3TT3L 1A7BA 3B6SB 1JHKH 1CBJA 3TBSB 5GRVK 4AYBA 5IFHL 4PRAB 4ANXA 4QHUA 1NICA 4HGWA 3MXVH 3VGDA 3BESR 4G7YL 1FE8H 3AM8C 2EDLA 2IQAA 3U30C 2DQEH 1P84K 1JD7A 3JTSA 5FA3A 4F8PA 4YHNA 4K2UL 5AB9A 3Q8BA 5FUOL 4DJMA 5D7LE 3X1EA 3RGVA 4XWOD 1KB5A 3VD9A 1BGXH 1IZKA 2EZ0D 3ATFA 4KVNH 4Y4FD 2DJ4A 1JHLH 5HI5C 3NT0A 2E9GA 4XN8A 2F58L 1V54B 2R1YB 3GGWB 1EZLA 4RMUA 1SOXA 5AW6B 3BPNC 2ZUVA 5C08B 4C56B 2VLKA 5EDSA 4KH2A 3UZEC 4AY0A 4FXTA 1AG6A 2OW7A 1YC8A 2A9DA 1KN4H 3ARGC 3IPEA 3S3JA 2VXVL 4D7PA 3FCSB 2HKAA 4Y7MA 2DYPB 2XWDA 1U8HB 5SX5H 4E41A 2JTDA 4HUNB 4MA3B 4R26H 1FSKC 2JB5L 2TSBA 2VMCA 2OA9A 4MXWH 4BQBA 2EIJB 4JFWA 3K7UA 1HNGA 2JK5A 5E08H 1MW1A 4GH7B 1AIFA 2CD0A 4ZD3H 4KMLB 3W0WA 1KCRL 1RSYA 4L8DB 5G55A 5J1TC 4TNEA 3BGMB 2BS71 3RFZA 2CSPA 4LVOB 3U7YH 4GUPA 2CLRB 4HWBL 3DECA 2P26A 2HH0L 3HZMB 4UTAA 2AQPA 4JDZA 3BSGA 5I30H 3T0EB 2AXWA 3CVCA 2OSXA 2R2HB 3OAZH 1QG3A 1Y1DA 1KENL 4DGVH 5TDNB 2A83A 2MKLC 3QEGH 3X11A 1N59A 3TBVA 2YD7A 3V0VA 3B8YA 4X4YA 4JZNA 3ZR5A 4MAUH 2EXYD 3QH3A 3OZKA 1ZGLM 2VDRB 3VSTA 3A22A 4Y7OC 3EKCA 3TEWA 5ID1B 5I6NA 3QJQB 3FQXB 4PW4A 5T5NF 4Z76A 4N0RA 3U46B 4Q4EA 4CN4A 5KJ7E 4UAHA 1H6TA 3I85A 3RB5A 4YHZL 1UH4A 2VDLB 3GMLB 1R34A 3MV9B 1EPFA 3BEWA 5MERB 1TYJA 5IVOA 4OAWA 3U4BL 5EO0B 5G4OA 5SV3A 5AKSA 3KYAA 2JJTC 4S11A 5JHAA 4HJGB 5D1ZA 4YSRA 2DQUH 2NNAA 4DP6X 4BFIA 2VLLA 5GZOA 1D2OA 2WQXA 1MRFH 5IMOA 3N1PC 3SDDC 3B7TA 1W16A 2WZAA 1A65A 3DHJA 3MRJB 3SODB 5DEJA 43C9B 4C56D 2ZJSL 1PDKA 4IMKA 2EEDA 4L1SA 2NZ9C 4RAHA 4PMFA 2VMEA 5T5FH 5B7FA 4PD4K 3BKYL 2ZUQB 1D5XB 1KNOA 1NBYA 2VZ1A 4WU5B 5F1KC 4OLXL 1QNZH 5C2BH 4IIZA 1U91B 3JWNC 4OKVA 2NXZB 3AROA 1FUNA 3OD3A 2EYSB 3KPSD 4CSTA 1YMMB 4PG9B 1KDIA 3QZNA 2ZCKH 3L54A 3RI5F 5K9JH 1QZNA 4J2XA 4BZ1L 4QRRB 1TJHH 3AAZA 3IDUA 5BRQA 3X12A 3UG3A 4TNWF 3N40P 5A3ID 4N2NA 1J86A 4M3JA 1DCEA 3T0ED 2CGYA 1ZLSH 5JXAH 3EGSB 1ESOA 1FO0A 3BWZA 4XXDB 1CFNA 3B5TA 1HOCB 5IJDC 3EFOA 1IC7H 2WWNA 4PJGF 3I3DA 3WNPA 3KNBB 2WAHA 4X6EB 2GKIA 1JHTA 3PHOA 2FT7A 5DFAA 3QQNA 1LP9E 1MLCA 1KCSL 4XNXL 1MHEB 3NA4A 1CDUA 1DYZA 1QVOA 2AK4D 2FVNA 4J3UA 5DD1H 5FLVA 3L4CA 1YQ2A 3FB8A 4PGJA 1OIOA 3OB8A 2ZXDA 4X5PA 1KEML 3PV7A 4XH2B 1C16B 3MLUH 5C1MB 3APDA 3I50H 1KCVH 1J9QA 1ZWIB 2QVKA 3LKRA 3V9CA 5JHDB 4OCWL 2R4RL 4G5ZL 4I1RA 4JRYE 1S9KC 3CQPA 3MV7E 5SX4H 3OPUA 4UZUA 1G87A 4ODTL 1CYGA 1EZVX 1N4XL 1OGPA 4NWTL 1KJ2B 3CC1A 2VL4A 1JP5A 3K2KA 3H0TA 2DD8H 4C4BA 3RWGA 2VAAB 4FDWA 4AC2A 2OKMA 5TDPA 1IARB 1G7QB 4Z7OE 5IESH 3MOBH 3HNVL 4GKNA 1ZLWK 1FNHA 5GRUL 1XR9B 5LAXB 4PRIE 4ODSH 1DUZA 1ZSHA 5JXED 3MYZA 3CN4A 3GSOA 3UC0L 2AMUA 2NXZD 3RVUD 3KYNB 4TOYL 1F4AA 3SJVD 3GJFH 2YGOA 4HCRL 32C2A 4Q56A 3V0DA 3NAAH 3NP4A 4I9XA 2V5TA 4QRRD 3L3OB 1FLTX 4MD4B 3PRZA 1KIUA 4M4RB 1I3VA 4M6MH 4ZUVA 3VI3F 1OAYH 4XO5A 1K6QL 5DC4B 5IV2A 5DVPA 4LQFH 2BZDA 3BJ91 2CHDA 4FQXC 3RDTC 1RJLA 2K4WA 3X3FL 4ZMQA 1XF5B 5E8OA 1EDHA 3RNKB 1MHHA 2COVD 1RZGB 1WZ1L 1MCRA 5KOVC 1F97A 1LGVA 3GRWA 4MNGB 4NZTH 3MLRL 4GRLA 1IBZA 4XC3H 3HG5A 3FQUA 3SBQA 1ZANL 3EXJA 1C1EL 1OB1A 1OL0A 3KYOA 4FQQA 4X6FB 4N85A 5ACLA 3X14B 3O3AA 5EF2A 2DI8A 4HEPA 4MNQB 3UBGA 4QRPA 5IF0A 4WFEE 1I9IL 1RKRA 3MRLB 3WEAA 5FCSH 3EBGA 4C4KO 2NR6D 1D5ZB 3TA4D 4L9LC 3RTQA 5T3ZD 2CO2A 1I9RH 2B16A 1K8DB 5D2LB 1A4KB 3K2IA 4H88L 3P3TA 4W4NA 4MQTB 4KU1A 1A6TB 4F8TA 1HK6A 1KTLB 2HTLC 2HX7A 1Q38A 4PJ7A 4Y9EA 1HDMB 1NEUA 1NCBH 4QT5A 4M5ZH 3FTVA 3SPJA 4E9WA 2DQGH 3CFBA 2H32A 1ND0A 2W0FB 4F7CB 5J7CC 4PCTA 1Q0YH 2GTZA 3PDDA 1L9PA 4FEMA 4HDIB 1NGQL 5F3BA 3VQMA 1S9XB 4X7CC 4AMWA 3OAZK 4QHMB 4OTXL 2HZHA 1Y6KR 1HZHL 3OGOE 4F33A 1NFIA 5FUZL 5DD0L 3G04A 4XNUH 5B1CA 4RMVA 2QELA 1A6ZB 2A6KB 3Q1SL 4PJ5B 4NDMB 3BZFA 2CUHA 2V3EA 3IDYC 4IJ3B 4GSXA 2OM5A 2XJKA 3V7AG 4K3EH 3S3DB 3A67L 4AQEA 2RHEA 1R5IA 5B38B 1N64H 4W6WB 3P3YA 3VACA 4F37K 1VFBB 4TV3A 5BXFA 1ZLUH 3F05A 4D9LL 4E2OA 1XIWD 1UWFA 3N5AA 1JL8A 5GRJH 2VXUL 3L4ZA 4EZMA 3UJJL 5BNXD 2APTA 4KKAC 1MEXL 2AHIA 1JK9B 3JWNH 2HYMA 2DDQH 2XX1A 1DJXA 5HTSA 5CEZH 1JYVA 1JYNA 3FSOA 4NKDA 2XG4A 4TSCH 3VNYA 4LHUB 2UZYA 3HZKB 1FN4B 4MNQD 5DJ6A 1H9VA 1PF3A 1VPOH 5A2JH 1UGNA 5ICZA 3IJSA 5FYJL 4XP9L 4LEBA 4JGNA 4DSYA 4PJFF 1X9RA 4RNRA 4ZTPH 3TCTA 4QO1A 3CZEA 4NT6B 2PMZA 4BHUA 5KSBB 4HIEA 4ZMTA 1KCBA 5IBTL 3V10A 4DERA 2EECA 3S35X 2HJKA 3AY4C 3AQYA 1OK8A 2ILLA 2EDKA 1JXJA 1FJ1B 3BN3B 4HJ0D 1BZQK 1NDMB 5C0NC 2ICWA 3KVPA 4OUOA 2MKWA 1IKFL 5D93B 1U8QB 1F3RB 2ENYA 3UTPE 2AJXH 3H9HA 4Y2DB 1EHLH 3CZSA 4FQXA 3UX9B 4TF4A 4UM8A 4N8VB 5FOBB 1F2QA 2F19H 4MJIB 2IGFH 4AM0B 4I77L 2PPCA 1DLFL 5CMAA 4E9LA 5HVFB 3LNHA 3DGGB 4KO6A 4YBQD 3S8WA 1HAWA 3BPCB 3KDMA 1U93A 3GD1C 1UQSB 1MHPL 2ENPA 4JFDE 4JHZA 4N0CD 4YHOL 5EU4A 4OR1A 1EXUA 2P46B 3NIDB 4UI2A 2BRRL 4HH8A 1OARH 1WFOA 5DO8A 2E86A 3BIKB 1HYSD 4G7QB 2A4ZA 5E6RB 4PJ5D 3IDIB 2H7WA 1SBSH 4BUHA 5IR1B 3S35H 4GW1B 1P5VB 1PIFA 4JO1L 5CZKA 2HLFD 3ESOA 4BKSC 2R9HC 2NY2B 3SE9H 4BFOA 1F6LL 4XTRC 4OF7A 1UB5B 3C9NB 4L9LA 5ISZE 5BZXA 5KSUB 2FJHA 3F64A 4N4YB 3APCA 3FU7B 3QPQC 1FL5A 3MOQA 3FHQA 4KDWA 1NAMA 1NBQA 5ES4B 3QEQE 3P11H 2G9HB 3HE7B 1DVTA 2VDNL 2X9XA 4U3HA 1SMDA 4HPHA 5T1DL 4WWKC 5D8JL 3PL6C 2BX5A 3SDCB 2E7CA 3HC4L 5AFAA 4LHUD 3QCUH 1QBLH 3L1FA 4LLMB 6CGTA 5DLLA 1H0DA 5F44A 1EFXB 1EEZA 4RWYH 4DKFH 4XPFL 1AI1L 4FTVD 4U1MB 4X5XB 4PRNB 5AKTA 4WDIB 4P9HL 5EDXA 3ZZ1A 4AT6B 4GT0A 3QIWD 1JDAA 3HLAA 2WO2B 4ZUSA 2IDFA 1T89C 4QIRA 3VXSE 2YBRB 3U6RA 2IPKA 3ZGHA 5AVWB 3TA3A 2IV8A 3R8QA 1IM3B 2FEJA 2H9GA 2VXQA 4FHJA 3RY6C 3SZ6A 4CILA 4D0CB 4OFPA 3VXRB 1MXGA 4AKQA 1I8IB 2JKRM 3BN9D 1OY3B 3IRPX 2XQYA 3IXAA 4KKCC 4FABH 1W6WA 2W07A 4Y2DD 1XF3A 1A6WH 2A0LC 5C0CA 3GSNB 4PJCB 3BT2H 4IEFA 1XSJA 4MJID 3RUGB 1JUFB 4Y4HC 4XVSH 4AVHA 4E9VA 1CLVA 4TSBH 4JFZL 4HIHB 4M62L 5HYJB 2HRGA 4FFTA 4Y16C 1MCQA 2ZKXA 4UNVA 3K1DA 3VFOB 3G5VB 4S2SA 4B9GA 3DUUB 1YEHL 4GAAA 4HQQL 1Q0XH 2YEZB 4KKLD 1OPOA 4XOAA 4KY1H 1RP8A 2NY2D 4K9JA 3K6SB 1CR9L 3LKNB 1G7HA 2PPAA 5J1AA 3F5WA 4YVNA 2QKIB 5C0FB 2CE6A 3KHOA 1JFQH 3CC5B 5IOKA 1K5WA 5EZOH 2WQWA 5GGQH 4MCYA 4W9HC 2O5NA 4PEEA 5CINH 5ETUA 2P42B 3SPVA 3BXNB 3KEHA 3HE7D 2OI9B 2H3XC 1CGWA 1MJ8L 2DYRB 4W9EC 1BV8A 3IVKB 4XMLL 4AEIL 4EDWH 4A55A 5SWZB 2F54B 5MEOA 3GB7B 3SDCD 2FBRA 2YPLA 4A7GA 3P3UA 1EFXD 3TPUB 1FNFA 4ZZFA 5ECJE 1MOEA 1YA5A 3L16A 5IKCA 3WE6B 5IB4B 4LSVL 3T6VA 5I1GL 3QEHA 2A3TA 2VZTA 5E9NA 4R97C 2NY6B 5F7EH 3CN0A 2CO6A 2MJWA 1OGAB 2D3VA 2CO7B 1L7TH 5FUCE 1ZT4A 2B7DT 3MX0A 3WG7B 2DKUA 1IM3D 1WAAA 3VXRD 3SDXB 1WWAX 4MDRA 2KLTA 3G6DH 4GQ9H 4UV7H 3ZHFA 3O8XC 4ESKA 1J5OL 4P57A 2PR4H 3TYGL 5AW8B 3EDFA 1BYPA 2W9EH 4Y1AA 3I2CH 3GSVA 3I6LE 4ODHL 1B3IA 1OTUC 3QISA 2V2TB 5EBMB 3N9GH 1IGYA 4H0GA 1TQVA 4N2LA 1CTOA 1K4CB 3CCHA 4MSWB 3L3IB 4TKWA 3MLZH 5DJXB 2DIAA 3FO2A 3IETB 4PREB 3DX4A 3VQ2C 1DQDL 1NGZB 2OSWA 4D94A 4H8HA 1E2WA 43CAB 4ZX3A 4OI8A 2Z7UA 3CBKB 1KYFA 4BXSV 1JNHA 1E0OB 5AB1A 1HSAA 1UT1A 5LNEA 1QWHA 1UURA 3FU9A 5INDA 4CA4A 2IC2A 2PWGA 3E1ZA 4RZCA 1JPTH 3LEVL 4XODA 3QNXB 3U0WH 3BPLC 1NGXB 1MY7A 2H1PL 4B7IA 4D9RD 1FFNA 2PCPA 1XB6A 2ZKYA 4X9IA 1T89A 4I0CC 1UENA 3H7BA 2OMXA 1BBDL 1KPRB 2VKXA 4PV9A 4QLRA 5D6CA 4ZMYA 1TTUA 4RMSA 4ZO7A 5SWZD 3UTTA 1BQHB 3QXAB 2FJSA 1M56B 3PWUA 3CX2A 4GSRA 2EVFA 2JI2A 2HRPL 3DHUA 2NQCA 3K81A 3GI8H 4K15A 3TVMD 4QTIL 3VI4F 1FDLL 2EEAA 4ZMWA 3ABKB 5EIIA 4Y4HA 5KN5B 5BO0D 5LNGA 1BD2B 1EA9C 4XBPB 2N56A 1BQHG 2KLRA 2Q3XA 2NY6D 4JL1A 1S9VA 3DX8A 2A7BA 5KTEH 3MCYA 1OGAD 2HUHA 4MB1A 4Z7QE 3ZDYF 4U33A 4PJXB 1FC2D 1R33A 4E5XB 4U0QB 3MOAH 1TF4A 2VDPH 4AZ8A 1OPGH 4IU2B 1DVSA 2KDGA 3QRGL 1EGJL 5HGHA 1W9XA 4R90L 4H8WL 1AQ8A 3HZVA 4ZG1A 4O2EB 5AVTB 3RL1B 4JGMA 3TEUA 3D2UA 5IJVA 4JB9L 3IDJB 2YUXA 2QPUA 4P5SA 1UH2A 4MAZA 4Q89A 3EYVB 5IVXB 4KZEL 3L9YA 1RUMH 1B0IA 3TH2T 3V4UH 4R4NC 2JLPA 3G08B 1AYRA 3FT4B 1SXAA 3EDJA 2ZXAA 1DBAH 2Z31C 1VCAA 4ZFZA 3LDBB 4J3VA 3U4EA 2HSIA 3O6KL 5JHLH 1RK1B 2QADB 2XWXA 3QDMB 4ORGA 5TDOA 1CYXA 2ITFA 4LCUA 1F4HA 2O5YH 4NC1C 4WCYL 4UV4H 1ORSA 2IMNA 4K3JH 4RFEA 3VCLB 1EDYA 1R5VB 1UEYA 2VRKA 3IJYA 2V2XA 1UYWL 1IGTB 3V4VA 4EXPX 1CFMA 3ML8A 2WXRA 3OKKA 3R06A 4OCRH 3D25B 5KS9E 1GGBH 5FYKU 2X88A 1P1ZA 1T1XA 4I2XB 3T3PE 3Q8FA 2MTAA 1S5HB 3C09C 4PRPB 3RVTC 2VJ0A 2X0VA 3BAEL 5GS0D 3O8XA 2OL3L 2EE9A 2K7QA 3QNYA 4I1NB 5I5IA 2EEFA 1GSMA 2JI3A 4LFHG 4WHTA 5TD4A 2ZKWA 4ETQB 3JTTB 4U0RC 4IRSB 3OLEA 1WWCA 2VN3A 3LQAH 2F7OA 4N5ED 3RU8L 3DROA 1JGDB 1BD2D 2FWUA 4AL8C 1PFCA 4IKJA 1V8HA 1YEEL 1D5IL 3GSRB 4F9LA 2JJSC 3CFIC 3E7JA 1UKQA 2QZQA 3V0EA 5KYXB 3HJEA 3HUJB 4J5VA 3LRLA 4LEOB 2WY3B 3ESVF 2WC7A 1KBKA 3FUNA 4O2FA 3RWCA 3VFNB 1UCBH 5EOQH 3MODL 1DO5A 2P48B 4DKAA 2VIRB 1A7RH 4IW4C 2DLGA 5F9WB 5JDJA 3ULUD 2L4OA 2V7HB 4AWJC 5JIDA 1XF2A 5IVNA 1B9KA 1NC2B 3ROOB 2H2PC 4YE0A 1IAMA 5EN2B 2CLVB 3V5KA 2M83A 4H8UA 2ESVE 3L3KB 1JHKL 4K3GA 3EFFA 1DN0A 3ETSA 5AUMB 2N7SA 5IQMA 2NW2B 2R0ZH 4NO0B 2OQJA 1MJJA 4HH9B 1Y0LB 3MXVL 2GITB 3O3BA 1DZBA 2OJZH 4DETA 1FE8L 2V9QA 1H8SA 5CS7A 3TNNB 2QADD 2DQEL 3QDMD 3TF4A 4JFPB 1U8CB 1OXYA 3ARBB 4KKPA 1I3GH 3LIUA 4NPKA 4Z7VF 5TF1H 2AZAA 3VGAB 1JF1A 1BGXL 1LE9B 4KTDH 3K6OA 1O9VA 4KVNL 1JGVH 3RPIA 2MOGA 3CFEB 3OLDA 1JHLL 3O2VL 4LFHD 4L0PB 5D9SB 2D9QB 1J8HD 4CNIB 5E5MA 3FMGH 4LDLB 3ES6B 1SRDA 3EYOB 2V5RA 4JGUA 3HG3A 1KV3A 3FQTA 4TVPH 5K39A 5EU7C 4AEEA 2OK0L 2Q6WA 2WVUA 1K4DB 4X0KB 1YUHA 4NFDA 1KN4L 1OWRM 5EZLB 2DWDA 3NZUA 4JQIL 2ZSVA 3ABGA 4Q9RH 1X5JA 3C12A 3VVWA 2PW1A 2W88A 4NNPH 2LLNA 4R26L 3VXPB 1G94A 1Q94B 4MXWL 2XZCH 4HHAB 3L6FB 3MBEB 5E08L 4Z7AA 2H26A 2FGZA 1AZRA 3WLBA 2WINA 4AYMC 1DVYA 2DM2A 1T0OA 1QPXA 4K4KA 5DS2A 4C58B 4E0RA 5EO1B 2C1OA 2ARJA 3I3EA 4M3HA 1SYSA 2JF1A 4S1RL 1H8NA 3U7YL 4PP1D 5DWUL 4EEEA 2XZAL 2Z31A 1PG7H 3ZDZB 1J0JA 4AG4H 2H3NB 5CN2A 3VXUA 2J12B 4Y2OA 1OHQA 4DGVL 4H26B 1BIIA 1WBYA 3CFNA 2E9JA 2O5XL 3QEGL 4IDLA 1FL6B 4NCDA 4POZD 1CK0H 4F93B 1L7IH 4KK8C 3WIHA 1VKXA 3K4AA 3NTCH 1ZVNA 4ES8A 1NC2D 4MQ7B 3P0YH 3QT2A 1NMCB 3QWQB 4O4YH 3WKML 2MNUA 3BUDA 5I1IH 4ONFH 1XX9C 3UO8B 2GSGB 4WI7A 4G9FB 4GIPD 5D1XD 4ZXBB 2J3SA 2G5RA 3F01A 4LEEA 4NO0D 1T7ZA 4EQ2A 1JZ6A 5LBGA 3F12B 4HA1A 5L8KB 1E4WH 1U4FA 4FYRA 1UZ8A 4NHUB 4AYEC 1DQIA 3ARBD 4H0LC 4PJ9B 3AUVA 1AHKA 5K9QI 3W2DH 1TPXB 1BLNB 2DQCH 3GQFA 3IU4H 3P3RA 2CPUA 1IAIH 2DQUL 3J07A 4P2RB 3IE9A 2EE0A 4RGNE 3UERA 4ADGA 2JJSA 3FTUA 4FQHA 5D72H 1L0XA 5DUMH 2X28A 2PPDA 4GG8A 4ZQKA 1DQQA 5ITBH 3N42F 1INQA 1B0RA 2BNQE 2WWMC 1WHOA 1OE2A 2ERJB 1CDJA 2YSSA 5T5FL 2XUWA 3U2IA 5B1KA 5CJ5A 4PJFA 2JMRA 3QJUB 3WTTA 3ZE0B 1QNZL 5IM7B 5JYMA 3CH1A 3KDPB 3N2JA 4QRBA 1YY9C 3ECVA 1PJWA 3QE5A 3H9SB 2ZWYA 4MA1C 3ATEA 3QAZB 3W82A 4WW1A 1RUAH 1KBVA 1IGIH 2OR8A 2X7LA 4CU8A 1ZPLA 3SBWC 1WZAA 4P5KA 4NQDE 1TJHL 4JKKA 5L2KE 2WBJC 1BREA 4HG4J 1DSWA 4M6NL 4L5FE 5CIPB 4RQQA 2VC2H 2Z6FA 1SJVA 1ZA3B 3MMEA 1ZLSL 2PCFB 4R7NB 4UB0L 3UEZA 4XMPH 5ABZA 4K8RD 5LBSA 1C5BH 2Q3AA 4HPOH 1T1ZB 4XHQA 5DEZA 2IALB 4HXAH 4E36A 4JPIA 5TE7H 1E28B 4UQAA 3UBHA 4HX1A 4NAMA 3ZHNA 2L0DA 2F08A 1BVLB 4X50A 2WTOA 1VSCA 4HIIA 3H55A 1IEBA 3DX3A 3BP7B 4RZKA 4L3FA 4Y4KD 4TTGA 4LPXA 4OZIA 1H6UA 1XCTB 3MUGA 3NJGA 5DD1L 2BHUA 3V6OA 4IBUA 4G9FD 4ZXBD 1VRSA 2ZSWB 5FGCB 3GS0A 3OL2A 5GISH 1I1YB 3KHQA 3SE8H 2ZOLA 3NJLA 3FB7B 1SXNA 5JIIA 3MLUL 1G7LA 1KCVL 4F2ME 1FZJB 4IQHA 1QFHA 2DQHH 4HU2A 4PJ9D 5F7YC 2YA0A 5C0BB 1P5UB 2HT3C 3NP3A 1M2VA 2EJ1A 1B0GB 1Z9MA 4G70B 4YDJA 4P2RD 1IO4C 3PQYE 3EOTH 3BD5A 4FA8A 4PJEF 1GJIA 3BH9B 1YEKH 5F7BA 2P1YA 4U1HB 3QJSB 2BXYA 4A66A 2EADA 5DCCA 1WO2A 35C8L 1T6VN 5I1LA 2EIDA 1PY0A 5DMGC 4KK5D 3L9BA 3QWRD 2CRYA 3DJTA 4IRJB 3ORJA 4HJUA 1VENA 2FWLB 4Y89A 3UAFA 4ODSL 1FO0L 4FQPA 4HS6A 4NM8H 3UAJD 3EJTA 3WMSA 1GYVA 2IGTA 5DQDH 3SD2A 4LKCA 1V05A 3H9SD 1BAGA 2UY7B 1X5LA 1XCXA 3QJTB 4NQEE 2PXYC 1T5WA 3NAAL 1ZDQA 1ROWA 4WEBH 2BNUB 2XICA 3L7FB 4M03A 2OMBA 2AQ3A 1XD0A 1OAYL 1ZJAA 2ZUTA 3FW6A 3HAEB 3W9DB 4LQFL 2RCSL 4OZHF 3O81A 2X3BA 3L4XA 4DN3H 1I9EA 1JNJA 4WSKA 3WY4A 1QPKA 1A3LH 3RYMA 3OKYA 2EICA 5CN3A 4PRBB 3BEVA 4XVUC 1E90A 4UQ3A 1KGXA 2MNWA 5C0DA 2ZWLT 1KXQA 5E8EA 3QZWG 3HAEG 1M7UA 4QYOA 1X5IA 2AITA 3D3VA 5MHSE 1JOIA 3Q8EA 3IKCB 4KHXH 5FKAB 4JLRA 3L3HA 4YDKH 4X7TA 2HFTA 3F2LA 2EIEA 4JVWA 3FO1B 5GIRB 2WZ0A 4WI8A 2OTWB 1DQTA 1L6PA 2YAEA 2P8MA 4HW6A 5HDWA 3W5MA 5FM5M 1I9RL 1RSFA 4JK0D 4HPYH 3TBTA 4ZFFA 5HDLA 4ZODA 1G9NH 1AXSA 4XXWC 4R84A 5D7IF 5C0BD 4IDJH 2XWCA 1U2YA 3NCBB 3ARDB 1FYHB 5IBUB 5C3LD 5IREA 4X4XB 3NK4A 5AAWA 5F7HA 2AQRA 3QZMA 2YD0A 3SBWA 3NSXA 2AAVA 4WJ5A 4L3EE 1UT2A 5DYFA 2WBJA 4M5ZL 4A39A 4AITA 5AOKA 2WXFA 4O51A 5ERWA 4FKHA 1OP9A 4FNTA 5CLZA 4NBXB 4UDUA 4NN7C 2Q9OA 3WAJA 2B0SH 2DW5A 1Q0YL 1GS6X 4XRCA 5HHOB 5K93A 1MFUA 5IBUG 2EIZA 3SYQA 1CU4H 2AVGA 3HC0A 4XBEL 1C8PA 1BJMA 2R1XB 1XGQA 3WIAA 1D7FA 1HOEA 3PAZA 5K59F 5DEGA 4XNUL 4AZUA 3TP4A 3CFDA 3MUY1 4NZUH 5ICYA 3T6WA 2FT8A 2EYRA 3ZE1B 4KI5E 1XXDC 4GQZA 2CXGA 3FQRB 3LOWA 1AHWC 4N0UE 3PWPA 2J88L 4A7SA 4K3EL 4U6YA 1BXXA 1WT5C 1WC7B 4PJGE 4P23D 2IPUG 1XGPA 4OCYH 3FQWA 3SIKA 4A2LA 2IADA 4I87A 2BIMA 2B3IA 1C5DB 4IU3B 4MMXC 1YRKA 2GUOA 5GRJL 3HN8A 3REWB 4PJIF 1EX0A 2GT9A 4M7ZB 3CX5K 3E6HB 1OANA 4OFIA 2NDGA 2NX5E 4XGZB 2X12A 3U9PH 3DVIA 5GGVH 2DDQL 2X4SB 5CEZL 4Q6IB 4OJEH 1F58H 4TSCL 4X8JB 1YEIL 5BV7B 2Y9RT 2Q5BA 1K8IA 1NAKL 4L23A 4A6YA 5GGTA 2HKHL 1CG9B 1VEPA 5CP3H 3FUJA 4ZTPL 5BS0B 1NZRA 1N18A 3AABA 3M86A 5ECGA 5I18H 4YSTA 2QTEA 4PJ6A 1EQWA 4H8PA 3HI1B 5DJAA 1X7QB 2Y0SA 1T3FB 2E6JA 2W1NA 3WFZA 1FVCB 2ZQKA 1NCCH 4GW4B 4XZUA 3ARDD 4ZRGA 2GW5A 4AV4A 3G6JA 2PXYA 1T83A 2WLLB 1XZ0A 3L1OL 2R56H 1YYCA 1DHKA 1EAOA 4AEHH 5FYKH 4J3WA 2AJXL 4BELD 2P80D 1YYMH 3GSQA 1GOFA 5E5UB 1A7QH 3B8SA 4X80H 1DQLH 3CVHB 2P7TB 2C9VA 4GYBA 1QSFD 2F19L 3OAUH 2IGFL 4BBWA 4JO4H 1RZ8A 3KPMA 3IK2A 1K3IA 3VI4A 4DEUA 4XOCA 3VI3E 3RX8A 1HH6A 2J6EA 2V9UA 3JUYA 3LV3A 4LSRH 4OI9A 5HHXH 2O93L 3LJ3A 5IOPA 1T22B 5MENA 1SBSL 3WLWD 3S35L 4Z7UE 1GKOA 3WKYA 1I8UA 4PR5A 3VFSA 4FXKB 5D1QC 1KULA 5I82A 2OBGA 2FUTA 1U8PA 1BFVH 1DJIA 1XMWA 3SE9L 4FZEH 2XV2A 1BG1A 4GSUA 5DK0A 3R7RA 4TVUA 5LDUA 3SN6N 1GYAA 3NACL 1F11B 1HE8A 4XXWA 4AKOA 4YK4B 4ENZA 1ZT7A 4DZ8A 2IH1B 3P11L 1Q9OA 1DJSA 1HSBA 1KTBA 1CFTA 4BGDA 5FAAA 4AUYA 1IE5A 1QLEH 1CBVH 4HC1A 3QCUL 1G0DA 1B4JH 2IBZY 4M1CD 1HEJC 1U3NA 4CVXA 5BJTA 2AXGA 9PCYA 1XH2A 4LLAA 3QG7H 2DKMA 5I8EA 2EDJA 4DKFL 4OLUL 3T0VA 4IK6A 1HYRC 1CLOH 3H53A 4OFVA 5D7LB 1EEQA 3QIUD 1Z3GH 3DO4A 4XNBA 2D7PA 4GKZA 3ARFC 5DUPH 1DP0A 1TDQA 5KG9B 3QUKB 4LPYA 1BA9A 4H2AA 4G6MH 1I7UB 7FABL 3B2VH 3AFLA 2A1WH 1QABA 2BHYA 1LEGA 5B39A 3T8MA 5BUPA 1SOQA 4FABL 5HHME 2FD6H 5K69A 4C4UA 1GW6A 1M9SA 4PJDA 1A6WL 4HAGA 2R2BA 1OTTD 3UACA 2BOBA 4PTTB 5FFOA 4D8PA 1FGVH 1P7KB 3V0IA 5CD5C 3H7LA 4P2OC 1ID2A 2AV1A 4AIZA 1T20B 2BFGA 4MMXA 4XVSL 1NA8A 1NH6A 3LNDA 5I74C 1P6WA 2BCKB 4TSBL 2H6PA 1I3UA 4KV5F 2ZXEB 3OAYH 1WWWX 2LFGA 2I69A 3H4FA 3QSKB 4ODWB 1DQVA 3GZQA 4AIEA 3FRPA 3CN3A 5CSZA 3RGBA 4QAMB 4KJQC 3IJ8A 1IC0A 1AGCA 3ESNA 4GBXB 1I7ZB 5E8NB 1XGTB 4KY1L 2G4EA 5CP7B 1Q9LA 3NCJH 1RHFA 1LK3H 1UC6A 3OB0H 4JFYB 3WIFA 3BRFA 3L2NA 5EOTB 1YEWA 4R0LB 2V4LA 1JFQL 4TUJA 1V3LA 5HVHB 4OJDH 5EZOL 3MRGB 5GGQL 3ZKXC 3QUXB 4WAFA 4PJBE 5DJDB 4MDJB 3OKEA 3VXMA 4NAQA 5CINL 1U21A 5TQ2H 2HN7B 5A40E 4AYFA 1SN2A 4BINA 1ORQA 2BM3A 4EDWL 1U3ZA 4YFDB 1KIQB 2VXQL 5TGBA 3P4OA 1UHVA 4XN7A 4N22A 3B9VA 2H0EA 5BRPA 1JRHH 2VLRD 2CALA 1RU9H 1OLLA 3UABA 3A24A 2WOYA 5D7LD 2VMDA 3BLBA 4LLQB 5C09A 1ZA6B 2RBLA 2UUDH 3VXOA 5C0EA 3KLKA 3QQ4A 3LB6D 4N2OA 5E2JA 1E9PA 2AVFA 1ZTXE 1L7TL 3OM3B 4PS3A 4B0MM 4LIQE 1S7VA 2IWFA 3O9WC 2ZT9C 4M3KB 4EIZC 4KKBD 4JRWA 3O0LA 3M6DA 4GQ9L 4U1NA 4UV7L 1LEKB 5D1QA 3II2A 3BZEB 1AYOA 2XWJA 5GRXG 5MEQA 5EF1A 5E00B 5E56A 3CDGB 5LXGH 2W9EL 5F6IB 4JRXA