3NRYA

Insights into anti-parallel microtubule crosslinking by prc1, a conserved microtubule binding protein
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
130
structure length
125
Chain Sequence
GAAALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into Antiparallel Microtubule Crosslinking by PRC1, a Conserved Nonmotor Microtubule Binding Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein regulator of cytokinesis 1
total genus 48
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2010-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3nryA00
3NRYA 5KMGP 3NRXA
chains in the Genus database with same CATH superfamily
1JNRA 4JI5T 2DI4A 1IAPA 4NIQA 5CB4E 4DMWA 4DR6T 2E2AA 3RRCA 3TLVA 2BBHA 4HFHA 2M6IA 3ZN0B 2IC6A 2XQAA 5CGMA 5HXSA 3C4WA 5TAOA 3AA1B 1D1CA 3PJAJ 3AA6B 1M7KA 4JI2T 2VL8A 2LM2A 1LKXA 2X0YA 5AQKB 1WYCA 3W15B 5L3GB 2VKDA 4L5GA 5JRCB 1MNEA 2Q9QD 3IHRA 5JTGA 4DR7T 1XZYA 2N9DA 3ONXA 3QB5A 3VKHA 2Q9QA 3B5MA 3P7IA 3AXJA 4WBOA 1NWMX 5HXRA 4IE7A 4HFDA 1Y64B 5AQOB 4LF6T 4IGUA 3ZT6A 5KXJA 4DV2T 3A8YC 3FZFB 3Q5XA 5J1GA 3RPUA 5HYAA 5LJMA 2NP9A 2X66A 3N9NA 4Z91A 3N9MA 1X9BA 4P09A 5JR9A 4YY3T 5JRCA 4JI6T 1J5ET 3PV0F 2KLQA 3RH3A 4LMJA 3SRZA 4TNWA 4PJNA 4JV5T 3RHWA 3O1HA 2JMKA 4OFZA 3ZLIA 3N9LA 4A98A 4CN6A 5LG4A 4DV1T 3RQUA 3GN5B 4E7SA 4YSZA 3T1YT 2W63A 5LB7B 2PG8A 3L3PA 4PFOA 5LOVE 4PK6A 4AQYT 2SPCA 3NRYA 2V8SV 2CRBA 5HEUA 4CN1A 5FXVA 2ZM0A 5FP3A 4YLHA 5LP6E 2XTLA 3ZJ2A 2LT3A 4LFBT 1XMQT 4JI3T 3A5XA 2BS3A 1UCUA 4LMLA 4X62T 2E9XD 2WQYA 1WFDA 3JAEA 3CMLA 4AKHA 2H3RA 2E9XA 2FBWA 4TWHA 2M67A 2CXFA 3EHZA 4ANJA 5C2TA 3IF8B 5M4YA 1Y01A 3E08A 2HH7A 1J5WA 3PUQA 5FY0A 3KDSE 4B6XA 3N9PA 1N34T 1BR2A 4CXWA 4EV6A 3KV5A 3AE9A 4HWFA 1W0AA 2W2UA 2X51A 3PJAA 1IBKT 3ZJ1A 4HFVA 2FJBA 4J2CA 3CQXC 4I0UA 2EHOD 3UQ7A 2XM2A 1W0BA 2V5DA 2ODVA 5AQFB 5FL1A 2LSGA 2UUAT 2QVAA 1D0XA 3F2EA 2LKGA 2HN1A 3OBVE 1SE7A 2E9XB 2CE7A 2YKSA 4M1PA 4MALA 4X64T 1H7CA 3JADA 4B3ST 1ZKEA 3FB2A 1E2AA 2V5CA 2W61A 1DU2A 4X20E 3Q5DA 2WSSV 2ZM2A 4IE4A 4PW8A 4EOZB 2A9UA 1XMOT 1ZV4X 2BKPA 3JC6C 2HHHT 4EAHA 3AE4A 4ILCA 2ZLYA 2WZIA 3MJXA 4GK5E 3AE3A 4L0RA 4PAGA 3EI0A 2DWGA 2W4XA 4YTMA 3CWZB 1S35A 4AKRB 3N2KE 1XNQT 3NBXX 1FJGT 3ETVA 5LXTE 4QX7B 2WZHA 4YHHT 4QWNB 5AQGB 3P4QA 3RRWA 3N9QA 3ZC1A 2LRLA 1W9RA 3NWIA 3C50A 1D0YA 3UU3A 2JRKA 4H9OC 5H6RB 5HCMA 4U2ZA 2BVMA 2CEAA 2CBJA 3L09A 4C90A 4XBFB 1N32T 3CX8B 3ZMVB 4F8HA 3J9X1 4HWCA 5L3DB 3AE2A 2KWIB 2L3LA 3LG7A 2L8KA 2WCAA 3P4SA 3ZYLA 3AVRA 4HWIB 4JI1T 1NAFA 4BJMA 4ISTA 2RA1A 4ZI3D 2BKNA 4DV7T 2V7KA 5EK2A 2EHOA 4GOUA 5LHHB 2YOEA 3F57A 2MBGA 3LJCA 3UFGA 1Z8UA 3FZKB 3ZC0A 3MA9A 2Z6EA 3EAMA 4WYVA 5IHYA 4KP3C 2X9HA 2Y8DA 5AQLB 3C4ZA 1G8XA 3KV6A 5HWYA 1U4QA 4XZCA 4DUZT 3R84B 3QNUA 3FZHB 2EHOB 1CHUA 3L8RA 5L4HA 3RX6A 1ZHCA 2J47A 4IE6A 3VRBA 3FHNA 4NXMT 4N78D 4EIWA 1YQ4A 5GONE 3RI5A 1OXZA 2FJDA 2BG9A 3RYIE 4I4TE 3A7MA 2XASB 5FXXA 4JEUB 3WI3A 3L39A 2X9WA 4DVDA 2NTYA 4B3RT 4X1IE 5FXZA 5LA6E 4QXCB 2WB5A 1FIOA 1YKHB 5AQHB 2KXPB 4U31A 2WY2A 3P8CD 5EK4A 2B76A 3RGLA 1QLBA 4JI4T 3OYXA 4YTPA 4HWHA 3RIUA 3PUAA 3MXZA 5ABEA 4DR4T 2FJEA 3AE1A 4NUVA 1LVFA 5LBMA 1WR6A 1XDOA 3E0ZA 3PUYF 4OHFA 4EXTA 3ZEFB 1MIVA 2PBIA 2KSRA 2LKHA 2BVLA 2PFVA 3H37A 5DQVA 5AQQB 4ZZCA 1OEDB 4LF7T 2LSYA 3KVBA 4G63A 3B13A 2W67A 4LFAT 5FNVE 3CPZA 5KMGP 2ODUA 2K24A 5HAXA 3UULA 2H88A 2V6YB 2B1EA 3I1AA 3AE8A 4CI2B 4A5XA 4H63H 3BQIA 4H9RC 2BG9E 1NEKA 4JUYA 4U2YA 5DQWA 4JI8T 1BR1A 1MMGA 2D2SA 3N2OA 3ONJA 5AQIB 3PTRB 3ANWA 3FXEB 5CFBA 4X1YE 3P4WA 4H9PC 1D1AA 3RKOA 4AKIA 2W0GA 2UXXB 2IMLA 3EVYA 3RQWA 2BBJA 4PK4A 1HS7A 4KHZF 2L9QA 4KUMB 4MFRA 5JR9C 4LF5T 1I6ZA 4PJMA 5ABFA 2P9BA 1VRBA 4YXDA 4DV3T 4UF0B 5FXWA 1T72A 1XNRT 5HEHA 1OEDC 3TLWA 2VL0A 1FMWA 2IC9A 3EUHA 2VVNA 5L3BB 4P0AA 2OA5A 2W62A 3HKEE 3LSVA 1OWAA 3LK42 2VB6A 4HN9A 3Q2MA 3KFWX 4ILBA 4OYJA 3N9OA 1KNZA 2N2NA 1D0ZA 1JNZA 4WW0A 1HNXT 1VCSA 4KMCA 2WU2A 3IA3A 2BG9B 3P4PA 4IL9A 2C5IT 4DBQA 3KINB 1MMNA 3PUSA 4IIJE 4UV9B 3J7Yq 4DMVA 4X1KE 4GYRA 5L47A 4KHPT 3UU5A 5EK3A 2VVSA 4YJ2E 4P1NA 3JAFA 2Q9QC 4Z90A 5L3CB 5JDHA 4BA9A 3AAIA 3KBUA 2WM9A 2WP9A 3O9XA 3AAAB 1G73A 3RKGA 2K9AA 4YSYA 4DV6T 3VKGA 4JBWF 4LMKA 4EZ4A 4L9IA 4QH5A 4COFA 3HKBE 4AXPA 3KV4A 3RC3A 5C8YE 2V7JA 2IIUA 1HF8A 4I55E 3M65A 4U3CA 3I9YA 4ZXLA 5BR8T 4AKGA 3NRXA 5ABHA 2XPKA 2WU5A 3E22E 3CIRA 2CHOA 2LSKA 2H7VC 3OJAA 4HFEA 4IREA 5HCJA 3RLFF 2KT9A 2JQ9A 4O4JE 5LCYA 2GK9A 3RYFE 5ADXL 2BS4A 2K48A 5JREA 2V26A 3IEEA 4PFPA 5BMVE 2ZM8A 2UUCT 3AB3B 2Q9QB 4OYKA 1MIWA 3UT5E 2W00A 2E5LT 3C4XA 5JDGA 3HKDE 5DABA 3ZMTB 4TV9E 2YDQA 5L2LA 4HFIA 3G06A 3LDQB 5FYMA 4GIWA 4LF9T 5ABGA 2E5VA 2XQ9A 2MYSA 5L4EA 4TNVA 2E9XC 4FI5A 5JDQA 2ES0A 2QYWA 2CWYA 3S4UA 4K0KT 1CUNA 2NWBA 3DTOA 1OEDE 3VRAA 2JJ9A 1SA0E 4FJOA 4O8SA 4UF0A 5AQNB 4Q25A 5FL0A 1VOMA 2YU2A 2J1DG 2XAJB 3KBTA 2IAKA 2CXLA 4IDPA 4UELA 4UVAB 3TLSA 4C91A 5CJ5A 5IUXA 5LHIB 2NW7A 4K0UA 5JDFA 4DR3T 2AXDS 4JYAT 4U33A 2E8IA 3PUGA 5HXEA 4DO0A 3C51A 5LBQB 5EZYE 2QA7A 4ADZA 4O2AE 5E0OA 5LJNA 2UXBT 5ABFB 4EGWA 4UR9A 5FY7A 3NVOA 5FKYA 2WDQA 1UURA 2XQ8A 2R6GF 5AQRB 2H89A 4ZI2D 5CA0E 2LHNA 3AECA 3OVUA 2XZEA 2X0HA 2WMNA 3JC6D 4MHCA 3SFEA 3UTKA 5LGTB 3AA7B 4O4IE 1KNRA 3KVAA 4WBNE 3FZLB 2NR4A 1VCTA 4H9QC 4AISA 5KDMC 1LVKA 2DLRA 4ILUA 4YFSA 2NOXA 4DUYT 4AQFC 1E1HB 2VWAA 2VK9A 3UUMA 3DP7A 3AEFA 2DCFA 2XJ7A 4NUUA 5ETWA 3I0QA 2CPTA 3WAKA 3AEBA 2WWVA 5LGNB 3M3ZB 1I94T 4HGAA 5HXCA 1KF6A 3U78A 2XQ4A 3VR8A 1HX8A 2XUEA 5HWXA 1FMVA 3F31A 4F6RC 4HWDA 4IE5A 4HE8A 3HKCE 3OKQA 4AIUA 3HA4A 4ZS3A 2NTXA 3EDVA 4DV0T 2X9YA 4ERRA 1YKEB 3U3IA 5JH7E 2WS3A 4UIGA 4ZI3C 3FXDB 3K3NA 4PNIA 4CI1B 1HG2A 3UU4A 2C5KT 4ZHQE 3CQCB 4QX8B 1IBMT 4MLKA 5HEGA 3OYZA 2KZ7B 4LF8T 4YT0A 4CXYA 5J0ZA 1HCIA 2YDSA 3ZSTA 2XQ5A 2XHEB 1M62A 2LSJA 3PU3A 1UUSA 4MBQA 4UV8B 4BAYB 2ACZA 2JQHA 2X9XA 3FBZA 2MTQA 2WMOA 4YJ3E 3EDUA 2VKOA 2XY8B 3UQ4A 3I9WA 4EZHA 2NW8A 1XDPA 3O1IA 5FVKA 3ZT5A 4YTNA 4GYSA 1ZEEA 2ACXA 3RYCE 3ONLC 1R8IA 3UUNA 3VHLA 2VQET 3LK2B 4QKNA 2WAUA 3QB5K 3H3AA 5AQPB 1U5PA 3X1DA 1BR0A 1HNWT 4TWFA 4TN7B 4OX9T 4HFCA 1O3XA 1Z0PA 2LHRA 3PDYA 2WDRA 3C64A 4DIDB 4BJNA 4JI7T 4X66T 1AJ3A 2X67A 4HTEA 1US7B 4TX5A 5FVLA 4EEBA 2XQ7A 2YK0A 1UX5A 2ZM6T 1UGOA 2UXCT 1HX1B 3FBLA 3T8OA 4UXNB 1L0VA 5L3EB 3AAEB 4QXHB 2QRXA 3NZQA 4KX6A 1LRZA 2IDOB 2LM9A 2WBLA 4KBMB 1SUMB 3RIFA 1XWMA 2XAHB 4O4LE 2XAQB 2FJAA 4IHJE 4EYYR 3Q5WA 5AFUL 1WRDA 5J2TE 2DHRA 2I0MA 2J4GA 4ISSA 2C5JA 3Q5EA 1YW0A 1MNDA 3NKZA 3NZPA 5DJQC 5HEJA 2X68A 2YN6A 1W09A 2CM0A 2X0LB 3GWHA 3IBPA 3ANWB 3LK3B 3ZMSB 1X79A 5LG3A 4LFCT 1BR4A 4WZXA 2YDRA 2IW5B 5LMUT 3EABA 3AA0B 3AE5A 4IE0A 4HKAA 5HEOA 1IZNB 4IT4A 1KEYA 3R6NA 4DBRA 4H63V 4U72A 3SOLA 5JQGE 5JVDE 3C98B 4IDNA 3HL6A 3RYHE 4LF4T 4GKJT 2ZMAA 3HR0A 1OEDA 4P0BA 3ZT7A 4ZI7E 3LBXA 4X65T 3QK6A 1YD8G 3JCFA 2A3DA 3CQGB 4DV5T 3KV9A 5HXHA 2I59A 5AQJB 4CI3B 2MOZA 1B7TA 2KMFA 1EZ3A 4HEAA 3UUXB 4CQIA 4X5TA 2HPJA 4ZS2A 1HG5A 5AQMB 2M6BA 2VASA 2VKJA 4DR5T 3P4RA 2J62A 3ZSSA 5JDLA 1HFAA 1YQ3A 2EHOC 2XSAA 3O4XE 3PUWF 4HFBA 4UVCB 4ZEYA 2DL1A 1NENA 4ZZBA 1HTJF 3UUBA 3WAJA 1T98A 3ZCJA 5FY1A 5F3JA 3LFMA 2YU1A 2CXDA 2LSIA 1N33T 3VR9A 3UU8A 1WCRA 3MKDA 4O4HE 2BZBA 1HNZT 4NPPA 4KI0F 2HPLA 1WR0A 2YEVC 2KWHA 4QHOA 2V7MA 5JR9B 3V5SA 2UUBT 2HN2A 3ZCIA 2IHR1 2N1GA 4U74A 2NW9A 3TLTA 1GQEA 3ZPOA 4A56A 2C0SA 3UU6A 3K1SA 4A97A 3BQKA 2XQ3A 1E7PA 3AVSA 3ZMUB 5C3JA 2VQFT 1S94A 2LLYA 4ZOLE 3AXJB 3AEAA 3FZMB 3ETUA 3K8PC 3PE0A 4IDZA 1YXRA 3ZYMA 2JIWA 5AQSB 3SS1A 1N36T 3PURA 3RIUC 4IL4A 4I43B 2K3WA 5LHGB 4B3MT 2LE8A 2PTFA 2XM1A 2OLTA 3DJBA 4PK5A 5LMNT 3MZKB 1IBLT 5AQVB 1MMAA 2LEHA 4TV8E 4CN4A 5IWAT 1D1BA 3CK6A 3PUZF 2QGSA 4QH1A 4ASKA 1FEWA 4JLEA 2UU9T 4XAXB 2MAWA 1IJ5A 2BS2A 4I50E 4QH4A 2XAGB 3OPCA 3VU7H 1HR0T 2H7OA 2WWUA 3O1JA 4H9SE 5L3FB 4B3TT 4UEMA 4EEDA 2JMHA 1ZOYA 3AEEA 3BK9A 4H9NC 1IJ6A 3Q9DA 5A1LA 4Z8XA 5LNKA 1T7SA 2KNDA 3QOFA 4TWDA 2FUPA 2Y48B 2YINA 4UVBB 4YHJA 1KK7A 3RF1A 4DR1T 1SHZC 2JPFA 5F8PA 2XSBA 3ZYKA 2DNXA 4TZ4C 3ABVA 2DWKA 1MMDA 2D0TA 5H6QB 3OTOT 1ZP0A 4U7IA 3CX6B 2UXNB 4NXNT 2JQQA 3K3QC 2XQ6A 5FMNA 2IUBA 4EB6E 2CMRA 2RPAA 3MK7C 2CLYC 4CZZB 4QXBB 3D0TA 3PU8A 4ILAA 4V1Av 2XQYA 3ZN1B 3CKDA 4JI0T 2W66A 2CCQA 2CLYB 4AKLA 1UX4A 3GMIA 2BKOA 2V7IA 2CHNA 4WNKA 4ZI2C 2MPKA 1UK5A 2V1DB 4JEHB 4PJJA 3TKLB 5F5WA 2D9DA 3TLUA 3K3OA 4DNDA 1MIYA 3T1HT 3CX7B 5JDMA 3H3MA 3AEGA 4AQFA 3ESLA 2BDEA 3HI2A 3AE7A 1QSDA 2VKHA 4O2BE 2LOSA 1QUUA 2V7LA 3SFDA 3MACA 4EYUA 2V6XA 5LYJE 2D0UA 2LJLA 4GK0E 4YSXA 5AQUB 4DR2T 5J2UE 2K5BB 4GKKT 2CBIA 2UXDT 2V6YA 3I0OA 4CXXA 2G0UA 3BQLA 1J1JA 2A2FX 2BG9C 2CWOA 2I6HA 4G2AA 2A72A 2VURA 3AE6A 3LBXB 2D5UA 2F4VT 5JDNA 4U7YA 1WYBA 5AQTB 3GN5A 5LGUB 3AEDA 3PUVF 1KFYA 3RIAA 2OV9A 4OK0A 2KINB 1KNPA 5CA1E 3CVRA 4IDOA 2LOPA 1V9DA 3QUJA 3QC9A 2WDVA 4TUYE 2Y6XA 5IYZE 3V5UA 3N2GE 3ZKRA 3ZMZB 4DV4T 4PJLA 2RP4A 3GA8A 2JQKA 4IDQA 3UFEA 2LRKA 4E7ZA 3P50A 3PUXF 2CA5A 3SWHA 2PJQA 5KX5E 3RC8A 1T8BA 4AI6A 4AQGA 1WLXA 2AE9A 3N5LA 2XAFB 3B57A
chains in the Genus database with same CATH topology
2DI4A 1IAPA 5CB4E 4DMWA 3RRCA 3ZN0B 2IC6A 5HXSA 3C4WA 5TAOA 3AA1B 1D1CA 3U3IA 3AA6B 2VL8A 3W15B 1LKXA 5L3GB 1WYCA 5JRCB 2VKDA 4L5GA 1MNEA 2Q9QD 3IHRA 2N9DA 3ONXA 3VKHA 2Q9QA 3P7IA 4WBOA 1NWMX 5HXRA 4IE7A 1Y64B 4IGUA 3Q5XA 5HYAA 5J1GA 3RPUA 5LJMA 2NP9A 2X66A 3N9NA 3N9MA 5JR9A 4P09A 5JRCA 2KLQA 3RH3A 3SRZA 4PJNA 3O1HA 2JMKA 4OFZA 3ZLIA 3N9LA 5LG4A 3GN5B 4E7SA 2W63A 2PG8A 3L3PA 4PFOA 5LOVE 4PK6A 2SPCA 3NRYA 5FXVA 2ZM0A 5FP3A 4YLHA 5LP6E 2XTLA 3ZJ2A 2LT3A 3A5XA 1UCUA 2E9XD 3CMLA 4AKHA 2H3RA 2E9XA 2M67A 2CXFA 4ANJA 3IF8B 3E08A 4B6XA 2HH7A 3PUQA 5FY0A 3KDSE 3N9PA 1BR2A 4CXWA 3KV5A 2X51A 3ZJ1A 4HFVA 4J2CA 3CQXC 2EHOD 2ODVA 2LSGA 1D0XA 3F2EA 3OBVE 2E9XB 2CE7A 4M1PA 4MALA 1H7CA 1ZKEA 3FB2A 2W61A 4X20E 4EOZB 2WSSV 2ZM2A 4IE4A 4PW8A 1ZV4X 3JC6C 4EAHA 4PAGA 2ZLYA 3MJXA 4GK5E 4L0RA 2DWGA 3CWZB 1S35A 3N2KE 3NBXX 3ETVA 5LXTE 4QX7B 4QWNB 3RRWA 3N9QA 3ZC1A 3C50A 1D0YA 2JRKA 4H9OC 5H6RB 2BVMA 2CEAA 3L09A 4C90A 4XBFB 3CX8B 3ZMVB 3J9X1 5L3DB 3LG7A 2KWIB 2L3LA 2L8KA 3ZYLA 3AVRA 1NAFA 4BJMA 4ISTA 2RA1A 4ZI3D 2V7KA 5EK2A 2EHOA 4GOUA 5LHHB 3F57A 2MBGA 3LJCA 3ZC0A 3MA9A 2Z6EA 5IHYA 4KP3C 2X9HA 2Y8DA 3C4ZA 1G8XA 3KV6A 5HWYA 1U4QA 4XZCA 3R84B 3RX6A 2EHOB 1ZHCA 4IE6A 3FHNA 4N78D 4EIWA 5GONE 3RYIE 1OXZA 3ZCIA 4I4TE 2XASB 5FXXA 4JEUB 3WI3A 4DVDA 2X9WA 2NTYA 4X1IE 5FXZA 5LA6E 4QXCB 1FIOA 1YKHB 4A56A 2KXPB 5EK4A 3P8CD 3OYXA 3PUAA 3MXZA 4NUVA 1LVFA 5LBMA 1WR6A 4OHFA 3E0ZA 4EXTA 3ZEFB 1MIVA 2PBIA 2BVLA 2PFVA 3H37A 5DQVA 2LSYA 3KVBA 4G63A 3B13A 5FNVE 3CPZA 5KMGP 2ODUA 2K24A 5HAXA 3UULA 3I1AA 2B1EA 4CI2B 4H63H 3BQIA 4H9RC 4JUYA 5DQWA 1BR1A 1MMGA 2D2SA 3N2OA 3PTRB 3ANWA 3FXEB 4X1YE 4H9PC 1D1AA 3RKOA 4AKIA 2W0GA 2UXXB 3EVYA 4PK4A 1HS7A 4KUMB 2L9QA 4MFRA 5JR9C 4PJMA 2P9BA 1VRBA 4UF0B 5FXWA 1FMWA 2IC9A 3EUHA 5L3BB 4P0AA 2OA5A 2W62A 3HKEE 1OWAA 3LK42 2VB6A 4HN9A 3Q2MA 3KFWX 4OYJA 1KNZA 3N9OA 2N2NA 1D0ZA 4WW0A 4KMCA 2C5IT 4DBQA 3KINB 1MMNA 3PUSA 4IIJE 4UV9B 3J7Yq 4DMVA 4X1KE 4GYRA 5EK3A 4YJ2E 5L3CB 2Q9QC 5JDHA 4BA9A 3AAIA 3KBUA 2WM9A 3O9XA 3AAAB 1G73A 2K9AA 3VKGA 4EZ4A 4L9IA 3HKBE 4AXPA 3KV4A 3RC3A 5C8YE 2V7JA 4I55E 1HF8A 3M65A 4AKGA 3I9YA 3NRXA 3E22E 2H7VC 2LSKA 3OJAA 2KT9A 4O4JE 5LCYA 2GK9A 3RYFE 5ADXL 2K48A 5JREA 2V26A 3IEEA 4PFPA 5BMVE 2ZM8A 3AB3B 2Q9QB 4OYKA 1MIWA 3UT5E 2W00A 3C4XA 3HKDE 5DABA 3ZMTB 4TV9E 5L2LA 5FYMA 4GIWA 2MYSA 2E9XC 4FI5A 5JDQA 2ES0A 2CWYA 3S4UA 1CUNA 2NWBA 3DTOA 2JJ9A 1SA0E 4FJOA 4O8SA 4UF0A 4AKRB 1VOMA 2YU2A 2J1DG 2XAJB 3KBTA 2IAKA 2CXLA 4UELA 4UVAB 4C91A 5LHIB 2NW7A 4K0UA 5JDFA 2E8IA 3PUGA 5HXEA 4DO0A 3C51A 5LBQB 5EZYE 2QA7A 4ADZA 4O2AE 5E0OA 5LJNA 5FY7A 4ZI2D 5CA0E 2LHNA 4MHCA 5LGTB 3JC6D 2WMNA 3UTKA 3AA7B 4O4IE 3KVAA 4WBNE 4H9QC 5KDMC 1LVKA 2DLRA 4ILUA 4YFSA 2NOXA 4AQFC 1E1HB 2VWAA 2VK9A 3UUMA 3DP7A 2DCFA 4NUUA 5ETWA 3I0QA 3WAKA 5LGNB 4HGAA 5HXCA 3U78A 1HX8A 2XUEA 5HWXA 1FMVA 3F31A 4F6RC 4IE5A 4HE8A 3HKCE 3OKQA 3HA4A 4ZS3A 2NTXA 3EDVA 2X9YA 4ERRA 1YKEB 5JH7E 4UIGA 4ZI3C 3FXDB 3K3NA 4PNIA 4CI1B 1HG2A 2C5KT 4ZHQE 3CQCB 4QX8B 4MLKA 3OYZA 2KZ7B 4CXYA 1HCIA 3PU3A 2XHEB 2LSJA 4MBQA 4UV8B 4BAYB 2X9XA 3FBZA 2MTQA 2WMOA 4YJ3E 3EDUA 2VKOA 3I9WA 4EZHA 2NW8A 3O1IA 4GYSA 1ZEEA 2ACXA 3RYCE 3UUNA 3VHLA 3LK2B 4QKNA 2WAUA 3H3AA 1U5PA 1BR0A 4TN7B 1O3XA 1Z0PA 2LHRA 3PDYA 3C64A 1AJ3A 4BJNA 2X67A 4HTEA 1US7B 4TX5A 2YK0A 1UX5A 3FBLA 3T8OA 4UXNB 5L3EB 3AAEB 4QXHB 3NZQA 1LRZA 2WBLA 2LM9A 4KBMB 4EYYR 2XAHB 4O4LE 2XAQB 4IHJE 3Q5WA 5J2TE 1WRDA 2DHRA 4ISSA 2C5JA 5DJQC 1YW0A 1MNDA 3NZPA 2X68A 2CM0A 2X0LB 3GWHA 3IBPA 3ANWB 3LK3B 3ZMSB 1X79A 1BR4A 2IW5B 4IE0A 4HKAA 1IZNB 3R6NA 4DBRA 4H63V 4U72A 3SOLA 5JQGE 5JVDE 3C98B 3HL6A 3RYHE 2ZMAA 3HR0A 4P0BA 4ZI7E 3LBXA 3QK6A 1YD8G 2A3DA 3CQGB 3KV9A 5HXHA 2I59A 4CI3B 2MOZA 1B7TA 2KMFA 1EZ3A 4HEAA 3UUXB 4CQIA 4ZS2A 2HPJA 1HG5A 2VASA 2VKJA 5JDLA 1HFAA 2EHOC 3O4XE 4UVCB 1HTJF 3WAJA 1T98A 3ZCJA 5FY1A 5F3JA 3LFMA 2YU1A 2CXDA 2LSIA 3MKDA 4O4HE 2BZBA 4QHOA 2HPLA 2YEVC 2KWHA 2V7MA 5JR9B 3V5SA 2N1GA 4U74A 2NW9A 3ZPOA 2C0SA 3BQKA 3ZMUB 3AVSA 1S94A 4ZOLE 3K8PC 3ZYMA 5JDGA 3ETUA 4IDZA 3PE0A 3SS1A 3PURA 4I43B 5LHGB 2LE8A 4PK5A 3DJBA 3MZKB 1MMAA 2LEHA 4TV8E 1D1BA 4ASKA 2QGSA 1FEWA 4JLEA 4XAXB 1IJ5A 3VU7H 4I50E 2XAGB 2H7OA 2WWUA 3O1JA 4H9SE 5L3FB 4UEMA 2JMHA 3BK9A 4H9NC 1IJ6A 3Q9DA 5A1LA 4Z8XA 5LNKA 2KNDA 2YINA 2Y48B 4UVBB 4YHJA 1KK7A 1SHZC 2JPFA 5F8PA 3ZYKA 2DNXA 4TZ4C 2DWKA 1MMDA 2D0TA 5H6QB 3CX6B 2UXNB 2JQQA 3K3QC 5FMNA 4EB6E 2CMRA 3MK7C 2CLYC 4CZZB 4QXBB 3D0TA 3PU8A 4V1Av 2XQYA 3ZN1B 3CKDA 2CCQA 2CLYB 4AKLA 1UX4A 3GMIA 2V7IA 4WNKA 4ZI2C 4PJJA 2V1DB 4JEHB 3TKLB 4DNDA 3K3OA 1MIYA 3CX7B 5JDMA 4AQFA 3ESLA 2BDEA 3HI2A 5M4YA 1QSDA 2VKHA 4O2BE 2LOSA 1QUUA 2V7LA 5LYJE 3MACA 4EYUA 2D0UA 2LJLA 4GK0E 5J2UE 2K5BB 3I0OA 4CXXA 2G0UA 3BQLA 2A2FX 5AFUL 2CWOA 4G2AA 2A72A 3LBXB 2D5UA 5JDNA 1WYBA 3GN5A 5LGUB 4OK0A 5CA1E 2KINB 3CVRA 2LOPA 1V9DA 3QUJA 3QC9A 4TUYE 3ZMZB 2Y6XA 5IYZE 3V5UA 3N2GE 4PJLA 2RP4A 3GA8A 3UFEA 4E7ZA 2CA5A 3SWHA 2PJQA 5KX5E 3RC8A 4AI6A 4AQGA 1WLXA 3AA0B 3N5LA 2XAFB 3B57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRY A;  5KMG P;  3NRX A; 
#chains in the Genus database with same CATH topology
 1JNR A;  4JI5 T;  2DI4 A;  1IAP A;  4NIQ A;  5CB4 E;  4DMW A;  4DR6 T;  2E2A A;  3RRC A;  3TLV A;  2BBH A;  4HFH A;  2M6I A;  3ZN0 B;  2IC6 A;  2XQA A;  5CGM A;  5HXS A;  3C4W A;  5TAO A;  3AA1 B;  1D1C A;  3PJA J;  3AA6 B;  1M7K A;  4JI2 T;  2VL8 A;  2LM2 A;  1LKX A;  2X0Y A;  5AQK B;  1WYC A;  3W15 B;  5L3G B;  2VKD A;  4L5G A;  5JRC B;  1MNE A;  2Q9Q D;  3IHR A;  5JTG A;  4DR7 T;  1XZY A;  2N9D A;  3ONX A;  3QB5 A;  3VKH A;  2Q9Q A;  3B5M A;  3P7I A;  3AXJ A;  4WBO A;  1NWM X;  5HXR A;  4IE7 A;  4HFD A;  1Y64 B;  5AQO B;  4LF6 T;  4IGU A;  3ZT6 A;  5KXJ A;  4DV2 T;  3A8Y C;  3FZF B;  3Q5X A;  5J1G A;  3RPU A;  5HYA A;  5LJM A;  2NP9 A;  2X66 A;  3N9N A;  4Z91 A;  3N9M A;  1X9B A;  4P09 A;  5JR9 A;  4YY3 T;  5JRC A;  4JI6 T;  1J5E T;  3PV0 F;  2KLQ A;  3RH3 A;  4LMJ A;  3SRZ A;  4TNW A;  4PJN A;  4JV5 T;  3RHW A;  3O1H A;  2JMK A;  4OFZ A;  3ZLI A;  3N9L A;  4A98 A;  4CN6 A;  5LG4 A;  4DV1 T;  3RQU A;  3GN5 B;  4E7S A;  4YSZ A;  3T1Y T;  2W63 A;  5LB7 B;  2PG8 A;  3L3P A;  4PFO A;  5LOV E;  4PK6 A;  4AQY T;  2SPC A;  3NRY A;  2V8S V;  2CRB A;  5HEU A;  4CN1 A;  5FXV A;  2ZM0 A;  5FP3 A;  4YLH A;  5LP6 E;  2XTL A;  3ZJ2 A;  2LT3 A;  4LFB T;  1XMQ T;  4JI3 T;  3A5X A;  2BS3 A;  1UCU A;  4LML A;  4X62 T;  2E9X D;  2WQY A;  1WFD A;  3JAE A;  3CML A;  4AKH A;  2H3R A;  2E9X A;  2FBW A;  4TWH A;  2M67 A;  2CXF A;  3EHZ A;  4ANJ A;  5C2T A;  3IF8 B;  5M4Y A;  1Y01 A;  3E08 A;  2HH7 A;  1J5W A;  3PUQ A;  5FY0 A;  3KDS E;  4B6X A;  3N9P A;  1N34 T;  1BR2 A;  4CXW A;  4EV6 A;  3KV5 A;  3AE9 A;  4HWF A;  1W0A A;  2W2U A;  2X51 A;  3PJA A;  1IBK T;  3ZJ1 A;  4HFV A;  2FJB A;  4J2C A;  3CQX C;  4I0U A;  2EHO D;  3UQ7 A;  2XM2 A;  1W0B A;  2V5D A;  2ODV A;  5AQF B;  5FL1 A;  2LSG A;  2UUA T;  2QVA A;  1D0X A;  3F2E A;  2LKG A;  2HN1 A;  3OBV E;  1SE7 A;  2E9X B;  2CE7 A;  2YKS A;  4M1P A;  4MAL A;  4X64 T;  1H7C A;  3JAD A;  4B3S T;  1ZKE A;  3FB2 A;  1E2A A;  2V5C A;  2W61 A;  1DU2 A;  4X20 E;  3Q5D A;  2WSS V;  2ZM2 A;  4IE4 A;  4PW8 A;  4EOZ B;  2A9U A;  1XMO T;  1ZV4 X;  2BKP A;  3JC6 C;  2HHH T;  4EAH A;  3AE4 A;  4ILC A;  2ZLY A;  2WZI A;  3MJX A;  4GK5 E;  3AE3 A;  4L0R A;  4PAG A;  3EI0 A;  2DWG A;  2W4X A;  4YTM A;  3CWZ B;  1S35 A;  4AKR B;  3N2K E;  1XNQ T;  3NBX X;  1FJG T;  3ETV A;  5LXT E;  4QX7 B;  2WZH A;  4YHH T;  4QWN B;  5AQG B;  3P4Q A;  3RRW A;  3N9Q A;  3ZC1 A;  2LRL A;  1W9R A;  3NWI A;  3C50 A;  1D0Y A;  3UU3 A;  2JRK A;  4H9O C;  5H6R B;  5HCM A;  4U2Z A;  2BVM A;  2CEA A;  2CBJ A;  3L09 A;  4C90 A;  4XBF B;  1N32 T;  3CX8 B;  3ZMV B;  4F8H A;  3J9X 1;  4HWC A;  5L3D B;  3AE2 A;  2KWI B;  2L3L A;  3LG7 A;  2L8K A;  2WCA A;  3P4S A;  3ZYL A;  3AVR A;  4HWI B;  4JI1 T;  1NAF A;  4BJM A;  4IST A;  2RA1 A;  4ZI3 D;  2BKN A;  4DV7 T;  2V7K A;  5EK2 A;  2EHO A;  4GOU A;  5LHH B;  2YOE A;  3F57 A;  2MBG A;  3LJC A;  3UFG A;  1Z8U A;  3FZK B;  3ZC0 A;  3MA9 A;  2Z6E A;  3EAM A;  4WYV A;  5IHY A;  4KP3 C;  2X9H A;  2Y8D A;  5AQL B;  3C4Z A;  1G8X A;  3KV6 A;  5HWY A;  1U4Q A;  4XZC A;  4DUZ T;  3R84 B;  3QNU A;  3FZH B;  2EHO B;  1CHU A;  3L8R A;  5L4H A;  3RX6 A;  1ZHC A;  2J47 A;  4IE6 A;  3VRB A;  3FHN A;  4NXM T;  4N78 D;  4EIW A;  1YQ4 A;  5GON E;  3RI5 A;  1OXZ A;  2FJD A;  2BG9 A;  3RYI E;  4I4T E;  3A7M A;  2XAS B;  5FXX A;  4JEU B;  3WI3 A;  3L39 A;  2X9W A;  4DVD A;  2NTY A;  4B3R T;  4X1I E;  5FXZ A;  5LA6 E;  4QXC B;  2WB5 A;  1FIO A;  1YKH B;  5AQH B;  2KXP B;  4U31 A;  2WY2 A;  3P8C D;  5EK4 A;  2B76 A;  3RGL A;  1QLB A;  4JI4 T;  3OYX A;  4YTP A;  4HWH A;  3RIU A;  3PUA A;  3MXZ A;  5ABE A;  4DR4 T;  2FJE A;  3AE1 A;  4NUV A;  1LVF A;  5LBM A;  1WR6 A;  1XDO A;  3E0Z A;  3PUY F;  4OHF A;  4EXT A;  3ZEF B;  1MIV A;  2PBI A;  2KSR A;  2LKH A;  2BVL A;  2PFV A;  3H37 A;  5DQV A;  5AQQ B;  4ZZC A;  1OED B;  4LF7 T;  2LSY A;  3KVB A;  4G63 A;  3B13 A;  2W67 A;  4LFA T;  5FNV E;  3CPZ A;  5KMG P;  2ODU A;  2K24 A;  5HAX A;  3UUL A;  2H88 A;  2V6Y B;  2B1E A;  3I1A A;  3AE8 A;  4CI2 B;  4A5X A;  4H63 H;  3BQI A;  4H9R C;  2BG9 E;  1NEK A;  4JUY A;  4U2Y A;  5DQW A;  4JI8 T;  1BR1 A;  1MMG A;  2D2S A;  3N2O A;  3ONJ A;  5AQI B;  3PTR B;  3ANW A;  3FXE B;  5CFB A;  4X1Y E;  3P4W A;  4H9P C;  1D1A A;  3RKO A;  4AKI A;  2W0G A;  2UXX B;  2IML A;  3EVY A;  3RQW A;  2BBJ A;  4PK4 A;  1HS7 A;  4KHZ F;  2L9Q A;  4KUM B;  4MFR A;  5JR9 C;  4LF5 T;  1I6Z A;  4PJM A;  5ABF A;  2P9B A;  1VRB A;  4YXD A;  4DV3 T;  4UF0 B;  5FXW A;  1T72 A;  1XNR T;  5HEH A;  1OED C;  3TLW A;  2VL0 A;  1FMW A;  2IC9 A;  3EUH A;  2VVN A;  5L3B B;  4P0A A;  2OA5 A;  2W62 A;  3HKE E;  3LSV A;  1OWA A;  3LK4 2;  2VB6 A;  4HN9 A;  3Q2M A;  3KFW X;  4ILB A;  4OYJ A;  3N9O A;  1KNZ A;  2N2N A;  1D0Z A;  1JNZ A;  4WW0 A;  1HNX T;  1VCS A;  4KMC A;  2WU2 A;  3IA3 A;  2BG9 B;  3P4P A;  4IL9 A;  2C5I T;  4DBQ A;  3KIN B;  1MMN A;  3PUS A;  4IIJ E;  4UV9 B;  3J7Y q;  4DMV A;  4X1K E;  4GYR A;  5L47 A;  4KHP T;  3UU5 A;  5EK3 A;  2VVS A;  4YJ2 E;  4P1N A;  3JAF A;  2Q9Q C;  4Z90 A;  5L3C B;  5JDH A;  4BA9 A;  3AAI A;  3KBU A;  2WM9 A;  2WP9 A;  3O9X A;  3AAA B;  1G73 A;  3RKG A;  2K9A A;  4YSY A;  4DV6 T;  3VKG A;  4JBW F;  4LMK A;  4EZ4 A;  4L9I A;  4QH5 A;  4COF A;  3HKB E;  4AXP A;  3KV4 A;  3RC3 A;  5C8Y E;  2V7J A;  2IIU A;  1HF8 A;  4I55 E;  3M65 A;  4U3C A;  3I9Y A;  4ZXL A;  5BR8 T;  4AKG A;  3NRX A;  5ABH A;  2XPK A;  2WU5 A;  3E22 E;  3CIR A;  2CHO A;  2LSK A;  2H7V C;  3OJA A;  4HFE A;  4IRE A;  5HCJ A;  3RLF F;  2KT9 A;  2JQ9 A;  4O4J E;  5LCY A;  2GK9 A;  3RYF E;  5ADX L;  2BS4 A;  2K48 A;  5JRE A;  2V26 A;  3IEE A;  4PFP A;  5BMV E;  2ZM8 A;  2UUC T;  3AB3 B;  2Q9Q B;  4OYK A;  1MIW A;  3UT5 E;  2W00 A;  2E5L T;  3C4X A;  5JDG A;  3HKD E;  5DAB A;  3ZMT B;  4TV9 E;  2YDQ A;  5L2L A;  4HFI A;  3G06 A;  3LDQ B;  5FYM A;  4GIW A;  4LF9 T;  5ABG A;  2E5V A;  2XQ9 A;  2MYS A;  5L4E A;  4TNV A;  2E9X C;  4FI5 A;  5JDQ A;  2ES0 A;  2QYW A;  2CWY A;  3S4U A;  4K0K T;  1CUN A;  2NWB A;  3DTO A;  1OED E;  3VRA A;  2JJ9 A;  1SA0 E;  4FJO A;  4O8S A;  4UF0 A;  5AQN B;  4Q25 A;  5FL0 A;  1VOM A;  2YU2 A;  2J1D G;  2XAJ B;  3KBT A;  2IAK A;  2CXL A;  4IDP A;  4UEL A;  4UVA B;  3TLS A;  4C91 A;  5CJ5 A;  5IUX A;  5LHI B;  2NW7 A;  4K0U A;  5JDF A;  4DR3 T;  2AXD S;  4JYA T;  4U33 A;  2E8I A;  3PUG A;  5HXE A;  4DO0 A;  3C51 A;  5LBQ B;  5EZY E;  2QA7 A;  4ADZ A;  4O2A E;  5E0O A;  5LJN A;  2UXB T;  5ABF B;  4EGW A;  4UR9 A;  5FY7 A;  3NVO A;  5FKY A;  2WDQ A;  1UUR A;  2XQ8 A;  2R6G F;  5AQR B;  2H89 A;  4ZI2 D;  5CA0 E;  2LHN A;  3AEC A;  3OVU A;  2XZE A;  2X0H A;  2WMN A;  3JC6 D;  4MHC A;  3SFE A;  3UTK A;  5LGT B;  3AA7 B;  4O4I E;  1KNR A;  3KVA A;  4WBN E;  3FZL B;  2NR4 A;  1VCT A;  4H9Q C;  4AIS A;  5KDM C;  1LVK A;  2DLR A;  4ILU A;  4YFS A;  2NOX A;  4DUY T;  4AQF C;  1E1H B;  2VWA A;  2VK9 A;  3UUM A;  3DP7 A;  3AEF A;  2DCF A;  2XJ7 A;  4NUU A;  5ETW A;  3I0Q A;  2CPT A;  3WAK A;  3AEB A;  2WWV A;  5LGN B;  3M3Z B;  1I94 T;  4HGA A;  5HXC A;  1KF6 A;  3U78 A;  2XQ4 A;  3VR8 A;  1HX8 A;  2XUE A;  5HWX A;  1FMV A;  3F31 A;  4F6R C;  4HWD A;  4IE5 A;  4HE8 A;  3HKC E;  3OKQ A;  4AIU A;  3HA4 A;  4ZS3 A;  2NTX A;  3EDV A;  4DV0 T;  2X9Y A;  4ERR A;  1YKE B;  3U3I A;  5JH7 E;  2WS3 A;  4UIG A;  4ZI3 C;  3FXD B;  3K3N A;  4PNI A;  4CI1 B;  1HG2 A;  3UU4 A;  2C5K T;  4ZHQ E;  3CQC B;  4QX8 B;  1IBM T;  4MLK A;  5HEG A;  3OYZ A;  2KZ7 B;  4LF8 T;  4YT0 A;  4CXY A;  5J0Z A;  1HCI A;  2YDS A;  3ZST A;  2XQ5 A;  2XHE B;  1M62 A;  2LSJ A;  3PU3 A;  1UUS A;  4MBQ A;  4UV8 B;  4BAY B;  2ACZ A;  2JQH A;  2X9X A;  3FBZ A;  2MTQ A;  2WMO A;  4YJ3 E;  3EDU A;  2VKO A;  2XY8 B;  3UQ4 A;  3I9W A;  4EZH A;  2NW8 A;  1XDP A;  3O1I A;  5FVK A;  3ZT5 A;  4YTN A;  4GYS A;  1ZEE A;  2ACX A;  3RYC E;  3ONL C;  1R8I A;  3UUN A;  3VHL A;  2VQE T;  3LK2 B;  4QKN A;  2WAU A;  3QB5 K;  3H3A A;  5AQP B;  1U5P A;  3X1D A;  1BR0 A;  1HNW T;  4TWF A;  4TN7 B;  4OX9 T;  4HFC A;  1O3X A;  1Z0P A;  2LHR A;  3PDY A;  2WDR A;  3C64 A;  4DID B;  4BJN A;  4JI7 T;  4X66 T;  1AJ3 A;  2X67 A;  4HTE A;  1US7 B;  4TX5 A;  5FVL A;  4EEB A;  2XQ7 A;  2YK0 A;  1UX5 A;  2ZM6 T;  1UGO A;  2UXC T;  1HX1 B;  3FBL A;  3T8O A;  4UXN B;  1L0V A;  5L3E B;  3AAE B;  4QXH B;  2QRX A;  3NZQ A;  4KX6 A;  1LRZ A;  2IDO B;  2LM9 A;  2WBL A;  4KBM B;  1SUM B;  3RIF A;  1XWM A;  2XAH B;  4O4L E;  2XAQ B;  2FJA A;  4IHJ E;  4EYY R;  3Q5W A;  5AFU L;  1WRD A;  5J2T E;  2DHR A;  2I0M A;  2J4G A;  4ISS A;  2C5J A;  3Q5E A;  1YW0 A;  1MND A;  3NKZ A;  3NZP A;  5DJQ C;  5HEJ A;  2X68 A;  2YN6 A;  1W09 A;  2CM0 A;  2X0L B;  3GWH A;  3IBP A;  3ANW B;  3LK3 B;  3ZMS B;  1X79 A;  5LG3 A;  4LFC T;  1BR4 A;  4WZX A;  2YDR A;  2IW5 B;  5LMU T;  3EAB A;  3AA0 B;  3AE5 A;  4IE0 A;  4HKA A;  5HEO A;  1IZN B;  4IT4 A;  1KEY A;  3R6N A;  4DBR A;  4H63 V;  4U72 A;  3SOL A;  5JQG E;  5JVD E;  3C98 B;  4IDN A;  3HL6 A;  3RYH E;  4LF4 T;  4GKJ T;  2ZMA A;  3HR0 A;  1OED A;  4P0B A;  3ZT7 A;  4ZI7 E;  3LBX A;  4X65 T;  3QK6 A;  1YD8 G;  3JCF A;  2A3D A;  3CQG B;  4DV5 T;  3KV9 A;  5HXH A;  2I59 A;  5AQJ B;  4CI3 B;  2MOZ A;  1B7T A;  2KMF A;  1EZ3 A;  4HEA A;  3UUX B;  4CQI A;  4X5T A;  2HPJ A;  4ZS2 A;  1HG5 A;  5AQM B;  2M6B A;  2VAS A;  2VKJ A;  4DR5 T;  3P4R A;  2J62 A;  3ZSS A;  5JDL A;  1HFA A;  1YQ3 A;  2EHO C;  2XSA A;  3O4X E;  3PUW F;  4HFB A;  4UVC B;  4ZEY A;  2DL1 A;  1NEN A;  4ZZB A;  1HTJ F;  3UUB A;  3WAJ A;  1T98 A;  3ZCJ A;  5FY1 A;  5F3J A;  3LFM A;  2YU1 A;  2CXD A;  2LSI A;  1N33 T;  3VR9 A;  3UU8 A;  1WCR A;  3MKD A;  4O4H E;  2BZB A;  1HNZ T;  4NPP A;  4KI0 F;  2HPL A;  1WR0 A;  2YEV C;  2KWH A;  4QHO A;  2V7M A;  5JR9 B;  3V5S A;  2UUB T;  2HN2 A;  3ZCI A;  2IHR 1;  2N1G A;  4U74 A;  2NW9 A;  3TLT A;  1GQE A;  3ZPO A;  4A56 A;  2C0S A;  3UU6 A;  3K1S A;  4A97 A;  3BQK A;  2XQ3 A;  1E7P A;  3AVS A;  3ZMU B;  5C3J A;  2VQF T;  1S94 A;  2LLY A;  4ZOL E;  3AXJ B;  3AEA A;  3FZM B;  3ETU A;  3K8P C;  3PE0 A;  4IDZ A;  1YXR A;  3ZYM A;  2JIW A;  5AQS B;  3SS1 A;  1N36 T;  3PUR A;  3RIU C;  4IL4 A;  4I43 B;  2K3W A;  5LHG B;  4B3M T;  2LE8 A;  2PTF A;  2XM1 A;  2OLT A;  3DJB A;  4PK5 A;  5LMN T;  3MZK B;  1IBL T;  5AQV B;  1MMA A;  2LEH A;  4TV8 E;  4CN4 A;  5IWA T;  1D1B A;  3CK6 A;  3PUZ F;  2QGS A;  4QH1 A;  4ASK A;  1FEW A;  4JLE A;  2UU9 T;  4XAX B;  2MAW A;  1IJ5 A;  2BS2 A;  4I50 E;  4QH4 A;  2XAG B;  3OPC A;  3VU7 H;  1HR0 T;  2H7O A;  2WWU A;  3O1J A;  4H9S E;  5L3F B;  4B3T T;  4UEM A;  4EED A;  2JMH A;  1ZOY A;  3AEE A;  3BK9 A;  4H9N C;  1IJ6 A;  3Q9D A;  5A1L A;  4Z8X A;  5LNK A;  1T7S A;  2KND A;  3QOF A;  4TWD A;  2FUP A;  2Y48 B;  2YIN A;  4UVB B;  4YHJ A;  1KK7 A;  3RF1 A;  4DR1 T;  1SHZ C;  2JPF A;  5F8P A;  2XSB A;  3ZYK A;  2DNX A;  4TZ4 C;  3ABV A;  2DWK A;  1MMD A;  2D0T A;  5H6Q B;  3OTO T;  1ZP0 A;  4U7I A;  3CX6 B;  2UXN B;  4NXN T;  2JQQ A;  3K3Q C;  2XQ6 A;  5FMN A;  2IUB A;  4EB6 E;  2CMR A;  2RPA A;  3MK7 C;  2CLY C;  4CZZ B;  4QXB B;  3D0T A;  3PU8 A;  4ILA A;  4V1A v;  2XQY A;  3ZN1 B;  3CKD A;  4JI0 T;  2W66 A;  2CCQ A;  2CLY B;  4AKL A;  1UX4 A;  3GMI A;  2BKO A;  2V7I A;  2CHN A;  4WNK A;  4ZI2 C;  2MPK A;  1UK5 A;  2V1D B;  4JEH B;  4PJJ A;  3TKL B;  5F5W A;  2D9D A;  3TLU A;  3K3O A;  4DND A;  1MIY A;  3T1H T;  3CX7 B;  5JDM A;  3H3M A;  3AEG A;  4AQF A;  3ESL A;  2BDE A;  3HI2 A;  3AE7 A;  1QSD A;  2VKH A;  4O2B E;  2LOS A;  1QUU A;  2V7L A;  3SFD A;  3MAC A;  4EYU A;  2V6X A;  5LYJ E;  2D0U A;  2LJL A;  4GK0 E;  4YSX A;  5AQU B;  4DR2 T;  5J2U E;  2K5B B;  4GKK T;  2CBI A;  2UXD T;  2V6Y A;  3I0O A;  4CXX A;  2G0U A;  3BQL A;  1J1J A;  2A2F X;  2BG9 C;  2CWO A;  2I6H A;  4G2A A;  2A72 A;  2VUR A;  3AE6 A;  3LBX B;  2D5U A;  2F4V T;  5JDN A;  4U7Y A;  1WYB A;  5AQT B;  3GN5 A;  5LGU B;  3AED A;  3PUV F;  1KFY A;  3RIA A;  2OV9 A;  4OK0 A;  2KIN B;  1KNP A;  5CA1 E;  3CVR A;  4IDO A;  2LOP A;  1V9D A;  3QUJ A;  3QC9 A;  2WDV A;  4TUY E;  2Y6X A;  5IYZ E;  3V5U A;  3N2G E;  3ZKR A;  3ZMZ B;  4DV4 T;  4PJL A;  2RP4 A;  3GA8 A;  2JQK A;  4IDQ A;  3UFE A;  2LRK A;  4E7Z A;  3P50 A;  3PUX F;  2CA5 A;  3SWH A;  2PJQ A;  5KX5 E;  3RC8 A;  1T8B A;  4AI6 A;  4AQG A;  1WLX A;  2AE9 A;  3N5L A;  2XAF B;  3B57 A; 
#chains in the Genus database with same CATH homology
 2DI4 A;  1IAP A;  5CB4 E;  4DMW A;  3RRC A;  3ZN0 B;  2IC6 A;  5HXS A;  3C4W A;  5TAO A;  3AA1 B;  1D1C A;  3U3I A;  3AA6 B;  2VL8 A;  3W15 B;  1LKX A;  5L3G B;  1WYC A;  5JRC B;  2VKD A;  4L5G A;  1MNE A;  2Q9Q D;  3IHR A;  2N9D A;  3ONX A;  3VKH A;  2Q9Q A;  3P7I A;  4WBO A;  1NWM X;  5HXR A;  4IE7 A;  1Y64 B;  4IGU A;  3Q5X A;  5HYA A;  5J1G A;  3RPU A;  5LJM A;  2NP9 A;  2X66 A;  3N9N A;  3N9M A;  5JR9 A;  4P09 A;  5JRC A;  2KLQ A;  3RH3 A;  3SRZ A;  4PJN A;  3O1H A;  2JMK A;  4OFZ A;  3ZLI A;  3N9L A;  5LG4 A;  3GN5 B;  4E7S A;  2W63 A;  2PG8 A;  3L3P A;  4PFO A;  5LOV E;  4PK6 A;  2SPC A;  3NRY A;  5FXV A;  2ZM0 A;  5FP3 A;  4YLH A;  5LP6 E;  2XTL A;  3ZJ2 A;  2LT3 A;  3A5X A;  1UCU A;  2E9X D;  3CML A;  4AKH A;  2H3R A;  2E9X A;  2M67 A;  2CXF A;  4ANJ A;  3IF8 B;  3E08 A;  4B6X A;  2HH7 A;  3PUQ A;  5FY0 A;  3KDS E;  3N9P A;  1BR2 A;  4CXW A;  3KV5 A;  2X51 A;  3ZJ1 A;  4HFV A;  4J2C A;  3CQX C;  2EHO D;  2ODV A;  2LSG A;  1D0X A;  3F2E A;  3OBV E;  2E9X B;  2CE7 A;  4M1P A;  4MAL A;  1H7C A;  1ZKE A;  3FB2 A;  2W61 A;  4X20 E;  4EOZ B;  2WSS V;  2ZM2 A;  4IE4 A;  4PW8 A;  1ZV4 X;  3JC6 C;  4EAH A;  4PAG A;  2ZLY A;  3MJX A;  4GK5 E;  4L0R A;  2DWG A;  3CWZ B;  1S35 A;  3N2K E;  3NBX X;  3ETV A;  5LXT E;  4QX7 B;  4QWN B;  3RRW A;  3N9Q A;  3ZC1 A;  3C50 A;  1D0Y A;  2JRK A;  4H9O C;  5H6R B;  2BVM A;  2CEA A;  3L09 A;  4C90 A;  4XBF B;  3CX8 B;  3ZMV B;  3J9X 1;  5L3D B;  3LG7 A;  2KWI B;  2L3L A;  2L8K A;  3ZYL A;  3AVR A;  1NAF A;  4BJM A;  4IST A;  2RA1 A;  4ZI3 D;  2V7K A;  5EK2 A;  2EHO A;  4GOU A;  5LHH B;  3F57 A;  2MBG A;  3LJC A;  3ZC0 A;  3MA9 A;  2Z6E A;  5IHY A;  4KP3 C;  2X9H A;  2Y8D A;  3C4Z A;  1G8X A;  3KV6 A;  5HWY A;  1U4Q A;  4XZC A;  3R84 B;  3RX6 A;  2EHO B;  1ZHC A;  4IE6 A;  3FHN A;  4N78 D;  4EIW A;  5GON E;  3RYI E;  1OXZ A;  3ZCI A;  4I4T E;  2XAS B;  5FXX A;  4JEU B;  3WI3 A;  4DVD A;  2X9W A;  2NTY A;  4X1I E;  5FXZ A;  5LA6 E;  4QXC B;  1FIO A;  1YKH B;  4A56 A;  2KXP B;  5EK4 A;  3P8C D;  3OYX A;  3PUA A;  3MXZ A;  4NUV A;  1LVF A;  5LBM A;  1WR6 A;  4OHF A;  3E0Z A;  4EXT A;  3ZEF B;  1MIV A;  2PBI A;  2BVL A;  2PFV A;  3H37 A;  5DQV A;  2LSY A;  3KVB A;  4G63 A;  3B13 A;  5FNV E;  3CPZ A;  5KMG P;  2ODU A;  2K24 A;  5HAX A;  3UUL A;  3I1A A;  2B1E A;  4CI2 B;  4H63 H;  3BQI A;  4H9R C;  4JUY A;  5DQW A;  1BR1 A;  1MMG A;  2D2S A;  3N2O A;  3PTR B;  3ANW A;  3FXE B;  4X1Y E;  4H9P C;  1D1A A;  3RKO A;  4AKI A;  2W0G A;  2UXX B;  3EVY A;  4PK4 A;  1HS7 A;  4KUM B;  2L9Q A;  4MFR A;  5JR9 C;  4PJM A;  2P9B A;  1VRB A;  4UF0 B;  5FXW A;  1FMW A;  2IC9 A;  3EUH A;  5L3B B;  4P0A A;  2OA5 A;  2W62 A;  3HKE E;  1OWA A;  3LK4 2;  2VB6 A;  4HN9 A;  3Q2M A;  3KFW X;  4OYJ A;  1KNZ A;  3N9O A;  2N2N A;  1D0Z A;  4WW0 A;  4KMC A;  2C5I T;  4DBQ A;  3KIN B;  1MMN A;  3PUS A;  4IIJ E;  4UV9 B;  3J7Y q;  4DMV A;  4X1K E;  4GYR A;  5EK3 A;  4YJ2 E;  5L3C B;  2Q9Q C;  5JDH A;  4BA9 A;  3AAI A;  3KBU A;  2WM9 A;  3O9X A;  3AAA B;  1G73 A;  2K9A A;  3VKG A;  4EZ4 A;  4L9I A;  3HKB E;  4AXP A;  3KV4 A;  3RC3 A;  5C8Y E;  2V7J A;  4I55 E;  1HF8 A;  3M65 A;  4AKG A;  3I9Y A;  3NRX A;  3E22 E;  2H7V C;  2LSK A;  3OJA A;  2KT9 A;  4O4J E;  5LCY A;  2GK9 A;  3RYF E;  5ADX L;  2K48 A;  5JRE A;  2V26 A;  3IEE A;  4PFP A;  5BMV E;  2ZM8 A;  3AB3 B;  2Q9Q B;  4OYK A;  1MIW A;  3UT5 E;  2W00 A;  3C4X A;  3HKD E;  5DAB A;  3ZMT B;  4TV9 E;  5L2L A;  5FYM A;  4GIW A;  2MYS A;  2E9X C;  4FI5 A;  5JDQ A;  2ES0 A;  2CWY A;  3S4U A;  1CUN A;  2NWB A;  3DTO A;  2JJ9 A;  1SA0 E;  4FJO A;  4O8S A;  4UF0 A;  4AKR B;  1VOM A;  2YU2 A;  2J1D G;  2XAJ B;  3KBT A;  2IAK A;  2CXL A;  4UEL A;  4UVA B;  4C91 A;  5LHI B;  2NW7 A;  4K0U A;  5JDF A;  2E8I A;  3PUG A;  5HXE A;  4DO0 A;  3C51 A;  5LBQ B;  5EZY E;  2QA7 A;  4ADZ A;  4O2A E;  5E0O A;  5LJN A;  5FY7 A;  4ZI2 D;  5CA0 E;  2LHN A;  4MHC A;  5LGT B;  3JC6 D;  2WMN A;  3UTK A;  3AA7 B;  4O4I E;  3KVA A;  4WBN E;  4H9Q C;  5KDM C;  1LVK A;  2DLR A;  4ILU A;  4YFS A;  2NOX A;  4AQF C;  1E1H B;  2VWA A;  2VK9 A;  3UUM A;  3DP7 A;  2DCF A;  4NUU A;  5ETW A;  3I0Q A;  3WAK A;  5LGN B;  4HGA A;  5HXC A;  3U78 A;  1HX8 A;  2XUE A;  5HWX A;  1FMV A;  3F31 A;  4F6R C;  4IE5 A;  4HE8 A;  3HKC E;  3OKQ A;  3HA4 A;  4ZS3 A;  2NTX A;  3EDV A;  2X9Y A;  4ERR A;  1YKE B;  5JH7 E;  4UIG A;  4ZI3 C;  3FXD B;  3K3N A;  4PNI A;  4CI1 B;  1HG2 A;  2C5K T;  4ZHQ E;  3CQC B;  4QX8 B;  4MLK A;  3OYZ A;  2KZ7 B;  4CXY A;  1HCI A;  3PU3 A;  2XHE B;  2LSJ A;  4MBQ A;  4UV8 B;  4BAY B;  2X9X A;  3FBZ A;  2MTQ A;  2WMO A;  4YJ3 E;  3EDU A;  2VKO A;  3I9W A;  4EZH A;  2NW8 A;  3O1I A;  4GYS A;  1ZEE A;  2ACX A;  3RYC E;  3UUN A;  3VHL A;  3LK2 B;  4QKN A;  2WAU A;  3H3A A;  1U5P A;  1BR0 A;  4TN7 B;  1O3X A;  1Z0P A;  2LHR A;  3PDY A;  3C64 A;  1AJ3 A;  4BJN A;  2X67 A;  4HTE A;  1US7 B;  4TX5 A;  2YK0 A;  1UX5 A;  3FBL A;  3T8O A;  4UXN B;  5L3E B;  3AAE B;  4QXH B;  3NZQ A;  1LRZ A;  2WBL A;  2LM9 A;  4KBM B;  4EYY R;  2XAH B;  4O4L E;  2XAQ B;  4IHJ E;  3Q5W A;  5J2T E;  1WRD A;  2DHR A;  4ISS A;  2C5J A;  5DJQ C;  1YW0 A;  1MND A;  3NZP A;  2X68 A;  2CM0 A;  2X0L B;  3GWH A;  3IBP A;  3ANW B;  3LK3 B;  3ZMS B;  1X79 A;  1BR4 A;  2IW5 B;  4IE0 A;  4HKA A;  1IZN B;  3R6N A;  4DBR A;  4H63 V;  4U72 A;  3SOL A;  5JQG E;  5JVD E;  3C98 B;  3HL6 A;  3RYH E;  2ZMA A;  3HR0 A;  4P0B A;  4ZI7 E;  3LBX A;  3QK6 A;  1YD8 G;  2A3D A;  3CQG B;  3KV9 A;  5HXH A;  2I59 A;  4CI3 B;  2MOZ A;  1B7T A;  2KMF A;  1EZ3 A;  4HEA A;  3UUX B;  4CQI A;  4ZS2 A;  2HPJ A;  1HG5 A;  2VAS A;  2VKJ A;  5JDL A;  1HFA A;  2EHO C;  3O4X E;  4UVC B;  1HTJ F;  3WAJ A;  1T98 A;  3ZCJ A;  5FY1 A;  5F3J A;  3LFM A;  2YU1 A;  2CXD A;  2LSI A;  3MKD A;  4O4H E;  2BZB A;  4QHO A;  2HPL A;  2YEV C;  2KWH A;  2V7M A;  5JR9 B;  3V5S A;  2N1G A;  4U74 A;  2NW9 A;  3ZPO A;  2C0S A;  3BQK A;  3ZMU B;  3AVS A;  1S94 A;  4ZOL E;  3K8P C;  3ZYM A;  5JDG A;  3ETU A;  4IDZ A;  3PE0 A;  3SS1 A;  3PUR A;  4I43 B;  5LHG B;  2LE8 A;  4PK5 A;  3DJB A;  3MZK B;  1MMA A;  2LEH A;  4TV8 E;  1D1B A;  4ASK A;  2QGS A;  1FEW A;  4JLE A;  4XAX B;  1IJ5 A;  3VU7 H;  4I50 E;  2XAG B;  2H7O A;  2WWU A;  3O1J A;  4H9S E;  5L3F B;  4UEM A;  2JMH A;  3BK9 A;  4H9N C;  1IJ6 A;  3Q9D A;  5A1L A;  4Z8X A;  5LNK A;  2KND A;  2YIN A;  2Y48 B;  4UVB B;  4YHJ A;  1KK7 A;  1SHZ C;  2JPF A;  5F8P A;  3ZYK A;  2DNX A;  4TZ4 C;  2DWK A;  1MMD A;  2D0T A;  5H6Q B;  3CX6 B;  2UXN B;  2JQQ A;  3K3Q C;  5FMN A;  4EB6 E;  2CMR A;  3MK7 C;  2CLY C;  4CZZ B;  4QXB B;  3D0T A;  3PU8 A;  4V1A v;  2XQY A;  3ZN1 B;  3CKD A;  2CCQ A;  2CLY B;  4AKL A;  1UX4 A;  3GMI A;  2V7I A;  4WNK A;  4ZI2 C;  4PJJ A;  2V1D B;  4JEH B;  3TKL B;  4DND A;  3K3O A;  1MIY A;  3CX7 B;  5JDM A;  4AQF A;  3ESL A;  2BDE A;  3HI2 A;  5M4Y A;  1QSD A;  2VKH A;  4O2B E;  2LOS A;  1QUU A;  2V7L A;  5LYJ E;  3MAC A;  4EYU A;  2D0U A;  2LJL A;  4GK0 E;  5J2U E;  2K5B B;  3I0O A;  4CXX A;  2G0U A;  3BQL A;  2A2F X;  5AFU L;  2CWO A;  4G2A A;  2A72 A;  3LBX B;  2D5U A;  5JDN A;  1WYB A;  3GN5 A;  5LGU B;  4OK0 A;  5CA1 E;  2KIN B;  3CVR A;  2LOP A;  1V9D A;  3QUJ A;  3QC9 A;  4TUY E;  3ZMZ B;  2Y6X A;  5IYZ E;  3V5U A;  3N2G E;  4PJL A;  2RP4 A;  3GA8 A;  3UFE A;  4E7Z A;  2CA5 A;  3SWH A;  2PJQ A;  5KX5 E;  3RC8 A;  4AI6 A;  4AQG A;  1WLX A;  3AA0 B;  3N5L A;  2XAF B;  3B57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...