3NRUA

Ligand binding domain of epha7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
173
structure length
159
Chain Sequence
EVLLLDSKAEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ephrin A7 ligand binding domain
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Ephrin receptor
total genus 29
structure length 159
sequence length 173
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3nruA00
2B9VA 2LS6A 2RVAA 3I2HA 4A45A 4ZZ8A 3A21A 5C70A 5CYYA 4BK4A 3OBAA 4IUGA 3K46A 2YFZA 4OYUA 2XQXA 4DUVA 2VC9A 4AAXA 3WNNA 2Y6KA 2ZEWA 3K75B 2W91A 2ZEXA 2J1UA 4QB2A 1OH4A 3VD4A 3IB3A 4QPWA 5LA0A 1NUKA 2X05A 5C7GA 2VZSA 2J1VA 4BK5A 4YPJA 5B4XA 1JZ2A 4CVUA 2Y64A 1JYNA 5CZKA 2VZ3A 2EICA 1O59A 1JU3A 4MGSA 3F2ZA 5DMYA 2KD7A 1UMIA 2DDUA 5LCWL 3WF0A 3CQOA 3HNBM 4OMCA 2QQNA 4QX3A 2ORXA 3IAQA 2Z4FA 3ZM8A 1OT5A 3OEBA 1EUUA 2X10A 3W5MA 5IJRA 3MUZ1 1L7RA 4A41A 1PMHX 3CZUA 3A7QA 3I2IA 4P08A 4ET7A 2JD9A 2VMDA 2VZQA 4JKLA 2WABA 2CDOA 1UWWA 4M4RA 1JYXA 3I2JA 2C9KA 2WN3A 3FN9A 4GWJA 4QX2A 2DCJA 4DEQA 4RN5A 3OG2A 1CX1A 3VDAA 5A1AA 3EYPA 3C7HA 1JU4A 2CDPA 1W0NA 1JZ5A 3AC0A 5EJZB 1US3A 3I97A 1UYXA 1UXZA 4P00B 3DECA 3NNGA 5LA2A 3ACIA 4JHZA 1ULPA 2YC2A 2DCKA 2JDAA 2ZXQA 1IQDC 1GOFA 5FUIA 1GOGA 2QQKA 3VD7A 3J7HA 3WF2A 2J1TA 1UMHA 2ZEYA 2J1SA 1KGYA 5JXGA 2W1QA 1BHGA 3GXUA 4JKKA 2C26A 3FL7A 5EIYB 3ACFA 4UOJA 3EB7A 4JKMA 3OGSA 1XNAA 1MPXA 3LEIA 4PQQA 1H6YA 4CU9A 1UX7A 4PT6A 4CUAA 2QQJA 3IAPA 2W5FA 2V4VA 3PUHA 1CIYA 3CIHA 3LPFA 3WNPA 1UY4A 3T2PA 1RYYA 1UZ0A 2WO1A 2OKXA 3VDCA 2W3JA 5HXMA 3GDBA 3T0DA 1UXXX 1GOHA 3NJXA 3PUIA 2EIBA 4LKSA 3HN3A 4MOAA 2W1WA 2XHNA 5F7UA 1F4HA 4XUPA 2J7MA 3WF3A 1YQ2A 1JI6A 3ECQA 5B4NA 2ZEZA 3I2KA 4UI9L 3C7FA 1CZTA 3T0AA 2YFUA 4DUXA 1EUTA 1OD3A 1WKYA 2WUHA 3IIIA 1JHJA 2V5DA 3HJRA 1ULOA 1UY2A 2QQOA 2Y6HA 4RYDA 3ABZA 2L9LA 1JZ8A 3WNMA 1KEXA 3SEEA 4M4PA 3WQBA 1GUIA 2VO5A 1I5PA 3NJVA 2W87A 4DXTA 2B4KA 1OF4A 4TXWA 4DXSA 3VD3A 1UYYA 1JZ3A 3I2FA 1UY0A 3VD5A 2VQUA 4DUWA 2RJ2A 3LEKA 2WN2A 3W5NA 5JXJA 3HNMA 2WBKA 2Y6LA 2QQLA 2QQMA 3K77A 1T2XA 1PX3A 2VZRA 4QDRA 3DYOA 1W9SA 3BGAA 3K4ZA 2Y6JA 2VZPA 5LA1A 3HPNA 1W8NA 4QX0A 3T08A 4MADA 5EJ1B 3DYMA 4E8DA 3BN6A 3VDBA 2WYSA 4A6OA 1DYOA 2X09A 3WSOA 4A3ZA 5JR2A 4W8JA 1D7PM 2PQSA 4XVHA 3CMGA 4XUQA 3U37A 4XURA 2W47A 3UETA 3WNLA 1L7QA 1SDDB 3T0BA 4LPLA 2J22A 3LE0A 1W8OA 2JE8A 4JX0A 4DEVA 2HYXA 2YB7A 1WCQA 5C71A 4KMQA 2R7EB 2E33A 3A23A 5JMOA 2BBAA 5DPNA 2BZDA 1K12A 5I0DA 5G05L 2C4XA 4LHSA 1XNTA 3NRUA 4BDVB 2WAOA 3NQHA 1UYZA 1CZVA 4MGQA 4TTGA 4XUOA 5IFTA 3MBWA 4W50A 2W9XA 4L0PA 5IFPA 1JZ6A 2VZ1A 2ORZA 2W94A 3D3AA 1DP0A 1PMJX 3GGLA 1W9TA 1J83A 1R64A 4CU8A 1LNSA 3C7GA 2J1EA 4ZY9A 1P8JA 2QBXA 2WO2A 4QDQA 3FHQA 3T2OA 3UESA 4KWUA 4BJ0A 4A4AA 1K3IA 1US2A 2VJXA 3CZJA 3DYPA 3SEPA 3UNPA 2E31A 1K42A 3LQCA 4OMDA 2W95A 4CUBA 2Y8KA 1TG7A 2VR4A 2YG0A 4QX1A 2ID4A 4PF1A 4QB1A 4UAPA 2VZTA 4QDSA 1H6XA 4BXSV 3MV11 2QQIA 2VOTA 3OGVA 2EIEA 3WEZA 2JKXA 4ZXEA 2W92A 2XOMA 4MO3M 1O8SA 2V72A 3ACGA 2XONA 3WNKA 2W1SA 3THCA 2J1RA 4XUNA 2VTFA 4QB6A 2VZOA 3P6BA 2WZ8A 2VL4A 4A44A 4GZ9A 3MO4A 1JZ7A 2W1UA 3SKVA 3IDAA 4Z2AA 1CZSA 3HEIA 1NX9A 3T09A 3I3BA 1OF3A 1W99A 3SKJE 1XPWA 1JYVA 5JUVA 4KI5M 1F4AA 4FI9A 4W4ZA 2BGPA 1J84A 1O8PA 3E1F1 2WDBA 1NAEA 3WNOA 2VMEA 1JYWA 3HNYM 4P02B 1GU3A 4HG6B 2HLEA 2VZVA 2Y6GA 2J1AA 3K4AA 1SHWB 3C7OA 3K4DA 4XZUG 1K45A 3GM8A 3HOBA 1UY1A 3CDZB 2BERA 2RV9A 4D8MA 1GQPA 4OZOA 5JXHA 1TVGA 4CU7A 2VQTA 1GNYA 2VCBA 3JXSA 2VMFA 4QAWA 3THDA 5IYYA 2E26A 5IHRA 2WAAA 3VD9A 3OB8A 4CUCA 2WO3A 5HPOA 2BGOA 3P1IA 4A42A 4DXRA 2LW8A 1SG3A 4D0QA 2E32A 3I3EA 2W46A 4GWIA 3LPGA 3T2QA 3A22A 5J1XA 1JZ4A 4CU6A 3I2GA 3I3DA 4E8CA 4LQRA 4ZZ5A 3CKHA 5G04L 1XC6A 3MUY1 3MV01 3WF1A 1UY3A 2WQ8A 2VMCA 1GMMA 2EIDA 2WZEA 5JXIA 5DQ0A 3FHAA 3ACHA 3WF4A 3LEGA 4ARYA 4ARXA 4P5YA 2VZUA 3C7EA 4AG4A 4XUTA 3OGRA 1PX4A 2VCAA 3C8XA 5DN2A 4OUEA 1DLCA 3ETPA 2YC4A 2VCCA 1W9WA 3OEAA 2VM9A 1HN1A 1NKGA
chains in the Genus database with same CATH superfamily
2A6WA 4ZZ8A 2RVAA 3I2HA 4ASKA 1POQA 1V6NA 2XLGA 1ZYBA 1V6LA 3NO8A 1IG3A 2YFZA 1GP5A 2WFF2 1CAXA 4MLOA 3H8UA 4UFJA 4NHMA 4NRQA 5IVYA 5FZKA 5C9AA 3ZSKA 2DVDA 5FWJA 3ZYPA 4Q4Y3 1HB2A 1IGOA 4RS5C 2W91A 2ZEXA 2J1UA 4XDPA 4D6QA 2O8QA 1LHUA 1WMFA 4KNCA 3VD4A 2IXCA 5FPZA 4HN0A 4XBLA 4N43B 4AFMA 1H1IA 1KXGA 1LAJA 3FC0A 1UN1A 5KXBA 4M0HA 2TEPA 4AQ2A 4BK5A 3BCWA 1BK0A 5IK5A 1TE1B 2BFUS 1YIPA 1D2QA 3B01A 3QLQA 4CVUA 1ZZCA 4JGZC 1JYNA 2EAKA 1PVC2 4CEWB 2NPIA 1DF0A 3ZFFC 2JDYA 2EICA 2HWF2 3RZMA 4YARA 5LZ6A 3F2ZA 1DZQA 1LR5A 2VY0A 3J7NA 3KB5A 4IGOA 5DMYA 2KD7A 3DEMA 2E6VA 4EWAA 1NLRA 1OFNA 1BKZA 1OI6A 4YW4A 1RB8G 3BI3A 1N1YA 3Q8FA 1D4VB 4YYOA 1Z7S1 5FYSA 3WP3A 1QOSA 2P2KA 4I01A 1PHMA 4AVBA 2A3XA 5TSWA 4MYEA 5LBFA 2BUKA 5ERLA 1YFWA 3HR9A 5DDJ2 4BMBA 5IJRA 3WG4A 4A41A 5FZOA 4HKWA 2RS13 2XVGA 5FY9A 5CFDA 3VZNA 3QCWA 1W6PB 2HWF3 4O9EA 2D93A 3VGIA 3POIA 4WBBA 5A33B 3I2IA 3J7LA 2D3RA 3W21A 5C3SA 4D7TA 1NE6A 5JOZA 1EV11 1RUD1 2VZQA 1LB2A 5ACA2 1LGCA 2HBTA 2MPFA 4XXAA 1N3QA 1E5RA 2ZPXA 4LLFA 3SH5A 2IFWA 1MZFA 2RS52 2XKOA 1UWWA 4M4RA 1CD3G 1Y9GA 1JYXA 5DDJ1 2XJSA 2C9KA 2AZ5A 3PUQA 4NVPA 4DMIA 2PHRA 1N3PA 2GAUA 1HXS3 4EZHA 2IFRA 4AQ6A 1VB2A 4D6SA 4FFFA 3ZXJA 3AYEA 1YLLA 3PUSA 5JPNB 4DEQA 3TEWA 3OG2A 1PO21 2VBPA 3EYPA 3AKRA 3S5AA 3VLBB 1HV0A 3RVHA 4IEOA 1MS0A 2WS91 3AC0A 1JZ5A 1US3A 4P00B 3NNGA 3ZXEA 1W2OA 1S0BA 1LEDA 2YUEA 3MIFA 3M3EA 2ADEA 5JIAA 2ZTNA 4QX8A 5L36A 1NXMA 1QXPA 1O4TA 3SMHA 4A6SA 1OPMA 3J4UH 2MEV2 1O7FA 5FUIA 5FBZA 3O7OA 5A32B 4CEYB 4EN0A 2W39A 5DG1A 5SV8A 1O5UA 3CLPA 1N3OA 3RYPA 2F6BA 5FY5A 1OBNA 4DS0A 3JU9A 4PF5A 4DXZA 4Y26A 1A3KA 4FOWA 1F31A 1CX4A 1OH3A 1AR73 3AMQA 1PGL2 1NZCA 4IE7A 1KGYA 3TN92 5C8CB 2W1QA 3MI8A 4I30A 3GXUA 4XFHA 4GJZA 1QJU1 4COUA 1X33A 1FT9A 4DB5A 5FO7B 4LBQB 1NY71 4PI0A 4LR4A 3NAPA 1IPKA 2O0OA 1NLSA 1PO13 1UQXA 2G4IA 3ACFA 3DPRB 4ZXKA 3IIAA 1YFYA 1VE0A 2C24A 4COVA 2JB4A 2QQUA 3LEIA 5A7OA 3WG3A 2JKBA 2WLPA 5I8SA 1ONAA 4Q0QA 4CDQC 4OHVA 1GQGA 1ZVFA 2B39A 4JRAA 4W6YA 4LBQA 1LJ7A 5FYYA 4KGGA 1AXKA 1XQNA 1IQAA 5F3GA 2O14A 4URAA 2NMOA 4N53B 1CIWA 3WNPA 3AYDA 1YHFA 3T2PA 5I93A 1YJKA 3PVNA 2ZX0A 5C3RA 1RXGA 2WO1A 4IXLA 3U78A 3JD72 2OKXA 2SBAA 3Q8CA 1V70A 4LOTA 4Y4RA 1RUH2 2Q8DA 3ATGA 4QXCA 5ANNA 3AZYA 5BNPB 3MW2A 1GOHA 1UX6A 5FMDA 2LM3A 3JB4C 3GF6A 2BVBA 3HN3A 2DTWA 3CJIA 2W1WA 4MH0E 4IE5A 1W3VA 4V1PA 5K0UA 4AEDC 3KMHA 1CGPA 1ZRCA 3H1WA 5J7MA 2AREA 2PHUA 3BVCA 5IK7A 1OQ1A 2EXJA 1GWKA 3ECQA 4B7KA 3ZDSA 2D6PA 2R1DA 2R49A 3MGUA 1O3QA 3GBFA 1MR5A 4IE4A 1N1VA 2ZEZA 3BU0A 2ZZJA 3H42B 1CZTA 3FWEA 3T0AA 5I91A 1OD3A 2WUHA 3L2YA 3IIIA 3UK9A 4E4ZA 4XJWA 2V5DA 1XRUA 4O9GA 4CYDA 2CAUA 2WZR2 2QQOA 3HJRA 4QM8A 4RYDA 1NE4A 3ABZA 1GSLA 1CQ9A 1JYCA 2ZGTA 3DKWA 3R6SA 5HBAA 2LALA 5LATA 3ZX7A 2XJVA 4YRDA 5B2GB 2VO5A 3NJVA 4UXAA 3UGGA 5ABJB 2W87A 2GNMA 4CRQA 1X50A 4DXTA 4YM0A 1F9KA 3RI9A 2DURA 4XOGA 1EYBA 3VBSB 4JHTA 5BNNC 4K8FA 2IVJA 1LOAA 1PGSA 2WNVB 1CR7A 1JZ3A 1R092 3TEZA 3ZPYA 1AYM2 3LD8A 1OD5A 3I54A 5FPLA 1U5YA 1X36A 1Z7S2 1W6PA 1W05A 1GYKA 2EVXA 3KV5A 1SEFA 2RJ2A 2XJUA 4UW5A 5CFCC 1EP0A 2V09A 1S2KA 2QJVA 1V9U1 1LOBA 2WNEA 2W0XA 2QQLA 4TLFA 2QQMA 4OHXA 5A6XA 4DZGA 1HX6A 2RJLA 1KDMA 4QDRA 1NCRA 1W6OA 4JCKA 4NOTA 1ASJ2 3WINE 1UU4A 2Y6JA 2QQWA 5LA1A 4LJHA 1F2NA 2VU9A 1LRHA 3B7MA 4NROA 5AC92 3POEA 1I6XA 2R071 4QX0A 3WDVA 4Q2FA 4LITA 1GZCA 4LORA 2RS51 4PLMA 1ZREA 3ZFEB 4B4PA 3BN6A 3VDBA 4XXPA 3ZR6A 4BIOA 2VNRA 1DQ2A 1WMXA 4IEWA 2QZ3A 4BQ5A 4YVSB 2BV4A 1HQWA 2PQSA 1AX1A 4NJ4A 4XVHA 5D8AB 4RHV2 4Y24A 4E4DX 5C9AC 2BJSA 4HKOA 3JQXA 3UGHA 1YI7A 1TME2 2GN7A 3H1MA 5E16A 3OBTA 4XAAA 3TAYA 2RJKA 4DIQA 2ZHKA 1HB1A 1W8OA 5A7SA 1RMU3 4UFLA 2QKDA 4MX3A 4XJUA 3KQRA 4K6BA 5GLTA 3WW4A 1UU5A 1DQ1A 2MHFA 2HYXA 4PCRA 1C3HA 1DFQA 3N7JA 2XUEA 3D0SA 3LAGA 4YGCA 1APNA 2DFCA 3QACA 4I0AA 3KV9A 1OQEA 2GC2A 3HWJA 5FQ0B 3ZSLA 2D6KA 2CTVA 1AL21 2X5IB 5DPNA 5GM0A 4CCOA 2E7AA 3WG2A 3U10A 2D5FA 2D7FA 3A4UA 3IKWA 3WV6A 5G05L 4NWVA 4ATEA 4XF4A 1LKNA 1RHI2 1RVF2 2W68A 3BPZA 4R52A 3V0BB 1OA3A 4HANA 5A7WA 4CDXC 1VBD1 1SLTA 2WAOA 1BJQA 3H8OA 4ZS2A 1JODA 2TBVA 3E6BA 4QXBA 1SCRA 2Q8OA 3SCHA 2VNOA 3MPBA 4NMIA 1SFPA 3C2UA 4AFBA 5IFTA 2FHRA 3MBWA 4QGNA 1AX2A 5BPXA 5FO9B 4L0PA 3V0BA 5LBBA 1NT0A 2JDNA 5IFPA 1JZ6A 2ORZA 1N47A 2IC1A 1RGSA 4J1XA 3IN9A 4FXGB 1UW8A 2JDKA 1W9TA 1RHI1 1RVF1 3NMBA 4R4ZA 2OUHA 5IAXA 5KHIA 4KL1A 1R64A 2Q4SA 2GP3A 1J3QA 1YO8A 2TNFA 5JOWA 4RR3C 5D1IA 1P8JA 2C0ZA 2WQZC 4QDQA 3FHQA 3POSA 3QBQA 4YSFA 1QOOA 5A7WB 3HQRA 3E5UA 1CAWB 4LHNA 4XPVA 3SH3A 1US2A 2VJXA 2ZOEB 5F3EA 2JWPA 1QJEA 1DIWA 2RR12 2R30A 4QKFA 1K42A 1W6QA 2OQ7A 4IV3C 4XHXA 1R091 1K5MC 2B7YA 5FZHA 3ZXAC 4TWTA 1BBT3 4QKNA 5I8TA 1J3PA 2YG0A 1BCXA 4FPOB 4IV1C 1PNGA 3WUDA 4QB1A 1PM4A 3VL9A 4Q4Y2 4FTEA 3LF7A 4L8QA 1ZZ6A 4QDSA 5GLUA 3ZDVA 2RM21 3VHOA 4IESA 3MV11 1WBFA 2HWC2 2QQIA 3HBZA 2B9UA 3OY8A 2VMGA 3ZFFB 1FV3A 4ZXEA 1FATA 1N1SA 3AZVA 2I45A 4IE0A 5IVCA 1BMV2 2YPDA 3GCXA 3I2OA 3DF0A 3VZMA 2C1FA 5CU1A 4LNVA 1BBT1 2VTFA 1UD1A 3INAA 5FPVA 2VZOA 4Y22B 3OD4A 4A7YA 1I3HA 1OLME 5T3NA 2XBO1 3ZFGC 1OKQA 2WZR1 4YZ4A 1NCQC 2VL4A 5FZDA 2Z69A 3POGA 1AR63 1U5ZA 3O0XA 3MO4A 2ZAAA 2IZWA 4MHUA 3VDDC 5I8YA 3IDAA 1ND3A 3EMRA 1TQ5A 3KF5A 4RQPA 3UKNA 1S0JA 4RGKA 1DCSA 3BOWA 3GBWA 1NXD1 2X8KA 4AVAA 3AMHA 4HVOA 3T09A 5CB7A 3M3CA 3SC7X 4LULA 3SKJE 1COV3 2PQQA 5T54A 4B3NA 3WHUA 5FPXA 1L7LA 1W8WA 2RS32 1BXHA 4PI2A 3WW2A 1JYVA 2HJIA 5KR7A 3TEYA 4MGIE 1JMUB 3TEXA 3TWIA 2ERFA 1ALYA 1M4WA 3PLQA 4GQ7A 5FP4A 2ARCA 2OXBA 4J6GA 4HT1T 2A6ZA 2PLV1 2HEVF 2RS33 3DPRC 4YG6A 1UKGA 3Q8AA 2ZABA 2BWCA 1NAEA 5FP3A 3WNOA 1TZOA 4C0BA 1MS3A 4Y1UA 4F8AA 3E97A 4HG6B 5KHKA 2VZVA 4AFDA 4CDQB 4H7MA 3K4AA 3OOXA 4RFRB 1PMIA 5A1LA 4F3JA 1DLLA 3C7OA 3RNSA 4XZUG 1QQP1 5CIRA 3WP5A 1OOPB 1HB3A 2A5ZA 1PIV1 1VB4A 4Q5OA 3HOBA 1UY1A 2P3IA 5EZWA 1CVNA 5FK8A 3MIHA 3H7JA 4K7JA 2IXHA 4OZOA 4AGVA 2DCZA 4ZU5A 1BVVA 1XU1A 2R041 3ZN6B 3IDBB 5FV3A 4LO8A 3TNPB 4QHOA 2PHLA 2VCBA 2VMFA 2JXAA 1DHKB 1R081 2Y33A 4WVWA 5CFDC 5IYYA 1G9FA 2I74A 2WAAA 4CUCA 4LBLA 2DVBA 4OQ8A 1HW5A 2LW8A 3JUUA 1G6NA 2E32A 3K2OA 5DG2A 3O12A 1EV12 2N7GA 1NA1C 2GC0A 2DTYA 3AL5A 1BEV3 1W6QB 3IWZA 1DQ4A 1RUE2 4ASLA 3O0WA 4Q4W1 1V00A 5J1XA 1JZ4A 3THTA 4L2NA 2ATFA 4AGRA 4XMIA 1L3JA 2IVIB 4CDUB 1NQDA 2BWAA 2JECA 3GZAA 1ZBA2 1VJ2A 2RS53 4LQRA 5HCAA 5IVVA 1H2MA 5G04L 5FZFA 2ET7A 2VE1A 1VMFA 4DFSA 2GH2A 1VBD2 1UY3A 3NNJA 5FLHA 5FTTC 2XH6A 2CU5A 1BEV2 5T5JA 1NQJA 1RUI2 5BNOA 5FZ3A 1IKQA 5K4LA 4B8EA 1XBFA 3O1OA 4WM7A 2Q30A 3NAPB 4PDWA 2VNGA 5DQ0A 5JXIA 3FHAA 4ARXA 3X29B 1LHVA 5I0RA 2WSVA 3M3QA 4IEPA 4D7SA 2LUWA 4XUTA 3AP4A 2YV8A 2RMU1 1AX0A 3VBOA 2Y60A 1WCKA 4M3CF 5K8SA 4XIOA 2Q0AA 1LTEA 1QWRA 2UYBA 1GNZA 3NV3A 4GJYA 4QU2A 1B35B 1FOD3 3EO6A 3OEAA 1HQLA 1FMD1 1ZM1A 5FUNA 2CV6A 4A45A 1XNBA 4FPGA 3WUCA 2QVSB 4IGPA 4D3WA 2XJQA 1SLCA 4YM3A 4KH9A 4LUMA 2HBUA 4OYUA 4LKEA 5DAQA 4JZRA 3VUOA 3ZYJB 4DUVA 4AAXA 1H8TC 3DUIA 2D3SA 1FPN2 2SLIA 2C9AA 5GALA 5C8WA 2K46A 2Y6KA 3VBFC 4F7ZA 2Z2SB 5JI7A 5A3WA 4BPZA 3AKPA 5T52A 4JGYB 1ASJ1 3ZSJA 2BDRA 1Y9MA 3M3OA 2VPVA 1MZ6A 4K1YA 3W58A 4WM8A 4QPWA 3N9NA 1AJKA 1KS4A 3H8XA 2ZKNA 1EAH2 2ZHMA 2HWB3 4Z2WA 2VZSA 4Q4X2 5E89A 4KGQA 4HL0A 3WHTA 5ABJC 5B4XA 5EQUA 2O1QA 3PTRB 1PM7A 2P3KA 5FLIA 5BNNB 4KQ7A 5J96B 1YXWA 2DU0A 4Q29A 3RG0A 5CG8A 5A7PA 3VL8A 2J42A 2XVKA 1QXRA 2VZ3A 1O3RA 3APBA 4RL7A 4GMP3 1OQDA 2VAUA 3OPTA 3ACLA 3AFGA 3ZFEA 3USUB 4BXFA 2XWJB 3CQOA 3P5BA 1E57A 2Q8EA 2QQNA 4AEDA 5K0UC 3O1MA 2KA3A 1V6JA 1SLLA 1YC61 3BUCA 1UL9A 4CDXB 3LOBA 3DN7A 1V9U3 1MEC3 3ST7A 1VRH3 1OT5A 4S2DA 2VTXJ 4LEJA 5A6ZA 3W5MA 2Y34A 4XMAA 3B00A 4NHLA 3H8RA 2HWE3 1LOEA 3LSDA 1L7RA 3MUZ1 3RS6A 3W20A 3OPWA 2Z5WA 3R4UA 3GZEA 3SXWA 1U5XA 3PL0A 1H1AA 4AFAA 3SITA 3MIGA 1EY2A 5ANQA 4BCUA 3I3MA 1RL3A 3V64A 4EYUA 1HB4A 1ND2C 1VMHA 4XJ8A 3N4MA 3JBG2 4YFZA 4RR3A 3B02A 1LECA 2DF7A 3N9MA 3POBA 5JI9A 1KRIA 3N9QA 5JOXA 1XE7A 3FUQA 3LDKA 3VBSA 2A71A 3OGJA 5FYCA 4EN7B 3GJBA 3PIJA 2WT1A 4GWJA 4IV1A 2MEV1 4QT6A 4JGYA 4QPGC 1SMVA 4HK8A 1GP4A 1LHOA 2OZJA 3ZN5A 5FPAA 2DVFA 4I0WB 4AYUA 1CX1A 3VDAA 1AZDA 5A1AA 5JDBA 2HWE1 3D4KA 5A3TA 3FZ3A 3BODA 1QNWA 1OA4A 1OC1A 2CDPA 3KS7A 4MUVA 4JDMA 2FDGA 1JOJA 1B09A 1U5IA 3PUAA 3ORJA 4HVRA 5LA2A 3IMMA 2E7QA 1VBE3 3ACIA 4JHZA 2JDHA 2YC2A 1I5ZA 3LFIA 2RR11 4CDUA 1PO23 1QHDA 4ZKTB 2RG4A 5BNPA 2JDAA 4NUBA 2BQPA 3CEWA 1C1FA 5EWSA 5FKBA 3M1HA 1MS5A 3HN1A 2QQKA 4ITCA 1PZ9A 3TNQA 4HLTA 4FAGA 4GMP1 1YFXA 2VUDA 5JR7B 2XPJA 5FZBA 1J3RA 1W03A 3WF2A 4BQYA 1ND3C 5A70A 3ZFGA 4IGQA 5GZEA 3VBRC 4XF0A 3ZFGB 2KR2A 5L9RA 1UMHA 2HWC1 1I9RA 2ZEYA 2NQYA 4G4FA 1OSGA 1YUDA 4NO4A 3ES4A 4QQ2A 5FYIA 5F6KA 3UGFA 4SBVA 5JOYA 3U4XA 5J98B 2PHTA 3E6CC 2HEYF 1ZBE3 4BQ1A 2W2IA 3DXUA 3GJAA 1NOVA 4WV8A 1UNBA 4GA9A 3MFAA 4XFGA 1DQ6A 5DZGA 1IPSA 4K40A 5A3MA 1JUHA 3WP4A 5I0SA 3DPRA 2D6NA 1ZA7A 1YQ5A 1MPXA 2ZZQA 4FQZA 4JDNA 4MXWA 4PQQA 4CCDA 4CU9A 3O0VA 1PO12 4D69A 2WO7A 4LO6B 1QJU3 1RUOA 2WNUA 4GMP0 1PNFA 1DG6A 4Q4X1 3BOPA 3PUHA 1V6KA 3UJOA 2JG8C 1QU0A 1VBB3 4P9WA 4ZU4A 5AFEA 3B3QE 1C8M1 3AVSA 3QH7A 4E2GA 5A3NA 4K3UA 4RSUA 5EP9A 4IV1B 4B7EA 4JGZA 1D4M1 2VUAA 2JEMA 1UZ0A 2ZS6B 3FX3A 4Z92B 1J1LA 4E2QA 2VUCA 5E8AA 3VBHB 5LEJA 2D40A 1DZTA 4FCAA 3VDCA 1DGWA 2DCTA 1POV0 5HXMA 3T0DA 1W06A 2WQ4A 5CA6A 4OFGA 3NJXA 1E5SA 1W6OB 1LGBA 4BE3A 4MOAA 1SFYA 2XHNA 4I3PA 4EZ4A 5F7UA 5DUUA 3W59A 3WF3A 1G7YA 3OUHA 2XVLA 3HQXA 1ZRFA 1SACA 4H2AA 4MVTA 4AE2A 3P3NA 4ZHNA 2QQPA 3LEMA 3Q8EA 2D3PA 1GZTA 4UI9L 4AL9A 5T5PA 1WLDA 3VDDB 4DUXA 2JG9C 2DWRA 2YFUA 3OUJA 4NIDA 1EUTA 1R1ZA 4AHWA 4COZA 3PMSA 2VXRA 1UY2A 2WNVA 2Y6HA 3O1UA 3I49A 5BV6A 2R063 1PVXA 1JZ8A 4CXXA 1Z0HA 1Q5OA 3U4SA 3MICA 3WQBA 1ND2A 1QGLA 4CEYC 4LE4A 4JC1A 1WW5A 4KWLA 4QQHA 1O4ZA 2O8OA 1DBNA 4LUKA 1RUD3 3B94A 4JVAA 4LBNA 5DAWA 1O3TA 1NYWA 2B4KA 5EV7A 4TXWA 2PAEA 1AR83 1F35A 1X7NA 4BMEA 2HWF1 3NJYA 4IETA 4HSJA 1W8ZA 2WWJA 4QPGA 3AZWA 2JICA 3IPVA 4RGAA 2E53A 2H0BA 1LENA 1OPOA 2RS12 2P5BA 4JDOA 3RRDA 3TN93 5CVRA 5KC6A 4PDWC 4JRLA 5JZGB 5DAXA 1SBFA 4FQ4A 2JD4A 3IDEA 3NKGA 1BMV1 2Y6LA 4ES8A 3IM0A 2VMHA 1MEC2 1RUG2 4BQ4A 5JWPA 1T2XA 1ZX5A 2VZRA 4Y22A 2LTNA 3P3PA 4XE9A 3T1MA 4HONA 1LHWA 2VZPA 1PIV3 3S7EA 4CUGA 4F83A 5C5TA 1RUC3 1C5IA 3THPA 1I1EA 4NN0A 1KJLA 1UIKA 5F6LB 3ZXKA 2HKXA 1XYOA 1PZ8A 1B35C 2BEOA 4MADA 4N53C 3WCSA 4A7KA 2ZX1A 2AUYA 3WVJA 2XR4A 4GULA 4EN8B 2JDPA 1O5LA 5FZEA 5IATA 1LU2A 1CAWA 3D0JA 2OPKA 1MZ5A 1DYOA 3AP9A 3WSOA 3TN91 4A3ZA 1D7PM 4QQLA 3CMGA 4FFHA 3W9AA 1QJU2 4UFKA 1ZZBA 1OHFA 2D6MA 4XACA 1L7QA 3RQ0A 5C3PA 4Z07A 3GBGA 2J22A 3LWCA 4BB3A 2GZWA 2PLV2 3E5XA 4BIFA 5FJHA 2VVDA 5FR3A 2QE3A 2WYFA 4FPEA 4JX0A 1WD4A 1OKOA 5IAVA 1WCQA 3PU8A 3RWNA 5IVBA 1S0CA 5A80A 3OYWB 3WDUA 1ZRRA 1WGPA 1MS4A 1QJX3 2R7EB 2OZ6A 2R061 4EWDA 4INDA 5JCTA 1UPSA 1LCLA 4L99A 3HT1A 1K12A 5C8CA 3KT4A 2A6YA 4RHV1 2JG8A 2R0HA 5CADA 1SLAA 4LHSA 1CONA 2XBO3 4AGGA 2BRTA 2EALA 2VW2A 4E4HA 3NQHA 4BHPA 5F5AA 1V6MA 1RUI1 3OD0A 1UPIA 5E1RA 4LLOA 1WMDA 5I0UA 4TTGA 5KXCA 4XUOA 4YVSA 4R9DA 2GSYA 2YDEA 2G19A 2W9XA 5GLZA 4FFGA 1GFF2 1NY72 4YW2A 5FZ6A 2ZACA 4BQ2A 2VZ1A 3LDRA 2RM23 3KCXA 5LY2A 2GP5A 4XZPA 2D6LX 3SLIA 3N7MA 3LA7A 3GGLA 4XEZA 4G9SB 1LULA 1W8TA 4DNYA 2V73A 2LRPA 3VHNA 4CU8A 1LNSA 1R093 2EXHA 1ENRA 2J1EA 3C7GA 4ZY9A 1FI2A 2CGPA 2B5HA 2QBXA 4LXLA 2WO2A 5GLVA 1WW6A 4QWNA 2QDRA 1NG0A 3ZO0B 4UF0A 4Q4X3 4AF9A 4BJ0A 1W0OA 1H8VA 1YWKA 3DYPA 2Q5TA 4YGEA 4JGYC 1ND2B 3HBKA 1LU1A 1RXFA 3R4DB 3WX5A 2WLQA 1GNHA 1CWPA 4HBNA 4WM7C 1C1LA 1DGWX 5F39A 2P6CA 2PAKA 3BKZA 5FY0A 2ARXA 5J3UA 4Y33A 1AYN1 5FREA 3KM5A 2E9QA 3MIDA 3T4VA 1NCRB 4CP9B 4B29A 3H50A 5AFBA 2VOTA 3OGVA 2EIEA 1YQ8A 1EAH1 1DU3D 4KBBA 2Q8CA 4QPYA 3AP6A 2RHPA 3AKSA 2UWBA 1OUSA 2XOMA 4MO3M 3NJZA 4NRPA 3KV4A 1G9DA 2W1SA 5FPUA 1RJ7A 1URXA 3NV4A 1XE0A 5APAA 3RPQA 2WZ8A 1GQHA 3VBRA 2Q1FA 1DGRN 1JTZX 4GZ9A 2PA7A 4A44A 3J8F1 4Q1RA 1VBE1 2CWMA 4X6RB 2OVUA 4Y1XA 3SKVA 1B35A 2D43A 3HEIA 1NX9A 2CGNA 4UBGA 3I3BA 1VBA1 4JAAA 4QPIB 1IS3A 1CJDA 2XXZA 4LBJA 2K0GA 1GZWA 4WM8C 1BLZA 3AYAA 3ZPOA 1QOTA 1TMF3 2AC1A 3RWKX 1J84A 5DXDA 2VOWA 1O8PA 3OY8B 1TME3 1MQTB 3EJKA 4AEKA 4YM1A 1VIWB 2DVGA 1RC6A 4HFSA 4R9BA 2VMEA 2DVAA 3RI8A 5T55A 3AZXA 4AW7A 2Y6GA 3DGTA 1TEIA 5FZGA 3HVDA 1SHWB 3VBOB 4M3CE 4N9IA 3WT3A 5C3OA 4FPJA 2PMWB 3NNLA 4FT8A 2WRAA 3CO2A 4YG0A 5FXXA 4D7YA 4I3GA 3KHCA 1ZRIA 1CJPA 1MVQA 3CDZB 4S2FA 3CJXA 2XL9A 3MDPA 5FZ7A 1YYNA 3VBHC 2JX9A 3V0AB 4UYBA 1TVGA 1K5MB 5LB6A 1VRH1 5FYZA 4E27A 3M70A 1A8MA 1GNYA 5I0TA 1VBC1 1HRI1 4IL7A 2DFBA 1W04A 4QAWA 4C1XA 4WVMB 4U2AA 3WY6A 1Q8QA 1RUH3 5FZ0A 1QDCA 4V2VA 1FYUA 4BWOA 1HRV3 2WO3A 2JG9A 3P1IA 1RUJ3 1W8HA 4UBHA 5JIUA 5FWEA 4GWMA 1Y43B 4EN6B 3RZZA 1ODNA 3POJA 4H3WA 4QGLA 1Q8OA 3LPGA 5A3UA 3T2QA 4AI2A 1WMEA 2FZ1A 3SCFA 1W6MA 3R05A 3E5QA 1FV2A 5FYHA 1OOPA 1ZZ7A 3I3DA 2WWSA 4O61A 3OF1A 2Z79A 5JVVA 3ZYGA 3O5SA 2DUQA 4E8CA 1PGL1 1QIQA 3CKHA 2XKPA 1XC6A 1NLQA 3FHIB 4GWNA 3MUY1 1UYPA 4MV2A 3QD6A 5SV5A 4CCCA 2BU9A 2BVVA 5H9RA 4CA9A 2B45X 3VB9A 1TMF1 2DYCA 5J09A 4CPBD 1FMD2 1XU2A 4GH4A 1FNYA 2A3WA 5J37A 2R072 1KQRA 4EJRA 4P5YA 4UFHA 5D2AA 3U11A 3C7EA 3RZHA 1LOCA 1W9FA 3ZYRA 2WFF1 3OGRA 3TB0A 4H55A 3C8XA 4GB33 4MGTA 1VRBA 1W2TA 4CTEA 2F4LA 4IEYA 1DLCA 4XFAA 4XTPA 2VCCA 4P9LA 2X5IA 4CP0A 4RQPB 3PTYA 4OULA 3N9LA 2NM1A 2VM9A 5FZCA 4EWEA 2B9VA 3ROUA 2FDFA 1UZZA 5CYYA 3I8TA 5FMCA 1DQ0A 1D2SA 4IUGA 1SLBA 1OVSA 3ASIA 3K46A 2XMLA 2XQXA 2ZKLA 5F3CA 1VBC3 2CWSA 2RDNA 4X8NA 1T6BX 3IT8A 4Q4V1 5CAZA 1VAMA 5GJ6A 4K9SA 1W8FA 4X8PA 4QB2A 1SZBA 3CF6E 5HCHA 1OLQA 3RSJA 2BBVA 2D5HA 3E6DA 5GZCA 2VVEA 4XJ9A 2YGMA 5A33A 4K21A 5FZ4A 1JOPA 3VZJA 4DINB 5AC91 1W90A 4HSLA 4CXYA 5GZDA 5LEKA 4YFWA 5CFDB 3OBZA 1ZZ8A 3WR0A 5F3IA 3JCIA 5JSPA 1NUKA 4AAPA 5C7GA 3B93A 4HPKA 1FAYA 4AQSA 4YPJA 2LROA 2W08A 1F5JA 4NAMA 4XHBA 1G86A 1KDKA 2GDFA 4BM8A 2GMEA 1NA1B 3UT0A 5FUPA 4BLIA 2XGXA 2ENRA 5KXEA 1UZWA 1JU3A 1WCUA 3WDWA 4MGSA 5IW0A 2DU1A 1OLRA 2WJSA 3ZIXA 1HLCA 1PIV2 4FXKB 2CGOA 1UOJA 2FCVA 2R042 4FPFA 4Y1YA 1Q43A 1R083 4B1MA 2ORXA 3IAQA 2Z4FA 3WZ1A 4KU8A 1E5HA 2PELA 2R043 5FDBA 1EUUA 5FAXA 2X29A 2XJTA 1HRI2 3L2HA 5DUVA 1PMHX 4ZS3A 4N43A 3A7QA 2HH9A 4R9AA 5IT6A 3AX4A 4LIVA 1AYM3 2FMYA 4P08A 4O65A 4ET7A 1HXS1 3ZXDA 1Q8PA 2WABA 4JKLA 2BPA2 5KBFA 2ZGMA 4Y20B 2WNUB 1XNCA 3LB9A 4C0HA 4GH4B 1IS6A 1GICA 2CDOA 3WDYA 4AK3A 1D4M2 3AK0A 1EAH3 1S0IA 3N35A 4XTMA 1XYNA 3I2JA 3CHXA 3JBG3 4OUMA 3ZXFA 2UU8A 2OA2A 4QX2A 1QH7A 3T30A 3AYCA 2BTVC 4S2GA 4Y20A 5GZGA 1DGRA 2DCJA 3ME2A 4IV3A 4Z1VA 4PIYA 1GKBA 1HDKA 5CFCA 1K5MA 5A3PA 4YZ2A 5C9AB 5C5UA 3VBFB 3FMGA 1JU4A 2D44A 3MLLA 1W0NA 4LE3A 5EJZB 2TUNA 3RYKA 3DV8A 1UXZA 2ZMNA 2JB8A 1NCRC 4HN1A 4Q0PA 4UW3A 4DY3A 2DCKA 1V6IA 1XB9A 2ET1A 5L7OB 3BIWE 3D8CA 2B42B 1IQDC 1RITA 1GOFA 1IS5A 5C6CA 3MPPG 1GOGA 2HWD1 1Z78A 2VQ0A 4HPKB 1BYHA 3UV9A 5IVJA 4ATFA 2X5IC 1VP6A 5JPMB 3S5QA 4KU7A 1WA4A 1HJGA 4GB32 2W52A 1NCQA 4XABA 4XFBA 5FO8B 5HI0A 1SDWA 1V0AA 2ZX3A 1VBB2 3DL3A 2J1SA 2CSGA 4YG3A 2ES3A 4DOUA 2WSUA 1VAKA 1QJY2 2BGCA 2DV9A 3MYXA 4K1ZA 1GWLA 2ZGSA 4Q4V2 4JKKA 1F5FA 3BTAA 2VW1A 3FL7A 3D82A 4UOJA 1UOGA 3EB7A 2OW4A 3OGSA 4FPLA 4FPKA 2IWGB 1AF9A 4PIXA 1GBGA 5FZ1A 5C4WC 1RUD2 2PAMA 5FXZA 5FXVA 3ZYIB 1UX7A 3POWA 4CDWC 5LY1A 4CUAA 2A1XA 4RHV3 2QQJA 4KWJA 3IAPA 2W5FA 2V4VA 4FBFA 1MQTC 1VBC2 1CIYA 3SCGA 3LPFA 3TBDA 5FY7A 5ABJA 4ONUA 1UU6A 3AJYA 1AR91 4A2UA 4MZUA 5CKQA 5A1FA 5LRRA 1UF2C 2JIJA 1JXNA 2QQVA 4XYXA 3EQEA 5EFUA 4NIIA 3UL2A 1O6UA 4CSWA 4HZFA 2B8MA 3VBHA 3POFA 3RGBA 4DY5A 1CPNA 1C28A 2GMPA 1WCSA 3H3ZA 5KHHA 4AXOA 1UXXX 3B9IA 3PUIA 2EIBA 4OUSA 4BYYA 1PO22 3LKJA 4XUPA 4D94A 3RYRA 3GNEA 3EHKA 5C33A 1YQ2A 3HIFA 3KVAA 3BPSA 2AR6A 3UJQA 4XJAA 5CBLA 3BTZA 3OCPA 5B4NA 1RJ8A 2XBO2 4BQWA 2WA4A 3I2KA 1SQ4A 3H3UA 1RUC1 2ARBA 2HEWF 4UW4A 1GLHA 1JOBA 4JGZB 2HWD2 1JHJA 3U14A 5ACA1 5LRSA 3ES1A 1C8M3 4XW3A 1S0FA 1JYTA 5GKAC 1VBB1 3WQ0A 2L9LA 2IXLA 1PVC1 3WNMA 5K7PA 1N1TA 2ZMKA 1NCQB 3ILRA 4M4PA 3SEEA 2Q1ZB 4WM8B 4NPRA 1W8UA 1GUIA 2Z42A 4W65A 2R062 2ZGOA 2FBEA 4W6WA 4XIKA 4LTAA 5IVFA 3H9AA 1OF4A 4Y5TA 1RMU1 5LBEA 3SQOA 4DXSA 2Y38A 2HWD3 2ZAHA 3VD3A 3LGRA 3SHRA 5FYTA 4FP2A 3BYWA 3I2FA 3VHRA 3VD5A 1HN0A 4FPYA 1ENQA 1AR81 2WC2A 3GHMA 1W2UA 5BYNA 2WN2A 3VBOC 3LA3A 1BZWA 1LESA 3KT7A 1ZNPA 3LOIA 3HNMA 4RGGA 4E4SA 2WBKA 5JXJA 5FP8A 1POV3 2XDVA 4NHKA 3K77A 3LDBA 5FIXA 4NIGA 1H4GA 1WBLA 2VG9A 1MS8A 2DBIA 1FXZA 3CU7A 4LBKA 1AHSA 3V0AA 3MIBA 1W9SA 2XJRA 4COYA 4YVWA 1AYM1 2F17A 2YGLA 3FE5A 1G9CA 4XQ4A 4AEJA 2DUPA 1W8NA 2JDUA 2VXJA 3J7MA 4M3CB 3T08A 1VBE2 4RQPC 1Y3TA 1QNYA 2QTWB 1SBEA 2DBNA 2GN3A 3DYMA 2C5DA 3ILFA 3RJ2X 3U07A 3ZKYA 4E8DA 2YU2A 5F1RA 5CKMA 2IXJA 3VKMA 3VBFA 4A6OA 4XBNA 4JQTA 2AYHA 5JR2A 5F8PA 2GH8A 1JW6A 4KG0A 4QHBA 3ZR5A 3AZZA 4YZ3A 5JSRA 3CNAA 5FZIA 5F32A 4XURA 3U37A 4QX7A 3WNLA 4EN9B 1SDDB 3AVRA 4LPLA 1OA2A 4GIQA 3LE0A 4G3YC 3I2DA 4P9YA 3S57A 2DCYA 2JE8A 1IPJA 5A7QA 4BISA 3S0MA 1CAUA 5FFOC 5FXWA 1COV2 2MNGA 2YB7A 5FYUA 4J1WA 3KHBA 5FZAA 4MGKE 3VKFC 5C71A 4XQWA 1W2AX 4COWA 4KMQA 1KJRA 2VQAA 1C8M2 3A23A 2OUJA 5JMOA 1JHNA 2BBAA 2EAAA 1DDLA 4RD7A 4Y3OA 2VVFA 4LOSA 4OI4A 4GKXA 5IWFA 1XNTA 3NRUA 3ZN4A 1ODMA 2AEZA 2WINB 4N9HA 5AC93 4BDVB 2Y0OA 2ZHNA 4LHLA 5FBJA 2WKKA 1OFSA 1CN1A 3OUIA 1CZVA 1HIXA 4MGQA 4PHZA 3GZTB 3IMNA 3G7DA 5FMOS 4YM2A 3VKOA 4CCJA 3WLUA 4NR1A 3AJZA 1QEXA 4W50A 1MEC1 2CAVA 5E88A 5JZGA 1H2LA 2W94A 1KITA 2AEYA 3VN4A 2QUOA 3D3AA 3PVEA 4HETA 3NV1A 5EJ3A 1PMJX 4WZFA 1H1MA 4LO7A 4UF0B 1J83A 5AVPA 4ASMB 4GAZA 4R9CA 4CP9A 4QKDA 5FZMA 2RDQA 3BTXA 4XFCA 3T2OA 2GALA 3M3IA 4AI9A 2KM2A 3ALQA 4QXHA 4HMZA 1ZBA1 1SPPA 4BLJA 3RJRA 1UZYA 4KWUA 1JYIA 1K3IA 3PNAA 3SEPA 4M00A 1AUYA 2AENA 2E31A 2FCTA 3UNPA 4WVVA 2HWB1 1H4HA 5HCBA 2WWUA 1CAUB 3ILNA 4XDOA 3BIEA 3V65A 3RZJA 4GH4C 1PK6A 2JENA 2W95A 3I59B 3FLPA 4NHYA 1GANA 2ADDA 2Y8KA 4YZ5A 1R1A3 2VR4A 1H8TB 3T3YA 2FDHA 5DAVA 2OYZA 1HV1A 1LEMA 1QY4A 3ITQA 1H2NA 3JD71 4PF1A 2VOVA 1HJFA 4XCBA 1QJY3 4UAPA 2WL1A 2VZTA 4GB31 4P9IA 5M0TA 1F8VA 2WZPP 1H6XA 1ST8A 3AMNA 1QH6A 2EA7A 3EBRA 1VALA 4JTNA 4YVWB 4BXSV 3TRSB 1RUG1 4NIHA 3MF6A 1VRH2 1AR71 1NZIA 4PBOA 2W92A 1S55A 5DAPA 3MLKA 3C3VA 1D0HA 4Q0VA 4AFCA 1O8SA 3ACGA 2XONA 3WNKA 1R082 1YJLA 4BQXA 3Q9OA 1MACA 2J1RA 3THCA 4XUNA 1W9YA 4QB6A 1ZA4A 3ZYBA 4HVQA 2VOXA 4NIAA 3P6BA 1LGNA 5CEHA 3B9CA 2H6BA 5EXOA 4AVCA 4LA2A 3WDTA 1HRV1 4LKFA 1K5JA 4OI1A 4CZSA 1JZ7A 1G9BA 4P9JA 2W1UA 5FZLA 1W6MB 4Z2AA 4FOVA 3N3HA 1CZSA 1FPN1 2VCMA 4N53A 3SH4A 4QM9A 4Y1VA 3PURA 1REDA 2VTXA 4H14A 1X9TA 2VH9A 4XCAA 1SBDA 4XDQA 2WA3A 2WFPA 3B5LB 1BBT2 3CL1A 3LFMA 1F4AA 4XF3A 4LA3A 1HXS2 5BNOB 4FI9A 4W4ZA 2VNVA 2WNUC 2BGPA 2ZGNA 3LA2A 1RUH1 2UWCA 1WA6X 2YY1A 2ZBJA 1WW4A 3E1F1 2JJ6A 4IEZA 4UWDA 3H1YA 3RDIA 2JIGA 1S2EA 3J8F2 4P9GA 4K20A 2RDRA 4BZ4A 2VGDA 2A6XA 3HNYM 1WLCA 4OLLA 5C4WB 1JYWA 3M4FA 4P02B 4CCKA 2HLEA 2OX0A 2PTMA 2J1AA 3HMYA 3TYJA 3CBNA 2CNAA 4IERA 2WIIB 4Q1PA 5JMCA 2NZ9A 5L9VA 4P9XA 3KV6A 3PVBB 3ZFEC 4LIUA 2BOIA 4AI8A 1H9WA 2AH2A 2BNMA 3LIGA 4J25A 4V2WA 1A8DA 4WVMA 3VZKA 3ZMOA 2BERA 1ASJ3 4RS5B 1LHNA 2E51A 1GQPA 2Y26A 2YC0A 3CJIC 3H3LA 4QPGB 3FFQA 1ULCA 4MSVA 2A6VA 1RUF3 2EXKA 3I3QA 4BA6A 2Y0IA 1UOFA 1VBA3 2G9GA 2ZGUA 3PIGA 1RUG3 2VQTA 3WP6A 4CU7A 1AVBA 2V5YA 5L7OC 3N7LA 3U75A 4PJYA 3THDA 4N43C 1TME1 3FBYA 4LHKA 4QX5A 2E26A 4C8DA 3GCWA 4MGZE 5IHRA 3MW4A 3VD9A 2IUWA 3NNFA 1ZRDA 3D6EA 5HPOA 4ZU7A 2GNTA 3KSCA 3JD73 5K9YA 4UFIA 3U0ZA 1GWMA 4KBZA 4D0QA 1MS1A 4EQVA 2YXSA 3N9OA 1R1A2 2W46A 4GWIA 2QFEA 2R0FA 3A22A 2BNNA 4OQ9A 5F5CA 3JQWA 4CCNA 1CAVA 4CU6A 3J8F3 2P3YA 4CE8A 2ILMA 2RMU2 1OLMA 3R4SA 4XETA 1WWYA 3VBRB 2PLV3 2RS31 2VBDA 3MV01 2OIIA 3WF1A 1J58A 4CEYA 1ULEA 4YW7A 4YGDA 5A32A 4OI0A 4KG8A 2WQ8A 2VMCA 2XQRA 4CDWB 3AP7A 1VLNA 1GMMA 2VUJA 2GMMA 5GLWA 2EIDA 1AYN3 2WZEA 1Q3EA 1X82A 2VBBA 1UOBA 4ARYA 3ACHA 3LEGA 1W28A 1UO9A 2VZUA 1XNKA 1CESA 3N36A 3U1XA 1OVPA 3B69A 4CP2A 1WCDJ 2GNBA 2ZGLA 4MGYE 5DN2A 4PIZA 4YW3A 1AR62 2BNOA 3USUA 4OUEA 1ACCA 4YZ1A 3O1PA 3ETPA 2YC4A 4NPMA 4Q4W3 1W9WA 3PJYA 1BEV1 4BU2A 1S4CA 5HCFA 5L73A 2BW8A 4YLZA 5FYVA 4JQRA 5CZKA 5HV4A 1NKGA 2LS6A 5H9PA 5C70A 2XB6C 3A21A 1H9PA 4BK4A 1V6OA 3OBAA 2NYYA 2ZGRA 3V56A 1U0AA 4IV3B 1PVC3 5LWBA 2BYVE 4QD2A 2VC9A 4IEXA 2PHDA 2RE9A 3WNNA 2A75A 5IUQA 4LKDA 2P4EA 4XBQA 3KGZA 2AACA 2ZEWA 3K75B 2QCSB 1XJAA 4NHXA 2V4AA 2X53S 3PHMA 2HWB2 4R4XA 1WZXA 5C4WA 1BK1A 1RUI3 1DZRA 1OH4A 2ZHLA 3ZSMA 4AOCA 4CCEA 4OHWA 4FFIA 3IB3A 4TYSA 5LA0A 1UKRA 4CEWA 2X05A 1QQP3 2UWAA 2J1VA 3L9JT 2EF6A 1JZ2A 2XLFA 1GP6A 4LT5A 4N8MA 1DYPA 1RUE3 2A70A 2Y64A 2IXIA 4SLIA 5T50A 5F9TA 2FCUA 4NWWA 5L9BA 2FDIA 1O59A 2A3YA 4P14A 4AI1A 5C8CC 2NN8A 4IEQA 5F5IA 1AR93 1UMIA 2DDUA 4CPBA 4Q8KA 5F5QA 5LCWL 3WF0A 1HKDA 3HNBM 4OMCA 1QJX1 4QX3A 2VECA 3S30A 3LSEA 3VKLA 4FSJA 1POV1 5AVAA 4ORFA 3AP5A 3ZM8A 1CAXB 4FTBA 3MW3A 2D97A 3OEBA 2X10A 3PMEA 3OJBA 5IK8A 4FTSA 1A78A 4PDWB 4CXWA 5JZGC 3CZUA 3RZGA 2D6OX 3RFRA 5FYBA 1AR61 4Q27A 4IDZA 3OGGA 3T1LA 4AI0A 4OI2A 4OZXA 2JD9A 5HXVA 3O1RA 3WW1A 2VMDA 1AL23 5D8AA 5JXHA 5FYMA 5T5OA 3WNXA 1NA1A 1C8NA 4EV0A 1RIRA 2GNDA 4XJZA 5CKNA 4C91A 2GC1A 1QQP2 4NE9A 3S7IA 1RUNA 2YBKA 5LK5A 4LK7A 2WN3A 1TMF2 3FN9A 4QPIA 2FMDA 4O7XA 2YYOA 3NW4A 3OPZA 4AEDB 1PK6C 1Q56A 2WT0A 4RN5A 1ZBE2 2D98A 5A3OA 3ZN6A 3ZLIA 4UW6A 3C7HA 3KQ4B 4PLNA 4QHZA 4EE2A 5LW9A 3K3NA 4AHXA 2YHJA 3I97A 1UYXA 5FPBA 3DECA 1KFXL 5IVEA 4Y5SA 2RDSA 1ULPA 3K3OA 1XNDA 1J1TA 3EXUA 3VBUC 1WUVA 1UAIA 1X8EA 2ZXQA 4YVWC 2P6HA 4FAHA 3R0RA 5J48A 4FPHA 5EHDA 5FZ9A 3VD7A 5BUVA 4MG2A 3VDDA 3AL6A 1O3SA 3J7HA 1XSRA 1UCXA 1RHI3 1RVF3 3AKQA 3ZMNA 2ETEA 5J36A 4I2OA 1VR3A 1G9AA 1RUE1 1O4YA 2ZX2A 4DPNA 3IBMA 1AXZA 2J1TA 4HOOA 4YW5A 3FLTA 3NL1A 4NPLA 1QDOA 3ZYFA 4RA0A 1QJX2 5JXGA 1OMIA 2YROA 3J26N 1BHGA 3DCQA 3NVCA 4L97A 1RINA 4XC9A 1ULDA 2ZCWA 2C26A 4Q26A 5EIYB 1H0BA 4JKMA 1AR82 4HK9A 4RS5A 2VMIA 1UMZA 3AXDA 4AZZA 4MXVA 1WLWA 2QNKA 1VBD3 3GYDA 1XNAA 1H6YA 2A7AA 3G6JB 2I2SA 4PT6A 1D4M3 3FFZA 4B4RA 3WOGA 5BY5A 3Q8BA 1W0PA 1W39A 2PHXA 2WT2A 2NP0A 3NKTA 5LASA 1AL22 1JN2P 1UIJA 4B1LA 4GD4A 3CIHA 1H2KA 4OVEA 1UY4A 4A3XA 1QXJA 1RYYA 3ZYHA 3JB8A 3M8LA 1MVEA 3ZFFA 1RUC2 4M3CA 5HV0A 1IZ3A 1S1AA 1FOD2 2W3JA 4YVSC 3GDBA 3NWKA 4CCLA 5DABA 4WM7B 1C57A 2PFWA 5LA9A 2WNOA 4Q4W2 4IE6A 1YFUA 4LKSA 1PGW1 5L19A 1ZBE1 4D6RA 2KXLA 1ULGA 1F4HA 2J7MA 3CJIB 2CY6A 3F95A 5ISLA 2HWC3 3QH6A 4YW1A 1Y9QA 5L7OA 1RTVA 1AR92 1JI6A 3GZUC 1OUXA 4XF9A 3A0KA 4N7IA 4DO0A 2R073 5FP9A 3WD5A 3C7FA 1CPMA 2XJPA 3M2MA 4LMFA 3I4IA 4BOWA 1WKYA 2ZMLA 2PHWA 1XXNA 3HT2A 3JBG1 1VMJA 4AQTA 1ULOA 4S2HA 3WG1A 1PGW2 4FO9A 2RR13 2ZA9A 3OTFA 2P37A 1KEXA 1JS9A 1MS9A 4PBPA 2VW0A 4QU1A 4AVTA 2OT7A 1I5PA 2FDKA 2PHFA 5BNOC 3BTYA 3USSA 4P5HA 1IKPA 1UYYA 5T5LA 2HYKA 1IS4A 1UY0A 3K48A 1PO11 4MHRA 1D0GA 4KWKA 1GZWB 1S2BA 4QPIC 1TNRA 2VQUA 3SISA 4HKLA 4DUWA 4JV4A 3LEKA 5FY4A 4ZPIA 3W5NA 2WFF3 3VZOA 1AR72 1EPWA 1W3XA 1XSQA 3AMPA 1HQNA 5FY1A 2YPJA 1RUF1 5D21A 3POYA 1BVP1 3DXTA 5JAXA 4RR3B 1PX3A 3KT1A 4IEUA 4XQDA 3DYOA 3N7KA 1WD3A 3BGAA 2ZJCA 2OQ6A 3VHPA 5FQ0A 3K4ZA 2MEV3 4YW6A 4AWDA 3HPNA 4Z82A 3NNMA 2F4PA 4BQ3A 5EJ1B 4L11A 2FDJA 4N90A 2UYAA 5FOJB 3FLRA 3KLSA 2WYSA 3A0NA 4GKYA 2QDNA 3GHNA 1A6CA 3MIEA 1MZEA 3ZXGA 1YCIA 1S0EA 2WS93 2X09A 3ZKUA 4AHYA 4W8JA 4AVSA 1T6GC 5C3QA 4L9BA 1M06G 3NSTA 1YQCA 1H8TA 2UY8A 3OBRA 2G9FA 4X6QB 5DZFA 4XUQA 3MF9A 3UETA 2W47A 3I59A 1RUJ1 2XWBB 2K2SA 3T0BA 2P1BA 4WZCA 1GZ9A 2ZGKA 2Y6FA 5H9SA 1IOAA 1U12A 4A7ZA 1KD7A 1TNFA 4RFT0 1Y4WA 3KD4A 4QQPA 5A7NA 1SPPB 4Q4V3 4DEVA 4ES9A 4CEWC 5LK7B 1FX5A 5FKCA 1FPN3 4IW3A 1AJOA 4IEVA 2E33A 1W6NB 1QJFA 5JSOA 3WQ1A 3HQUA 4HXCA 2BZDA 1EV13 5BNQA 1ULFA 1REEA 1ND3B 3KCYA 4GALA 4JTOA 5I0DA 2C4XA 1SCSA 2P34A 4C90A 1C5HA 4BH9A 1RUJ2 4NRMA 5KHGA 4N7UA 1QMJA 1HRV2 4M01A 2RS11 1UYZA 5FLJA 5A6YA 1UZVA 1CAVB 1W6NA 3UKTA 1QF3A 4PLOA 2ZGPA 2Q1MA 5EYYA 3MFCA 3KF3A 4CCMA 1VBA2 3LIHA 5H9QA 2BFUL 3WXPA 1AL0G 3O14A 3ZOIA 1EPZA 1Y7BA 1DP0A 3RZLA 2BP6A 1QJY1 2OPWA 1DQ5A 5A3LA 4CP1A 1YNAA 4LBOA 2I07B 5F2SA 1AYN2 1E5IA 1R1A1 3ETQA 2PXJA 4B4QA 3O1VA 1FMD3 3D5OA 2P17A 2JG8B 1S0DA 4GXLA 2NLRA 2JDMA 1WLTA 4M0NA 1OOPC 3WCRA 4XILA 2ZGQA 1SLIA 3AXEA 3UESA 2RMU3 4TSVA 1G8WA 4Q8LA 4OCTA 4A4AA 4DRRA 1SFNA 2R1BA 4MXWB 1ZBA3 3CZJA 5A6QA 2VULA 4ZONA 1RMU2 2E63A 1IG0A 3MLJA 4ISRA 3MEPA 3LQCA 3LZZA 1FNZA 1C4RA 4OMDA 4Y4YA 5GZFA 1J59A 4CUBA 3KZ4C 5FMBA 1FOD1 1QJZA 3M7AA 3OYWA 1TG7A 2XLAA 4FVVA 5EYXA 2OS2A 3PU3A 4UFMA 4QX1A 1DYKA 4FOQA 2ID4A 4IQPA 4TN7A 3URFA 4QXKA 3AMMA 4AVVA 3KVBA 4LO4B 3RMXA 2PYTA 1LOGA 2CYFA 2GU9A 1HRI3 3RZKA 4I02A 5DDJ3 1LOFA 1JBCA 3WEZA 4FPCA 2JKXA 5BNPC 4OHZA 1Q8SA 1O91A 1KFUL 4AHZA 4URTA 3VV1A 1V9U2 3I7DA 2JG9B 3JZVA 3DKQA 3OSDA 5FP7A 2E7TA 2V72A 1RUF2 4QGMA 1ENSA 5JLVA 4TZDA 3NV2A 4C1WA 4H7LA 4CDUC 2XG3A 2H6CA 3RMYA 4AR2A 3VBUB 3KCCA 4YGBA 3PDQA 3UYJA 1STMA 4NAOA 5DUWA 4XAEA 1YIFA 4I0BA 3O1TA 2PN5A 1ZZ9A 3BU7A 1IHMA 1YRZA 4EROA 3IPVB 3KGLA 2G9ZA 3N9PA 1OXCA 1S0GA 2VOKA 3FJSA 2WR9A 5FJKA 3VZLA 3WQ7A 1YI9A 4AI3A 1JH5A 1X8MA 3NAPC 1Z7S3 4QQOA 5FMOL 5FK7A 2FZ2A 4FP3A 1GR3A 5EPAA 3QOPA 1OF3A 1W99A 4UT5A 2IXKA 1XPWA 3PJQA 3O1SA 2R6QA 5JUVA 3HAGA 4KI5M 5F37A 2EIGA 2VD7A 4U36A 1JUIA 2K9ZA 2GC3A 3T2TA 3UKVA 1VAVA 3LCPA 2WDBA 1BQPA 5CG9A 1MQTA 2AGSA 2YZ4A 4LBQD 4LO5B 3ZVXA 4CDWA 1YEWA 4CDQA 5FRAA 1GU3A 2ZX4A 3IZOA 1ENXA 4R8HA 5IK4A 3VKNA 3ZXLA 3K4DA 3AB0A 1PK6B 4FOYA 3S6PA 1K45A 5BXXA 5FZ8A 3GM8A 5FOBB 5KHJA 4W6XA 3ZIWA 2HWE2 2H0VA 1OURA 1GV9A 1REFA 2RV9A 3AFKA 4YWAA 4D8MA 3BB6A 4L92A 2UY9A 4CDXA 4TLGA 2QZ2A 3K51A 1WW7A 3FUOA 4E9KA 2R32A 4Q4Y1 2YBSA 3ZSEA 3JXSA 4Y5Z0 2DUOA 3BALA 4XFIA 3GALA 4YNIA 3SNMA 3OB8A 4QMAA 5FY8A 3ENRA 1VPHA 2BGOA 4A42A 4DXRA 4DQAA 1PZ7A 1SG3A 2C6SA 2XUMA 2B46X 3AM2A 1COV1 3FBMA 4Q0UA 3I3EA 3MHZA 2R16A 4Y1ZA 5D8AC 1H30A 3H0OA 2NMNA 2YMZA 5E6HA 3IDCB 5LBCA 3WDXA 4META 1X9PA 3VBSC 3ON7A 3H7YA 4DRVA 3I2GA 1W2NA 1XOYA 2WNVC 2CHHA 4Q0SA 2ARAA 2EXIA 4ZZ5A 1XE8A 4OHYA 3HD8B 5ACA3 5K0UB 2WZR3 3J9SA 5F2WA 3T4HB 1F15A 2JE9A 5KWRA 3MZHA 4XFFA 1AXYA 5CFCB 2BOJA 4K8RB 5BNNA 4QKBA 1YQ6A 3ELNA 3TOJA 3PVOA 2FD8A 3WF4A 2WS92 4Z8BA 2G1MA 1QKQA 1XYPA 1KS5A 3AKTA 3KWVA 4ISQA 4AG4A 3VBUA 4E2SA 5KXDA 1Q8VA 2RM22 5DZEA 1PX4A 2VCAA 4LBMA 4PQ9A 4LK6A 2XL7A 4AEMA 2A73B 2FQPA 5FZOB 1LOFC 3WW3A 4I09A 2YBPA 4XF1A 1A34A 1DGLA 2UURA 2CL2A 2YU1A 2P3JA 2JE7A 5KC5A 2XHKA 5FCCA 1LODA 5CNAA 5DUXA 5CISA 2JDZA 1HN1A 4WVZA
chains in the Genus database with same CATH topology
2B9VA 2LS6A 2RVAA 3I2HA 4A45A 4ZZ8A 3A21A 5C70A 5CYYA 4BK4A 3OBAA 4IUGA 3K46A 2YFZA 4OYUA 2XQXA 4DUVA 2VC9A 4AAXA 3WNNA 2Y6KA 2ZEWA 3K75B 2W91A 2ZEXA 2J1UA 4QB2A 1OH4A 3VD4A 3IB3A 4QPWA 5LA0A 1NUKA 2X05A 5C7GA 2VZSA 2J1VA 4BK5A 4YPJA 5B4XA 1JZ2A 4CVUA 2Y64A 1JYNA 5CZKA 2VZ3A 2EICA 1O59A 1JU3A 4MGSA 3F2ZA 5DMYA 2KD7A 1UMIA 2DDUA 5LCWL 3WF0A 3CQOA 3HNBM 4OMCA 2QQNA 4QX3A 2ORXA 3IAQA 2Z4FA 3ZM8A 1OT5A 3OEBA 1EUUA 2X10A 3W5MA 5IJRA 3MUZ1 1L7RA 4A41A 1PMHX 3CZUA 3A7QA 3I2IA 4P08A 4ET7A 2JD9A 2VMDA 2VZQA 4JKLA 2WABA 2CDOA 1UWWA 4M4RA 1JYXA 3I2JA 2C9KA 2WN3A 3FN9A 4GWJA 4QX2A 2DCJA 4DEQA 4RN5A 3OG2A 1CX1A 3VDAA 5A1AA 3EYPA 3C7HA 1JU4A 2CDPA 1W0NA 1JZ5A 3AC0A 5EJZB 1US3A 3I97A 1UYXA 1UXZA 4P00B 3DECA 3NNGA 5LA2A 3ACIA 4JHZA 1ULPA 2YC2A 2DCKA 2JDAA 2ZXQA 1IQDC 1GOFA 5FUIA 1GOGA 2QQKA 3VD7A 3J7HA 3WF2A 2J1TA 1UMHA 2ZEYA 2J1SA 1KGYA 5JXGA 2W1QA 1BHGA 3GXUA 4JKKA 2C26A 3FL7A 5EIYB 3ACFA 4UOJA 3EB7A 4JKMA 3OGSA 1XNAA 1MPXA 3LEIA 4PQQA 1H6YA 4CU9A 1UX7A 4PT6A 4CUAA 2QQJA 3IAPA 2W5FA 2V4VA 3PUHA 1CIYA 3CIHA 3LPFA 3WNPA 1UY4A 3T2PA 1RYYA 1UZ0A 2WO1A 2OKXA 3VDCA 2W3JA 5HXMA 3GDBA 3T0DA 1UXXX 1GOHA 3NJXA 3PUIA 2EIBA 4LKSA 3HN3A 4MOAA 2W1WA 2XHNA 5F7UA 1F4HA 4XUPA 2J7MA 3WF3A 1YQ2A 1JI6A 3ECQA 5B4NA 2ZEZA 3I2KA 4UI9L 3C7FA 1CZTA 3T0AA 2YFUA 4DUXA 1EUTA 1OD3A 1WKYA 2WUHA 3IIIA 1JHJA 2V5DA 3HJRA 1ULOA 1UY2A 2QQOA 2Y6HA 4RYDA 3ABZA 2L9LA 1JZ8A 3WNMA 1KEXA 3SEEA 4M4PA 3WQBA 1GUIA 2VO5A 1I5PA 3NJVA 2W87A 4DXTA 2B4KA 1OF4A 4TXWA 4DXSA 3VD3A 1UYYA 1JZ3A 3I2FA 1UY0A 3VD5A 2VQUA 4DUWA 2RJ2A 3LEKA 2WN2A 3W5NA 5JXJA 3HNMA 2WBKA 2Y6LA 2QQLA 2QQMA 3K77A 1T2XA 1PX3A 2VZRA 4QDRA 3DYOA 1W9SA 3BGAA 3K4ZA 2Y6JA 2VZPA 5LA1A 3HPNA 1W8NA 4QX0A 3T08A 4MADA 5EJ1B 3DYMA 4E8DA 3BN6A 3VDBA 2WYSA 4A6OA 1DYOA 2X09A 3WSOA 4A3ZA 5JR2A 4W8JA 1D7PM 2PQSA 4XVHA 3CMGA 4XUQA 3U37A 4XURA 2W47A 3UETA 3WNLA 1L7QA 1SDDB 3T0BA 4LPLA 2J22A 3LE0A 1W8OA 2JE8A 4JX0A 4DEVA 2HYXA 2YB7A 1WCQA 5C71A 4KMQA 2R7EB 2E33A 3A23A 5JMOA 2BBAA 5DPNA 2BZDA 1K12A 5I0DA 5G05L 2C4XA 4LHSA 1XNTA 3NRUA 4BDVB 2WAOA 3NQHA 1UYZA 1CZVA 4MGQA 4TTGA 4XUOA 5IFTA 3MBWA 4W50A 2W9XA 4L0PA 5IFPA 1JZ6A 2VZ1A 2ORZA 2W94A 3D3AA 1DP0A 1PMJX 3GGLA 1W9TA 1J83A 1R64A 4CU8A 1LNSA 3C7GA 2J1EA 4ZY9A 1P8JA 2QBXA 2WO2A 4QDQA 3FHQA 3T2OA 3UESA 4KWUA 4BJ0A 4A4AA 1K3IA 1US2A 2VJXA 3CZJA 3DYPA 3SEPA 3UNPA 2E31A 1K42A 3LQCA 4OMDA 2W95A 4CUBA 2Y8KA 1TG7A 2VR4A 2YG0A 4QX1A 2ID4A 4PF1A 4QB1A 4UAPA 2VZTA 4QDSA 1H6XA 4BXSV 3MV11 2QQIA 2VOTA 3OGVA 2EIEA 3WEZA 2JKXA 4ZXEA 2W92A 2XOMA 4MO3M 1O8SA 2V72A 3ACGA 2XONA 3WNKA 2W1SA 3THCA 2J1RA 4XUNA 2VTFA 4QB6A 2VZOA 3P6BA 2WZ8A 2VL4A 4A44A 4GZ9A 3MO4A 1JZ7A 2W1UA 3SKVA 3IDAA 4Z2AA 1CZSA 3HEIA 1NX9A 3T09A 3I3BA 1OF3A 1W99A 3SKJE 1XPWA 1JYVA 5JUVA 4KI5M 1F4AA 4FI9A 4W4ZA 2BGPA 1J84A 1O8PA 3E1F1 2WDBA 1NAEA 3WNOA 2VMEA 1JYWA 3HNYM 4P02B 1GU3A 4HG6B 2HLEA 2VZVA 2Y6GA 2J1AA 3K4AA 1SHWB 3C7OA 3K4DA 4XZUG 1K45A 3GM8A 3HOBA 1UY1A 3CDZB 2BERA 2RV9A 4D8MA 1GQPA 4OZOA 5JXHA 1TVGA 4CU7A 2VQTA 1GNYA 2VCBA 3JXSA 2VMFA 4QAWA 3THDA 5IYYA 2E26A 5IHRA 2WAAA 3VD9A 3OB8A 4CUCA 2WO3A 5HPOA 2BGOA 3P1IA 4A42A 4DXRA 2LW8A 1SG3A 4D0QA 2E32A 3I3EA 2W46A 4GWIA 3LPGA 3T2QA 3A22A 5J1XA 1JZ4A 4CU6A 3I2GA 3I3DA 4E8CA 4LQRA 4ZZ5A 3CKHA 5G04L 1XC6A 3MUY1 3MV01 3WF1A 1UY3A 2WQ8A 2VMCA 1GMMA 2EIDA 2WZEA 5JXIA 5DQ0A 3FHAA 3ACHA 3WF4A 3LEGA 4ARYA 4ARXA 4P5YA 2VZUA 3C7EA 4AG4A 4XUTA 3OGRA 1PX4A 2VCAA 3C8XA 5DN2A 4OUEA 1DLCA 3ETPA 2YC4A 2VCCA 1W9WA 3OEAA 2VM9A 1HN1A 1NKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9V A;  2LS6 A;  2RVA A;  3I2H A;  4A45 A;  4ZZ8 A;  3A21 A;  5C70 A;  5CYY A;  4BK4 A;  3OBA A;  4IUG A;  3K46 A;  2YFZ A;  4OYU A;  2XQX A;  4DUV A;  2VC9 A;  4AAX A;  3WNN A;  2Y6K A;  2ZEW A;  3K75 B;  2W91 A;  2ZEX A;  2J1U A;  4QB2 A;  1OH4 A;  3VD4 A;  3IB3 A;  4QPW A;  5LA0 A;  1NUK A;  2X05 A;  5C7G A;  2VZS A;  2J1V A;  4BK5 A;  4YPJ A;  5B4X A;  1JZ2 A;  4CVU A;  2Y64 A;  1JYN A;  5CZK A;  2VZ3 A;  2EIC A;  1O59 A;  1JU3 A;  4MGS A;  3F2Z A;  5DMY A;  2KD7 A;  1UMI A;  2DDU A;  5LCW L;  3WF0 A;  3CQO A;  3HNB M;  4OMC A;  2QQN A;  4QX3 A;  2ORX A;  3IAQ A;  2Z4F A;  3ZM8 A;  1OT5 A;  3OEB A;  1EUU A;  2X10 A;  3W5M A;  5IJR A;  3MUZ 1;  1L7R A;  4A41 A;  1PMH X;  3CZU A;  3A7Q A;  3I2I A;  4P08 A;  4ET7 A;  2JD9 A;  2VMD A;  2VZQ A;  4JKL A;  2WAB A;  2CDO A;  1UWW A;  4M4R A;  1JYX A;  3I2J A;  2C9K A;  2WN3 A;  3FN9 A;  4GWJ A;  4QX2 A;  2DCJ A;  4DEQ A;  4RN5 A;  3OG2 A;  1CX1 A;  3VDA A;  5A1A A;  3EYP A;  3C7H A;  1JU4 A;  2CDP A;  1W0N A;  1JZ5 A;  3AC0 A;  5EJZ B;  1US3 A;  3I97 A;  1UYX A;  1UXZ A;  4P00 B;  3DEC A;  3NNG A;  5LA2 A;  3ACI A;  4JHZ A;  1ULP A;  2YC2 A;  2DCK A;  2JDA A;  2ZXQ A;  1IQD C;  1GOF A;  5FUI A;  1GOG A;  2QQK A;  3VD7 A;  3J7H A;  3WF2 A;  2J1T A;  1UMH A;  2ZEY A;  2J1S A;  1KGY A;  5JXG A;  2W1Q A;  1BHG A;  3GXU A;  4JKK A;  2C26 A;  3FL7 A;  5EIY B;  3ACF A;  4UOJ A;  3EB7 A;  4JKM A;  3OGS A;  1XNA A;  1MPX A;  3LEI A;  4PQQ A;  1H6Y A;  4CU9 A;  1UX7 A;  4PT6 A;  4CUA A;  2QQJ A;  3IAP A;  2W5F A;  2V4V A;  3PUH A;  1CIY A;  3CIH A;  3LPF A;  3WNP A;  1UY4 A;  3T2P A;  1RYY A;  1UZ0 A;  2WO1 A;  2OKX A;  3VDC A;  2W3J A;  5HXM A;  3GDB A;  3T0D A;  1UXX X;  1GOH A;  3NJX A;  3PUI A;  2EIB A;  4LKS A;  3HN3 A;  4MOA A;  2W1W A;  2XHN A;  5F7U A;  1F4H A;  4XUP A;  2J7M A;  3WF3 A;  1YQ2 A;  1JI6 A;  3ECQ A;  5B4N A;  2ZEZ A;  3I2K A;  4UI9 L;  3C7F A;  1CZT A;  3T0A A;  2YFU A;  4DUX A;  1EUT A;  1OD3 A;  1WKY A;  2WUH A;  3III A;  1JHJ A;  2V5D A;  3HJR A;  1ULO A;  1UY2 A;  2QQO A;  2Y6H A;  4RYD A;  3ABZ A;  2L9L A;  1JZ8 A;  3WNM A;  1KEX A;  3SEE A;  4M4P A;  3WQB A;  1GUI A;  2VO5 A;  1I5P A;  3NJV A;  2W87 A;  4DXT A;  2B4K A;  1OF4 A;  4TXW A;  4DXS A;  3VD3 A;  1UYY A;  1JZ3 A;  3I2F A;  1UY0 A;  3VD5 A;  2VQU A;  4DUW A;  2RJ2 A;  3LEK A;  2WN2 A;  3W5N A;  5JXJ A;  3HNM A;  2WBK A;  2Y6L A;  2QQL A;  2QQM A;  3K77 A;  1T2X A;  1PX3 A;  2VZR A;  4QDR A;  3DYO A;  1W9S A;  3BGA A;  3K4Z A;  2Y6J A;  2VZP A;  5LA1 A;  3HPN A;  1W8N A;  4QX0 A;  3T08 A;  4MAD A;  5EJ1 B;  3DYM A;  4E8D A;  3BN6 A;  3VDB A;  2WYS A;  4A6O A;  1DYO A;  2X09 A;  3WSO A;  4A3Z A;  5JR2 A;  4W8J A;  1D7P M;  2PQS A;  4XVH A;  3CMG A;  4XUQ A;  3U37 A;  4XUR A;  2W47 A;  3UET A;  3WNL A;  1L7Q A;  1SDD B;  3T0B A;  4LPL A;  2J22 A;  3LE0 A;  1W8O A;  2JE8 A;  4JX0 A;  4DEV A;  2HYX A;  2YB7 A;  1WCQ A;  5C71 A;  4KMQ A;  2R7E B;  2E33 A;  3A23 A;  5JMO A;  2BBA A;  5DPN A;  2BZD A;  1K12 A;  5I0D A;  5G05 L;  2C4X A;  4LHS A;  1XNT A;  3NRU A;  4BDV B;  2WAO A;  3NQH A;  1UYZ A;  1CZV A;  4MGQ A;  4TTG A;  4XUO A;  5IFT A;  3MBW A;  4W50 A;  2W9X A;  4L0P A;  5IFP A;  1JZ6 A;  2VZ1 A;  2ORZ A;  2W94 A;  3D3A A;  1DP0 A;  1PMJ X;  3GGL A;  1W9T A;  1J83 A;  1R64 A;  4CU8 A;  1LNS A;  3C7G A;  2J1E A;  4ZY9 A;  1P8J A;  2QBX A;  2WO2 A;  4QDQ A;  3FHQ A;  3T2O A;  3UES A;  4KWU A;  4BJ0 A;  4A4A A;  1K3I A;  1US2 A;  2VJX A;  3CZJ A;  3DYP A;  3SEP A;  3UNP A;  2E31 A;  1K42 A;  3LQC A;  4OMD A;  2W95 A;  4CUB A;  2Y8K A;  1TG7 A;  2VR4 A;  2YG0 A;  4QX1 A;  2ID4 A;  4PF1 A;  4QB1 A;  4UAP A;  2VZT A;  4QDS A;  1H6X A;  4BXS V;  3MV1 1;  2QQI A;  2VOT A;  3OGV A;  2EIE A;  3WEZ A;  2JKX A;  4ZXE A;  2W92 A;  2XOM A;  4MO3 M;  1O8S A;  2V72 A;  3ACG A;  2XON A;  3WNK A;  2W1S A;  3THC A;  2J1R A;  4XUN A;  2VTF A;  4QB6 A;  2VZO A;  3P6B A;  2WZ8 A;  2VL4 A;  4A44 A;  4GZ9 A;  3MO4 A;  1JZ7 A;  2W1U A;  3SKV A;  3IDA A;  4Z2A A;  1CZS A;  3HEI A;  1NX9 A;  3T09 A;  3I3B A;  1OF3 A;  1W99 A;  3SKJ E;  1XPW A;  1JYV A;  5JUV A;  4KI5 M;  1F4A A;  4FI9 A;  4W4Z A;  2BGP A;  1J84 A;  1O8P A;  3E1F 1;  2WDB A;  1NAE A;  3WNO A;  2VME A;  1JYW A;  3HNY M;  4P02 B;  1GU3 A;  4HG6 B;  2HLE A;  2VZV A;  2Y6G A;  2J1A A;  3K4A A;  1SHW B;  3C7O A;  3K4D A;  4XZU G;  1K45 A;  3GM8 A;  3HOB A;  1UY1 A;  3CDZ B;  2BER A;  2RV9 A;  4D8M A;  1GQP A;  4OZO A;  5JXH A;  1TVG A;  4CU7 A;  2VQT A;  1GNY A;  2VCB A;  3JXS A;  2VMF A;  4QAW A;  3THD A;  5IYY A;  2E26 A;  5IHR A;  2WAA A;  3VD9 A;  3OB8 A;  4CUC A;  2WO3 A;  5HPO A;  2BGO A;  3P1I A;  4A42 A;  4DXR A;  2LW8 A;  1SG3 A;  4D0Q A;  2E32 A;  3I3E A;  2W46 A;  4GWI A;  3LPG A;  3T2Q A;  3A22 A;  5J1X A;  1JZ4 A;  4CU6 A;  3I2G A;  3I3D A;  4E8C A;  4LQR A;  4ZZ5 A;  3CKH A;  5G04 L;  1XC6 A;  3MUY 1;  3MV0 1;  3WF1 A;  1UY3 A;  2WQ8 A;  2VMC A;  1GMM A;  2EID A;  2WZE A;  5JXI A;  5DQ0 A;  3FHA A;  3ACH A;  3WF4 A;  3LEG A;  4ARY A;  4ARX A;  4P5Y A;  2VZU A;  3C7E A;  4AG4 A;  4XUT A;  3OGR A;  1PX4 A;  2VCA A;  3C8X A;  5DN2 A;  4OUE A;  1DLC A;  3ETP A;  2YC4 A;  2VCC A;  1W9W A;  3OEA A;  2VM9 A;  1HN1 A;  1NKG A; 
#chains in the Genus database with same CATH topology
 2A6W A;  4ZZ8 A;  2RVA A;  3I2H A;  4ASK A;  1POQ A;  1V6N A;  2XLG A;  1ZYB A;  1V6L A;  3NO8 A;  1IG3 A;  2YFZ A;  1GP5 A;  2WFF 2;  1CAX A;  4MLO A;  3H8U A;  4UFJ A;  4NHM A;  4NRQ A;  5IVY A;  5FZK A;  5C9A A;  3ZSK A;  2DVD A;  5FWJ A;  3ZYP A;  4Q4Y 3;  1HB2 A;  1IGO A;  4RS5 C;  2W91 A;  2ZEX A;  2J1U A;  4XDP A;  4D6Q A;  2O8Q A;  1LHU A;  1WMF A;  4KNC A;  3VD4 A;  2IXC A;  5FPZ A;  4HN0 A;  4XBL A;  4N43 B;  4AFM A;  1H1I A;  1KXG A;  1LAJ A;  3FC0 A;  1UN1 A;  5KXB A;  4M0H A;  2TEP A;  4AQ2 A;  4BK5 A;  3BCW A;  1BK0 A;  5IK5 A;  1TE1 B;  2BFU S;  1YIP A;  1D2Q A;  3B01 A;  3QLQ A;  4CVU A;  1ZZC A;  4JGZ C;  1JYN A;  2EAK A;  1PVC 2;  4CEW B;  2NPI A;  1DF0 A;  3ZFF C;  2JDY A;  2EIC A;  2HWF 2;  3RZM A;  4YAR A;  5LZ6 A;  3F2Z A;  1DZQ A;  1LR5 A;  2VY0 A;  3J7N A;  3KB5 A;  4IGO A;  5DMY A;  2KD7 A;  3DEM A;  2E6V A;  4EWA A;  1NLR A;  1OFN A;  1BKZ A;  1OI6 A;  4YW4 A;  1RB8 G;  3BI3 A;  1N1Y A;  3Q8F A;  1D4V B;  4YYO A;  1Z7S 1;  5FYS A;  3WP3 A;  1QOS A;  2P2K A;  4I01 A;  1PHM A;  4AVB A;  2A3X A;  5TSW A;  4MYE A;  5LBF A;  2BUK A;  5ERL A;  1YFW A;  3HR9 A;  5DDJ 2;  4BMB A;  5IJR A;  3WG4 A;  4A41 A;  5FZO A;  4HKW A;  2RS1 3;  2XVG A;  5FY9 A;  5CFD A;  3VZN A;  3QCW A;  1W6P B;  2HWF 3;  4O9E A;  2D93 A;  3VGI A;  3POI A;  4WBB A;  5A33 B;  3I2I A;  3J7L A;  2D3R A;  3W21 A;  5C3S A;  4D7T A;  1NE6 A;  5JOZ A;  1EV1 1;  1RUD 1;  2VZQ A;  1LB2 A;  5ACA 2;  1LGC A;  2HBT A;  2MPF A;  4XXA A;  1N3Q A;  1E5R A;  2ZPX A;  4LLF A;  3SH5 A;  2IFW A;  1MZF A;  2RS5 2;  2XKO A;  1UWW A;  4M4R A;  1CD3 G;  1Y9G A;  1JYX A;  5DDJ 1;  2XJS A;  2C9K A;  2AZ5 A;  3PUQ A;  4NVP A;  4DMI A;  2PHR A;  1N3P A;  2GAU A;  1HXS 3;  4EZH A;  2IFR A;  4AQ6 A;  1VB2 A;  4D6S A;  4FFF A;  3ZXJ A;  3AYE A;  1YLL A;  3PUS A;  5JPN B;  4DEQ A;  3TEW A;  3OG2 A;  1PO2 1;  2VBP A;  3EYP A;  3AKR A;  3S5A A;  3VLB B;  1HV0 A;  3RVH A;  4IEO A;  1MS0 A;  2WS9 1;  3AC0 A;  1JZ5 A;  1US3 A;  4P00 B;  3NNG A;  3ZXE A;  1W2O A;  1S0B A;  1LED A;  2YUE A;  3MIF A;  3M3E A;  2ADE A;  5JIA A;  2ZTN A;  4QX8 A;  5L36 A;  1NXM A;  1QXP A;  1O4T A;  3SMH A;  4A6S A;  1OPM A;  3J4U H;  2MEV 2;  1O7F A;  5FUI A;  5FBZ A;  3O7O A;  5A32 B;  4CEY B;  4EN0 A;  2W39 A;  5DG1 A;  5SV8 A;  1O5U A;  3CLP A;  1N3O A;  3RYP A;  2F6B A;  5FY5 A;  1OBN A;  4DS0 A;  3JU9 A;  4PF5 A;  4DXZ A;  4Y26 A;  1A3K A;  4FOW A;  1F31 A;  1CX4 A;  1OH3 A;  1AR7 3;  3AMQ A;  1PGL 2;  1NZC A;  4IE7 A;  1KGY A;  3TN9 2;  5C8C B;  2W1Q A;  3MI8 A;  4I30 A;  3GXU A;  4XFH A;  4GJZ A;  1QJU 1;  4COU A;  1X33 A;  1FT9 A;  4DB5 A;  5FO7 B;  4LBQ B;  1NY7 1;  4PI0 A;  4LR4 A;  3NAP A;  1IPK A;  2O0O A;  1NLS A;  1PO1 3;  1UQX A;  2G4I A;  3ACF A;  3DPR B;  4ZXK A;  3IIA A;  1YFY A;  1VE0 A;  2C24 A;  4COV A;  2JB4 A;  2QQU A;  3LEI A;  5A7O A;  3WG3 A;  2JKB A;  2WLP A;  5I8S A;  1ONA A;  4Q0Q A;  4CDQ C;  4OHV A;  1GQG A;  1ZVF A;  2B39 A;  4JRA A;  4W6Y A;  4LBQ A;  1LJ7 A;  5FYY A;  4KGG A;  1AXK A;  1XQN A;  1IQA A;  5F3G A;  2O14 A;  4URA A;  2NMO A;  4N53 B;  1CIW A;  3WNP A;  3AYD A;  1YHF A;  3T2P A;  5I93 A;  1YJK A;  3PVN A;  2ZX0 A;  5C3R A;  1RXG A;  2WO1 A;  4IXL A;  3U78 A;  3JD7 2;  2OKX A;  2SBA A;  3Q8C A;  1V70 A;  4LOT A;  4Y4R A;  1RUH 2;  2Q8D A;  3ATG A;  4QXC A;  5ANN A;  3AZY A;  5BNP B;  3MW2 A;  1GOH A;  1UX6 A;  5FMD A;  2LM3 A;  3JB4 C;  3GF6 A;  2BVB A;  3HN3 A;  2DTW A;  3CJI A;  2W1W A;  4MH0 E;  4IE5 A;  1W3V A;  4V1P A;  5K0U A;  4AED C;  3KMH A;  1CGP A;  1ZRC A;  3H1W A;  5J7M A;  2ARE A;  2PHU A;  3BVC A;  5IK7 A;  1OQ1 A;  2EXJ A;  1GWK A;  3ECQ A;  4B7K A;  3ZDS A;  2D6P A;  2R1D A;  2R49 A;  3MGU A;  1O3Q A;  3GBF A;  1MR5 A;  4IE4 A;  1N1V A;  2ZEZ A;  3BU0 A;  2ZZJ A;  3H42 B;  1CZT A;  3FWE A;  3T0A A;  5I91 A;  1OD3 A;  2WUH A;  3L2Y A;  3III A;  3UK9 A;  4E4Z A;  4XJW A;  2V5D A;  1XRU A;  4O9G A;  4CYD A;  2CAU A;  2WZR 2;  2QQO A;  3HJR A;  4QM8 A;  4RYD A;  1NE4 A;  3ABZ A;  1GSL A;  1CQ9 A;  1JYC A;  2ZGT A;  3DKW A;  3R6S A;  5HBA A;  2LAL A;  5LAT A;  3ZX7 A;  2XJV A;  4YRD A;  5B2G B;  2VO5 A;  3NJV A;  4UXA A;  3UGG A;  5ABJ B;  2W87 A;  2GNM A;  4CRQ A;  1X50 A;  4DXT A;  4YM0 A;  1F9K A;  3RI9 A;  2DUR A;  4XOG A;  1EYB A;  3VBS B;  4JHT A;  5BNN C;  4K8F A;  2IVJ A;  1LOA A;  1PGS A;  2WNV B;  1CR7 A;  1JZ3 A;  1R09 2;  3TEZ A;  3ZPY A;  1AYM 2;  3LD8 A;  1OD5 A;  3I54 A;  5FPL A;  1U5Y A;  1X36 A;  1Z7S 2;  1W6P A;  1W05 A;  1GYK A;  2EVX A;  3KV5 A;  1SEF A;  2RJ2 A;  2XJU A;  4UW5 A;  5CFC C;  1EP0 A;  2V09 A;  1S2K A;  2QJV A;  1V9U 1;  1LOB A;  2WNE A;  2W0X A;  2QQL A;  4TLF A;  2QQM A;  4OHX A;  5A6X A;  4DZG A;  1HX6 A;  2RJL A;  1KDM A;  4QDR A;  1NCR A;  1W6O A;  4JCK A;  4NOT A;  1ASJ 2;  3WIN E;  1UU4 A;  2Y6J A;  2QQW A;  5LA1 A;  4LJH A;  1F2N A;  2VU9 A;  1LRH A;  3B7M A;  4NRO A;  5AC9 2;  3POE A;  1I6X A;  2R07 1;  4QX0 A;  3WDV A;  4Q2F A;  4LIT A;  1GZC A;  4LOR A;  2RS5 1;  4PLM A;  1ZRE A;  3ZFE B;  4B4P A;  3BN6 A;  3VDB A;  4XXP A;  3ZR6 A;  4BIO A;  2VNR A;  1DQ2 A;  1WMX A;  4IEW A;  2QZ3 A;  4BQ5 A;  4YVS B;  2BV4 A;  1HQW A;  2PQS A;  1AX1 A;  4NJ4 A;  4XVH A;  5D8A B;  4RHV 2;  4Y24 A;  4E4D X;  5C9A C;  2BJS A;  4HKO A;  3JQX A;  3UGH A;  1YI7 A;  1TME 2;  2GN7 A;  3H1M A;  5E16 A;  3OBT A;  4XAA A;  3TAY A;  2RJK A;  4DIQ A;  2ZHK A;  1HB1 A;  1W8O A;  5A7S A;  1RMU 3;  4UFL A;  2QKD A;  4MX3 A;  4XJU A;  3KQR A;  4K6B A;  5GLT A;  3WW4 A;  1UU5 A;  1DQ1 A;  2MHF A;  2HYX A;  4PCR A;  1C3H A;  1DFQ A;  3N7J A;  2XUE A;  3D0S A;  3LAG A;  4YGC A;  1APN A;  2DFC A;  3QAC A;  4I0A A;  3KV9 A;  1OQE A;  2GC2 A;  3HWJ A;  5FQ0 B;  3ZSL A;  2D6K A;  2CTV A;  1AL2 1;  2X5I B;  5DPN A;  5GM0 A;  4CCO A;  2E7A A;  3WG2 A;  3U10 A;  2D5F A;  2D7F A;  3A4U A;  3IKW A;  3WV6 A;  5G05 L;  4NWV A;  4ATE A;  4XF4 A;  1LKN A;  1RHI 2;  1RVF 2;  2W68 A;  3BPZ A;  4R52 A;  3V0B B;  1OA3 A;  4HAN A;  5A7W A;  4CDX C;  1VBD 1;  1SLT A;  2WAO A;  1BJQ A;  3H8O A;  4ZS2 A;  1JOD A;  2TBV A;  3E6B A;  4QXB A;  1SCR A;  2Q8O A;  3SCH A;  2VNO A;  3MPB A;  4NMI A;  1SFP A;  3C2U A;  4AFB A;  5IFT A;  2FHR A;  3MBW A;  4QGN A;  1AX2 A;  5BPX A;  5FO9 B;  4L0P A;  3V0B A;  5LBB A;  1NT0 A;  2JDN A;  5IFP A;  1JZ6 A;  2ORZ A;  1N47 A;  2IC1 A;  1RGS A;  4J1X A;  3IN9 A;  4FXG B;  1UW8 A;  2JDK A;  1W9T A;  1RHI 1;  1RVF 1;  3NMB A;  4R4Z A;  2OUH A;  5IAX A;  5KHI A;  4KL1 A;  1R64 A;  2Q4S A;  2GP3 A;  1J3Q A;  1YO8 A;  2TNF A;  5JOW A;  4RR3 C;  5D1I A;  1P8J A;  2C0Z A;  2WQZ C;  4QDQ A;  3FHQ A;  3POS A;  3QBQ A;  4YSF A;  1QOO A;  5A7W B;  3HQR A;  3E5U A;  1CAW B;  4LHN A;  4XPV A;  3SH3 A;  1US2 A;  2VJX A;  2ZOE B;  5F3E A;  2JWP A;  1QJE A;  1DIW A;  2RR1 2;  2R30 A;  4QKF A;  1K42 A;  1W6Q A;  2OQ7 A;  4IV3 C;  4XHX A;  1R09 1;  1K5M C;  2B7Y A;  5FZH A;  3ZXA C;  4TWT A;  1BBT 3;  4QKN A;  5I8T A;  1J3P A;  2YG0 A;  1BCX A;  4FPO B;  4IV1 C;  1PNG A;  3WUD A;  4QB1 A;  1PM4 A;  3VL9 A;  4Q4Y 2;  4FTE A;  3LF7 A;  4L8Q A;  1ZZ6 A;  4QDS A;  5GLU A;  3ZDV A;  2RM2 1;  3VHO A;  4IES A;  3MV1 1;  1WBF A;  2HWC 2;  2QQI A;  3HBZ A;  2B9U A;  3OY8 A;  2VMG A;  3ZFF B;  1FV3 A;  4ZXE A;  1FAT A;  1N1S A;  3AZV A;  2I45 A;  4IE0 A;  5IVC A;  1BMV 2;  2YPD A;  3GCX A;  3I2O A;  3DF0 A;  3VZM A;  2C1F A;  5CU1 A;  4LNV A;  1BBT 1;  2VTF A;  1UD1 A;  3INA A;  5FPV A;  2VZO A;  4Y22 B;  3OD4 A;  4A7Y A;  1I3H A;  1OLM E;  5T3N A;  2XBO 1;  3ZFG C;  1OKQ A;  2WZR 1;  4YZ4 A;  1NCQ C;  2VL4 A;  5FZD A;  2Z69 A;  3POG A;  1AR6 3;  1U5Z A;  3O0X A;  3MO4 A;  2ZAA A;  2IZW A;  4MHU A;  3VDD C;  5I8Y A;  3IDA A;  1ND3 A;  3EMR A;  1TQ5 A;  3KF5 A;  4RQP A;  3UKN A;  1S0J A;  4RGK A;  1DCS A;  3BOW A;  3GBW A;  1NXD 1;  2X8K A;  4AVA A;  3AMH A;  4HVO A;  3T09 A;  5CB7 A;  3M3C A;  3SC7 X;  4LUL A;  3SKJ E;  1COV 3;  2PQQ A;  5T54 A;  4B3N A;  3WHU A;  5FPX A;  1L7L A;  1W8W A;  2RS3 2;  1BXH A;  4PI2 A;  3WW2 A;  1JYV A;  2HJI A;  5KR7 A;  3TEY A;  4MGI E;  1JMU B;  3TEX A;  3TWI A;  2ERF A;  1ALY A;  1M4W A;  3PLQ A;  4GQ7 A;  5FP4 A;  2ARC A;  2OXB A;  4J6G A;  4HT1 T;  2A6Z A;  2PLV 1;  2HEV F;  2RS3 3;  3DPR C;  4YG6 A;  1UKG A;  3Q8A A;  2ZAB A;  2BWC A;  1NAE A;  5FP3 A;  3WNO A;  1TZO A;  4C0B A;  1MS3 A;  4Y1U A;  4F8A A;  3E97 A;  4HG6 B;  5KHK A;  2VZV A;  4AFD A;  4CDQ B;  4H7M A;  3K4A A;  3OOX A;  4RFR B;  1PMI A;  5A1L A;  4F3J A;  1DLL A;  3C7O A;  3RNS A;  4XZU G;  1QQP 1;  5CIR A;  3WP5 A;  1OOP B;  1HB3 A;  2A5Z A;  1PIV 1;  1VB4 A;  4Q5O A;  3HOB A;  1UY1 A;  2P3I A;  5EZW A;  1CVN A;  5FK8 A;  3MIH A;  3H7J A;  4K7J A;  2IXH A;  4OZO A;  4AGV A;  2DCZ A;  4ZU5 A;  1BVV A;  1XU1 A;  2R04 1;  3ZN6 B;  3IDB B;  5FV3 A;  4LO8 A;  3TNP B;  4QHO A;  2PHL A;  2VCB A;  2VMF A;  2JXA A;  1DHK B;  1R08 1;  2Y33 A;  4WVW A;  5CFD C;  5IYY A;  1G9F A;  2I74 A;  2WAA A;  4CUC A;  4LBL A;  2DVB A;  4OQ8 A;  1HW5 A;  2LW8 A;  3JUU A;  1G6N A;  2E32 A;  3K2O A;  5DG2 A;  3O12 A;  1EV1 2;  2N7G A;  1NA1 C;  2GC0 A;  2DTY A;  3AL5 A;  1BEV 3;  1W6Q B;  3IWZ A;  1DQ4 A;  1RUE 2;  4ASL A;  3O0W A;  4Q4W 1;  1V00 A;  5J1X A;  1JZ4 A;  3THT A;  4L2N A;  2ATF A;  4AGR A;  4XMI A;  1L3J A;  2IVI B;  4CDU B;  1NQD A;  2BWA A;  2JEC A;  3GZA A;  1ZBA 2;  1VJ2 A;  2RS5 3;  4LQR A;  5HCA A;  5IVV A;  1H2M A;  5G04 L;  5FZF A;  2ET7 A;  2VE1 A;  1VMF A;  4DFS A;  2GH2 A;  1VBD 2;  1UY3 A;  3NNJ A;  5FLH A;  5FTT C;  2XH6 A;  2CU5 A;  1BEV 2;  5T5J A;  1NQJ A;  1RUI 2;  5BNO A;  5FZ3 A;  1IKQ A;  5K4L A;  4B8E A;  1XBF A;  3O1O A;  4WM7 A;  2Q30 A;  3NAP B;  4PDW A;  2VNG A;  5DQ0 A;  5JXI A;  3FHA A;  4ARX A;  3X29 B;  1LHV A;  5I0R A;  2WSV A;  3M3Q A;  4IEP A;  4D7S A;  2LUW A;  4XUT A;  3AP4 A;  2YV8 A;  2RMU 1;  1AX0 A;  3VBO A;  2Y60 A;  1WCK A;  4M3C F;  5K8S A;  4XIO A;  2Q0A A;  1LTE A;  1QWR A;  2UYB A;  1GNZ A;  3NV3 A;  4GJY A;  4QU2 A;  1B35 B;  1FOD 3;  3EO6 A;  3OEA A;  1HQL A;  1FMD 1;  1ZM1 A;  5FUN A;  2CV6 A;  4A45 A;  1XNB A;  4FPG A;  3WUC A;  2QVS B;  4IGP A;  4D3W A;  2XJQ A;  1SLC A;  4YM3 A;  4KH9 A;  4LUM A;  2HBU A;  4OYU A;  4LKE A;  5DAQ A;  4JZR A;  3VUO A;  3ZYJ B;  4DUV A;  4AAX A;  1H8T C;  3DUI A;  2D3S A;  1FPN 2;  2SLI A;  2C9A A;  5GAL A;  5C8W A;  2K46 A;  2Y6K A;  3VBF C;  4F7Z A;  2Z2S B;  5JI7 A;  5A3W A;  4BPZ A;  3AKP A;  5T52 A;  4JGY B;  1ASJ 1;  3ZSJ A;  2BDR A;  1Y9M A;  3M3O A;  2VPV A;  1MZ6 A;  4K1Y A;  3W58 A;  4WM8 A;  4QPW A;  3N9N A;  1AJK A;  1KS4 A;  3H8X A;  2ZKN A;  1EAH 2;  2ZHM A;  2HWB 3;  4Z2W A;  2VZS A;  4Q4X 2;  5E89 A;  4KGQ A;  4HL0 A;  3WHT A;  5ABJ C;  5B4X A;  5EQU A;  2O1Q A;  3PTR B;  1PM7 A;  2P3K A;  5FLI A;  5BNN B;  4KQ7 A;  5J96 B;  1YXW A;  2DU0 A;  4Q29 A;  3RG0 A;  5CG8 A;  5A7P A;  3VL8 A;  2J42 A;  2XVK A;  1QXR A;  2VZ3 A;  1O3R A;  3APB A;  4RL7 A;  4GMP 3;  1OQD A;  2VAU A;  3OPT A;  3ACL A;  3AFG A;  3ZFE A;  3USU B;  4BXF A;  2XWJ B;  3CQO A;  3P5B A;  1E57 A;  2Q8E A;  2QQN A;  4AED A;  5K0U C;  3O1M A;  2KA3 A;  1V6J A;  1SLL A;  1YC6 1;  3BUC A;  1UL9 A;  4CDX B;  3LOB A;  3DN7 A;  1V9U 3;  1MEC 3;  3ST7 A;  1VRH 3;  1OT5 A;  4S2D A;  2VTX J;  4LEJ A;  5A6Z A;  3W5M A;  2Y34 A;  4XMA A;  3B00 A;  4NHL A;  3H8R A;  2HWE 3;  1LOE A;  3LSD A;  1L7R A;  3MUZ 1;  3RS6 A;  3W20 A;  3OPW A;  2Z5W A;  3R4U A;  3GZE A;  3SXW A;  1U5X A;  3PL0 A;  1H1A A;  4AFA A;  3SIT A;  3MIG A;  1EY2 A;  5ANQ A;  4BCU A;  3I3M A;  1RL3 A;  3V64 A;  4EYU A;  1HB4 A;  1ND2 C;  1VMH A;  4XJ8 A;  3N4M A;  3JBG 2;  4YFZ A;  4RR3 A;  3B02 A;  1LEC A;  2DF7 A;  3N9M A;  3POB A;  5JI9 A;  1KRI A;  3N9Q A;  5JOX A;  1XE7 A;  3FUQ A;  3LDK A;  3VBS A;  2A71 A;  3OGJ A;  5FYC A;  4EN7 B;  3GJB A;  3PIJ A;  2WT1 A;  4GWJ A;  4IV1 A;  2MEV 1;  4QT6 A;  4JGY A;  4QPG C;  1SMV A;  4HK8 A;  1GP4 A;  1LHO A;  2OZJ A;  3ZN5 A;  5FPA A;  2DVF A;  4I0W B;  4AYU A;  1CX1 A;  3VDA A;  1AZD A;  5A1A A;  5JDB A;  2HWE 1;  3D4K A;  5A3T A;  3FZ3 A;  3BOD A;  1QNW A;  1OA4 A;  1OC1 A;  2CDP A;  3KS7 A;  4MUV A;  4JDM A;  2FDG A;  1JOJ A;  1B09 A;  1U5I A;  3PUA A;  3ORJ A;  4HVR A;  5LA2 A;  3IMM A;  2E7Q A;  1VBE 3;  3ACI A;  4JHZ A;  2JDH A;  2YC2 A;  1I5Z A;  3LFI A;  2RR1 1;  4CDU A;  1PO2 3;  1QHD A;  4ZKT B;  2RG4 A;  5BNP A;  2JDA A;  4NUB A;  2BQP A;  3CEW A;  1C1F A;  5EWS A;  5FKB A;  3M1H A;  1MS5 A;  3HN1 A;  2QQK A;  4ITC A;  1PZ9 A;  3TNQ A;  4HLT A;  4FAG A;  4GMP 1;  1YFX A;  2VUD A;  5JR7 B;  2XPJ A;  5FZB A;  1J3R A;  1W03 A;  3WF2 A;  4BQY A;  1ND3 C;  5A70 A;  3ZFG A;  4IGQ A;  5GZE A;  3VBR C;  4XF0 A;  3ZFG B;  2KR2 A;  5L9R A;  1UMH A;  2HWC 1;  1I9R A;  2ZEY A;  2NQY A;  4G4F A;  1OSG A;  1YUD A;  4NO4 A;  3ES4 A;  4QQ2 A;  5FYI A;  5F6K A;  3UGF A;  4SBV A;  5JOY A;  3U4X A;  5J98 B;  2PHT A;  3E6C C;  2HEY F;  1ZBE 3;  4BQ1 A;  2W2I A;  3DXU A;  3GJA A;  1NOV A;  4WV8 A;  1UNB A;  4GA9 A;  3MFA A;  4XFG A;  1DQ6 A;  5DZG A;  1IPS A;  4K40 A;  5A3M A;  1JUH A;  3WP4 A;  5I0S A;  3DPR A;  2D6N A;  1ZA7 A;  1YQ5 A;  1MPX A;  2ZZQ A;  4FQZ A;  4JDN A;  4MXW A;  4PQQ A;  4CCD A;  4CU9 A;  3O0V A;  1PO1 2;  4D69 A;  2WO7 A;  4LO6 B;  1QJU 3;  1RUO A;  2WNU A;  4GMP 0;  1PNF A;  1DG6 A;  4Q4X 1;  3BOP A;  3PUH A;  1V6K A;  3UJO A;  2JG8 C;  1QU0 A;  1VBB 3;  4P9W A;  4ZU4 A;  5AFE A;  3B3Q E;  1C8M 1;  3AVS A;  3QH7 A;  4E2G A;  5A3N A;  4K3U A;  4RSU A;  5EP9 A;  4IV1 B;  4B7E A;  4JGZ A;  1D4M 1;  2VUA A;  2JEM A;  1UZ0 A;  2ZS6 B;  3FX3 A;  4Z92 B;  1J1L A;  4E2Q A;  2VUC A;  5E8A A;  3VBH B;  5LEJ A;  2D40 A;  1DZT A;  4FCA A;  3VDC A;  1DGW A;  2DCT A;  1POV 0;  5HXM A;  3T0D A;  1W06 A;  2WQ4 A;  5CA6 A;  4OFG A;  3NJX A;  1E5S A;  1W6O B;  1LGB A;  4BE3 A;  4MOA A;  1SFY A;  2XHN A;  4I3P A;  4EZ4 A;  5F7U A;  5DUU A;  3W59 A;  3WF3 A;  1G7Y A;  3OUH A;  2XVL A;  3HQX A;  1ZRF A;  1SAC A;  4H2A A;  4MVT A;  4AE2 A;  3P3N A;  4ZHN A;  2QQP A;  3LEM A;  3Q8E A;  2D3P A;  1GZT A;  4UI9 L;  4AL9 A;  5T5P A;  1WLD A;  3VDD B;  4DUX A;  2JG9 C;  2DWR A;  2YFU A;  3OUJ A;  4NID A;  1EUT A;  1R1Z A;  4AHW A;  4COZ A;  3PMS A;  2VXR A;  1UY2 A;  2WNV A;  2Y6H A;  3O1U A;  3I49 A;  5BV6 A;  2R06 3;  1PVX A;  1JZ8 A;  4CXX A;  1Z0H A;  1Q5O A;  3U4S A;  3MIC A;  3WQB A;  1ND2 A;  1QGL A;  4CEY C;  4LE4 A;  4JC1 A;  1WW5 A;  4KWL A;  4QQH A;  1O4Z A;  2O8O A;  1DBN A;  4LUK A;  1RUD 3;  3B94 A;  4JVA A;  4LBN A;  5DAW A;  1O3T A;  1NYW A;  2B4K A;  5EV7 A;  4TXW A;  2PAE A;  1AR8 3;  1F35 A;  1X7N A;  4BME A;  2HWF 1;  3NJY A;  4IET A;  4HSJ A;  1W8Z A;  2WWJ A;  4QPG A;  3AZW A;  2JIC A;  3IPV A;  4RGA A;  2E53 A;  2H0B A;  1LEN A;  1OPO A;  2RS1 2;  2P5B A;  4JDO A;  3RRD A;  3TN9 3;  5CVR A;  5KC6 A;  4PDW C;  4JRL A;  5JZG B;  5DAX A;  1SBF A;  4FQ4 A;  2JD4 A;  3IDE A;  3NKG A;  1BMV 1;  2Y6L A;  4ES8 A;  3IM0 A;  2VMH A;  1MEC 2;  1RUG 2;  4BQ4 A;  5JWP A;  1T2X A;  1ZX5 A;  2VZR A;  4Y22 A;  2LTN A;  3P3P A;  4XE9 A;  3T1M A;  4HON A;  1LHW A;  2VZP A;  1PIV 3;  3S7E A;  4CUG A;  4F83 A;  5C5T A;  1RUC 3;  1C5I A;  3THP A;  1I1E A;  4NN0 A;  1KJL A;  1UIK A;  5F6L B;  3ZXK A;  2HKX A;  1XYO A;  1PZ8 A;  1B35 C;  2BEO A;  4MAD A;  4N53 C;  3WCS A;  4A7K A;  2ZX1 A;  2AUY A;  3WVJ A;  2XR4 A;  4GUL A;  4EN8 B;  2JDP A;  1O5L A;  5FZE A;  5IAT A;  1LU2 A;  1CAW A;  3D0J A;  2OPK A;  1MZ5 A;  1DYO A;  3AP9 A;  3WSO A;  3TN9 1;  4A3Z A;  1D7P M;  4QQL A;  3CMG A;  4FFH A;  3W9A A;  1QJU 2;  4UFK A;  1ZZB A;  1OHF A;  2D6M A;  4XAC A;  1L7Q A;  3RQ0 A;  5C3P A;  4Z07 A;  3GBG A;  2J22 A;  3LWC A;  4BB3 A;  2GZW A;  2PLV 2;  3E5X A;  4BIF A;  5FJH A;  2VVD A;  5FR3 A;  2QE3 A;  2WYF A;  4FPE A;  4JX0 A;  1WD4 A;  1OKO A;  5IAV A;  1WCQ A;  3PU8 A;  3RWN A;  5IVB A;  1S0C A;  5A80 A;  3OYW B;  3WDU A;  1ZRR A;  1WGP A;  1MS4 A;  1QJX 3;  2R7E B;  2OZ6 A;  2R06 1;  4EWD A;  4IND A;  5JCT A;  1UPS A;  1LCL A;  4L99 A;  3HT1 A;  1K12 A;  5C8C A;  3KT4 A;  2A6Y A;  4RHV 1;  2JG8 A;  2R0H A;  5CAD A;  1SLA A;  4LHS A;  1CON A;  2XBO 3;  4AGG A;  2BRT A;  2EAL A;  2VW2 A;  4E4H A;  3NQH A;  4BHP A;  5F5A A;  1V6M A;  1RUI 1;  3OD0 A;  1UPI A;  5E1R A;  4LLO A;  1WMD A;  5I0U A;  4TTG A;  5KXC A;  4XUO A;  4YVS A;  4R9D A;  2GSY A;  2YDE A;  2G19 A;  2W9X A;  5GLZ A;  4FFG A;  1GFF 2;  1NY7 2;  4YW2 A;  5FZ6 A;  2ZAC A;  4BQ2 A;  2VZ1 A;  3LDR A;  2RM2 3;  3KCX A;  5LY2 A;  2GP5 A;  4XZP A;  2D6L X;  3SLI A;  3N7M A;  3LA7 A;  3GGL A;  4XEZ A;  4G9S B;  1LUL A;  1W8T A;  4DNY A;  2V73 A;  2LRP A;  3VHN A;  4CU8 A;  1LNS A;  1R09 3;  2EXH A;  1ENR A;  2J1E A;  3C7G A;  4ZY9 A;  1FI2 A;  2CGP A;  2B5H A;  2QBX A;  4LXL A;  2WO2 A;  5GLV A;  1WW6 A;  4QWN A;  2QDR A;  1NG0 A;  3ZO0 B;  4UF0 A;  4Q4X 3;  4AF9 A;  4BJ0 A;  1W0O A;  1H8V A;  1YWK A;  3DYP A;  2Q5T A;  4YGE A;  4JGY C;  1ND2 B;  3HBK A;  1LU1 A;  1RXF A;  3R4D B;  3WX5 A;  2WLQ A;  1GNH A;  1CWP A;  4HBN A;  4WM7 C;  1C1L A;  1DGW X;  5F39 A;  2P6C A;  2PAK A;  3BKZ A;  5FY0 A;  2ARX A;  5J3U A;  4Y33 A;  1AYN 1;  5FRE A;  3KM5 A;  2E9Q A;  3MID A;  3T4V A;  1NCR B;  4CP9 B;  4B29 A;  3H50 A;  5AFB A;  2VOT A;  3OGV A;  2EIE A;  1YQ8 A;  1EAH 1;  1DU3 D;  4KBB A;  2Q8C A;  4QPY A;  3AP6 A;  2RHP A;  3AKS A;  2UWB A;  1OUS A;  2XOM A;  4MO3 M;  3NJZ A;  4NRP A;  3KV4 A;  1G9D A;  2W1S A;  5FPU A;  1RJ7 A;  1URX A;  3NV4 A;  1XE0 A;  5APA A;  3RPQ A;  2WZ8 A;  1GQH A;  3VBR A;  2Q1F A;  1DGR N;  1JTZ X;  4GZ9 A;  2PA7 A;  4A44 A;  3J8F 1;  4Q1R A;  1VBE 1;  2CWM A;  4X6R B;  2OVU A;  4Y1X A;  3SKV A;  1B35 A;  2D43 A;  3HEI A;  1NX9 A;  2CGN A;  4UBG A;  3I3B A;  1VBA 1;  4JAA A;  4QPI B;  1IS3 A;  1CJD A;  2XXZ A;  4LBJ A;  2K0G A;  1GZW A;  4WM8 C;  1BLZ A;  3AYA A;  3ZPO A;  1QOT A;  1TMF 3;  2AC1 A;  3RWK X;  1J84 A;  5DXD A;  2VOW A;  1O8P A;  3OY8 B;  1TME 3;  1MQT B;  3EJK A;  4AEK A;  4YM1 A;  1VIW B;  2DVG A;  1RC6 A;  4HFS A;  4R9B A;  2VME A;  2DVA A;  3RI8 A;  5T55 A;  3AZX A;  4AW7 A;  2Y6G A;  3DGT A;  1TEI A;  5FZG A;  3HVD A;  1SHW B;  3VBO B;  4M3C E;  4N9I A;  3WT3 A;  5C3O A;  4FPJ A;  2PMW B;  3NNL A;  4FT8 A;  2WRA A;  3CO2 A;  4YG0 A;  5FXX A;  4D7Y A;  4I3G A;  3KHC A;  1ZRI A;  1CJP A;  1MVQ A;  3CDZ B;  4S2F A;  3CJX A;  2XL9 A;  3MDP A;  5FZ7 A;  1YYN A;  3VBH C;  2JX9 A;  3V0A B;  4UYB A;  1TVG A;  1K5M B;  5LB6 A;  1VRH 1;  5FYZ A;  4E27 A;  3M70 A;  1A8M A;  1GNY A;  5I0T A;  1VBC 1;  1HRI 1;  4IL7 A;  2DFB A;  1W04 A;  4QAW A;  4C1X A;  4WVM B;  4U2A A;  3WY6 A;  1Q8Q A;  1RUH 3;  5FZ0 A;  1QDC A;  4V2V A;  1FYU A;  4BWO A;  1HRV 3;  2WO3 A;  2JG9 A;  3P1I A;  1RUJ 3;  1W8H A;  4UBH A;  5JIU A;  5FWE A;  4GWM A;  1Y43 B;  4EN6 B;  3RZZ A;  1ODN A;  3POJ A;  4H3W A;  4QGL A;  1Q8O A;  3LPG A;  5A3U A;  3T2Q A;  4AI2 A;  1WME A;  2FZ1 A;  3SCF A;  1W6M A;  3R05 A;  3E5Q A;  1FV2 A;  5FYH A;  1OOP A;  1ZZ7 A;  3I3D A;  2WWS A;  4O61 A;  3OF1 A;  2Z79 A;  5JVV A;  3ZYG A;  3O5S A;  2DUQ A;  4E8C A;  1PGL 1;  1QIQ A;  3CKH A;  2XKP A;  1XC6 A;  1NLQ A;  3FHI B;  4GWN A;  3MUY 1;  1UYP A;  4MV2 A;  3QD6 A;  5SV5 A;  4CCC A;  2BU9 A;  2BVV A;  5H9R A;  4CA9 A;  2B45 X;  3VB9 A;  1TMF 1;  2DYC A;  5J09 A;  4CPB D;  1FMD 2;  1XU2 A;  4GH4 A;  1FNY A;  2A3W A;  5J37 A;  2R07 2;  1KQR A;  4EJR A;  4P5Y A;  4UFH A;  5D2A A;  3U11 A;  3C7E A;  3RZH A;  1LOC A;  1W9F A;  3ZYR A;  2WFF 1;  3OGR A;  3TB0 A;  4H55 A;  3C8X A;  4GB3 3;  4MGT A;  1VRB A;  1W2T A;  4CTE A;  2F4L A;  4IEY A;  1DLC A;  4XFA A;  4XTP A;  2VCC A;  4P9L A;  2X5I A;  4CP0 A;  4RQP B;  3PTY A;  4OUL A;  3N9L A;  2NM1 A;  2VM9 A;  5FZC A;  4EWE A;  2B9V A;  3ROU A;  2FDF A;  1UZZ A;  5CYY A;  3I8T A;  5FMC A;  1DQ0 A;  1D2S A;  4IUG A;  1SLB A;  1OVS A;  3ASI A;  3K46 A;  2XML A;  2XQX A;  2ZKL A;  5F3C A;  1VBC 3;  2CWS A;  2RDN A;  4X8N A;  1T6B X;  3IT8 A;  4Q4V 1;  5CAZ A;  1VAM A;  5GJ6 A;  4K9S A;  1W8F A;  4X8P A;  4QB2 A;  1SZB A;  3CF6 E;  5HCH A;  1OLQ A;  3RSJ A;  2BBV A;  2D5H A;  3E6D A;  5GZC A;  2VVE A;  4XJ9 A;  2YGM A;  5A33 A;  4K21 A;  5FZ4 A;  1JOP A;  3VZJ A;  4DIN B;  5AC9 1;  1W90 A;  4HSL A;  4CXY A;  5GZD A;  5LEK A;  4YFW A;  5CFD B;  3OBZ A;  1ZZ8 A;  3WR0 A;  5F3I A;  3JCI A;  5JSP A;  1NUK A;  4AAP A;  5C7G A;  3B93 A;  4HPK A;  1FAY A;  4AQS A;  4YPJ A;  2LRO A;  2W08 A;  1F5J A;  4NAM A;  4XHB A;  1G86 A;  1KDK A;  2GDF A;  4BM8 A;  2GME A;  1NA1 B;  3UT0 A;  5FUP A;  4BLI A;  2XGX A;  2ENR A;  5KXE A;  1UZW A;  1JU3 A;  1WCU A;  3WDW A;  4MGS A;  5IW0 A;  2DU1 A;  1OLR A;  2WJS A;  3ZIX A;  1HLC A;  1PIV 2;  4FXK B;  2CGO A;  1UOJ A;  2FCV A;  2R04 2;  4FPF A;  4Y1Y A;  1Q43 A;  1R08 3;  4B1M A;  2ORX A;  3IAQ A;  2Z4F A;  3WZ1 A;  4KU8 A;  1E5H A;  2PEL A;  2R04 3;  5FDB A;  1EUU A;  5FAX A;  2X29 A;  2XJT A;  1HRI 2;  3L2H A;  5DUV A;  1PMH X;  4ZS3 A;  4N43 A;  3A7Q A;  2HH9 A;  4R9A A;  5IT6 A;  3AX4 A;  4LIV A;  1AYM 3;  2FMY A;  4P08 A;  4O65 A;  4ET7 A;  1HXS 1;  3ZXD A;  1Q8P A;  2WAB A;  4JKL A;  2BPA 2;  5KBF A;  2ZGM A;  4Y20 B;  2WNU B;  1XNC A;  3LB9 A;  4C0H A;  4GH4 B;  1IS6 A;  1GIC A;  2CDO A;  3WDY A;  4AK3 A;  1D4M 2;  3AK0 A;  1EAH 3;  1S0I A;  3N35 A;  4XTM A;  1XYN A;  3I2J A;  3CHX A;  3JBG 3;  4OUM A;  3ZXF A;  2UU8 A;  2OA2 A;  4QX2 A;  1QH7 A;  3T30 A;  3AYC A;  2BTV C;  4S2G A;  4Y20 A;  5GZG A;  1DGR A;  2DCJ A;  3ME2 A;  4IV3 A;  4Z1V A;  4PIY A;  1GKB A;  1HDK A;  5CFC A;  1K5M A;  5A3P A;  4YZ2 A;  5C9A B;  5C5U A;  3VBF B;  3FMG A;  1JU4 A;  2D44 A;  3MLL A;  1W0N A;  4LE3 A;  5EJZ B;  2TUN A;  3RYK A;  3DV8 A;  1UXZ A;  2ZMN A;  2JB8 A;  1NCR C;  4HN1 A;  4Q0P A;  4UW3 A;  4DY3 A;  2DCK A;  1V6I A;  1XB9 A;  2ET1 A;  5L7O B;  3BIW E;  3D8C A;  2B42 B;  1IQD C;  1RIT A;  1GOF A;  1IS5 A;  5C6C A;  3MPP G;  1GOG A;  2HWD 1;  1Z78 A;  2VQ0 A;  4HPK B;  1BYH A;  3UV9 A;  5IVJ A;  4ATF A;  2X5I C;  1VP6 A;  5JPM B;  3S5Q A;  4KU7 A;  1WA4 A;  1HJG A;  4GB3 2;  2W52 A;  1NCQ A;  4XAB A;  4XFB A;  5FO8 B;  5HI0 A;  1SDW A;  1V0A A;  2ZX3 A;  1VBB 2;  3DL3 A;  2J1S A;  2CSG A;  4YG3 A;  2ES3 A;  4DOU A;  2WSU A;  1VAK A;  1QJY 2;  2BGC A;  2DV9 A;  3MYX A;  4K1Z A;  1GWL A;  2ZGS A;  4Q4V 2;  4JKK A;  1F5F A;  3BTA A;  2VW1 A;  3FL7 A;  3D82 A;  4UOJ A;  1UOG A;  3EB7 A;  2OW4 A;  3OGS A;  4FPL A;  4FPK A;  2IWG B;  1AF9 A;  4PIX A;  1GBG A;  5FZ1 A;  5C4W C;  1RUD 2;  2PAM A;  5FXZ A;  5FXV A;  3ZYI B;  1UX7 A;  3POW A;  4CDW C;  5LY1 A;  4CUA A;  2A1X A;  4RHV 3;  2QQJ A;  4KWJ A;  3IAP A;  2W5F A;  2V4V A;  4FBF A;  1MQT C;  1VBC 2;  1CIY A;  3SCG A;  3LPF A;  3TBD A;  5FY7 A;  5ABJ A;  4ONU A;  1UU6 A;  3AJY A;  1AR9 1;  4A2U A;  4MZU A;  5CKQ A;  5A1F A;  5LRR A;  1UF2 C;  2JIJ A;  1JXN A;  2QQV A;  4XYX A;  3EQE A;  5EFU A;  4NII A;  3UL2 A;  1O6U A;  4CSW A;  4HZF A;  2B8M A;  3VBH A;  3POF A;  3RGB A;  4DY5 A;  1CPN A;  1C28 A;  2GMP A;  1WCS A;  3H3Z A;  5KHH A;  4AXO A;  1UXX X;  3B9I A;  3PUI A;  2EIB A;  4OUS A;  4BYY A;  1PO2 2;  3LKJ A;  4XUP A;  4D94 A;  3RYR A;  3GNE A;  3EHK A;  5C33 A;  1YQ2 A;  3HIF A;  3KVA A;  3BPS A;  2AR6 A;  3UJQ A;  4XJA A;  5CBL A;  3BTZ A;  3OCP A;  5B4N A;  1RJ8 A;  2XBO 2;  4BQW A;  2WA4 A;  3I2K A;  1SQ4 A;  3H3U A;  1RUC 1;  2ARB A;  2HEW F;  4UW4 A;  1GLH A;  1JOB A;  4JGZ B;  2HWD 2;  1JHJ A;  3U14 A;  5ACA 1;  5LRS A;  3ES1 A;  1C8M 3;  4XW3 A;  1S0F A;  1JYT A;  5GKA C;  1VBB 1;  3WQ0 A;  2L9L A;  2IXL A;  1PVC 1;  3WNM A;  5K7P A;  1N1T A;  2ZMK A;  1NCQ B;  3ILR A;  4M4P A;  3SEE A;  2Q1Z B;  4WM8 B;  4NPR A;  1W8U A;  1GUI A;  2Z42 A;  4W65 A;  2R06 2;  2ZGO A;  2FBE A;  4W6W A;  4XIK A;  4LTA A;  5IVF A;  3H9A A;  1OF4 A;  4Y5T A;  1RMU 1;  5LBE A;  3SQO A;  4DXS A;  2Y38 A;  2HWD 3;  2ZAH A;  3VD3 A;  3LGR A;  3SHR A;  5FYT A;  4FP2 A;  3BYW A;  3I2F A;  3VHR A;  3VD5 A;  1HN0 A;  4FPY A;  1ENQ A;  1AR8 1;  2WC2 A;  3GHM A;  1W2U A;  5BYN A;  2WN2 A;  3VBO C;  3LA3 A;  1BZW A;  1LES A;  3KT7 A;  1ZNP A;  3LOI A;  3HNM A;  4RGG A;  4E4S A;  2WBK A;  5JXJ A;  5FP8 A;  1POV 3;  2XDV A;  4NHK A;  3K77 A;  3LDB A;  5FIX A;  4NIG A;  1H4G A;  1WBL A;  2VG9 A;  1MS8 A;  2DBI A;  1FXZ A;  3CU7 A;  4LBK A;  1AHS A;  3V0A A;  3MIB A;  1W9S A;  2XJR A;  4COY A;  4YVW A;  1AYM 1;  2F17 A;  2YGL A;  3FE5 A;  1G9C A;  4XQ4 A;  4AEJ A;  2DUP A;  1W8N A;  2JDU A;  2VXJ A;  3J7M A;  4M3C B;  3T08 A;  1VBE 2;  4RQP C;  1Y3T A;  1QNY A;  2QTW B;  1SBE A;  2DBN A;  2GN3 A;  3DYM A;  2C5D A;  3ILF A;  3RJ2 X;  3U07 A;  3ZKY A;  4E8D A;  2YU2 A;  5F1R A;  5CKM A;  2IXJ A;  3VKM A;  3VBF A;  4A6O A;  4XBN A;  4JQT A;  2AYH A;  5JR2 A;  5F8P A;  2GH8 A;  1JW6 A;  4KG0 A;  4QHB A;  3ZR5 A;  3AZZ A;  4YZ3 A;  5JSR A;  3CNA A;  5FZI A;  5F32 A;  4XUR A;  3U37 A;  4QX7 A;  3WNL A;  4EN9 B;  1SDD B;  3AVR A;  4LPL A;  1OA2 A;  4GIQ A;  3LE0 A;  4G3Y C;  3I2D A;  4P9Y A;  3S57 A;  2DCY A;  2JE8 A;  1IPJ A;  5A7Q A;  4BIS A;  3S0M A;  1CAU A;  5FFO C;  5FXW A;  1COV 2;  2MNG A;  2YB7 A;  5FYU A;  4J1W A;  3KHB A;  5FZA A;  4MGK E;  3VKF C;  5C71 A;  4XQW A;  1W2A X;  4COW A;  4KMQ A;  1KJR A;  2VQA A;  1C8M 2;  3A23 A;  2OUJ A;  5JMO A;  1JHN A;  2BBA A;  2EAA A;  1DDL A;  4RD7 A;  4Y3O A;  2VVF A;  4LOS A;  4OI4 A;  4GKX A;  5IWF A;  1XNT A;  3NRU A;  3ZN4 A;  1ODM A;  2AEZ A;  2WIN B;  4N9H A;  5AC9 3;  4BDV B;  2Y0O A;  2ZHN A;  4LHL A;  5FBJ A;  2WKK A;  1OFS A;  1CN1 A;  3OUI A;  1CZV A;  1HIX A;  4MGQ A;  4PHZ A;  3GZT B;  3IMN A;  3G7D A;  5FMO S;  4YM2 A;  3VKO A;  4CCJ A;  3WLU A;  4NR1 A;  3AJZ A;  1QEX A;  4W50 A;  1MEC 1;  2CAV A;  5E88 A;  5JZG A;  1H2L A;  2W94 A;  1KIT A;  2AEY A;  3VN4 A;  2QUO A;  3D3A A;  3PVE A;  4HET A;  3NV1 A;  5EJ3 A;  1PMJ X;  4WZF A;  1H1M A;  4LO7 A;  4UF0 B;  1J83 A;  5AVP A;  4ASM B;  4GAZ A;  4R9C A;  4CP9 A;  4QKD A;  5FZM A;  2RDQ A;  3BTX A;  4XFC A;  3T2O A;  2GAL A;  3M3I A;  4AI9 A;  2KM2 A;  3ALQ A;  4QXH A;  4HMZ A;  1ZBA 1;  1SPP A;  4BLJ A;  3RJR A;  1UZY A;  4KWU A;  1JYI A;  1K3I A;  3PNA A;  3SEP A;  4M00 A;  1AUY A;  2AEN A;  2E31 A;  2FCT A;  3UNP A;  4WVV A;  2HWB 1;  1H4H A;  5HCB A;  2WWU A;  1CAU B;  3ILN A;  4XDO A;  3BIE A;  3V65 A;  3RZJ A;  4GH4 C;  1PK6 A;  2JEN A;  2W95 A;  3I59 B;  3FLP A;  4NHY A;  1GAN A;  2ADD A;  2Y8K A;  4YZ5 A;  1R1A 3;  2VR4 A;  1H8T B;  3T3Y A;  2FDH A;  5DAV A;  2OYZ A;  1HV1 A;  1LEM A;  1QY4 A;  3ITQ A;  1H2N A;  3JD7 1;  4PF1 A;  2VOV A;  1HJF A;  4XCB A;  1QJY 3;  4UAP A;  2WL1 A;  2VZT A;  4GB3 1;  4P9I A;  5M0T A;  1F8V A;  2WZP P;  1H6X A;  1ST8 A;  3AMN A;  1QH6 A;  2EA7 A;  3EBR A;  1VAL A;  4JTN A;  4YVW B;  4BXS V;  3TRS B;  1RUG 1;  4NIH A;  3MF6 A;  1VRH 2;  1AR7 1;  1NZI A;  4PBO A;  2W92 A;  1S55 A;  5DAP A;  3MLK A;  3C3V A;  1D0H A;  4Q0V A;  4AFC A;  1O8S A;  3ACG A;  2XON A;  3WNK A;  1R08 2;  1YJL A;  4BQX A;  3Q9O A;  1MAC A;  2J1R A;  3THC A;  4XUN A;  1W9Y A;  4QB6 A;  1ZA4 A;  3ZYB A;  4HVQ A;  2VOX A;  4NIA A;  3P6B A;  1LGN A;  5CEH A;  3B9C A;  2H6B A;  5EXO A;  4AVC A;  4LA2 A;  3WDT A;  1HRV 1;  4LKF A;  1K5J A;  4OI1 A;  4CZS A;  1JZ7 A;  1G9B A;  4P9J A;  2W1U A;  5FZL A;  1W6M B;  4Z2A A;  4FOV A;  3N3H A;  1CZS A;  1FPN 1;  2VCM A;  4N53 A;  3SH4 A;  4QM9 A;  4Y1V A;  3PUR A;  1RED A;  2VTX A;  4H14 A;  1X9T A;  2VH9 A;  4XCA A;  1SBD A;  4XDQ A;  2WA3 A;  2WFP A;  3B5L B;  1BBT 2;  3CL1 A;  3LFM A;  1F4A A;  4XF3 A;  4LA3 A;  1HXS 2;  5BNO B;  4FI9 A;  4W4Z A;  2VNV A;  2WNU C;  2BGP A;  2ZGN A;  3LA2 A;  1RUH 1;  2UWC A;  1WA6 X;  2YY1 A;  2ZBJ A;  1WW4 A;  3E1F 1;  2JJ6 A;  4IEZ A;  4UWD A;  3H1Y A;  3RDI A;  2JIG A;  1S2E A;  3J8F 2;  4P9G A;  4K20 A;  2RDR A;  4BZ4 A;  2VGD A;  2A6X A;  3HNY M;  1WLC A;  4OLL A;  5C4W B;  1JYW A;  3M4F A;  4P02 B;  4CCK A;  2HLE A;  2OX0 A;  2PTM A;  2J1A A;  3HMY A;  3TYJ A;  3CBN A;  2CNA A;  4IER A;  2WII B;  4Q1P A;  5JMC A;  2NZ9 A;  5L9V A;  4P9X A;  3KV6 A;  3PVB B;  3ZFE C;  4LIU A;  2BOI A;  4AI8 A;  1H9W A;  2AH2 A;  2BNM A;  3LIG A;  4J25 A;  4V2W A;  1A8D A;  4WVM A;  3VZK A;  3ZMO A;  2BER A;  1ASJ 3;  4RS5 B;  1LHN A;  2E51 A;  1GQP A;  2Y26 A;  2YC0 A;  3CJI C;  3H3L A;  4QPG B;  3FFQ A;  1ULC A;  4MSV A;  2A6V A;  1RUF 3;  2EXK A;  3I3Q A;  4BA6 A;  2Y0I A;  1UOF A;  1VBA 3;  2G9G A;  2ZGU A;  3PIG A;  1RUG 3;  2VQT A;  3WP6 A;  4CU7 A;  1AVB A;  2V5Y A;  5L7O C;  3N7L A;  3U75 A;  4PJY A;  3THD A;  4N43 C;  1TME 1;  3FBY A;  4LHK A;  4QX5 A;  2E26 A;  4C8D A;  3GCW A;  4MGZ E;  5IHR A;  3MW4 A;  3VD9 A;  2IUW A;  3NNF A;  1ZRD A;  3D6E A;  5HPO A;  4ZU7 A;  2GNT A;  3KSC A;  3JD7 3;  5K9Y A;  4UFI A;  3U0Z A;  1GWM A;  4KBZ A;  4D0Q A;  1MS1 A;  4EQV A;  2YXS A;  3N9O A;  1R1A 2;  2W46 A;  4GWI A;  2QFE A;  2R0F A;  3A22 A;  2BNN A;  4OQ9 A;  5F5C A;  3JQW A;  4CCN A;  1CAV A;  4CU6 A;  3J8F 3;  2P3Y A;  4CE8 A;  2ILM A;  2RMU 2;  1OLM A;  3R4S A;  4XET A;  1WWY A;  3VBR B;  2PLV 3;  2RS3 1;  2VBD A;  3MV0 1;  2OII A;  3WF1 A;  1J58 A;  4CEY A;  1ULE A;  4YW7 A;  4YGD A;  5A32 A;  4OI0 A;  4KG8 A;  2WQ8 A;  2VMC A;  2XQR A;  4CDW B;  3AP7 A;  1VLN A;  1GMM A;  2VUJ A;  2GMM A;  5GLW A;  2EID A;  1AYN 3;  2WZE A;  1Q3E A;  1X82 A;  2VBB A;  1UOB A;  4ARY A;  3ACH A;  3LEG A;  1W28 A;  1UO9 A;  2VZU A;  1XNK A;  1CES A;  3N36 A;  3U1X A;  1OVP A;  3B69 A;  4CP2 A;  1WCD J;  2GNB A;  2ZGL A;  4MGY E;  5DN2 A;  4PIZ A;  4YW3 A;  1AR6 2;  2BNO A;  3USU A;  4OUE A;  1ACC A;  4YZ1 A;  3O1P A;  3ETP A;  2YC4 A;  4NPM A;  4Q4W 3;  1W9W A;  3PJY A;  1BEV 1;  4BU2 A;  1S4C A;  5HCF A;  5L73 A;  2BW8 A;  4YLZ A;  5FYV A;  4JQR A;  5CZK A;  5HV4 A;  1NKG A;  2LS6 A;  5H9P A;  5C70 A;  2XB6 C;  3A21 A;  1H9P A;  4BK4 A;  1V6O A;  3OBA A;  2NYY A;  2ZGR A;  3V56 A;  1U0A A;  4IV3 B;  1PVC 3;  5LWB A;  2BYV E;  4QD2 A;  2VC9 A;  4IEX A;  2PHD A;  2RE9 A;  3WNN A;  2A75 A;  5IUQ A;  4LKD A;  2P4E A;  4XBQ A;  3KGZ A;  2AAC A;  2ZEW A;  3K75 B;  2QCS B;  1XJA A;  4NHX A;  2V4A A;  2X53 S;  3PHM A;  2HWB 2;  4R4X A;  1WZX A;  5C4W A;  1BK1 A;  1RUI 3;  1DZR A;  1OH4 A;  2ZHL A;  3ZSM A;  4AOC A;  4CCE A;  4OHW A;  4FFI A;  3IB3 A;  4TYS A;  5LA0 A;  1UKR A;  4CEW A;  2X05 A;  1QQP 3;  2UWA A;  2J1V A;  3L9J T;  2EF6 A;  1JZ2 A;  2XLF A;  1GP6 A;  4LT5 A;  4N8M A;  1DYP A;  1RUE 3;  2A70 A;  2Y64 A;  2IXI A;  4SLI A;  5T50 A;  5F9T A;  2FCU A;  4NWW A;  5L9B A;  2FDI A;  1O59 A;  2A3Y A;  4P14 A;  4AI1 A;  5C8C C;  2NN8 A;  4IEQ A;  5F5I A;  1AR9 3;  1UMI A;  2DDU A;  4CPB A;  4Q8K A;  5F5Q A;  5LCW L;  3WF0 A;  1HKD A;  3HNB M;  4OMC A;  1QJX 1;  4QX3 A;  2VEC A;  3S30 A;  3LSE A;  3VKL A;  4FSJ A;  1POV 1;  5AVA A;  4ORF A;  3AP5 A;  3ZM8 A;  1CAX B;  4FTB A;  3MW3 A;  2D97 A;  3OEB A;  2X10 A;  3PME A;  3OJB A;  5IK8 A;  4FTS A;  1A78 A;  4PDW B;  4CXW A;  5JZG C;  3CZU A;  3RZG A;  2D6O X;  3RFR A;  5FYB A;  1AR6 1;  4Q27 A;  4IDZ A;  3OGG A;  3T1L A;  4AI0 A;  4OI2 A;  4OZX A;  2JD9 A;  5HXV A;  3O1R A;  3WW1 A;  2VMD A;  1AL2 3;  5D8A A;  5JXH A;  5FYM A;  5T5O A;  3WNX A;  1NA1 A;  1C8N A;  4EV0 A;  1RIR A;  2GND A;  4XJZ A;  5CKN A;  4C91 A;  2GC1 A;  1QQP 2;  4NE9 A;  3S7I A;  1RUN A;  2YBK A;  5LK5 A;  4LK7 A;  2WN3 A;  1TMF 2;  3FN9 A;  4QPI A;  2FMD A;  4O7X A;  2YYO A;  3NW4 A;  3OPZ A;  4AED B;  1PK6 C;  1Q56 A;  2WT0 A;  4RN5 A;  1ZBE 2;  2D98 A;  5A3O A;  3ZN6 A;  3ZLI A;  4UW6 A;  3C7H A;  3KQ4 B;  4PLN A;  4QHZ A;  4EE2 A;  5LW9 A;  3K3N A;  4AHX A;  2YHJ A;  3I97 A;  1UYX A;  5FPB A;  3DEC A;  1KFX L;  5IVE A;  4Y5S A;  2RDS A;  1ULP A;  3K3O A;  1XND A;  1J1T A;  3EXU A;  3VBU C;  1WUV A;  1UAI A;  1X8E A;  2ZXQ A;  4YVW C;  2P6H A;  4FAH A;  3R0R A;  5J48 A;  4FPH A;  5EHD A;  5FZ9 A;  3VD7 A;  5BUV A;  4MG2 A;  3VDD A;  3AL6 A;  1O3S A;  3J7H A;  1XSR A;  1UCX A;  1RHI 3;  1RVF 3;  3AKQ A;  3ZMN A;  2ETE A;  5J36 A;  4I2O A;  1VR3 A;  1G9A A;  1RUE 1;  1O4Y A;  2ZX2 A;  4DPN A;  3IBM A;  1AXZ A;  2J1T A;  4HOO A;  4YW5 A;  3FLT A;  3NL1 A;  4NPL A;  1QDO A;  3ZYF A;  4RA0 A;  1QJX 2;  5JXG A;  1OMI A;  2YRO A;  3J26 N;  1BHG A;  3DCQ A;  3NVC A;  4L97 A;  1RIN A;  4XC9 A;  1ULD A;  2ZCW A;  2C26 A;  4Q26 A;  5EIY B;  1H0B A;  4JKM A;  1AR8 2;  4HK9 A;  4RS5 A;  2VMI A;  1UMZ A;  3AXD A;  4AZZ A;  4MXV A;  1WLW A;  2QNK A;  1VBD 3;  3GYD A;  1XNA A;  1H6Y A;  2A7A A;  3G6J B;  2I2S A;  4PT6 A;  1D4M 3;  3FFZ A;  4B4R A;  3WOG A;  5BY5 A;  3Q8B A;  1W0P A;  1W39 A;  2PHX A;  2WT2 A;  2NP0 A;  3NKT A;  5LAS A;  1AL2 2;  1JN2 P;  1UIJ A;  4B1L A;  4GD4 A;  3CIH A;  1H2K A;  4OVE A;  1UY4 A;  4A3X A;  1QXJ A;  1RYY A;  3ZYH A;  3JB8 A;  3M8L A;  1MVE A;  3ZFF A;  1RUC 2;  4M3C A;  5HV0 A;  1IZ3 A;  1S1A A;  1FOD 2;  2W3J A;  4YVS C;  3GDB A;  3NWK A;  4CCL A;  5DAB A;  4WM7 B;  1C57 A;  2PFW A;  5LA9 A;  2WNO A;  4Q4W 2;  4IE6 A;  1YFU A;  4LKS A;  1PGW 1;  5L19 A;  1ZBE 1;  4D6R A;  2KXL A;  1ULG A;  1F4H A;  2J7M A;  3CJI B;  2CY6 A;  3F95 A;  5ISL A;  2HWC 3;  3QH6 A;  4YW1 A;  1Y9Q A;  5L7O A;  1RTV A;  1AR9 2;  1JI6 A;  3GZU C;  1OUX A;  4XF9 A;  3A0K A;  4N7I A;  4DO0 A;  2R07 3;  5FP9 A;  3WD5 A;  3C7F A;  1CPM A;  2XJP A;  3M2M A;  4LMF A;  3I4I A;  4BOW A;  1WKY A;  2ZML A;  2PHW A;  1XXN A;  3HT2 A;  3JBG 1;  1VMJ A;  4AQT A;  1ULO A;  4S2H A;  3WG1 A;  1PGW 2;  4FO9 A;  2RR1 3;  2ZA9 A;  3OTF A;  2P37 A;  1KEX A;  1JS9 A;  1MS9 A;  4PBP A;  2VW0 A;  4QU1 A;  4AVT A;  2OT7 A;  1I5P A;  2FDK A;  2PHF A;  5BNO C;  3BTY A;  3USS A;  4P5H A;  1IKP A;  1UYY A;  5T5L A;  2HYK A;  1IS4 A;  1UY0 A;  3K48 A;  1PO1 1;  4MHR A;  1D0G A;  4KWK A;  1GZW B;  1S2B A;  4QPI C;  1TNR A;  2VQU A;  3SIS A;  4HKL A;  4DUW A;  4JV4 A;  3LEK A;  5FY4 A;  4ZPI A;  3W5N A;  2WFF 3;  3VZO A;  1AR7 2;  1EPW A;  1W3X A;  1XSQ A;  3AMP A;  1HQN A;  5FY1 A;  2YPJ A;  1RUF 1;  5D21 A;  3POY A;  1BVP 1;  3DXT A;  5JAX A;  4RR3 B;  1PX3 A;  3KT1 A;  4IEU A;  4XQD A;  3DYO A;  3N7K A;  1WD3 A;  3BGA A;  2ZJC A;  2OQ6 A;  3VHP A;  5FQ0 A;  3K4Z A;  2MEV 3;  4YW6 A;  4AWD A;  3HPN A;  4Z82 A;  3NNM A;  2F4P A;  4BQ3 A;  5EJ1 B;  4L11 A;  2FDJ A;  4N90 A;  2UYA A;  5FOJ B;  3FLR A;  3KLS A;  2WYS A;  3A0N A;  4GKY A;  2QDN A;  3GHN A;  1A6C A;  3MIE A;  1MZE A;  3ZXG A;  1YCI A;  1S0E A;  2WS9 3;  2X09 A;  3ZKU A;  4AHY A;  4W8J A;  4AVS A;  1T6G C;  5C3Q A;  4L9B A;  1M06 G;  3NST A;  1YQC A;  1H8T A;  2UY8 A;  3OBR A;  2G9F A;  4X6Q B;  5DZF A;  4XUQ A;  3MF9 A;  3UET A;  2W47 A;  3I59 A;  1RUJ 1;  2XWB B;  2K2S A;  3T0B A;  2P1B A;  4WZC A;  1GZ9 A;  2ZGK A;  2Y6F A;  5H9S A;  1IOA A;  1U12 A;  4A7Z A;  1KD7 A;  1TNF A;  4RFT 0;  1Y4W A;  3KD4 A;  4QQP A;  5A7N A;  1SPP B;  4Q4V 3;  4DEV A;  4ES9 A;  4CEW C;  5LK7 B;  1FX5 A;  5FKC A;  1FPN 3;  4IW3 A;  1AJO A;  4IEV A;  2E33 A;  1W6N B;  1QJF A;  5JSO A;  3WQ1 A;  3HQU A;  4HXC A;  2BZD A;  1EV1 3;  5BNQ A;  1ULF A;  1REE A;  1ND3 B;  3KCY A;  4GAL A;  4JTO A;  5I0D A;  2C4X A;  1SCS A;  2P34 A;  4C90 A;  1C5H A;  4BH9 A;  1RUJ 2;  4NRM A;  5KHG A;  4N7U A;  1QMJ A;  1HRV 2;  4M01 A;  2RS1 1;  1UYZ A;  5FLJ A;  5A6Y A;  1UZV A;  1CAV B;  1W6N A;  3UKT A;  1QF3 A;  4PLO A;  2ZGP A;  2Q1M A;  5EYY A;  3MFC A;  3KF3 A;  4CCM A;  1VBA 2;  3LIH A;  5H9Q A;  2BFU L;  3WXP A;  1AL0 G;  3O14 A;  3ZOI A;  1EPZ A;  1Y7B A;  1DP0 A;  3RZL A;  2BP6 A;  1QJY 1;  2OPW A;  1DQ5 A;  5A3L A;  4CP1 A;  1YNA A;  4LBO A;  2I07 B;  5F2S A;  1AYN 2;  1E5I A;  1R1A 1;  3ETQ A;  2PXJ A;  4B4Q A;  3O1V A;  1FMD 3;  3D5O A;  2P17 A;  2JG8 B;  1S0D A;  4GXL A;  2NLR A;  2JDM A;  1WLT A;  4M0N A;  1OOP C;  3WCR A;  4XIL A;  2ZGQ A;  1SLI A;  3AXE A;  3UES A;  2RMU 3;  4TSV A;  1G8W A;  4Q8L A;  4OCT A;  4A4A A;  4DRR A;  1SFN A;  2R1B A;  4MXW B;  1ZBA 3;  3CZJ A;  5A6Q A;  2VUL A;  4ZON A;  1RMU 2;  2E63 A;  1IG0 A;  3MLJ A;  4ISR A;  3MEP A;  3LQC A;  3LZZ A;  1FNZ A;  1C4R A;  4OMD A;  4Y4Y A;  5GZF A;  1J59 A;  4CUB A;  3KZ4 C;  5FMB A;  1FOD 1;  1QJZ A;  3M7A A;  3OYW A;  1TG7 A;  2XLA A;  4FVV A;  5EYX A;  2OS2 A;  3PU3 A;  4UFM A;  4QX1 A;  1DYK A;  4FOQ A;  2ID4 A;  4IQP A;  4TN7 A;  3URF A;  4QXK A;  3AMM A;  4AVV A;  3KVB A;  4LO4 B;  3RMX A;  2PYT A;  1LOG A;  2CYF A;  2GU9 A;  1HRI 3;  3RZK A;  4I02 A;  5DDJ 3;  1LOF A;  1JBC A;  3WEZ A;  4FPC A;  2JKX A;  5BNP C;  4OHZ A;  1Q8S A;  1O91 A;  1KFU L;  4AHZ A;  4URT A;  3VV1 A;  1V9U 2;  3I7D A;  2JG9 B;  3JZV A;  3DKQ A;  3OSD A;  5FP7 A;  2E7T A;  2V72 A;  1RUF 2;  4QGM A;  1ENS A;  5JLV A;  4TZD A;  3NV2 A;  4C1W A;  4H7L A;  4CDU C;  2XG3 A;  2H6C A;  3RMY A;  4AR2 A;  3VBU B;  3KCC A;  4YGB A;  3PDQ A;  3UYJ A;  1STM A;  4NAO A;  5DUW A;  4XAE A;  1YIF A;  4I0B A;  3O1T A;  2PN5 A;  1ZZ9 A;  3BU7 A;  1IHM A;  1YRZ A;  4ERO A;  3IPV B;  3KGL A;  2G9Z A;  3N9P A;  1OXC A;  1S0G A;  2VOK A;  3FJS A;  2WR9 A;  5FJK A;  3VZL A;  3WQ7 A;  1YI9 A;  4AI3 A;  1JH5 A;  1X8M A;  3NAP C;  1Z7S 3;  4QQO A;  5FMO L;  5FK7 A;  2FZ2 A;  4FP3 A;  1GR3 A;  5EPA A;  3QOP A;  1OF3 A;  1W99 A;  4UT5 A;  2IXK A;  1XPW A;  3PJQ A;  3O1S A;  2R6Q A;  5JUV A;  3HAG A;  4KI5 M;  5F37 A;  2EIG A;  2VD7 A;  4U36 A;  1JUI A;  2K9Z A;  2GC3 A;  3T2T A;  3UKV A;  1VAV A;  3LCP A;  2WDB A;  1BQP A;  5CG9 A;  1MQT A;  2AGS A;  2YZ4 A;  4LBQ D;  4LO5 B;  3ZVX A;  4CDW A;  1YEW A;  4CDQ A;  5FRA A;  1GU3 A;  2ZX4 A;  3IZO A;  1ENX A;  4R8H A;  5IK4 A;  3VKN A;  3ZXL A;  3K4D A;  3AB0 A;  1PK6 B;  4FOY A;  3S6P A;  1K45 A;  5BXX A;  5FZ8 A;  3GM8 A;  5FOB B;  5KHJ A;  4W6X A;  3ZIW A;  2HWE 2;  2H0V A;  1OUR A;  1GV9 A;  1REF A;  2RV9 A;  3AFK A;  4YWA A;  4D8M A;  3BB6 A;  4L92 A;  2UY9 A;  4CDX A;  4TLG A;  2QZ2 A;  3K51 A;  1WW7 A;  3FUO A;  4E9K A;  2R32 A;  4Q4Y 1;  2YBS A;  3ZSE A;  3JXS A;  4Y5Z 0;  2DUO A;  3BAL A;  4XFI A;  3GAL A;  4YNI A;  3SNM A;  3OB8 A;  4QMA A;  5FY8 A;  3ENR A;  1VPH A;  2BGO A;  4A42 A;  4DXR A;  4DQA A;  1PZ7 A;  1SG3 A;  2C6S A;  2XUM A;  2B46 X;  3AM2 A;  1COV 1;  3FBM A;  4Q0U A;  3I3E A;  3MHZ A;  2R16 A;  4Y1Z A;  5D8A C;  1H30 A;  3H0O A;  2NMN A;  2YMZ A;  5E6H A;  3IDC B;  5LBC A;  3WDX A;  4MET A;  1X9P A;  3VBS C;  3ON7 A;  3H7Y A;  4DRV A;  3I2G A;  1W2N A;  1XOY A;  2WNV C;  2CHH A;  4Q0S A;  2ARA A;  2EXI A;  4ZZ5 A;  1XE8 A;  4OHY A;  3HD8 B;  5ACA 3;  5K0U B;  2WZR 3;  3J9S A;  5F2W A;  3T4H B;  1F15 A;  2JE9 A;  5KWR A;  3MZH A;  4XFF A;  1AXY A;  5CFC B;  2BOJ A;  4K8R B;  5BNN A;  4QKB A;  1YQ6 A;  3ELN A;  3TOJ A;  3PVO A;  2FD8 A;  3WF4 A;  2WS9 2;  4Z8B A;  2G1M A;  1QKQ A;  1XYP A;  1KS5 A;  3AKT A;  3KWV A;  4ISQ A;  4AG4 A;  3VBU A;  4E2S A;  5KXD A;  1Q8V A;  2RM2 2;  5DZE A;  1PX4 A;  2VCA A;  4LBM A;  4PQ9 A;  4LK6 A;  2XL7 A;  4AEM A;  2A73 B;  2FQP A;  5FZO B;  1LOF C;  3WW3 A;  4I09 A;  2YBP A;  4XF1 A;  1A34 A;  1DGL A;  2UUR A;  2CL2 A;  2YU1 A;  2P3J A;  2JE7 A;  5KC5 A;  2XHK A;  5FCC A;  1LOD A;  5CNA A;  5DUX A;  5CIS A;  2JDZ A;  1HN1 A;  4WVZ A; 
#chains in the Genus database with same CATH homology
 2B9V A;  2LS6 A;  2RVA A;  3I2H A;  4A45 A;  4ZZ8 A;  3A21 A;  5C70 A;  5CYY A;  4BK4 A;  3OBA A;  4IUG A;  3K46 A;  2YFZ A;  4OYU A;  2XQX A;  4DUV A;  2VC9 A;  4AAX A;  3WNN A;  2Y6K A;  2ZEW A;  3K75 B;  2W91 A;  2ZEX A;  2J1U A;  4QB2 A;  1OH4 A;  3VD4 A;  3IB3 A;  4QPW A;  5LA0 A;  1NUK A;  2X05 A;  5C7G A;  2VZS A;  2J1V A;  4BK5 A;  4YPJ A;  5B4X A;  1JZ2 A;  4CVU A;  2Y64 A;  1JYN A;  5CZK A;  2VZ3 A;  2EIC A;  1O59 A;  1JU3 A;  4MGS A;  3F2Z A;  5DMY A;  2KD7 A;  1UMI A;  2DDU A;  5LCW L;  3WF0 A;  3CQO A;  3HNB M;  4OMC A;  2QQN A;  4QX3 A;  2ORX A;  3IAQ A;  2Z4F A;  3ZM8 A;  1OT5 A;  3OEB A;  1EUU A;  2X10 A;  3W5M A;  5IJR A;  3MUZ 1;  1L7R A;  4A41 A;  1PMH X;  3CZU A;  3A7Q A;  3I2I A;  4P08 A;  4ET7 A;  2JD9 A;  2VMD A;  2VZQ A;  4JKL A;  2WAB A;  2CDO A;  1UWW A;  4M4R A;  1JYX A;  3I2J A;  2C9K A;  2WN3 A;  3FN9 A;  4GWJ A;  4QX2 A;  2DCJ A;  4DEQ A;  4RN5 A;  3OG2 A;  1CX1 A;  3VDA A;  5A1A A;  3EYP A;  3C7H A;  1JU4 A;  2CDP A;  1W0N A;  1JZ5 A;  3AC0 A;  5EJZ B;  1US3 A;  3I97 A;  1UYX A;  1UXZ A;  4P00 B;  3DEC A;  3NNG A;  5LA2 A;  3ACI A;  4JHZ A;  1ULP A;  2YC2 A;  2DCK A;  2JDA A;  2ZXQ A;  1IQD C;  1GOF A;  5FUI A;  1GOG A;  2QQK A;  3VD7 A;  3J7H A;  3WF2 A;  2J1T A;  1UMH A;  2ZEY A;  2J1S A;  1KGY A;  5JXG A;  2W1Q A;  1BHG A;  3GXU A;  4JKK A;  2C26 A;  3FL7 A;  5EIY B;  3ACF A;  4UOJ A;  3EB7 A;  4JKM A;  3OGS A;  1XNA A;  1MPX A;  3LEI A;  4PQQ A;  1H6Y A;  4CU9 A;  1UX7 A;  4PT6 A;  4CUA A;  2QQJ A;  3IAP A;  2W5F A;  2V4V A;  3PUH A;  1CIY A;  3CIH A;  3LPF A;  3WNP A;  1UY4 A;  3T2P A;  1RYY A;  1UZ0 A;  2WO1 A;  2OKX A;  3VDC A;  2W3J A;  5HXM A;  3GDB A;  3T0D A;  1UXX X;  1GOH A;  3NJX A;  3PUI A;  2EIB A;  4LKS A;  3HN3 A;  4MOA A;  2W1W A;  2XHN A;  5F7U A;  1F4H A;  4XUP A;  2J7M A;  3WF3 A;  1YQ2 A;  1JI6 A;  3ECQ A;  5B4N A;  2ZEZ A;  3I2K A;  4UI9 L;  3C7F A;  1CZT A;  3T0A A;  2YFU A;  4DUX A;  1EUT A;  1OD3 A;  1WKY A;  2WUH A;  3III A;  1JHJ A;  2V5D A;  3HJR A;  1ULO A;  1UY2 A;  2QQO A;  2Y6H A;  4RYD A;  3ABZ A;  2L9L A;  1JZ8 A;  3WNM A;  1KEX A;  3SEE A;  4M4P A;  3WQB A;  1GUI A;  2VO5 A;  1I5P A;  3NJV A;  2W87 A;  4DXT A;  2B4K A;  1OF4 A;  4TXW A;  4DXS A;  3VD3 A;  1UYY A;  1JZ3 A;  3I2F A;  1UY0 A;  3VD5 A;  2VQU A;  4DUW A;  2RJ2 A;  3LEK A;  2WN2 A;  3W5N A;  5JXJ A;  3HNM A;  2WBK A;  2Y6L A;  2QQL A;  2QQM A;  3K77 A;  1T2X A;  1PX3 A;  2VZR A;  4QDR A;  3DYO A;  1W9S A;  3BGA A;  3K4Z A;  2Y6J A;  2VZP A;  5LA1 A;  3HPN A;  1W8N A;  4QX0 A;  3T08 A;  4MAD A;  5EJ1 B;  3DYM A;  4E8D A;  3BN6 A;  3VDB A;  2WYS A;  4A6O A;  1DYO A;  2X09 A;  3WSO A;  4A3Z A;  5JR2 A;  4W8J A;  1D7P M;  2PQS A;  4XVH A;  3CMG A;  4XUQ A;  3U37 A;  4XUR A;  2W47 A;  3UET A;  3WNL A;  1L7Q A;  1SDD B;  3T0B A;  4LPL A;  2J22 A;  3LE0 A;  1W8O A;  2JE8 A;  4JX0 A;  4DEV A;  2HYX A;  2YB7 A;  1WCQ A;  5C71 A;  4KMQ A;  2R7E B;  2E33 A;  3A23 A;  5JMO A;  2BBA A;  5DPN A;  2BZD A;  1K12 A;  5I0D A;  5G05 L;  2C4X A;  4LHS A;  1XNT A;  3NRU A;  4BDV B;  2WAO A;  3NQH A;  1UYZ A;  1CZV A;  4MGQ A;  4TTG A;  4XUO A;  5IFT A;  3MBW A;  4W50 A;  2W9X A;  4L0P A;  5IFP A;  1JZ6 A;  2VZ1 A;  2ORZ A;  2W94 A;  3D3A A;  1DP0 A;  1PMJ X;  3GGL A;  1W9T A;  1J83 A;  1R64 A;  4CU8 A;  1LNS A;  3C7G A;  2J1E A;  4ZY9 A;  1P8J A;  2QBX A;  2WO2 A;  4QDQ A;  3FHQ A;  3T2O A;  3UES A;  4KWU A;  4BJ0 A;  4A4A A;  1K3I A;  1US2 A;  2VJX A;  3CZJ A;  3DYP A;  3SEP A;  3UNP A;  2E31 A;  1K42 A;  3LQC A;  4OMD A;  2W95 A;  4CUB A;  2Y8K A;  1TG7 A;  2VR4 A;  2YG0 A;  4QX1 A;  2ID4 A;  4PF1 A;  4QB1 A;  4UAP A;  2VZT A;  4QDS A;  1H6X A;  4BXS V;  3MV1 1;  2QQI A;  2VOT A;  3OGV A;  2EIE A;  3WEZ A;  2JKX A;  4ZXE A;  2W92 A;  2XOM A;  4MO3 M;  1O8S A;  2V72 A;  3ACG A;  2XON A;  3WNK A;  2W1S A;  3THC A;  2J1R A;  4XUN A;  2VTF A;  4QB6 A;  2VZO A;  3P6B A;  2WZ8 A;  2VL4 A;  4A44 A;  4GZ9 A;  3MO4 A;  1JZ7 A;  2W1U A;  3SKV A;  3IDA A;  4Z2A A;  1CZS A;  3HEI A;  1NX9 A;  3T09 A;  3I3B A;  1OF3 A;  1W99 A;  3SKJ E;  1XPW A;  1JYV A;  5JUV A;  4KI5 M;  1F4A A;  4FI9 A;  4W4Z A;  2BGP A;  1J84 A;  1O8P A;  3E1F 1;  2WDB A;  1NAE A;  3WNO A;  2VME A;  1JYW A;  3HNY M;  4P02 B;  1GU3 A;  4HG6 B;  2HLE A;  2VZV A;  2Y6G A;  2J1A A;  3K4A A;  1SHW B;  3C7O A;  3K4D A;  4XZU G;  1K45 A;  3GM8 A;  3HOB A;  1UY1 A;  3CDZ B;  2BER A;  2RV9 A;  4D8M A;  1GQP A;  4OZO A;  5JXH A;  1TVG A;  4CU7 A;  2VQT A;  1GNY A;  2VCB A;  3JXS A;  2VMF A;  4QAW A;  3THD A;  5IYY A;  2E26 A;  5IHR A;  2WAA A;  3VD9 A;  3OB8 A;  4CUC A;  2WO3 A;  5HPO A;  2BGO A;  3P1I A;  4A42 A;  4DXR A;  2LW8 A;  1SG3 A;  4D0Q A;  2E32 A;  3I3E A;  2W46 A;  4GWI A;  3LPG A;  3T2Q A;  3A22 A;  5J1X A;  1JZ4 A;  4CU6 A;  3I2G A;  3I3D A;  4E8C A;  4LQR A;  4ZZ5 A;  3CKH A;  5G04 L;  1XC6 A;  3MUY 1;  3MV0 1;  3WF1 A;  1UY3 A;  2WQ8 A;  2VMC A;  1GMM A;  2EID A;  2WZE A;  5JXI A;  5DQ0 A;  3FHA A;  3ACH A;  3WF4 A;  3LEG A;  4ARY A;  4ARX A;  4P5Y A;  2VZU A;  3C7E A;  4AG4 A;  4XUT A;  3OGR A;  1PX4 A;  2VCA A;  3C8X A;  5DN2 A;  4OUE A;  1DLC A;  3ETP A;  2YC4 A;  2VCC A;  1W9W A;  3OEA A;  2VM9 A;  1HN1 A;  1NKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...