3NRRA

Co-crystal structure of dihydrofolate reductase-thymidylate synthase from babesia bovis with dump, raltitrexed and nadp
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
509
structure length
503
Chain Sequence
NSYEGCGDLTIFVAVALNKVIGHKNQIPWPHITHDFRFLRNGTTYIPPEVLSKNPDIQNVVIFGRKTYESIPKASLPLKNRINVILSRTVKEVPGCLVYEDLSTAIRDLRANVPHNKIFILGGSFLYKEVLDNGLCDKIYLTRLNKEYPGDTYFPDIPDTFEITAISPTFSTDFVSYDFVIYERKDDPPFDQLLMTGTDISVPKPKYVACPGVRIRNHEEFQYLDILADVLSHGVLKPNRTGTDAYSKFGYQMRFDLSRSFPLLTTKKVALRSIIEELLWFIKGSTNGNDLLAKNVRIWELNGRRDFLDKNGFTDREEHDLGPIYGFQWRHFGAEYLDMHADYTGKGIDQLAEIINRIKTNPNDRRLIVCSWNVSDLKKMALPPCHCFFQFYVSDNKLSCMMHQRSCDLGLGVPFNIASYSILTAMVAQVCGLGLGEFVHNLADAHIYVDHVDAVTTQIARIPHPFPRLRLNPDIRNIEDFTIDDIVVEDYVSHPPIPMAMSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inhibitor-bound complexes of dihydrofolate reductase-thymidylate synthase from Babesia bovis.
pubmed doi rcsb
molecule keywords Dihydrofolate reductase-thymidylate synthase
molecule tags Transferase
source organism Babesia bovis
total genus 162
structure length 503
sequence length 509
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00186 DHFR_1 Dihydrofolate reductase
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3nrrA03
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3nrrA01
1HFRA 2BLBA 1TVVA 1DDRA 1RA2A 1YPVA 3TMSA 1BJGA 1U72A 2W3VA 3ZPCA 1CI7A 1JU6A 1RE7A 3QJ7A 3B5BA 1BKPA 1LCAA 3DRCA 3N5EB 1J3JA 5HVBA 2HXVA 1J3KC 3EELA 1NJEA 5HQYA 3UM5A 4P3QA 1IA4A 2G8AA 3QLXA 5WRNA 3N5EA 3KY8A 1BOZA 3F0BX 4PDJA 4EZ8A 1B5DA 3IRMA 3JWFA 3QFXA 1LY4A 1JUVA 4EILA 1TLSA 3IHIA 1F28A 3NXOA 1VZAA 1DLSA 1RA8A 2ONBA 3FL8A 1BDUA 3TQBA 1DDUA 1NJBA 4QLFA 4ELGA 1DR3A 4EINA 1NJAA 4PSGA 1KZJA 4ELFA 4XT4A 3CD2A 4XT8A 4FGGA 3QL3A 5DFRA 4PSYA 1S3YA 1S3WA 1KZIA 2W3BA 2ANOA 1OHKA 3NRRA 1TLCA 3N5GA 4ELBA 1TRGA 2ZZAA 4QLEA 4Q67A 2KGKA 3I8AX 1QZFA 1HW4A 5BY6A 1TSXA 5HT5A 1TSNA 3C0AA 3SRQX 1DYIA 1BO8A 3DGAC 1RX9A 5ECCA 4H0RA 3L3RA 3JTWA 1D1GA 4QJCA 1TYSA 4PSTA 4KAKA 1RX6A 1MVTA 2HM9A 1F4BA 4EIGA 1RH3A 3E0BA 3JW5A 4FGTA 1EVFA 1AN5A 2TDDA 1HFPA 1U71A 1JTQA 3EF9A 4HA9A 4TMSA 3CL9A 3SRUX 1J3JC 3ROAA 4IRRA 1TDAA 3UWLB 5JA3A 2G6VA 3IK0A 2INQA 4DP3A 3QLZA 3DATA 3JVXA 1LUDA 4HA7A 1DYHA 3QYOA 2CD2A 4X5GA 1VZCA 1JMIA 1RB2A 4DPDA 4X5IA 4H98A 1I00A 1B49A 3EJLA 1AXWA 1RA9A 1CZ3A 2QK8A 5HF2X 3K47A 4G6WX 3DAUA 3BZ0A 3DG8A 1DR1A 1E26A 1TVUA 3HJ3A 4IXGX 3NXRA 4M6JA 3F8YA 4DDRA 3JSUA 3EGYX 3FQ0A 1TDUA 2G8XA 4O1XD 4KFJA 1DHIA 2W3MA 3D84X 2KCEA 2OIPA 2W3AA 3IA4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 2C2TA 4FHBA 4KM0A 4IXFX 1IA2A 2VETA 1AIQA 3KGYA 1RD7A 4LAGX 1DNAA 3NTZA 3IJZA 2FZHA 1F4CA 4PSSA 2B3ZA 3GYFA 2FTNA 8DFRA 3OAFA 1DR4A 3OCHA 1DRHA 2TSRA 3IX9A 1RX3A 1DAJA 1TDCA 1JG0A 1SYNA 2A9WA 1F4GA 1KCEA 1DR2A 5J7WA 3FQZA 3BFIA 1LCBA 3JW3A 4QLGA 3TD8A 1AOEA 3RG9A 3SRRX 3FQVA 1FWMA 1ZDRA 5ECXA 2W9HA 3NU0A 2W9TA 3NXYA 4XECX 4ISWA 1DRBA 1RTSA 1TSMA 3GH0A 4RGCA 2DHFA 2RD8B 1BZFA 3UM8A 1DYJA 4GEVA 1HW3A 4KY4A 1RX5A 1FFLA 3F0VX 2FZJA 3SA1A 4KM2A 3HBBA 1RX1A 2P4GA 1JMGA 4GH8A 2RD8A 4X5HA 3EEJA 4LAHX 1TDBA 4E28A 3FY8X 3DG8C 3VCOA 4KD7A 1BQ1A 1TJSA 5H39A 1SEJA 1VZBA 2W9GA 3BGXA 4F2VA 1DYRA 1THYA 5CCCA 5HSUA 4UP1A 1HZWA 1BSFA 3JWCA 3KFYA 1EVGA 3SA2A 3FL9A 5E8QA 1RX7A 4Q0DA 1IA1A 4M7UA 1RF7A 1DIUA 4KBNA 3FREX 5U27A 4Q6AA 1DREA 4KY8A 1JUJA 3EHIX 1BO7A 3IROA 4EJ1A 4ELEA 5U26A 3B9HA 3IRNA 3TQAA 3K2HA 1VJ3A 1B5EA 1TSDA 3QG2A 1BQ2A 4KJLA 1DR6A 4FOAA 4NX7A 1RB3A 4O1UA 2FTOX 2G86A 5H38A 1NCEA 4M6LA 3GHCA 4XT7A 5HF0X 3BHLA 4KNEA 2G89A 4KNZA 1LY3A 3FQFA 5HPBA 1S3UA 4FOGA 4HOFA 1M79A 4FGHA 3DFRA 4EB4A 3K74A 2L28A 1DRAA 3QL0A 1DG8A 4O7UA 1VDRA 2AZNA 3CLBA 3EDWX 1DISA 1F4FA 1J3KA 2H2QA 3OB7A 1M78A 1NJDA 2BL9A 4KEBA 1HFQA 3FRBX 4DQ1A 3FRAX 5CC9A 4H95A 3Q1HA 1F4EA 3NXTA 3C06A 2ANQA 1TVWA 5HVEA 3FRDX 1LCEA 1AOBA 1KMVA 3EAWX 1PDBA 4LEKX 5HUIA 1AI9A 2FZIA 4E5OA 1TSWA 4XSDA 4DFRA 1DF7A 5HT4A 3QLYA 3QLRA 3SRWX 3F0SX 4P66A 1B02A 1DHFA 2JYBA 5FDAA 2TDMA 1TSZA 3EX8A 4P68A 1DR7A 2BLAA 3NZCX 1TSLA 2GD9A 3SAIA 3GH2X 2O7PA 1BP6A 1RX4A 3QYLA 2OBCA 3F8ZA 4H1IA 3M09A 2BLCA 3R33A 3RO9A 2D0KA 3TQ9A 3LG4A 4CD2A 4P3RA 3GG5A 3IK1A 1J3IA 4XT6A 4XSEA 4H97A 3TQ8A 1MVSA 4FOXA 4G2OX 4G3MA 3K45A 2C2SA 3FYWX 3NZAX 1KMSA 5HSRA 1BP0A 1BKOA 1RX2A 5FCTA 4Q0EA 1DRFA 3F0QX 4M2XA 3SQYX 3ZPGA 4O1XA 5HS3A 4FQSA 4QHVA 1DLRA 3BHRA 2FTQA 3SH2A 3KGBA 4KPWA 1TSYA 1RX8A 3NZ9X 4GYHA 3F0UX 3UM6A 4IQQA 3KJRA 3IX6A 4X5JA 4ELHA 3S9UA 3FYVX 2ITHA 1BPJA 1JTUA 3ED7A 4KL9A 4QI9A 4XSCA 4X5FA 2AAZA 2TSCA 1ZPRA 1CD2A 1TDRA 3NZBX 3FRFX 3GHVA 3NXVA 4JEFA 5JG0X 1VZEA 1DDSA 5HI6A 4HOGA 3N0HA 3S7AA 1DHJA 1JMFA 1KLKA 1RA3A 4H96A 1U70A 7DFRA 4LRRA 3NXXA 3HB8A 3BNZA 3SGYA 4XRBA 3H9KA 2RDAA 3QLSA 3JWKA 3NZDA 3FY9X 1TISA 3FQCA 5H3AA 4XT5A 2CIGA 4H0UA 3JWMA 1F4DA 4DPHA 1AJMA 4IQBA 1J3IC 4M6KA 4KLXA 3F0XX 4IXED 3SR5X 4TU5X 3INVA 4I1NA 4ISKA 2BBQA 4QJZD 1EV5A 3NZ6X 1PD8A 1JMHA 1DR5A 3F91A 4G95A 5DXVA 3DL6A 1M7AA 3EBUA 1AO8A 3QLWA 1PD9A 3KJSA 5EAJA 4OR7A 1DG7A 1RA1A 4ECKA 4OSGA 4I13A 5HQZA 3FS6A 2HQPA 4KJKA 1JOLA 4XE6X 4M7VA 1DG5A 4HOEA 1EV8A 3EEMA 4PTHA 3EEKA 3EIGA 2DRCA 3UWLA 3CSEA 2D5NA 2G8DA 4PTJA 3GI2A 1QQQA 3IA5A 3QGTA 4G8ZX 2LF1A 1JOMA 3S3VA 1JUTA 1IA3A 2W3WA 4KJJA 2W9SA 1NJCA 1BSPA 1BIDA 6DFRA 3GHWA 4NX6A 1TSVA 3DL5A 3D80A 1S3VA 1HVYA 1OHJA 1RC4A 3BYXA 3SRSX 3FQOA 4EIZA 2VF0A 3DGAA 2XW7A 4LAEX 3M08A 1YHOA 1RG7A
chains in the Genus database with same CATH superfamily
1HFRA 2BLBA 1TVVA 1DDRA 1RA2A 1YPVA 3TMSA 1BJGA 1U72A 2W3VA 3ZPCA 1CI7A 1JU6A 1RE7A 3QJ7A 3B5BA 1BKPA 1LCAA 3DRCA 3N5EB 1J3JA 5HVBA 2HXVA 1J3KC 3EELA 1NJEA 5HQYA 3UM5A 4P3QA 1IA4A 2G8AA 3QLXA 5WRNA 3N5EA 3KY8A 1BOZA 3F0BX 4PDJA 4EZ8A 1B5DA 3IRMA 3JWFA 3QFXA 1LY4A 1JUVA 4EILA 1TLSA 3IHIA 1F28A 3NXOA 1VZAA 1DLSA 1RA8A 2ONBA 3FL8A 1BDUA 3TQBA 1DDUA 1NJBA 4QLFA 4ELGA 1DR3A 4EINA 1NJAA 4PSGA 1KZJA 4ELFA 4XT4A 3CD2A 4XT8A 4FGGA 3QL3A 5DFRA 4PSYA 1S3YA 1S3WA 1KZIA 2W3BA 2ANOA 1OHKA 3NRRA 1TLCA 3N5GA 4ELBA 1TRGA 2ZZAA 4QLEA 4Q67A 2KGKA 3I8AX 1QZFA 1HW4A 5BY6A 1TSXA 5HT5A 1TSNA 3C0AA 3SRQX 1DYIA 1BO8A 3DGAC 1RX9A 5ECCA 4H0RA 3L3RA 3JTWA 1D1GA 4QJCA 1TYSA 4PSTA 4KAKA 1RX6A 1MVTA 2HM9A 1F4BA 4EIGA 1RH3A 3E0BA 3JW5A 4FGTA 1EVFA 1AN5A 2TDDA 1HFPA 1U71A 1JTQA 3EF9A 4HA9A 4TMSA 3CL9A 3SRUX 1J3JC 3ROAA 4IRRA 1TDAA 3UWLB 5JA3A 2G6VA 3IK0A 2INQA 4DP3A 3QLZA 3DATA 3JVXA 1LUDA 4HA7A 1DYHA 3QYOA 2CD2A 4X5GA 1VZCA 1JMIA 1RB2A 4DPDA 4X5IA 4H98A 1I00A 1B49A 3EJLA 1AXWA 1RA9A 1CZ3A 2QK8A 5HF2X 3K47A 4G6WX 3DAUA 3BZ0A 3DG8A 1DR1A 1E26A 1TVUA 3HJ3A 4IXGX 3NXRA 4M6JA 3F8YA 4DDRA 3JSUA 3EGYX 3FQ0A 1TDUA 2G8XA 4O1XD 4KFJA 1DHIA 2W3MA 3D84X 2KCEA 2OIPA 2W3AA 3IA4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 2C2TA 4FHBA 4KM0A 4IXFX 1IA2A 2VETA 1AIQA 3KGYA 1RD7A 4LAGX 1DNAA 3NTZA 3IJZA 2FZHA 1F4CA 4PSSA 2B3ZA 3GYFA 2FTNA 8DFRA 3OAFA 1DR4A 3OCHA 1DRHA 2TSRA 3IX9A 1RX3A 1DAJA 1TDCA 1JG0A 1SYNA 2A9WA 1F4GA 1KCEA 1DR2A 5J7WA 3FQZA 3BFIA 1LCBA 3JW3A 4QLGA 3TD8A 1AOEA 3RG9A 3SRRX 3FQVA 1FWMA 1ZDRA 5ECXA 2W9HA 3NU0A 2W9TA 3NXYA 4XECX 4ISWA 1DRBA 1RTSA 1TSMA 3GH0A 4RGCA 2DHFA 2RD8B 1BZFA 3UM8A 1DYJA 4GEVA 1HW3A 4KY4A 1RX5A 1FFLA 3F0VX 2FZJA 3SA1A 4KM2A 3HBBA 1RX1A 2P4GA 1JMGA 4GH8A 2RD8A 4X5HA 3EEJA 4LAHX 1TDBA 4E28A 3FY8X 3DG8C 3VCOA 4KD7A 1BQ1A 1TJSA 5H39A 1SEJA 1VZBA 2W9GA 3BGXA 4F2VA 1DYRA 1THYA 5CCCA 5HSUA 4UP1A 1HZWA 1BSFA 3JWCA 3KFYA 1EVGA 3SA2A 3FL9A 5E8QA 1RX7A 4Q0DA 1IA1A 4M7UA 1RF7A 1DIUA 4KBNA 3FREX 5U27A 4Q6AA 1DREA 4KY8A 1JUJA 3EHIX 1BO7A 3IROA 4EJ1A 4ELEA 5U26A 3B9HA 3IRNA 3TQAA 3K2HA 1VJ3A 1B5EA 1TSDA 3QG2A 1BQ2A 4KJLA 1DR6A 4FOAA 4NX7A 1RB3A 4O1UA 2FTOX 2G86A 5H38A 1NCEA 4M6LA 3GHCA 4XT7A 5HF0X 3BHLA 4KNEA 2G89A 4KNZA 1LY3A 3FQFA 5HPBA 1S3UA 4FOGA 4HOFA 1M79A 4FGHA 3DFRA 4EB4A 3K74A 2L28A 1DRAA 3QL0A 1DG8A 4O7UA 1VDRA 2AZNA 3CLBA 3EDWX 1DISA 1F4FA 1J3KA 2H2QA 3OB7A 1M78A 1NJDA 2BL9A 4KEBA 1HFQA 3FRBX 4DQ1A 3FRAX 5CC9A 4H95A 3Q1HA 1F4EA 3NXTA 3C06A 2ANQA 1TVWA 5HVEA 3FRDX 1LCEA 1AOBA 1KMVA 3EAWX 1PDBA 4LEKX 5HUIA 1AI9A 2FZIA 4E5OA 1TSWA 4XSDA 4DFRA 1DF7A 5HT4A 3QLYA 3QLRA 3SRWX 3F0SX 4P66A 1B02A 1DHFA 2JYBA 5FDAA 2TDMA 1TSZA 3EX8A 4P68A 1DR7A 2BLAA 3NZCX 1TSLA 2GD9A 3SAIA 3GH2X 2O7PA 1BP6A 1RX4A 3QYLA 2OBCA 3F8ZA 4H1IA 3M09A 2BLCA 3R33A 3RO9A 2D0KA 3TQ9A 3LG4A 4CD2A 4P3RA 3GG5A 3IK1A 1J3IA 4XT6A 4XSEA 4H97A 3TQ8A 1MVSA 4FOXA 4G2OX 4G3MA 3K45A 2C2SA 3FYWX 3NZAX 1KMSA 5HSRA 1BP0A 1BKOA 1RX2A 5FCTA 4Q0EA 1DRFA 3F0QX 4M2XA 3SQYX 3ZPGA 4O1XA 5HS3A 4FQSA 4QHVA 1DLRA 3BHRA 2FTQA 3SH2A 3KGBA 4KPWA 1TSYA 1RX8A 3NZ9X 4GYHA 3F0UX 3UM6A 4IQQA 3KJRA 3IX6A 4X5JA 4ELHA 3S9UA 3FYVX 2ITHA 1BPJA 1JTUA 3ED7A 4KL9A 4QI9A 4XSCA 4X5FA 2AAZA 2TSCA 1ZPRA 1CD2A 1TDRA 3NZBX 3FRFX 3GHVA 3NXVA 4JEFA 5JG0X 1VZEA 1DDSA 5HI6A 4HOGA 3N0HA 3S7AA 1DHJA 1JMFA 1KLKA 1RA3A 4H96A 1U70A 7DFRA 4LRRA 3NXXA 3HB8A 3BNZA 3SGYA 4XRBA 3H9KA 2RDAA 3QLSA 3JWKA 3NZDA 3FY9X 1TISA 3FQCA 5H3AA 4XT5A 2CIGA 4H0UA 3JWMA 1F4DA 4DPHA 1AJMA 4IQBA 1J3IC 4M6KA 4KLXA 3F0XX 4IXED 3SR5X 4TU5X 3INVA 4I1NA 4ISKA 2BBQA 4QJZD 1EV5A 3NZ6X 1PD8A 1JMHA 1DR5A 3F91A 4G95A 5DXVA 3DL6A 1M7AA 3EBUA 1AO8A 3QLWA 1PD9A 3KJSA 5EAJA 4OR7A 1DG7A 1RA1A 4ECKA 4OSGA 4I13A 5HQZA 3FS6A 2HQPA 4KJKA 1JOLA 4XE6X 4M7VA 1DG5A 4HOEA 1EV8A 3EEMA 4PTHA 3EEKA 3EIGA 2DRCA 3UWLA 3CSEA 2D5NA 2G8DA 4PTJA 3GI2A 1QQQA 3IA5A 3QGTA 4G8ZX 2LF1A 1JOMA 3S3VA 1JUTA 1IA3A 2W3WA 4KJJA 2W9SA 1NJCA 1BSPA 1BIDA 6DFRA 3GHWA 4NX6A 1TSVA 3DL5A 3D80A 1S3VA 1HVYA 1OHJA 1RC4A 3BYXA 3SRSX 3FQOA 4EIZA 2VF0A 3DGAA 2XW7A 4LAEX 3M08A 1YHOA 1RG7A
chains in the Genus database with same CATH topology
1HFRA 2BLBA 1TVVA 1DDRA 1RA2A 1YPVA 3TMSA 1BJGA 1U72A 2W3VA 3ZPCA 1CI7A 1JU6A 1RE7A 3QJ7A 3B5BA 1BKPA 1LCAA 3DRCA 3N5EB 1J3JA 5HVBA 2HXVA 1J3KC 3EELA 1NJEA 5HQYA 3UM5A 4P3QA 1IA4A 2G8AA 3QLXA 5WRNA 3N5EA 3KY8A 1BOZA 3F0BX 4PDJA 4EZ8A 1B5DA 3IRMA 3JWFA 3QFXA 1LY4A 1JUVA 4EILA 1TLSA 3IHIA 1F28A 3NXOA 1VZAA 1DLSA 1RA8A 2ONBA 3FL8A 1BDUA 3TQBA 1DDUA 1NJBA 4QLFA 4ELGA 1DR3A 4EINA 1NJAA 4PSGA 1KZJA 4ELFA 4XT4A 3CD2A 4XT8A 4FGGA 3QL3A 5DFRA 4PSYA 1S3YA 1S3WA 1KZIA 2W3BA 2ANOA 1OHKA 3NRRA 1TLCA 3N5GA 4ELBA 1TRGA 2ZZAA 4QLEA 4Q67A 2KGKA 3I8AX 1QZFA 1HW4A 5BY6A 1TSXA 5HT5A 1TSNA 3C0AA 3SRQX 1DYIA 1BO8A 3DGAC 1RX9A 5ECCA 4H0RA 3L3RA 3JTWA 1D1GA 4QJCA 1TYSA 4PSTA 4KAKA 1RX6A 1MVTA 2HM9A 1F4BA 4EIGA 1RH3A 3E0BA 3JW5A 4FGTA 1EVFA 1AN5A 2TDDA 1HFPA 1U71A 1JTQA 3EF9A 4HA9A 4TMSA 3CL9A 3SRUX 1J3JC 3ROAA 4IRRA 1TDAA 3UWLB 5JA3A 2G6VA 3IK0A 2INQA 4DP3A 3QLZA 3DATA 3JVXA 1LUDA 4HA7A 1DYHA 3QYOA 2CD2A 4X5GA 1VZCA 1JMIA 1RB2A 4DPDA 4X5IA 4H98A 1I00A 1B49A 3EJLA 1AXWA 1RA9A 1CZ3A 2QK8A 5HF2X 3K47A 4G6WX 3DAUA 3BZ0A 3DG8A 1DR1A 1E26A 1TVUA 3HJ3A 4IXGX 3NXRA 4M6JA 3F8YA 4DDRA 3JSUA 3EGYX 3FQ0A 1TDUA 2G8XA 4O1XD 4KFJA 1DHIA 2W3MA 3D84X 2KCEA 2OIPA 2W3AA 3IA4A 3I3RA 4GD7A 4KYAA 1VZDA 3V8HA 2C2TA 4FHBA 4KM0A 4IXFX 1IA2A 2VETA 1AIQA 3KGYA 1RD7A 4LAGX 1DNAA 3NTZA 3IJZA 2FZHA 1F4CA 4PSSA 2B3ZA 3GYFA 2FTNA 8DFRA 3OAFA 1DR4A 3OCHA 1DRHA 2TSRA 3IX9A 1RX3A 1DAJA 1TDCA 1JG0A 1SYNA 2A9WA 1F4GA 1KCEA 1DR2A 5J7WA 3FQZA 3BFIA 1LCBA 3JW3A 4QLGA 3TD8A 1AOEA 3RG9A 3SRRX 3FQVA 1FWMA 1ZDRA 5ECXA 2W9HA 3NU0A 2W9TA 3NXYA 4XECX 4ISWA 1DRBA 1RTSA 1TSMA 3GH0A 4RGCA 2DHFA 2RD8B 1BZFA 3UM8A 1DYJA 4GEVA 1HW3A 4KY4A 1RX5A 1FFLA 3F0VX 2FZJA 3SA1A 4KM2A 3HBBA 1RX1A 2P4GA 1JMGA 4GH8A 2RD8A 4X5HA 3EEJA 4LAHX 1TDBA 4E28A 3FY8X 3DG8C 3VCOA 4KD7A 1BQ1A 1TJSA 5H39A 1SEJA 1VZBA 2W9GA 3BGXA 4F2VA 1DYRA 1THYA 5CCCA 5HSUA 4UP1A 1HZWA 1BSFA 3JWCA 3KFYA 1EVGA 3SA2A 3FL9A 5E8QA 1RX7A 4Q0DA 1IA1A 4M7UA 1RF7A 1DIUA 4KBNA 3FREX 5U27A 4Q6AA 1DREA 4KY8A 1JUJA 3EHIX 1BO7A 3IROA 4EJ1A 4ELEA 5U26A 3B9HA 3IRNA 3TQAA 3K2HA 1VJ3A 1B5EA 1TSDA 3QG2A 1BQ2A 4KJLA 1DR6A 4FOAA 4NX7A 1RB3A 4O1UA 2FTOX 2G86A 5H38A 1NCEA 4M6LA 3GHCA 4XT7A 5HF0X 3BHLA 4KNEA 2G89A 4KNZA 1LY3A 3FQFA 5HPBA 1S3UA 4FOGA 4HOFA 1M79A 4FGHA 3DFRA 4EB4A 3K74A 2L28A 1DRAA 3QL0A 1DG8A 4O7UA 1VDRA 2AZNA 3CLBA 3EDWX 1DISA 1F4FA 1J3KA 2H2QA 3OB7A 1M78A 1NJDA 2BL9A 4KEBA 1HFQA 3FRBX 4DQ1A 3FRAX 5CC9A 4H95A 3Q1HA 1F4EA 3NXTA 3C06A 2ANQA 1TVWA 5HVEA 3FRDX 1LCEA 1AOBA 1KMVA 3EAWX 1PDBA 4LEKX 5HUIA 1AI9A 2FZIA 4E5OA 1TSWA 4XSDA 4DFRA 1DF7A 5HT4A 3QLYA 3QLRA 3SRWX 3F0SX 4P66A 1B02A 1DHFA 2JYBA 5FDAA 2TDMA 1TSZA 3EX8A 4P68A 1DR7A 2BLAA 3NZCX 1TSLA 2GD9A 3SAIA 3GH2X 2O7PA 1BP6A 1RX4A 3QYLA 2OBCA 3F8ZA 4H1IA 3M09A 2BLCA 3R33A 3RO9A 2D0KA 3TQ9A 3LG4A 4CD2A 4P3RA 3GG5A 3IK1A 1J3IA 4XT6A 4XSEA 4H97A 3TQ8A 1MVSA 4FOXA 4G2OX 4G3MA 3K45A 2C2SA 3FYWX 3NZAX 1KMSA 5HSRA 1BP0A 1BKOA 1RX2A 5FCTA 4Q0EA 1DRFA 3F0QX 4M2XA 3SQYX 3ZPGA 4O1XA 5HS3A 4FQSA 4QHVA 1DLRA 3BHRA 2FTQA 3SH2A 3KGBA 4KPWA 1TSYA 1RX8A 3NZ9X 4GYHA 3F0UX 3UM6A 4IQQA 3KJRA 3IX6A 4X5JA 4ELHA 3S9UA 3FYVX 2ITHA 1BPJA 1JTUA 3ED7A 4KL9A 4QI9A 4XSCA 4X5FA 2AAZA 2TSCA 1ZPRA 1CD2A 1TDRA 3NZBX 3FRFX 3GHVA 3NXVA 4JEFA 5JG0X 1VZEA 1DDSA 5HI6A 4HOGA 3N0HA 3S7AA 1DHJA 1JMFA 1KLKA 1RA3A 4H96A 1U70A 7DFRA 4LRRA 3NXXA 3HB8A 3BNZA 3SGYA 4XRBA 3H9KA 2RDAA 3QLSA 3JWKA 3NZDA 3FY9X 1TISA 3FQCA 5H3AA 4XT5A 2CIGA 4H0UA 3JWMA 1F4DA 4DPHA 1AJMA 4IQBA 1J3IC 4M6KA 4KLXA 3F0XX 4IXED 3SR5X 4TU5X 3INVA 4I1NA 4ISKA 2BBQA 4QJZD 1EV5A 3NZ6X 1PD8A 1JMHA 1DR5A 3F91A 4G95A 5DXVA 3DL6A 1M7AA 3EBUA 1AO8A 3QLWA 1PD9A 3KJSA 5EAJA 4OR7A 1DG7A 1RA1A 4ECKA 4OSGA 4I13A 5HQZA 3FS6A 2HQPA 4KJKA 1JOLA 4XE6X 4M7VA 1DG5A 4HOEA 1EV8A 3EEMA 4PTHA 3EEKA 3EIGA 2DRCA 3UWLA 3CSEA 2D5NA 2G8DA 4PTJA 3GI2A 1QQQA 3IA5A 3QGTA 4G8ZX 2LF1A 1JOMA 3S3VA 1JUTA 1IA3A 2W3WA 4KJJA 2W9SA 1NJCA 1BSPA 1BIDA 6DFRA 3GHWA 4NX6A 1TSVA 3DL5A 3D80A 1S3VA 1HVYA 1OHJA 1RC4A 3BYXA 3SRSX 3FQOA 4EIZA 2VF0A 3DGAA 2XW7A 4LAEX 3M08A 1YHOA 1RG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFR A;  2BLB A;  1TVV A;  1DDR A;  1RA2 A;  1YPV A;  3TMS A;  1BJG A;  1U72 A;  2W3V A;  3ZPC A;  1CI7 A;  1JU6 A;  1RE7 A;  3QJ7 A;  3B5B A;  1BKP A;  1LCA A;  3DRC A;  3N5E B;  1J3J A;  5HVB A;  2HXV A;  1J3K C;  3EEL A;  1NJE A;  5HQY A;  3UM5 A;  4P3Q A;  1IA4 A;  2G8A A;  3QLX A;  5WRN A;  3N5E A;  3KY8 A;  1BOZ A;  3F0B X;  4PDJ A;  4EZ8 A;  1B5D A;  3IRM A;  3JWF A;  3QFX A;  1LY4 A;  1JUV A;  4EIL A;  1TLS A;  3IHI A;  1F28 A;  3NXO A;  1VZA A;  1DLS A;  1RA8 A;  2ONB A;  3FL8 A;  1BDU A;  3TQB A;  1DDU A;  1NJB A;  4QLF A;  4ELG A;  1DR3 A;  4EIN A;  1NJA A;  4PSG A;  1KZJ A;  4ELF A;  4XT4 A;  3CD2 A;  4XT8 A;  4FGG A;  3QL3 A;  5DFR A;  4PSY A;  1S3Y A;  1S3W A;  1KZI A;  2W3B A;  2ANO A;  1OHK A;  3NRR A;  1TLC A;  3N5G A;  4ELB A;  1TRG A;  2ZZA A;  4QLE A;  4Q67 A;  2KGK A;  3I8A X;  1QZF A;  1HW4 A;  5BY6 A;  1TSX A;  5HT5 A;  1TSN A;  3C0A A;  3SRQ X;  1DYI A;  1BO8 A;  3DGA C;  1RX9 A;  5ECC A;  4H0R A;  3L3R A;  3JTW A;  1D1G A;  4QJC A;  1TYS A;  4PST A;  4KAK A;  1RX6 A;  1MVT A;  2HM9 A;  1F4B A;  4EIG A;  1RH3 A;  3E0B A;  3JW5 A;  4FGT A;  1EVF A;  1AN5 A;  2TDD A;  1HFP A;  1U71 A;  1JTQ A;  3EF9 A;  4HA9 A;  4TMS A;  3CL9 A;  3SRU X;  1J3J C;  3ROA A;  4IRR A;  1TDA A;  3UWL B;  5JA3 A;  2G6V A;  3IK0 A;  2INQ A;  4DP3 A;  3QLZ A;  3DAT A;  3JVX A;  1LUD A;  4HA7 A;  1DYH A;  3QYO A;  2CD2 A;  4X5G A;  1VZC A;  1JMI A;  1RB2 A;  4DPD A;  4X5I A;  4H98 A;  1I00 A;  1B49 A;  3EJL A;  1AXW A;  1RA9 A;  1CZ3 A;  2QK8 A;  5HF2 X;  3K47 A;  4G6W X;  3DAU A;  3BZ0 A;  3DG8 A;  1DR1 A;  1E26 A;  1TVU A;  3HJ3 A;  4IXG X;  3NXR A;  4M6J A;  3F8Y A;  4DDR A;  3JSU A;  3EGY X;  3FQ0 A;  1TDU A;  2G8X A;  4O1X D;  4KFJ A;  1DHI A;  2W3M A;  3D84 X;  2KCE A;  2OIP A;  2W3A A;  3IA4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  2C2T A;  4FHB A;  4KM0 A;  4IXF X;  1IA2 A;  2VET A;  1AIQ A;  3KGY A;  1RD7 A;  4LAG X;  1DNA A;  3NTZ A;  3IJZ A;  2FZH A;  1F4C A;  4PSS A;  2B3Z A;  3GYF A;  2FTN A;  8DFR A;  3OAF A;  1DR4 A;  3OCH A;  1DRH A;  2TSR A;  3IX9 A;  1RX3 A;  1DAJ A;  1TDC A;  1JG0 A;  1SYN A;  2A9W A;  1F4G A;  1KCE A;  1DR2 A;  5J7W A;  3FQZ A;  3BFI A;  1LCB A;  3JW3 A;  4QLG A;  3TD8 A;  1AOE A;  3RG9 A;  3SRR X;  3FQV A;  1FWM A;  1ZDR A;  5ECX A;  2W9H A;  3NU0 A;  2W9T A;  3NXY A;  4XEC X;  4ISW A;  1DRB A;  1RTS A;  1TSM A;  3GH0 A;  4RGC A;  2DHF A;  2RD8 B;  1BZF A;  3UM8 A;  1DYJ A;  4GEV A;  1HW3 A;  4KY4 A;  1RX5 A;  1FFL A;  3F0V X;  2FZJ A;  3SA1 A;  4KM2 A;  3HBB A;  1RX1 A;  2P4G A;  1JMG A;  4GH8 A;  2RD8 A;  4X5H A;  3EEJ A;  4LAH X;  1TDB A;  4E28 A;  3FY8 X;  3DG8 C;  3VCO A;  4KD7 A;  1BQ1 A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  2W9G A;  3BGX A;  4F2V A;  1DYR A;  1THY A;  5CCC A;  5HSU A;  4UP1 A;  1HZW A;  1BSF A;  3JWC A;  3KFY A;  1EVG A;  3SA2 A;  3FL9 A;  5E8Q A;  1RX7 A;  4Q0D A;  1IA1 A;  4M7U A;  1RF7 A;  1DIU A;  4KBN A;  3FRE X;  5U27 A;  4Q6A A;  1DRE A;  4KY8 A;  1JUJ A;  3EHI X;  1BO7 A;  3IRO A;  4EJ1 A;  4ELE A;  5U26 A;  3B9H A;  3IRN A;  3TQA A;  3K2H A;  1VJ3 A;  1B5E A;  1TSD A;  3QG2 A;  1BQ2 A;  4KJL A;  1DR6 A;  4FOA A;  4NX7 A;  1RB3 A;  4O1U A;  2FTO X;  2G86 A;  5H38 A;  1NCE A;  4M6L A;  3GHC A;  4XT7 A;  5HF0 X;  3BHL A;  4KNE A;  2G89 A;  4KNZ A;  1LY3 A;  3FQF A;  5HPB A;  1S3U A;  4FOG A;  4HOF A;  1M79 A;  4FGH A;  3DFR A;  4EB4 A;  3K74 A;  2L28 A;  1DRA A;  3QL0 A;  1DG8 A;  4O7U A;  1VDR A;  2AZN A;  3CLB A;  3EDW X;  1DIS A;  1F4F A;  1J3K A;  2H2Q A;  3OB7 A;  1M78 A;  1NJD A;  2BL9 A;  4KEB A;  1HFQ A;  3FRB X;  4DQ1 A;  3FRA X;  5CC9 A;  4H95 A;  3Q1H A;  1F4E A;  3NXT A;  3C06 A;  2ANQ A;  1TVW A;  5HVE A;  3FRD X;  1LCE A;  1AOB A;  1KMV A;  3EAW X;  1PDB A;  4LEK X;  5HUI A;  1AI9 A;  2FZI A;  4E5O A;  1TSW A;  4XSD A;  4DFR A;  1DF7 A;  5HT4 A;  3QLY A;  3QLR A;  3SRW X;  3F0S X;  4P66 A;  1B02 A;  1DHF A;  2JYB A;  5FDA A;  2TDM A;  1TSZ A;  3EX8 A;  4P68 A;  1DR7 A;  2BLA A;  3NZC X;  1TSL A;  2GD9 A;  3SAI A;  3GH2 X;  2O7P A;  1BP6 A;  1RX4 A;  3QYL A;  2OBC A;  3F8Z A;  4H1I A;  3M09 A;  2BLC A;  3R33 A;  3RO9 A;  2D0K A;  3TQ9 A;  3LG4 A;  4CD2 A;  4P3R A;  3GG5 A;  3IK1 A;  1J3I A;  4XT6 A;  4XSE A;  4H97 A;  3TQ8 A;  1MVS A;  4FOX A;  4G2O X;  4G3M A;  3K45 A;  2C2S A;  3FYW X;  3NZA X;  1KMS A;  5HSR A;  1BP0 A;  1BKO A;  1RX2 A;  5FCT A;  4Q0E A;  1DRF A;  3F0Q X;  4M2X A;  3SQY X;  3ZPG A;  4O1X A;  5HS3 A;  4FQS A;  4QHV A;  1DLR A;  3BHR A;  2FTQ A;  3SH2 A;  3KGB A;  4KPW A;  1TSY A;  1RX8 A;  3NZ9 X;  4GYH A;  3F0U X;  3UM6 A;  4IQQ A;  3KJR A;  3IX6 A;  4X5J A;  4ELH A;  3S9U A;  3FYV X;  2ITH A;  1BPJ A;  1JTU A;  3ED7 A;  4KL9 A;  4QI9 A;  4XSC A;  4X5F A;  2AAZ A;  2TSC A;  1ZPR A;  1CD2 A;  1TDR A;  3NZB X;  3FRF X;  3GHV A;  3NXV A;  4JEF A;  5JG0 X;  1VZE A;  1DDS A;  5HI6 A;  4HOG A;  3N0H A;  3S7A A;  1DHJ A;  1JMF A;  1KLK A;  1RA3 A;  4H96 A;  1U70 A;  7DFR A;  4LRR A;  3NXX A;  3HB8 A;  3BNZ A;  3SGY A;  4XRB A;  3H9K A;  2RDA A;  3QLS A;  3JWK A;  3NZD A;  3FY9 X;  1TIS A;  3FQC A;  5H3A A;  4XT5 A;  2CIG A;  4H0U A;  3JWM A;  1F4D A;  4DPH A;  1AJM A;  4IQB A;  1J3I C;  4M6K A;  4KLX A;  3F0X X;  4IXE D;  3SR5 X;  4TU5 X;  3INV A;  4I1N A;  4ISK A;  2BBQ A;  4QJZ D;  1EV5 A;  3NZ6 X;  1PD8 A;  1JMH A;  1DR5 A;  3F91 A;  4G95 A;  5DXV A;  3DL6 A;  1M7A A;  3EBU A;  1AO8 A;  3QLW A;  1PD9 A;  3KJS A;  5EAJ A;  4OR7 A;  1DG7 A;  1RA1 A;  4ECK A;  4OSG A;  4I13 A;  5HQZ A;  3FS6 A;  2HQP A;  4KJK A;  1JOL A;  4XE6 X;  4M7V A;  1DG5 A;  4HOE A;  1EV8 A;  3EEM A;  4PTH A;  3EEK A;  3EIG A;  2DRC A;  3UWL A;  3CSE A;  2D5N A;  2G8D A;  4PTJ A;  3GI2 A;  1QQQ A;  3IA5 A;  3QGT A;  4G8Z X;  2LF1 A;  1JOM A;  3S3V A;  1JUT A;  1IA3 A;  2W3W A;  4KJJ A;  2W9S A;  1NJC A;  1BSP A;  1BID A;  6DFR A;  3GHW A;  4NX6 A;  1TSV A;  3DL5 A;  3D80 A;  1S3V A;  1HVY A;  1OHJ A;  1RC4 A;  3BYX A;  3SRS X;  3FQO A;  4EIZ A;  2VF0 A;  3DGA A;  2XW7 A;  4LAE X;  3M08 A;  1YHO A;  1RG7 A; 
#chains in the Genus database with same CATH topology
 1HFR A;  2BLB A;  1TVV A;  1DDR A;  1RA2 A;  1YPV A;  3TMS A;  1BJG A;  1U72 A;  2W3V A;  3ZPC A;  1CI7 A;  1JU6 A;  1RE7 A;  3QJ7 A;  3B5B A;  1BKP A;  1LCA A;  3DRC A;  3N5E B;  1J3J A;  5HVB A;  2HXV A;  1J3K C;  3EEL A;  1NJE A;  5HQY A;  3UM5 A;  4P3Q A;  1IA4 A;  2G8A A;  3QLX A;  5WRN A;  3N5E A;  3KY8 A;  1BOZ A;  3F0B X;  4PDJ A;  4EZ8 A;  1B5D A;  3IRM A;  3JWF A;  3QFX A;  1LY4 A;  1JUV A;  4EIL A;  1TLS A;  3IHI A;  1F28 A;  3NXO A;  1VZA A;  1DLS A;  1RA8 A;  2ONB A;  3FL8 A;  1BDU A;  3TQB A;  1DDU A;  1NJB A;  4QLF A;  4ELG A;  1DR3 A;  4EIN A;  1NJA A;  4PSG A;  1KZJ A;  4ELF A;  4XT4 A;  3CD2 A;  4XT8 A;  4FGG A;  3QL3 A;  5DFR A;  4PSY A;  1S3Y A;  1S3W A;  1KZI A;  2W3B A;  2ANO A;  1OHK A;  3NRR A;  1TLC A;  3N5G A;  4ELB A;  1TRG A;  2ZZA A;  4QLE A;  4Q67 A;  2KGK A;  3I8A X;  1QZF A;  1HW4 A;  5BY6 A;  1TSX A;  5HT5 A;  1TSN A;  3C0A A;  3SRQ X;  1DYI A;  1BO8 A;  3DGA C;  1RX9 A;  5ECC A;  4H0R A;  3L3R A;  3JTW A;  1D1G A;  4QJC A;  1TYS A;  4PST A;  4KAK A;  1RX6 A;  1MVT A;  2HM9 A;  1F4B A;  4EIG A;  1RH3 A;  3E0B A;  3JW5 A;  4FGT A;  1EVF A;  1AN5 A;  2TDD A;  1HFP A;  1U71 A;  1JTQ A;  3EF9 A;  4HA9 A;  4TMS A;  3CL9 A;  3SRU X;  1J3J C;  3ROA A;  4IRR A;  1TDA A;  3UWL B;  5JA3 A;  2G6V A;  3IK0 A;  2INQ A;  4DP3 A;  3QLZ A;  3DAT A;  3JVX A;  1LUD A;  4HA7 A;  1DYH A;  3QYO A;  2CD2 A;  4X5G A;  1VZC A;  1JMI A;  1RB2 A;  4DPD A;  4X5I A;  4H98 A;  1I00 A;  1B49 A;  3EJL A;  1AXW A;  1RA9 A;  1CZ3 A;  2QK8 A;  5HF2 X;  3K47 A;  4G6W X;  3DAU A;  3BZ0 A;  3DG8 A;  1DR1 A;  1E26 A;  1TVU A;  3HJ3 A;  4IXG X;  3NXR A;  4M6J A;  3F8Y A;  4DDR A;  3JSU A;  3EGY X;  3FQ0 A;  1TDU A;  2G8X A;  4O1X D;  4KFJ A;  1DHI A;  2W3M A;  3D84 X;  2KCE A;  2OIP A;  2W3A A;  3IA4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  2C2T A;  4FHB A;  4KM0 A;  4IXF X;  1IA2 A;  2VET A;  1AIQ A;  3KGY A;  1RD7 A;  4LAG X;  1DNA A;  3NTZ A;  3IJZ A;  2FZH A;  1F4C A;  4PSS A;  2B3Z A;  3GYF A;  2FTN A;  8DFR A;  3OAF A;  1DR4 A;  3OCH A;  1DRH A;  2TSR A;  3IX9 A;  1RX3 A;  1DAJ A;  1TDC A;  1JG0 A;  1SYN A;  2A9W A;  1F4G A;  1KCE A;  1DR2 A;  5J7W A;  3FQZ A;  3BFI A;  1LCB A;  3JW3 A;  4QLG A;  3TD8 A;  1AOE A;  3RG9 A;  3SRR X;  3FQV A;  1FWM A;  1ZDR A;  5ECX A;  2W9H A;  3NU0 A;  2W9T A;  3NXY A;  4XEC X;  4ISW A;  1DRB A;  1RTS A;  1TSM A;  3GH0 A;  4RGC A;  2DHF A;  2RD8 B;  1BZF A;  3UM8 A;  1DYJ A;  4GEV A;  1HW3 A;  4KY4 A;  1RX5 A;  1FFL A;  3F0V X;  2FZJ A;  3SA1 A;  4KM2 A;  3HBB A;  1RX1 A;  2P4G A;  1JMG A;  4GH8 A;  2RD8 A;  4X5H A;  3EEJ A;  4LAH X;  1TDB A;  4E28 A;  3FY8 X;  3DG8 C;  3VCO A;  4KD7 A;  1BQ1 A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  2W9G A;  3BGX A;  4F2V A;  1DYR A;  1THY A;  5CCC A;  5HSU A;  4UP1 A;  1HZW A;  1BSF A;  3JWC A;  3KFY A;  1EVG A;  3SA2 A;  3FL9 A;  5E8Q A;  1RX7 A;  4Q0D A;  1IA1 A;  4M7U A;  1RF7 A;  1DIU A;  4KBN A;  3FRE X;  5U27 A;  4Q6A A;  1DRE A;  4KY8 A;  1JUJ A;  3EHI X;  1BO7 A;  3IRO A;  4EJ1 A;  4ELE A;  5U26 A;  3B9H A;  3IRN A;  3TQA A;  3K2H A;  1VJ3 A;  1B5E A;  1TSD A;  3QG2 A;  1BQ2 A;  4KJL A;  1DR6 A;  4FOA A;  4NX7 A;  1RB3 A;  4O1U A;  2FTO X;  2G86 A;  5H38 A;  1NCE A;  4M6L A;  3GHC A;  4XT7 A;  5HF0 X;  3BHL A;  4KNE A;  2G89 A;  4KNZ A;  1LY3 A;  3FQF A;  5HPB A;  1S3U A;  4FOG A;  4HOF A;  1M79 A;  4FGH A;  3DFR A;  4EB4 A;  3K74 A;  2L28 A;  1DRA A;  3QL0 A;  1DG8 A;  4O7U A;  1VDR A;  2AZN A;  3CLB A;  3EDW X;  1DIS A;  1F4F A;  1J3K A;  2H2Q A;  3OB7 A;  1M78 A;  1NJD A;  2BL9 A;  4KEB A;  1HFQ A;  3FRB X;  4DQ1 A;  3FRA X;  5CC9 A;  4H95 A;  3Q1H A;  1F4E A;  3NXT A;  3C06 A;  2ANQ A;  1TVW A;  5HVE A;  3FRD X;  1LCE A;  1AOB A;  1KMV A;  3EAW X;  1PDB A;  4LEK X;  5HUI A;  1AI9 A;  2FZI A;  4E5O A;  1TSW A;  4XSD A;  4DFR A;  1DF7 A;  5HT4 A;  3QLY A;  3QLR A;  3SRW X;  3F0S X;  4P66 A;  1B02 A;  1DHF A;  2JYB A;  5FDA A;  2TDM A;  1TSZ A;  3EX8 A;  4P68 A;  1DR7 A;  2BLA A;  3NZC X;  1TSL A;  2GD9 A;  3SAI A;  3GH2 X;  2O7P A;  1BP6 A;  1RX4 A;  3QYL A;  2OBC A;  3F8Z A;  4H1I A;  3M09 A;  2BLC A;  3R33 A;  3RO9 A;  2D0K A;  3TQ9 A;  3LG4 A;  4CD2 A;  4P3R A;  3GG5 A;  3IK1 A;  1J3I A;  4XT6 A;  4XSE A;  4H97 A;  3TQ8 A;  1MVS A;  4FOX A;  4G2O X;  4G3M A;  3K45 A;  2C2S A;  3FYW X;  3NZA X;  1KMS A;  5HSR A;  1BP0 A;  1BKO A;  1RX2 A;  5FCT A;  4Q0E A;  1DRF A;  3F0Q X;  4M2X A;  3SQY X;  3ZPG A;  4O1X A;  5HS3 A;  4FQS A;  4QHV A;  1DLR A;  3BHR A;  2FTQ A;  3SH2 A;  3KGB A;  4KPW A;  1TSY A;  1RX8 A;  3NZ9 X;  4GYH A;  3F0U X;  3UM6 A;  4IQQ A;  3KJR A;  3IX6 A;  4X5J A;  4ELH A;  3S9U A;  3FYV X;  2ITH A;  1BPJ A;  1JTU A;  3ED7 A;  4KL9 A;  4QI9 A;  4XSC A;  4X5F A;  2AAZ A;  2TSC A;  1ZPR A;  1CD2 A;  1TDR A;  3NZB X;  3FRF X;  3GHV A;  3NXV A;  4JEF A;  5JG0 X;  1VZE A;  1DDS A;  5HI6 A;  4HOG A;  3N0H A;  3S7A A;  1DHJ A;  1JMF A;  1KLK A;  1RA3 A;  4H96 A;  1U70 A;  7DFR A;  4LRR A;  3NXX A;  3HB8 A;  3BNZ A;  3SGY A;  4XRB A;  3H9K A;  2RDA A;  3QLS A;  3JWK A;  3NZD A;  3FY9 X;  1TIS A;  3FQC A;  5H3A A;  4XT5 A;  2CIG A;  4H0U A;  3JWM A;  1F4D A;  4DPH A;  1AJM A;  4IQB A;  1J3I C;  4M6K A;  4KLX A;  3F0X X;  4IXE D;  3SR5 X;  4TU5 X;  3INV A;  4I1N A;  4ISK A;  2BBQ A;  4QJZ D;  1EV5 A;  3NZ6 X;  1PD8 A;  1JMH A;  1DR5 A;  3F91 A;  4G95 A;  5DXV A;  3DL6 A;  1M7A A;  3EBU A;  1AO8 A;  3QLW A;  1PD9 A;  3KJS A;  5EAJ A;  4OR7 A;  1DG7 A;  1RA1 A;  4ECK A;  4OSG A;  4I13 A;  5HQZ A;  3FS6 A;  2HQP A;  4KJK A;  1JOL A;  4XE6 X;  4M7V A;  1DG5 A;  4HOE A;  1EV8 A;  3EEM A;  4PTH A;  3EEK A;  3EIG A;  2DRC A;  3UWL A;  3CSE A;  2D5N A;  2G8D A;  4PTJ A;  3GI2 A;  1QQQ A;  3IA5 A;  3QGT A;  4G8Z X;  2LF1 A;  1JOM A;  3S3V A;  1JUT A;  1IA3 A;  2W3W A;  4KJJ A;  2W9S A;  1NJC A;  1BSP A;  1BID A;  6DFR A;  3GHW A;  4NX6 A;  1TSV A;  3DL5 A;  3D80 A;  1S3V A;  1HVY A;  1OHJ A;  1RC4 A;  3BYX A;  3SRS X;  3FQO A;  4EIZ A;  2VF0 A;  3DGA A;  2XW7 A;  4LAE X;  3M08 A;  1YHO A;  1RG7 A; 
#chains in the Genus database with same CATH homology
 1HFR A;  2BLB A;  1TVV A;  1DDR A;  1RA2 A;  1YPV A;  3TMS A;  1BJG A;  1U72 A;  2W3V A;  3ZPC A;  1CI7 A;  1JU6 A;  1RE7 A;  3QJ7 A;  3B5B A;  1BKP A;  1LCA A;  3DRC A;  3N5E B;  1J3J A;  5HVB A;  2HXV A;  1J3K C;  3EEL A;  1NJE A;  5HQY A;  3UM5 A;  4P3Q A;  1IA4 A;  2G8A A;  3QLX A;  5WRN A;  3N5E A;  3KY8 A;  1BOZ A;  3F0B X;  4PDJ A;  4EZ8 A;  1B5D A;  3IRM A;  3JWF A;  3QFX A;  1LY4 A;  1JUV A;  4EIL A;  1TLS A;  3IHI A;  1F28 A;  3NXO A;  1VZA A;  1DLS A;  1RA8 A;  2ONB A;  3FL8 A;  1BDU A;  3TQB A;  1DDU A;  1NJB A;  4QLF A;  4ELG A;  1DR3 A;  4EIN A;  1NJA A;  4PSG A;  1KZJ A;  4ELF A;  4XT4 A;  3CD2 A;  4XT8 A;  4FGG A;  3QL3 A;  5DFR A;  4PSY A;  1S3Y A;  1S3W A;  1KZI A;  2W3B A;  2ANO A;  1OHK A;  3NRR A;  1TLC A;  3N5G A;  4ELB A;  1TRG A;  2ZZA A;  4QLE A;  4Q67 A;  2KGK A;  3I8A X;  1QZF A;  1HW4 A;  5BY6 A;  1TSX A;  5HT5 A;  1TSN A;  3C0A A;  3SRQ X;  1DYI A;  1BO8 A;  3DGA C;  1RX9 A;  5ECC A;  4H0R A;  3L3R A;  3JTW A;  1D1G A;  4QJC A;  1TYS A;  4PST A;  4KAK A;  1RX6 A;  1MVT A;  2HM9 A;  1F4B A;  4EIG A;  1RH3 A;  3E0B A;  3JW5 A;  4FGT A;  1EVF A;  1AN5 A;  2TDD A;  1HFP A;  1U71 A;  1JTQ A;  3EF9 A;  4HA9 A;  4TMS A;  3CL9 A;  3SRU X;  1J3J C;  3ROA A;  4IRR A;  1TDA A;  3UWL B;  5JA3 A;  2G6V A;  3IK0 A;  2INQ A;  4DP3 A;  3QLZ A;  3DAT A;  3JVX A;  1LUD A;  4HA7 A;  1DYH A;  3QYO A;  2CD2 A;  4X5G A;  1VZC A;  1JMI A;  1RB2 A;  4DPD A;  4X5I A;  4H98 A;  1I00 A;  1B49 A;  3EJL A;  1AXW A;  1RA9 A;  1CZ3 A;  2QK8 A;  5HF2 X;  3K47 A;  4G6W X;  3DAU A;  3BZ0 A;  3DG8 A;  1DR1 A;  1E26 A;  1TVU A;  3HJ3 A;  4IXG X;  3NXR A;  4M6J A;  3F8Y A;  4DDR A;  3JSU A;  3EGY X;  3FQ0 A;  1TDU A;  2G8X A;  4O1X D;  4KFJ A;  1DHI A;  2W3M A;  3D84 X;  2KCE A;  2OIP A;  2W3A A;  3IA4 A;  3I3R A;  4GD7 A;  4KYA A;  1VZD A;  3V8H A;  2C2T A;  4FHB A;  4KM0 A;  4IXF X;  1IA2 A;  2VET A;  1AIQ A;  3KGY A;  1RD7 A;  4LAG X;  1DNA A;  3NTZ A;  3IJZ A;  2FZH A;  1F4C A;  4PSS A;  2B3Z A;  3GYF A;  2FTN A;  8DFR A;  3OAF A;  1DR4 A;  3OCH A;  1DRH A;  2TSR A;  3IX9 A;  1RX3 A;  1DAJ A;  1TDC A;  1JG0 A;  1SYN A;  2A9W A;  1F4G A;  1KCE A;  1DR2 A;  5J7W A;  3FQZ A;  3BFI A;  1LCB A;  3JW3 A;  4QLG A;  3TD8 A;  1AOE A;  3RG9 A;  3SRR X;  3FQV A;  1FWM A;  1ZDR A;  5ECX A;  2W9H A;  3NU0 A;  2W9T A;  3NXY A;  4XEC X;  4ISW A;  1DRB A;  1RTS A;  1TSM A;  3GH0 A;  4RGC A;  2DHF A;  2RD8 B;  1BZF A;  3UM8 A;  1DYJ A;  4GEV A;  1HW3 A;  4KY4 A;  1RX5 A;  1FFL A;  3F0V X;  2FZJ A;  3SA1 A;  4KM2 A;  3HBB A;  1RX1 A;  2P4G A;  1JMG A;  4GH8 A;  2RD8 A;  4X5H A;  3EEJ A;  4LAH X;  1TDB A;  4E28 A;  3FY8 X;  3DG8 C;  3VCO A;  4KD7 A;  1BQ1 A;  1TJS A;  5H39 A;  1SEJ A;  1VZB A;  2W9G A;  3BGX A;  4F2V A;  1DYR A;  1THY A;  5CCC A;  5HSU A;  4UP1 A;  1HZW A;  1BSF A;  3JWC A;  3KFY A;  1EVG A;  3SA2 A;  3FL9 A;  5E8Q A;  1RX7 A;  4Q0D A;  1IA1 A;  4M7U A;  1RF7 A;  1DIU A;  4KBN A;  3FRE X;  5U27 A;  4Q6A A;  1DRE A;  4KY8 A;  1JUJ A;  3EHI X;  1BO7 A;  3IRO A;  4EJ1 A;  4ELE A;  5U26 A;  3B9H A;  3IRN A;  3TQA A;  3K2H A;  1VJ3 A;  1B5E A;  1TSD A;  3QG2 A;  1BQ2 A;  4KJL A;  1DR6 A;  4FOA A;  4NX7 A;  1RB3 A;  4O1U A;  2FTO X;  2G86 A;  5H38 A;  1NCE A;  4M6L A;  3GHC A;  4XT7 A;  5HF0 X;  3BHL A;  4KNE A;  2G89 A;  4KNZ A;  1LY3 A;  3FQF A;  5HPB A;  1S3U A;  4FOG A;  4HOF A;  1M79 A;  4FGH A;  3DFR A;  4EB4 A;  3K74 A;  2L28 A;  1DRA A;  3QL0 A;  1DG8 A;  4O7U A;  1VDR A;  2AZN A;  3CLB A;  3EDW X;  1DIS A;  1F4F A;  1J3K A;  2H2Q A;  3OB7 A;  1M78 A;  1NJD A;  2BL9 A;  4KEB A;  1HFQ A;  3FRB X;  4DQ1 A;  3FRA X;  5CC9 A;  4H95 A;  3Q1H A;  1F4E A;  3NXT A;  3C06 A;  2ANQ A;  1TVW A;  5HVE A;  3FRD X;  1LCE A;  1AOB A;  1KMV A;  3EAW X;  1PDB A;  4LEK X;  5HUI A;  1AI9 A;  2FZI A;  4E5O A;  1TSW A;  4XSD A;  4DFR A;  1DF7 A;  5HT4 A;  3QLY A;  3QLR A;  3SRW X;  3F0S X;  4P66 A;  1B02 A;  1DHF A;  2JYB A;  5FDA A;  2TDM A;  1TSZ A;  3EX8 A;  4P68 A;  1DR7 A;  2BLA A;  3NZC X;  1TSL A;  2GD9 A;  3SAI A;  3GH2 X;  2O7P A;  1BP6 A;  1RX4 A;  3QYL A;  2OBC A;  3F8Z A;  4H1I A;  3M09 A;  2BLC A;  3R33 A;  3RO9 A;  2D0K A;  3TQ9 A;  3LG4 A;  4CD2 A;  4P3R A;  3GG5 A;  3IK1 A;  1J3I A;  4XT6 A;  4XSE A;  4H97 A;  3TQ8 A;  1MVS A;  4FOX A;  4G2O X;  4G3M A;  3K45 A;  2C2S A;  3FYW X;  3NZA X;  1KMS A;  5HSR A;  1BP0 A;  1BKO A;  1RX2 A;  5FCT A;  4Q0E A;  1DRF A;  3F0Q X;  4M2X A;  3SQY X;  3ZPG A;  4O1X A;  5HS3 A;  4FQS A;  4QHV A;  1DLR A;  3BHR A;  2FTQ A;  3SH2 A;  3KGB A;  4KPW A;  1TSY A;  1RX8 A;  3NZ9 X;  4GYH A;  3F0U X;  3UM6 A;  4IQQ A;  3KJR A;  3IX6 A;  4X5J A;  4ELH A;  3S9U A;  3FYV X;  2ITH A;  1BPJ A;  1JTU A;  3ED7 A;  4KL9 A;  4QI9 A;  4XSC A;  4X5F A;  2AAZ A;  2TSC A;  1ZPR A;  1CD2 A;  1TDR A;  3NZB X;  3FRF X;  3GHV A;  3NXV A;  4JEF A;  5JG0 X;  1VZE A;  1DDS A;  5HI6 A;  4HOG A;  3N0H A;  3S7A A;  1DHJ A;  1JMF A;  1KLK A;  1RA3 A;  4H96 A;  1U70 A;  7DFR A;  4LRR A;  3NXX A;  3HB8 A;  3BNZ A;  3SGY A;  4XRB A;  3H9K A;  2RDA A;  3QLS A;  3JWK A;  3NZD A;  3FY9 X;  1TIS A;  3FQC A;  5H3A A;  4XT5 A;  2CIG A;  4H0U A;  3JWM A;  1F4D A;  4DPH A;  1AJM A;  4IQB A;  1J3I C;  4M6K A;  4KLX A;  3F0X X;  4IXE D;  3SR5 X;  4TU5 X;  3INV A;  4I1N A;  4ISK A;  2BBQ A;  4QJZ D;  1EV5 A;  3NZ6 X;  1PD8 A;  1JMH A;  1DR5 A;  3F91 A;  4G95 A;  5DXV A;  3DL6 A;  1M7A A;  3EBU A;  1AO8 A;  3QLW A;  1PD9 A;  3KJS A;  5EAJ A;  4OR7 A;  1DG7 A;  1RA1 A;  4ECK A;  4OSG A;  4I13 A;  5HQZ A;  3FS6 A;  2HQP A;  4KJK A;  1JOL A;  4XE6 X;  4M7V A;  1DG5 A;  4HOE A;  1EV8 A;  3EEM A;  4PTH A;  3EEK A;  3EIG A;  2DRC A;  3UWL A;  3CSE A;  2D5N A;  2G8D A;  4PTJ A;  3GI2 A;  1QQQ A;  3IA5 A;  3QGT A;  4G8Z X;  2LF1 A;  1JOM A;  3S3V A;  1JUT A;  1IA3 A;  2W3W A;  4KJJ A;  2W9S A;  1NJC A;  1BSP A;  1BID A;  6DFR A;  3GHW A;  4NX6 A;  1TSV A;  3DL5 A;  3D80 A;  1S3V A;  1HVY A;  1OHJ A;  1RC4 A;  3BYX A;  3SRS X;  3FQO A;  4EIZ A;  2VF0 A;  3DGA A;  2XW7 A;  4LAE X;  3M08 A;  1YHO A;  1RG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...