3NRYA

Insights into anti-parallel microtubule crosslinking by prc1, a conserved microtubule binding protein
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
130
structure length
125
Chain Sequence
b'GAAALKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein regulator of cytokinesis 1
publication title Insights into Antiparallel Microtubule Crosslinking by PRC1, a Conserved Nonmotor Microtubule Binding Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 48
structure length 125
sequence length 130
ec nomenclature
pdb deposition date 2010-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1520 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3nryA00
5KMGP 3NRXA 3NRYA
chains in the Genus database with same CATH superfamily
2BVLA 4DV1T 5FY1A 2W62A 5LYJE 2V7KA 3ZMVB 3A8YC 5L3GB 4AKHA 5HXEA 1NAFA 5CA0E 3UU4A 3SRZA 5LGTB 1XNRT 3VRAA 3B13A 4U31A 5CFBA 2QYWA 2LRLA 1WYBA 4EEBA 3K8PC 2XASB 4HWFA 2BS3A 5J2TE 2BVMA 1WFDA 4PJMA 5LMNT 2BS4A 3CK6A 3RYHE 5AQVB 2YN6A 3TLWA 4DR5T 1YKHB 3RKGA 4AQGA 2VQET 3ONXA 2EHOC 3ZMZB 5L3EB 3UFEA 2XAGB 4I50E 4LF8T 3AE3A 4OYJA 2LLYA 5JDFA 2VVNA 1VCSA 2JQHA 2LKHA 5JR9B 3L39A 5FP3A 4MLKA 1YW0A 2V5DA 3ABVA 2EHOD 2M6IA 3ZJ1A 3FZKB 3KV6A 3DJBA 2BZBA 4ZI2C 2X66A 2P9BA 4YSZA 2K3WA 3UU6A 4GK0E 5FXXA 2OV9A 3PJAA 4DUYT 5LA6E 1ZV4X 2WSSV 4CI2B 4ZZBA 4ZI2D 4AXPA 2YEVC 1BR1A 1Y64B 4PFPA 3IF8B 5JDNA 2WU5A 2XZEA 2ES0A 4CXWA 3P4PA 3N2KE 1VOMA 3ZT5A 4CN1A 3H3AA 2MOZA 5H6QB 2CA5A 2BG9E 4E7ZA 2XHEB 4X1KE 2VVSA 1UX4A 2J4GA 3O1IA 5HEJA 2CWOA 3KBTA 4IL4A 3HKCE 5FNVE 3RIUC 4L9IA 4PJNA 1T8BA 5FYMA 2WMOA 3LFMA 4IL9A 3AE8A 4QH1A 1MIVA 3FB2A 3ONJA 3N9PA 4CQIA 4F6RC 3L09A 4JI8T 3AXJA 4U74A 3V5SA 5ETWA 1N34T 3UQ4A 4EB6E 4OFZA 3AAAB 4IDZA 3PUXF 3RGLA 4WBOA 3JAEA 2EHOA 3RH3A 4PJLA 3P7IA 4X66T 3MK7C 5AQKB 4ZXLA 3AE1A 3N2OA 3O4XE 3KV5A 3PURA 5M4YA 4BAYB 3LK42 4Q25A 2D0UA 2PJQA 2K48A 3OPCA 5AQTB 2K5BB 4IE4A 3AEDA 3OBVE 4KX6A 4QHOA 2MBGA 2YU1A 3UU3A 2D0TA 1GQEA 4B6XA 4DR6T 3OJAA 4LF4T 2LHRA 5HEOA 3PJAJ 2X67A 2VK9A 1LVKA 2XAHB 5JDQA 2CCQA 2ZM2A 2NW7A 3FBZA 5AQMB 3VKGA 3HKDE 4IHJE 5HEGA 4HE8A 5JRCA 4QX7B 5ABFA 2XQAA 4JI7T 2CHOA 5C8YE 4H9QC 1T98A 5KXJA 1W09A 5LHIB 1FMVA 4I55E 2CMRA 3AE6A 3AE4A 2WP9A 4YY3T 4UXNB 5L2LA 4ZS3A 2UUCT 3RLFF 4DVDA 1BR2A 4JLEA 3RIUA 2CBJA 3C64A 4EZHA 2RPAA 2XQYA 3ZEFB 1T72A 4DV6T 3B5MA 2VKDA 4PAGA 4DBQA 4ZS2A 2CBIA 5FL1A 2XM2A 2JMHA 5JR9C 4YHJA 5AQIB 4ERRA 4UIGA 3BQIA 4NPPA 5ABGA 3AE7A 5ABEA 1G8XA 5EZYE 2WMNA 2H7VC 4LFAT 2WCAA 4LMKA 3UTKA 2CLYB 5A1LA 3E08A 4NUVA 4BA9A 2ACXA 5DQVA 3NWIA 2IUBA 2UU9T 2LEHA 3TLUA 2V6XA 4F8HA 3GN5B 4JV5T 2ZM6T 2L9QA 3AECA 5JRCB 3B57A 5ABFB 4ISTA 5BR8T 3FXDB 2KNDA 3VHLA 3I9WA 4KP3C 5HXSA 1SHZC 3PE0A 1UX5A 4BJNA 1CUNA 4QWNB 4GYRA 5AQFB 3ZJ2A 4PFOA 2CM0A 2K24A 5HEHA 3ONLC 2J62A 3ZN1B 4B3MT 3RIFA 1E7PA 5AQQB 1WLXA 2WY2A 5FVKA 2CE7A 1S94A 4QX8B 4ZI3C 2FBWA 2ACZA 2VKOA 4OYKA 2JQ9A 3HI2A 2VB6A 3KV4A 3PUZF 1CHUA 2BG9C 5CB4E 3N9MA 4HGAA 3QB5K 1WCRA 2VKJA 3NVOA 3F31A 1HFAA 1US7B 3FXEB 3PUSA 2RA1A 4U33A 4DIDB 2HN1A 3ETVA 3OTOT 3M65A 3P4RA 3ZSSA 2LSKA 4TUYE 2HPLA 2W67A 2V5CA 4H9RC 4GIWA 3K3QC 3F57A 4G2AA 1OWAA 2BDEA 2ZM8A 3EAMA 5JREA 3P4WA 4DR3T 3HR0A 5FVLA 3AEBA 2VL0A 2FJEA 3ZYMA 2HN2A 1HS7A 2FJBA 3ZYKA 4NUUA 2LRKA 2LOPA 3AE9A 3RF1A 2WQYA 4JI4T 2UXBT 5HWYA 2B76A 2X9YA 2WS3A 3FZMB 4G63A 3PV0F 2IC6A 5L3DB 4LF5T 2UXDT 4AQYT 2X51A 4HFHA 3EVYA 1OEDE 4KMCA 4Z90A 4QH5A 1XZYA 5CJ5A 3VU7H 4TN7B 1KK7A 2X9HA 1M62A 2YK0A 4X62T 5DABA 5CGMA 1JNRA 1MNEA 3W15B 3FZLB 1X9BA 2XQ9A 4A5XA 2PTFA 3O9XA 3OVUA 5AQHB 4P0BA 1VCTA 1J5ET 2MYSA 5AFUL 2PFVA 4CI3B 4HFDA 3Q5EA 1OEDB 4P1NA 2XQ6A 3AEGA 4HFIA 3DTOA 3IHRA 1XDOA 4B3TT 2UXNB 5J0ZA 2W61A 3LSVA 1WYCA 1YXRA 2BG9A 3NZQA 1Z8UA 2DI4A 2N2NA 4TZ4C 1WRDA 2KT9A 3ZLIA 2Y6XA 4WZXA 3VKHA 5F3JA 4V1Av 1J5WA 4P09A 2NP9A 3CIRA 2V1DB 3N2GE 2CEAA 2DWKA 1HNXT 4ANJA 2Z6EA 3CX8B 3Q2MA 4UEMA 4FJOA 5HYAA 4O2AE 2CLYC 5H6RB 3LDQB 2C5JA 2G0UA 2FUPA 4OX9T 2FJAA 5LBMA 2E9XB 2J47A 2IDOB 5AQOB 4LFCT 2LE8A 4A97A 4ADZA 2V8SV 3UULA 2V6YA 3I0OA 2JJ9A 4UELA 4YLHA 3L8RA 3PU8A 3ETUA 2Y48B 2CWYA 4ZI7E 2UUBT 2IW5B 1NWMX 4O4HE 4AISA 2LJLA 5LHGB 3ZYLA 2KSRA 3WAKA 1JNZA 3BK9A 3QC9A 2LSIA 3ZSTA 5HWXA 4EZ4A 4COFA 3C50A 2BG9B 4TNVA 3C4ZA 3SS1A 3UU8A 2XY8B 4DR7T 2Y8DA 2UXXB 2W00A 2XQ7A 3T1YT 3RX6A 3MACA 3ZMUB 1KNZA 3ZPOA 2NW9A 5CA1E 5LXTE 1VRBA 5IWAT 4XAXB 3T8OA 1E1HB 1MIYA 2KXPB 2WB5A 5IYZE 3RC3A 4UR9A 3PUYF 1IBMT 4DV0T 3ZKRA 4MFRA 3ZC1A 2M67A 2VWAA 2BS2A 3ESLA 1HR0T 1LVFA 3Q5WA 4B3RT 1DU2A 4DR1T 2I6HA 5FL0A 2LM2A 1HX8A 2V6YB 2DWGA 2XUEA 5LP6E 3P4SA 1IZNB 3U78A 4CXYA 3C98B 3G06A 4A56A 2XQ4A 3K3OA 4H9OC 1Z0PA 4I43B 4HWDA 5FKYA 4YJ2E 2Q9QA 4IREA 3QOFA 3LBXB 2X0HA 4U7IA 1G73A 5C3JA 3CX7B 2NTXA 2L8KA 4KHZF 3KBUA 4E7SA 4TWFA 4TWHA 3VRBA 1FJGT 3GN5A 3TLTA 4TV9E 4IE7A 2XSBA 3ZMSB 2LT3A 2MPKA 2UXCT 2VASA 5LCYA 4LMJA 2QVAA 3P4QA 2H88A 1Y01A 2ODVA 4TNWA 1H7CA 4B3ST 2JQQA 5HEUA 2IMLA 4ZHQE 4EV6A 3TLSA 2YKSA 3AE5A 1AJ3A 1YQ3A 3MKDA 4OHFA 3H3MA 4LF6T 4DMVA 2X68A 5LHHB 2QGSA 5HAXA 3VR9A 4DV2T 4ILCA 1OEDC 3UUNA 4DR2T 5AQPB 2CXLA 5GONE 1ZOYA 5HXCA 3K3NA 3SFEA 4CZZB 4IE6A 4JI3T 2DHRA 4NIQA 1D0ZA 5FXVA 3UUBA 2XAJB 1N33T 4X65T 4YSXA 3CKDA 4DV4T 2XAQB 2Q9QB 3S4UA 2BBHA 3LJCA 1HG2A 4AKRB 1XNQT 1V9DA 3KV9A 2YDRA 1UCUA 5AQSB 4EGWA 4DUZT 2J1DG 4IDQA 2NR4A 2V7LA 4IE5A 2NW8A 4LF7T 4YFSA 2JIWA 3IBPA 3CPZA 3OYXA 3I9YA 2D2SA 5TAOA 2YOEA 1D1AA 4H9PC 1UGOA 1YKEB 5JTGA 5AQGB 1I6ZA 4IT4A 3UQ7A 5FXZA 2E9XC 4EOZB 4YXDA 4PK4A 5KMGP 3HKEE 4ZZCA 4DNDA 1YQ4A 5HXRA 2XTLA 3FZFB 4EYYR 4GK5E 3JAFA 5FMNA 2X9WA 3MJXA 3PUAA 3GMIA 1SE7A 2HHHT 1U4QA 1KNPA 5EK3A 1MNDA 5L3BB 2M6BA 2C0SA 2LSYA 4O8SA 2B1EA 4PJJA 2E9XD 2WZHA 1I94T 1LKXA 3AEAA 3FBLA 1HG5A 3BQLA 3KINB 5HXHA 3KVAA 3ZC0A 4EXTA 2LSJA 5LNKA 5AQLB 1MMNA 5DQWA 1UK5A 1OXZA 1XDPA 4MALA 3C51A 3ZT7A 4Z8XA 3LK3B 3E22E 3HKBE 2AE9A 4JI2T 1HNZT 4HEAA 3AVSA 2WBLA 1UURA 5IHYA 1L0VA 4ZI3D 3O1HA 2H89A 3NRXA 4JYAT 1J1JA 1B7TA 3N9QA 3ANWA 3RRWA 3RYFE 1OEDA 2N1GA 5JQGE 4U2YA 5LGUB 2WDRA 3BQKA 3AAIA 1QSDA 3AA6B 5LB7B 2VQFT 1W0AA 3SWHA 4UF0A 3QB5A 3OKQA 3N9OA 4ZEYA 5JDGA 2OA5A 1X79A 1ZHCA 4KBMB 2H7OA 4EEDA 4LF9T 4H63V 2SPCA 3ZN0B 4DV3T 1S35A 5J2UE 4H9SE 3KVBA 5KX5E 4IGUA 3N9NA 2GK9A 2XAFB 5LJNA 1KF6A 2WU2A 3OYZA 4GOUA 2WZIA 2XSAA 2JRKA 1ZKEA 3RYCE 4HTEA 4U2ZA 2E9XA 5FY7A 2CXFA 2V7JA 2E5LT 1NEKA 1SA0E 3J7Yq 2N9DA 4HWHA 4ILAA 4HN9A 3U3IA 1ZEEA 3CX6B 5LOVE 2A3DA 4KUMB 3HL6A 4ZOLE 3UT5E 4O4LE 3M3ZB 4YSYA 2D9DA 1D1BA 4HWIB 3ANWB 2W0GA 2XJ7A 5L4HA 2HPJA 1WR0A 2K9AA 4JI1T 2XQ3A 1HX1B 2LM9A 4UV9B 2ZLYA 2ODUA 4X64T 2X9XA 5C2TA 4UF0B 4X1IE 2NWBA 2YU2A 2KINB 4AI6A 2IC9A 3UUMA 2E5VA 1NENA 4NXMT 4BJMA 4PNIA 5BMVE 1N36T 3CQXC 5EK2A 1EZ3A 2L3LA 1MMDA 5AQRB 3EUHA 2DNXA 2Q9QC 4WNKA 3AA7B 3T1HT 4EAHA 2JQKA 1QLBA 3CWZB 3EHZA 2C5IT 5LG4A 2BKPA 4I4TE 2W66A 1D0YA 2IAKA 5LJMA 4K0UA 2WDVA 4AQFA 2C5KT 2X0LB 2X0YA 4JI6T 2LSGA 1XWMA 4C90A 3AEFA 4IDOA 4GYSA 2Q9QD 2WWVA 2I0MA 3AB3B 4AKLA 4QXBB 2YINA 3CQGB 2PBIA 3AA0B 3QK6A 5DJQC 1SUMB 3FHNA 4A98A 4OK0A 1IJ5A 3CMLA 3LBXA 3NBXX 4CN4A 2ZM0A 3C4WA 1D0XA 1T7SA 4O2BE 4DMWA 3D0TA 3RYIE 4O4JE 1XMOT 1M7KA 2PG8A 3QUJA 4JBWF 3CQCB 5HCMA 3RRCA 2LKGA 4MHCA 5L47A 3TKLB 2V7MA 4X1YE 3RIAA 1HNWT 4I0UA 5EK4A 1UUSA 2OLTA 1BR0A 3AEEA 4EIWA 4UV8B 2LHNA 4YTPA 2AXDS 4CN6A 4LFBT 2A2FX 3NZPA 4DV7T 3PUVF 4JI0T 3RKOA 3MA9A 2YDQA 1HTJF 3ZCJA 2D5UA 3GWHA 4HFCA 3Q5DA 4LMLA 4WBNE 2V7IA 2WDQA 3N5LA 2H3RA 1D1CA 5JDHA 4HWCA 2E8IA 2WWUA 1LRZA 5AQJB 5AQUB 2VURA 3TLVA 5LBQB 4KI0F 4QH4A 5E0OA 4QXHB 4PW8A 3R6NA 2VL8A 5L3CB 3NKZA 4H9NC 4WYVA 2JMKA 4M1PA 5L4EA 3WI3A 4GKKT 4IIJE 1W0BA 2R6GF 4GKJT 3ZMTB 4O4IE 1O3XA 3AAEB 4N78D 1HF8A 3SFDA 1U5PA 2IHR1 1W9RA 4IDPA 3UU5A 4JI5T 2KLQA 4QKNA 4PK6A 3AXJB 1QUUA 4YHHT 3EABA 1WR6A 4P0AA 3WAJA 2KMFA 4H63H 1MMAA 2I59A 4X5TA 1IBLT 2EHOB 2A9UA 4PK5A 3N9LA 5JDMA 3JCFA 3KDSE 3GA8A 4TX5A 3NRYA 4L0RA 2WM9A 4ASKA 2W4XA 3AE2A 3IEEA 4J2CA 2QA7A 1XMQT 2KWIB 2BKNA 2BBJA 3UFGA 2W63A 4C91A 4ISSA 4CI1B 4IDNA 3QNUA 2WAUA 3LG7A 2QRXA 5FXWA 4HFVA 3FZHB 1KEYA 4YTMA 1KNRA 2KWHA 4DV5T 4L5GA 4YT0A 4U7YA 4KHPT 5ADXL 5LMUT 4FI5A 3KFWX 4XBFB 2RP4A 4DO0A 2YDSA 4JEUB 3AVRA 3P8CD 4U72A 2ZMAA 2HH7A 4K0KT 3SOLA 3V5UA 2XM1A 3MZKB 3A5XA 3VR8A 1ZP0A 4TWDA 2W2UA 3Q9DA 2CXDA 2XQ8A 5JVDE 4Z91A 3CVRA 2CPTA 1N32T 3C4XA 5LG3A 2NTYA 2JPFA 4JUYA 3JC6C 2KZ7B 3HA4A 3EI0A 2UUAT 4AKGA 3PUQA 4QXCB 3AA1B 2XPKA 5F8PA 3RPUA 3P50A 4UVBB 3JADA 3E0ZA 2BKOA 1IBKT 2DCFA 2MAWA 1BR4A 5F5WA 5HCJA 3ZT6A 4HKAA 1HCIA 4HFBA 3ZCIA 4DR4T 4HFEA 4DBRA 3I0QA 4YJ3E 2XQ5A 3Q5XA 3RQUA 3JC6D 5IUXA 3PDYA 2IIUA 3EDVA 3LK2B 5KDMC 2VKHA 4MBQA 4U3CA 3X1DA 3PUGA 5J1GA 3IA3A 2FJDA 4X20E 3I1AA 4UVAB 1KFYA 1YD8G 5AQNB 4IE0A 3EDUA 2A72A 4NXNT 3RI5A 4TV8E 1FEWA 5LGNB 3MXZA 2E2AA 4UVCB 2NOXA 2LOSA 3RC8A 1R8IA 3O1JA 5FY0A 5ABHA 1IAPA 3J9X1 4YTNA 4CXXA 2DL1A 3RQWA 4AKIA 1MIWA 5JH7E 2DLRA 3F2EA 1E2AA 2V26A 3PUWF 3RHWA 1IJ6A 2CRBA 4ILUA 3PU3A 3UUXB 3DP7A 3H37A 3K1SA 4AQFC 4EYUA 4WW0A 4AIUA 2MTQA 3PTRB 5JR9A 2F4VT 5L3FB 4ILBA 1FMWA 3A7MA 4JEHB 4XZCA 3L3PA 1FIOA 2CHNA 1MMGA 3R84B 5JDLA
chains in the Genus database with same CATH topology
2C5KT 2BVLA 2X0LB 4YJ2E 2L9QA 5FY1A 2W62A 5LYJE 3B57A 5JRCB 2Q9QA 2LSGA 4ISTA 2V7KA 3FXDB 3ZMVB 2KNDA 4C90A 5L3GB 3LBXB 4AKHA 5HXEA 1G73A 1NAFA 4GYSA 3VHLA 2Q9QD 3CX7B 2NTXA 3I9WA 5CA0E 2L8KA 3KBUA 3SRZA 4KP3C 3AB3B 5LGTB 4AKLA 4E7SA 4QXBB 5HXSA 1SHZC 3PE0A 1UX5A 2YINA 3CQGB 3GN5A 3B13A 4BJNA 2PBIA 3AA0B 3QK6A 4TV9E 5DJQC 1CUNA 4IE7A 1WYBA 3FHNA 3ZMSB 2LT3A 4QWNB 2VASA 4OK0A 5LCYA 4GYRA 3K8PC 2XASB 1IJ5A 3CMLA 3LBXA 3NBXX 5J2TE 2ZM0A 3C4WA 2BVMA 1D0XA 3ZJ2A 4PFOA 2CM0A 2K24A 4PJMA 4O2BE 4DMWA 3D0TA 3RYIE 2ODVA 4O4JE 1H7CA 3ZN1B 2JQQA 3RYHE 2PG8A 4ZHQE 3QUJA 1WLXA 3CQCB 2CE7A 3RRCA 1S94A 1AJ3A 4MHCA 3MKDA 3TKLB 1YKHB 2V7MA 4X1YE 4OHFA 4QX8B 4AQGA 4ZI3C 4DMVA 2X68A 3ONXA 2EHOC 5EK4A 5LHHB 2QGSA 3ZMZB 2VKOA 5L3EB 3UFEA 4OYKA 5HAXA 3HI2A 2XAGB 4I50E 2VB6A 3KV4A 5CB4E 3N9MA 4OYJA 4HGAA 1BR0A 3UUNA 5JDFA 4EIWA 4UV8B 2CXLA 5GONE 5HXCA 2LHNA 2VKJA 3K3NA 3F31A 5JR9B 1HFAA 2A2FX 3NZPA 5FP3A 4CZZB 4IE6A 4MLKA 1US7B 3FXEB 3PUSA 2DHRA 1D0ZA 1YW0A 2RA1A 5FXVA 2EHOD 2XAJB 3ZJ1A 3RKOA 3KV6A 3ETVA 3M65A 3DJBA 2BZBA 3MA9A 2LSKA 3CKDA 4TUYE 4ZI2C 2X66A 1HTJF 3ZCJA 2HPLA 2D5UA 2XAQB 2Q9QB 3S4UA 4H9RC 4GIWA 2P9BA 3GWHA 3LJCA 1HG2A 3K3QC 4WBNE 4AKRB 1V9DA 3F57A 2V7IA 3KV9A 4G2AA 1UCUA 1OWAA 2BDEA 2J1DG 4GK0E 3N5LA 5FXXA 2ZM8A 2V7LA 2H3RA 5JREA 4IE5A 2NW8A 3HR0A 1D1CA 4YFSA 5JDHA 3IBPA 3CPZA 2E8IA 2WWUA 1LRZA 5LA6E 1ZV4X 3OYXA 3I9YA 3ZYMA 2D2SA 5TAOA 2WSSV 1HS7A 5LBQB 4CI2B 1D1AA 4H9PC 5E0OA 4QXHB 3ZYKA 4NUUA 4PW8A 4ZI2D 1YKEB 3R6NA 2LOPA 4AXPA 2VL8A 5L3CB 2YEVC 1BR1A 5FXZA 1Y64B 2E9XC 4H9NC 4PFPA 2JMKA 4EOZB 5HWYA 2X9YA 3IF8B 4M1PA 4PK4A 5KMGP 5JDNA 3WI3A 4IIJE 3HKEE 4DNDA 2ES0A 5HXRA 4O4IE 3ZMTB 4CXWA 4G63A 2XTLA 1O3XA 2IC6A 3N2KE 1VOMA 3AAEB 4N78D 4EYYR 5L3DB 3H3AA 4GK5E 2MOZA 5H6QB 2CA5A 1HF8A 5FMNA 2X9WA 3MJXA 3PUAA 3GMIA 1U4QA 2X51A 4E7ZA 1U5PA 5EK3A 1MNDA 5L3BB 2XHEB 3EVYA 2C0SA 4KMCA 4X1KE 2KLQA 2LSYA 4QKNA 4O8SA 2B1EA 4PJJA 4TN7B 3VU7H 1KK7A 4PK6A 1UX4A 2X9HA 1QUUA 2E9XD 3O1IA 2YK0A 2CWOA 1LKXA 3KBTA 3FBLA 1WR6A 5DABA 4P0AA 1HG5A 3WAJA 2KMFA 3HKCE 4H63H 1MMAA 2I59A 5FNVE 3BQLA 3KINB 5HXHA 4L9IA 3KVAA 3ZC0A 4PJNA 1MNEA 3W15B 4EXTA 5FYMA 2WMOA 3LFMA 2LSJA 5LNKA 2EHOB 3O9XA 4PK5A 1MIVA 3FB2A 1MMNA 5DQWA 3N9PA 3N9LA 4P0BA 1OXZA 4MALA 3C51A 4CQIA 4F6RC 3L09A 5JDMA 2MYSA 5AFUL 3KDSE 2PFVA 3GA8A 4TX5A 4U74A 4Z8XA 3V5SA 3NRYA 4CI3B 4L0RA 2WM9A 5ETWA 3LK3B 3E22E 4EB6E 4OFZA 4ASKA 3HKBE 3AAAB 4IDZA 3IEEA 4J2CA 4WBOA 4HEAA 3DTOA 2EHOA 3IHRA 2QA7A 3RH3A 2KWIB 3AVSA 2WBLA 2W63A 4C91A 2UXNB 2W61A 4ISSA 4PJLA 5IHYA 4ZI3D 3O1HA 3P7IA 4CI1B 3NRXA 2WAUA 1WYCA 3LG7A 1B7TA 5FXWA 3MK7C 3N9QA 4HFVA 3NZQA 3ANWA 3RRWA 3RYFE 2N1GA 5JQGE 2KWHA 2DI4A 2N2NA 3N2OA 5LGUB 3BQKA 3AAIA 4TZ4C 1WRDA 2KT9A 3O4XE 2Y6XA 3KV5A 3PURA 4L5GA 3ZLIA 5M4YA 1QSDA 5ADXL 4BAYB 4FI5A 3VKHA 3AA6B 3KFWX 4XBFB 5F3JA 3LK42 4V1Av 2RP4A 4P09A 2NP9A 2D0UA 2PJQA 2V1DB 3N2GE 2CEAA 3SWHA 4DO0A 2DWKA 4JEUB 3AVRA 3P8CD 4UF0A 2K48A 4U72A 4ANJA 2Z6EA 3CX8B 3N9OA 3OKQA 3Q2MA 4UEMA 4FJOA 5JDGA 5HYAA 2K5BB 2OA5A 2ZMAA 4IE4A 2HH7A 1X79A 1ZHCA 4O2AE 3OBVE 4QHOA 3SOLA 4KBMB 2H7OA 2CLYC 5H6RB 3V5UA 3MZKB 3A5XA 2MBGA 2C5JA 2G0UA 2YU1A 5LBMA 3Q9DA 4H63V 2CXDA 2E9XB 2SPCA 3ZN0B 2D0TA 1S35A 4B6XA 5J2UE 4H9SE 5JVDE 3CVRA 3OJAA 3KVBA 5KX5E 3C4XA 2LHRA 2NTYA 2JPFA 4JUYA 3JC6C 2LE8A 2KZ7B 2X67A 3HA4A 4IGUA 4ADZA 4AKGA 3N9NA 2GK9A 2XAFB 3PUQA 5LJNA 3UULA 4QXCB 3AA1B 2VK9A 1LVKA 3I0OA 5F8PA 3RPUA 4UVBB 2JJ9A 2XAHB 4UELA 4YLHA 3OYZA 5JDQA 3PU8A 2CCQA 2ZM2A 3ETUA 2NW7A 2Y48B 3FBZA 4GOUA 3E0ZA 2DCFA 2JRKA 1ZKEA 2CWYA 3RYCE 3VKGA 4HTEA 3HKDE 2E9XA 5FY7A 2CXFA 4ZI7E 1BR4A 4IHJE 2IW5B 1NWMX 4HKAA 1HCIA 2V7JA 3ZCIA 4O4HE 2LJLA 4HE8A 5LHGB 4DBRA 3I0QA 5JRCA 4YJ3E 4QX7B 3ZYLA 1SA0E 3Q5XA 3J7Yq 2N9DA 3JC6D 4HN9A 3U3IA 3WAKA 5C8YE 4H9QC 3PDYA 1ZEEA 3CX6B 1T98A 3BK9A 3EDVA 3LK2B 5LHIB 3QC9A 5KDMC 1FMVA 2LSIA 4I55E 2VKHA 4MBQA 5LOVE 2A3DA 4KUMB 3HL6A 4ZOLE 3UT5E 4O4LE 4EZ4A 2CMRA 5HWXA 3PUGA 5J1GA 3C50A 4X20E 4UXNB 5L2LA 3I1AA 1D1BA 4ZS3A 3C4ZA 3SS1A 4UVAB 4DVDA 3ANWB 2W0GA 1BR2A 4JLEA 1YD8G 4IE0A 2HPJA 3EDUA 2A72A 2Y8DA 4TV8E 1FEWA 2UXXB 2K9AA 2W00A 5LGNB 3MXZA 2LM9A 4UV9B 3RX6A 3MACA 2ZLYA 4UVCB 3ZMUB 2NOXA 3C64A 2LOSA 1KNZA 3RC8A 2ODUA 3ZPOA 4EZHA 2NW9A 2X9XA 5CA1E 2XQYA 3O1JA 5FY0A 5LXTE 3ZEFB 1IAPA 1VRBA 4UF0B 2NWBA 4X1IE 3J9X1 2YU2A 4CXXA 4XAXB 3T8OA 2KINB 4AI6A 2IC9A 3UUMA 4AKIA 1MIWA 2VKDA 5JH7E 1E1HB 4PAGA 1MIYA 4DBQA 2DLRA 3F2EA 4ZS2A 2KXPB 4BJMA 5IYZE 2V26A 3RC3A 2JMHA 4PNIA 5BMVE 5JR9C 1IJ6A 4YHJA 4MFRA 3ZC1A 2M67A 4UIGA 4ERRA 2VWAA 4ILUA 3ESLA 3CQXC 3BQIA 3PU3A 1EZ3A 2L3LA 3UUXB 5EK2A 1LVFA 3Q5WA 1MMDA 3DP7A 1G8XA 3H37A 3EUHA 5EZYE 4AQFC 2WMNA 2H7VC 4EYUA 2DNXA 1HX8A 2Q9QC 2DWGA 2XUEA 4WNKA 4WW0A 5LP6E 2MTQA 3UTKA 2CLYB 3AA7B 5A1LA 3E08A 3PTRB 4EAHA 1IZNB 3U78A 4NUVA 5JR9A 4CXYA 5L3FB 4BA9A 2ACXA 5DQVA 1FMWA 3C98B 4A56A 4JEHB 4XZCA 3CWZB 3L3PA 1FIOA 2C5IT 5LG4A 1MMGA 2LEHA 3K3OA 4I4TE 4H9OC 1Z0PA 1D0YA 4I43B 2IAKA 3GN5B 5LJMA 3R84B 4K0UA 5JDLA 4AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMG P;  3NRX A;  3NRY A; 
#chains in the Genus database with same CATH topology
 2BVL A;  4DV1 T;  5FY1 A;  2W62 A;  5LYJ E;  2V7K A;  3ZMV B;  3A8Y C;  5L3G B;  4AKH A;  5HXE A;  1NAF A;  5CA0 E;  3UU4 A;  3SRZ A;  5LGT B;  1XNR T;  3VRA A;  3B13 A;  4U31 A;  5CFB A;  2QYW A;  2LRL A;  1WYB A;  4EEB A;  3K8P C;  2XAS B;  4HWF A;  2BS3 A;  5J2T E;  2BVM A;  1WFD A;  4PJM A;  5LMN T;  2BS4 A;  3CK6 A;  3RYH E;  5AQV B;  2YN6 A;  3TLW A;  4DR5 T;  1YKH B;  3RKG A;  4AQG A;  2VQE T;  3ONX A;  2EHO C;  3ZMZ B;  5L3E B;  3UFE A;  2XAG B;  4I50 E;  4LF8 T;  3AE3 A;  4OYJ A;  2LLY A;  5JDF A;  2VVN A;  1VCS A;  2JQH A;  2LKH A;  5JR9 B;  3L39 A;  5FP3 A;  4MLK A;  1YW0 A;  2V5D A;  3ABV A;  2EHO D;  2M6I A;  3ZJ1 A;  3FZK B;  3KV6 A;  3DJB A;  2BZB A;  4ZI2 C;  2X66 A;  2P9B A;  4YSZ A;  2K3W A;  3UU6 A;  4GK0 E;  5FXX A;  2OV9 A;  3PJA A;  4DUY T;  5LA6 E;  1ZV4 X;  2WSS V;  4CI2 B;  4ZZB A;  4ZI2 D;  4AXP A;  2YEV C;  1BR1 A;  1Y64 B;  4PFP A;  3IF8 B;  5JDN A;  2WU5 A;  2XZE A;  2ES0 A;  4CXW A;  3P4P A;  3N2K E;  1VOM A;  3ZT5 A;  4CN1 A;  3H3A A;  2MOZ A;  5H6Q B;  2CA5 A;  2BG9 E;  4E7Z A;  2XHE B;  4X1K E;  2VVS A;  1UX4 A;  2J4G A;  3O1I A;  5HEJ A;  2CWO A;  3KBT A;  4IL4 A;  3HKC E;  5FNV E;  3RIU C;  4L9I A;  4PJN A;  1T8B A;  5FYM A;  2WMO A;  3LFM A;  4IL9 A;  3AE8 A;  4QH1 A;  1MIV A;  3FB2 A;  3ONJ A;  3N9P A;  4CQI A;  4F6R C;  3L09 A;  4JI8 T;  3AXJ A;  4U74 A;  3V5S A;  5ETW A;  1N34 T;  3UQ4 A;  4EB6 E;  4OFZ A;  3AAA B;  4IDZ A;  3PUX F;  3RGL A;  4WBO A;  3JAE A;  2EHO A;  3RH3 A;  4PJL A;  3P7I A;  4X66 T;  3MK7 C;  5AQK B;  4ZXL A;  3AE1 A;  3N2O A;  3O4X E;  3KV5 A;  3PUR A;  5M4Y A;  4BAY B;  3LK4 2;  4Q25 A;  2D0U A;  2PJQ A;  2K48 A;  3OPC A;  5AQT B;  2K5B B;  4IE4 A;  3AED A;  3OBV E;  4KX6 A;  4QHO A;  2MBG A;  2YU1 A;  3UU3 A;  2D0T A;  1GQE A;  4B6X A;  4DR6 T;  3OJA A;  4LF4 T;  2LHR A;  5HEO A;  3PJA J;  2X67 A;  2VK9 A;  1LVK A;  2XAH B;  5JDQ A;  2CCQ A;  2ZM2 A;  2NW7 A;  3FBZ A;  5AQM B;  3VKG A;  3HKD E;  4IHJ E;  5HEG A;  4HE8 A;  5JRC A;  4QX7 B;  5ABF A;  2XQA A;  4JI7 T;  2CHO A;  5C8Y E;  4H9Q C;  1T98 A;  5KXJ A;  1W09 A;  5LHI B;  1FMV A;  4I55 E;  2CMR A;  3AE6 A;  3AE4 A;  2WP9 A;  4YY3 T;  4UXN B;  5L2L A;  4ZS3 A;  2UUC T;  3RLF F;  4DVD A;  1BR2 A;  4JLE A;  3RIU A;  2CBJ A;  3C64 A;  4EZH A;  2RPA A;  2XQY A;  3ZEF B;  1T72 A;  4DV6 T;  3B5M A;  2VKD A;  4PAG A;  4DBQ A;  4ZS2 A;  2CBI A;  5FL1 A;  2XM2 A;  2JMH A;  5JR9 C;  4YHJ A;  5AQI B;  4ERR A;  4UIG A;  3BQI A;  4NPP A;  5ABG A;  3AE7 A;  5ABE A;  1G8X A;  5EZY E;  2WMN A;  2H7V C;  4LFA T;  2WCA A;  4LMK A;  3UTK A;  2CLY B;  5A1L A;  3E08 A;  4NUV A;  4BA9 A;  2ACX A;  5DQV A;  3NWI A;  2IUB A;  2UU9 T;  2LEH A;  3TLU A;  2V6X A;  4F8H A;  3GN5 B;  4JV5 T;  2ZM6 T;  2L9Q A;  3AEC A;  5JRC B;  3B57 A;  5ABF B;  4IST A;  5BR8 T;  3FXD B;  2KND A;  3VHL A;  3I9W A;  4KP3 C;  5HXS A;  1SHZ C;  3PE0 A;  1UX5 A;  4BJN A;  1CUN A;  4QWN B;  4GYR A;  5AQF B;  3ZJ2 A;  4PFO A;  2CM0 A;  2K24 A;  5HEH A;  3ONL C;  2J62 A;  3ZN1 B;  4B3M T;  3RIF A;  1E7P A;  5AQQ B;  1WLX A;  2WY2 A;  5FVK A;  2CE7 A;  1S94 A;  4QX8 B;  4ZI3 C;  2FBW A;  2ACZ A;  2VKO A;  4OYK A;  2JQ9 A;  3HI2 A;  2VB6 A;  3KV4 A;  3PUZ F;  1CHU A;  2BG9 C;  5CB4 E;  3N9M A;  4HGA A;  3QB5 K;  1WCR A;  2VKJ A;  3NVO A;  3F31 A;  1HFA A;  1US7 B;  3FXE B;  3PUS A;  2RA1 A;  4U33 A;  4DID B;  2HN1 A;  3ETV A;  3OTO T;  3M65 A;  3P4R A;  3ZSS A;  2LSK A;  4TUY E;  2HPL A;  2W67 A;  2V5C A;  4H9R C;  4GIW A;  3K3Q C;  3F57 A;  4G2A A;  1OWA A;  2BDE A;  2ZM8 A;  3EAM A;  5JRE A;  3P4W A;  4DR3 T;  3HR0 A;  5FVL A;  3AEB A;  2VL0 A;  2FJE A;  3ZYM A;  2HN2 A;  1HS7 A;  2FJB A;  3ZYK A;  4NUU A;  2LRK A;  2LOP A;  3AE9 A;  3RF1 A;  2WQY A;  4JI4 T;  2UXB T;  5HWY A;  2B76 A;  2X9Y A;  2WS3 A;  3FZM B;  4G63 A;  3PV0 F;  2IC6 A;  5L3D B;  4LF5 T;  2UXD T;  4AQY T;  2X51 A;  4HFH A;  3EVY A;  1OED E;  4KMC A;  4Z90 A;  4QH5 A;  1XZY A;  5CJ5 A;  3VU7 H;  4TN7 B;  1KK7 A;  2X9H A;  1M62 A;  2YK0 A;  4X62 T;  5DAB A;  5CGM A;  1JNR A;  1MNE A;  3W15 B;  3FZL B;  1X9B A;  2XQ9 A;  4A5X A;  2PTF A;  3O9X A;  3OVU A;  5AQH B;  4P0B A;  1VCT A;  1J5E T;  2MYS A;  5AFU L;  2PFV A;  4CI3 B;  4HFD A;  3Q5E A;  1OED B;  4P1N A;  2XQ6 A;  3AEG A;  4HFI A;  3DTO A;  3IHR A;  1XDO A;  4B3T T;  2UXN B;  5J0Z A;  2W61 A;  3LSV A;  1WYC A;  1YXR A;  2BG9 A;  3NZQ A;  1Z8U A;  2DI4 A;  2N2N A;  4TZ4 C;  1WRD A;  2KT9 A;  3ZLI A;  2Y6X A;  4WZX A;  3VKH A;  5F3J A;  4V1A v;  1J5W A;  4P09 A;  2NP9 A;  3CIR A;  2V1D B;  3N2G E;  2CEA A;  2DWK A;  1HNX T;  4ANJ A;  2Z6E A;  3CX8 B;  3Q2M A;  4UEM A;  4FJO A;  5HYA A;  4O2A E;  2CLY C;  5H6R B;  3LDQ B;  2C5J A;  2G0U A;  2FUP A;  4OX9 T;  2FJA A;  5LBM A;  2E9X B;  2J47 A;  2IDO B;  5AQO B;  4LFC T;  2LE8 A;  4A97 A;  4ADZ A;  2V8S V;  3UUL A;  2V6Y A;  3I0O A;  2JJ9 A;  4UEL A;  4YLH A;  3L8R A;  3PU8 A;  3ETU A;  2Y48 B;  2CWY A;  4ZI7 E;  2UUB T;  2IW5 B;  1NWM X;  4O4H E;  4AIS A;  2LJL A;  5LHG B;  3ZYL A;  2KSR A;  3WAK A;  1JNZ A;  3BK9 A;  3QC9 A;  2LSI A;  3ZST A;  5HWX A;  4EZ4 A;  4COF A;  3C50 A;  2BG9 B;  4TNV A;  3C4Z A;  3SS1 A;  3UU8 A;  2XY8 B;  4DR7 T;  2Y8D A;  2UXX B;  2W00 A;  2XQ7 A;  3T1Y T;  3RX6 A;  3MAC A;  3ZMU B;  1KNZ A;  3ZPO A;  2NW9 A;  5CA1 E;  5LXT E;  1VRB A;  5IWA T;  4XAX B;  3T8O A;  1E1H B;  1MIY A;  2KXP B;  2WB5 A;  5IYZ E;  3RC3 A;  4UR9 A;  3PUY F;  1IBM T;  4DV0 T;  3ZKR A;  4MFR A;  3ZC1 A;  2M67 A;  2VWA A;  2BS2 A;  3ESL A;  1HR0 T;  1LVF A;  3Q5W A;  4B3R T;  1DU2 A;  4DR1 T;  2I6H A;  5FL0 A;  2LM2 A;  1HX8 A;  2V6Y B;  2DWG A;  2XUE A;  5LP6 E;  3P4S A;  1IZN B;  3U78 A;  4CXY A;  3C98 B;  3G06 A;  4A56 A;  2XQ4 A;  3K3O A;  4H9O C;  1Z0P A;  4I43 B;  4HWD A;  5FKY A;  4YJ2 E;  2Q9Q A;  4IRE A;  3QOF A;  3LBX B;  2X0H A;  4U7I A;  1G73 A;  5C3J A;  3CX7 B;  2NTX A;  2L8K A;  4KHZ F;  3KBU A;  4E7S A;  4TWF A;  4TWH A;  3VRB A;  1FJG T;  3GN5 A;  3TLT A;  4TV9 E;  4IE7 A;  2XSB A;  3ZMS B;  2LT3 A;  2MPK A;  2UXC T;  2VAS A;  5LCY A;  4LMJ A;  2QVA A;  3P4Q A;  2H88 A;  1Y01 A;  2ODV A;  4TNW A;  1H7C A;  4B3S T;  2JQQ A;  5HEU A;  2IML A;  4ZHQ E;  4EV6 A;  3TLS A;  2YKS A;  3AE5 A;  1AJ3 A;  1YQ3 A;  3MKD A;  4OHF A;  3H3M A;  4LF6 T;  4DMV A;  2X68 A;  5LHH B;  2QGS A;  5HAX A;  3VR9 A;  4DV2 T;  4ILC A;  1OED C;  3UUN A;  4DR2 T;  5AQP B;  2CXL A;  5GON E;  1ZOY A;  5HXC A;  3K3N A;  3SFE A;  4CZZ B;  4IE6 A;  4JI3 T;  2DHR A;  4NIQ A;  1D0Z A;  5FXV A;  3UUB A;  2XAJ B;  1N33 T;  4X65 T;  4YSX A;  3CKD A;  4DV4 T;  2XAQ B;  2Q9Q B;  3S4U A;  2BBH A;  3LJC A;  1HG2 A;  4AKR B;  1XNQ T;  1V9D A;  3KV9 A;  2YDR A;  1UCU A;  5AQS B;  4EGW A;  4DUZ T;  2J1D G;  4IDQ A;  2NR4 A;  2V7L A;  4IE5 A;  2NW8 A;  4LF7 T;  4YFS A;  2JIW A;  3IBP A;  3CPZ A;  3OYX A;  3I9Y A;  2D2S A;  5TAO A;  2YOE A;  1D1A A;  4H9P C;  1UGO A;  1YKE B;  5JTG A;  5AQG B;  1I6Z A;  4IT4 A;  3UQ7 A;  5FXZ A;  2E9X C;  4EOZ B;  4YXD A;  4PK4 A;  5KMG P;  3HKE E;  4ZZC A;  4DND A;  1YQ4 A;  5HXR A;  2XTL A;  3FZF B;  4EYY R;  4GK5 E;  3JAF A;  5FMN A;  2X9W A;  3MJX A;  3PUA A;  3GMI A;  1SE7 A;  2HHH T;  1U4Q A;  1KNP A;  5EK3 A;  1MND A;  5L3B B;  2M6B A;  2C0S A;  2LSY A;  4O8S A;  2B1E A;  4PJJ A;  2E9X D;  2WZH A;  1I94 T;  1LKX A;  3AEA A;  3FBL A;  1HG5 A;  3BQL A;  3KIN B;  5HXH A;  3KVA A;  3ZC0 A;  4EXT A;  2LSJ A;  5LNK A;  5AQL B;  1MMN A;  5DQW A;  1UK5 A;  1OXZ A;  1XDP A;  4MAL A;  3C51 A;  3ZT7 A;  4Z8X A;  3LK3 B;  3E22 E;  3HKB E;  2AE9 A;  4JI2 T;  1HNZ T;  4HEA A;  3AVS A;  2WBL A;  1UUR A;  5IHY A;  1L0V A;  4ZI3 D;  3O1H A;  2H89 A;  3NRX A;  4JYA T;  1J1J A;  1B7T A;  3N9Q A;  3ANW A;  3RRW A;  3RYF E;  1OED A;  2N1G A;  5JQG E;  4U2Y A;  5LGU B;  2WDR A;  3BQK A;  3AAI A;  1QSD A;  3AA6 B;  5LB7 B;  2VQF T;  1W0A A;  3SWH A;  4UF0 A;  3QB5 A;  3OKQ A;  3N9O A;  4ZEY A;  5JDG A;  2OA5 A;  1X79 A;  1ZHC A;  4KBM B;  2H7O A;  4EED A;  4LF9 T;  4H63 V;  2SPC A;  3ZN0 B;  4DV3 T;  1S35 A;  5J2U E;  4H9S E;  3KVB A;  5KX5 E;  4IGU A;  3N9N A;  2GK9 A;  2XAF B;  5LJN A;  1KF6 A;  2WU2 A;  3OYZ A;  4GOU A;  2WZI A;  2XSA A;  2JRK A;  1ZKE A;  3RYC E;  4HTE A;  4U2Z A;  2E9X A;  5FY7 A;  2CXF A;  2V7J A;  2E5L T;  1NEK A;  1SA0 E;  3J7Y q;  2N9D A;  4HWH A;  4ILA A;  4HN9 A;  3U3I A;  1ZEE A;  3CX6 B;  5LOV E;  2A3D A;  4KUM B;  3HL6 A;  4ZOL E;  3UT5 E;  4O4L E;  3M3Z B;  4YSY A;  2D9D A;  1D1B A;  4HWI B;  3ANW B;  2W0G A;  2XJ7 A;  5L4H A;  2HPJ A;  1WR0 A;  2K9A A;  4JI1 T;  2XQ3 A;  1HX1 B;  2LM9 A;  4UV9 B;  2ZLY A;  2ODU A;  4X64 T;  2X9X A;  5C2T A;  4UF0 B;  4X1I E;  2NWB A;  2YU2 A;  2KIN B;  4AI6 A;  2IC9 A;  3UUM A;  2E5V A;  1NEN A;  4NXM T;  4BJM A;  4PNI A;  5BMV E;  1N36 T;  3CQX C;  5EK2 A;  1EZ3 A;  2L3L A;  1MMD A;  5AQR B;  3EUH A;  2DNX A;  2Q9Q C;  4WNK A;  3AA7 B;  3T1H T;  4EAH A;  2JQK A;  1QLB A;  3CWZ B;  3EHZ A;  2C5I T;  5LG4 A;  2BKP A;  4I4T E;  2W66 A;  1D0Y A;  2IAK A;  5LJM A;  4K0U A;  2WDV A;  4AQF A;  2C5K T;  2X0L B;  2X0Y A;  4JI6 T;  2LSG A;  1XWM A;  4C90 A;  3AEF A;  4IDO A;  4GYS A;  2Q9Q D;  2WWV A;  2I0M A;  3AB3 B;  4AKL A;  4QXB B;  2YIN A;  3CQG B;  2PBI A;  3AA0 B;  3QK6 A;  5DJQ C;  1SUM B;  3FHN A;  4A98 A;  4OK0 A;  1IJ5 A;  3CML A;  3LBX A;  3NBX X;  4CN4 A;  2ZM0 A;  3C4W A;  1D0X A;  1T7S A;  4O2B E;  4DMW A;  3D0T A;  3RYI E;  4O4J E;  1XMO T;  1M7K A;  2PG8 A;  3QUJ A;  4JBW F;  3CQC B;  5HCM A;  3RRC A;  2LKG A;  4MHC A;  5L47 A;  3TKL B;  2V7M A;  4X1Y E;  3RIA A;  1HNW T;  4I0U A;  5EK4 A;  1UUS A;  2OLT A;  1BR0 A;  3AEE A;  4EIW A;  4UV8 B;  2LHN A;  4YTP A;  2AXD S;  4CN6 A;  4LFB T;  2A2F X;  3NZP A;  4DV7 T;  3PUV F;  4JI0 T;  3RKO A;  3MA9 A;  2YDQ A;  1HTJ F;  3ZCJ A;  2D5U A;  3GWH A;  4HFC A;  3Q5D A;  4LML A;  4WBN E;  2V7I A;  2WDQ A;  3N5L A;  2H3R A;  1D1C A;  5JDH A;  4HWC A;  2E8I A;  2WWU A;  1LRZ A;  5AQJ B;  5AQU B;  2VUR A;  3TLV A;  5LBQ B;  4KI0 F;  4QH4 A;  5E0O A;  4QXH B;  4PW8 A;  3R6N A;  2VL8 A;  5L3C B;  3NKZ A;  4H9N C;  4WYV A;  2JMK A;  4M1P A;  5L4E A;  3WI3 A;  4GKK T;  4IIJ E;  1W0B A;  2R6G F;  4GKJ T;  3ZMT B;  4O4I E;  1O3X A;  3AAE B;  4N78 D;  1HF8 A;  3SFD A;  1U5P A;  2IHR 1;  1W9R A;  4IDP A;  3UU5 A;  4JI5 T;  2KLQ A;  4QKN A;  4PK6 A;  3AXJ B;  1QUU A;  4YHH T;  3EAB A;  1WR6 A;  4P0A A;  3WAJ A;  2KMF A;  4H63 H;  1MMA A;  2I59 A;  4X5T A;  1IBL T;  2EHO B;  2A9U A;  4PK5 A;  3N9L A;  5JDM A;  3JCF A;  3KDS E;  3GA8 A;  4TX5 A;  3NRY A;  4L0R A;  2WM9 A;  4ASK A;  2W4X A;  3AE2 A;  3IEE A;  4J2C A;  2QA7 A;  1XMQ T;  2KWI B;  2BKN A;  2BBJ A;  3UFG A;  2W63 A;  4C91 A;  4ISS A;  4CI1 B;  4IDN A;  3QNU A;  2WAU A;  3LG7 A;  2QRX A;  5FXW A;  4HFV A;  3FZH B;  1KEY A;  4YTM A;  1KNR A;  2KWH A;  4DV5 T;  4L5G A;  4YT0 A;  4U7Y A;  4KHP T;  5ADX L;  5LMU T;  4FI5 A;  3KFW X;  4XBF B;  2RP4 A;  4DO0 A;  2YDS A;  4JEU B;  3AVR A;  3P8C D;  4U72 A;  2ZMA A;  2HH7 A;  4K0K T;  3SOL A;  3V5U A;  2XM1 A;  3MZK B;  3A5X A;  3VR8 A;  1ZP0 A;  4TWD A;  2W2U A;  3Q9D A;  2CXD A;  2XQ8 A;  5JVD E;  4Z91 A;  3CVR A;  2CPT A;  1N32 T;  3C4X A;  5LG3 A;  2NTY A;  2JPF A;  4JUY A;  3JC6 C;  2KZ7 B;  3HA4 A;  3EI0 A;  2UUA T;  4AKG A;  3PUQ A;  4QXC B;  3AA1 B;  2XPK A;  5F8P A;  3RPU A;  3P50 A;  4UVB B;  3JAD A;  3E0Z A;  2BKO A;  1IBK T;  2DCF A;  2MAW A;  1BR4 A;  5F5W A;  5HCJ A;  3ZT6 A;  4HKA A;  1HCI A;  4HFB A;  3ZCI A;  4DR4 T;  4HFE A;  4DBR A;  3I0Q A;  4YJ3 E;  2XQ5 A;  3Q5X A;  3RQU A;  3JC6 D;  5IUX A;  3PDY A;  2IIU A;  3EDV A;  3LK2 B;  5KDM C;  2VKH A;  4MBQ A;  4U3C A;  3X1D A;  3PUG A;  5J1G A;  3IA3 A;  2FJD A;  4X20 E;  3I1A A;  4UVA B;  1KFY A;  1YD8 G;  5AQN B;  4IE0 A;  3EDU A;  2A72 A;  4NXN T;  3RI5 A;  4TV8 E;  1FEW A;  5LGN B;  3MXZ A;  2E2A A;  4UVC B;  2NOX A;  2LOS A;  3RC8 A;  1R8I A;  3O1J A;  5FY0 A;  5ABH A;  1IAP A;  3J9X 1;  4YTN A;  4CXX A;  2DL1 A;  3RQW A;  4AKI A;  1MIW A;  5JH7 E;  2DLR A;  3F2E A;  1E2A A;  2V26 A;  3PUW F;  3RHW A;  1IJ6 A;  2CRB A;  4ILU A;  3PU3 A;  3UUX B;  3DP7 A;  3H37 A;  3K1S A;  4AQF C;  4EYU A;  4WW0 A;  4AIU A;  2MTQ A;  3PTR B;  5JR9 A;  2F4V T;  5L3F B;  4ILB A;  1FMW A;  3A7M A;  4JEH B;  4XZC A;  3L3P A;  1FIO A;  2CHN A;  1MMG A;  3R84 B;  5JDL A; 
#chains in the Genus database with same CATH homology
 2C5K T;  2BVL A;  2X0L B;  4YJ2 E;  2L9Q A;  5FY1 A;  2W62 A;  5LYJ E;  3B57 A;  5JRC B;  2Q9Q A;  2LSG A;  4IST A;  2V7K A;  3FXD B;  3ZMV B;  2KND A;  4C90 A;  5L3G B;  3LBX B;  4AKH A;  5HXE A;  1G73 A;  1NAF A;  4GYS A;  3VHL A;  2Q9Q D;  3CX7 B;  2NTX A;  3I9W A;  5CA0 E;  2L8K A;  3KBU A;  3SRZ A;  4KP3 C;  3AB3 B;  5LGT B;  4AKL A;  4E7S A;  4QXB B;  5HXS A;  1SHZ C;  3PE0 A;  1UX5 A;  2YIN A;  3CQG B;  3GN5 A;  3B13 A;  4BJN A;  2PBI A;  3AA0 B;  3QK6 A;  4TV9 E;  5DJQ C;  1CUN A;  4IE7 A;  1WYB A;  3FHN A;  3ZMS B;  2LT3 A;  4QWN B;  2VAS A;  4OK0 A;  5LCY A;  4GYR A;  3K8P C;  2XAS B;  1IJ5 A;  3CML A;  3LBX A;  3NBX X;  5J2T E;  2ZM0 A;  3C4W A;  2BVM A;  1D0X A;  3ZJ2 A;  4PFO A;  2CM0 A;  2K24 A;  4PJM A;  4O2B E;  4DMW A;  3D0T A;  3RYI E;  2ODV A;  4O4J E;  1H7C A;  3ZN1 B;  2JQQ A;  3RYH E;  2PG8 A;  4ZHQ E;  3QUJ A;  1WLX A;  3CQC B;  2CE7 A;  3RRC A;  1S94 A;  1AJ3 A;  4MHC A;  3MKD A;  3TKL B;  1YKH B;  2V7M A;  4X1Y E;  4OHF A;  4QX8 B;  4AQG A;  4ZI3 C;  4DMV A;  2X68 A;  3ONX A;  2EHO C;  5EK4 A;  5LHH B;  2QGS A;  3ZMZ B;  2VKO A;  5L3E B;  3UFE A;  4OYK A;  5HAX A;  3HI2 A;  2XAG B;  4I50 E;  2VB6 A;  3KV4 A;  5CB4 E;  3N9M A;  4OYJ A;  4HGA A;  1BR0 A;  3UUN A;  5JDF A;  4EIW A;  4UV8 B;  2CXL A;  5GON E;  5HXC A;  2LHN A;  2VKJ A;  3K3N A;  3F31 A;  5JR9 B;  1HFA A;  2A2F X;  3NZP A;  5FP3 A;  4CZZ B;  4IE6 A;  4MLK A;  1US7 B;  3FXE B;  3PUS A;  2DHR A;  1D0Z A;  1YW0 A;  2RA1 A;  5FXV A;  2EHO D;  2XAJ B;  3ZJ1 A;  3RKO A;  3KV6 A;  3ETV A;  3M65 A;  3DJB A;  2BZB A;  3MA9 A;  2LSK A;  3CKD A;  4TUY E;  4ZI2 C;  2X66 A;  1HTJ F;  3ZCJ A;  2HPL A;  2D5U A;  2XAQ B;  2Q9Q B;  3S4U A;  4H9R C;  4GIW A;  2P9B A;  3GWH A;  3LJC A;  1HG2 A;  3K3Q C;  4WBN E;  4AKR B;  1V9D A;  3F57 A;  2V7I A;  3KV9 A;  4G2A A;  1UCU A;  1OWA A;  2BDE A;  2J1D G;  4GK0 E;  3N5L A;  5FXX A;  2ZM8 A;  2V7L A;  2H3R A;  5JRE A;  4IE5 A;  2NW8 A;  3HR0 A;  1D1C A;  4YFS A;  5JDH A;  3IBP A;  3CPZ A;  2E8I A;  2WWU A;  1LRZ A;  5LA6 E;  1ZV4 X;  3OYX A;  3I9Y A;  3ZYM A;  2D2S A;  5TAO A;  2WSS V;  1HS7 A;  5LBQ B;  4CI2 B;  1D1A A;  4H9P C;  5E0O A;  4QXH B;  3ZYK A;  4NUU A;  4PW8 A;  4ZI2 D;  1YKE B;  3R6N A;  2LOP A;  4AXP A;  2VL8 A;  5L3C B;  2YEV C;  1BR1 A;  5FXZ A;  1Y64 B;  2E9X C;  4H9N C;  4PFP A;  2JMK A;  4EOZ B;  5HWY A;  2X9Y A;  3IF8 B;  4M1P A;  4PK4 A;  5KMG P;  5JDN A;  3WI3 A;  4IIJ E;  3HKE E;  4DND A;  2ES0 A;  5HXR A;  4O4I E;  3ZMT B;  4CXW A;  4G63 A;  2XTL A;  1O3X A;  2IC6 A;  3N2K E;  1VOM A;  3AAE B;  4N78 D;  4EYY R;  5L3D B;  3H3A A;  4GK5 E;  2MOZ A;  5H6Q B;  2CA5 A;  1HF8 A;  5FMN A;  2X9W A;  3MJX A;  3PUA A;  3GMI A;  1U4Q A;  2X51 A;  4E7Z A;  1U5P A;  5EK3 A;  1MND A;  5L3B B;  2XHE B;  3EVY A;  2C0S A;  4KMC A;  4X1K E;  2KLQ A;  2LSY A;  4QKN A;  4O8S A;  2B1E A;  4PJJ A;  4TN7 B;  3VU7 H;  1KK7 A;  4PK6 A;  1UX4 A;  2X9H A;  1QUU A;  2E9X D;  3O1I A;  2YK0 A;  2CWO A;  1LKX A;  3KBT A;  3FBL A;  1WR6 A;  5DAB A;  4P0A A;  1HG5 A;  3WAJ A;  2KMF A;  3HKC E;  4H63 H;  1MMA A;  2I59 A;  5FNV E;  3BQL A;  3KIN B;  5HXH A;  4L9I A;  3KVA A;  3ZC0 A;  4PJN A;  1MNE A;  3W15 B;  4EXT A;  5FYM A;  2WMO A;  3LFM A;  2LSJ A;  5LNK A;  2EHO B;  3O9X A;  4PK5 A;  1MIV A;  3FB2 A;  1MMN A;  5DQW A;  3N9P A;  3N9L A;  4P0B A;  1OXZ A;  4MAL A;  3C51 A;  4CQI A;  4F6R C;  3L09 A;  5JDM A;  2MYS A;  5AFU L;  3KDS E;  2PFV A;  3GA8 A;  4TX5 A;  4U74 A;  4Z8X A;  3V5S A;  3NRY A;  4CI3 B;  4L0R A;  2WM9 A;  5ETW A;  3LK3 B;  3E22 E;  4EB6 E;  4OFZ A;  4ASK A;  3HKB E;  3AAA B;  4IDZ A;  3IEE A;  4J2C A;  4WBO A;  4HEA A;  3DTO A;  2EHO A;  3IHR A;  2QA7 A;  3RH3 A;  2KWI B;  3AVS A;  2WBL A;  2W63 A;  4C91 A;  2UXN B;  2W61 A;  4ISS A;  4PJL A;  5IHY A;  4ZI3 D;  3O1H A;  3P7I A;  4CI1 B;  3NRX A;  2WAU A;  1WYC A;  3LG7 A;  1B7T A;  5FXW A;  3MK7 C;  3N9Q A;  4HFV A;  3NZQ A;  3ANW A;  3RRW A;  3RYF E;  2N1G A;  5JQG E;  2KWH A;  2DI4 A;  2N2N A;  3N2O A;  5LGU B;  3BQK A;  3AAI A;  4TZ4 C;  1WRD A;  2KT9 A;  3O4X E;  2Y6X A;  3KV5 A;  3PUR A;  4L5G A;  3ZLI A;  5M4Y A;  1QSD A;  5ADX L;  4BAY B;  4FI5 A;  3VKH A;  3AA6 B;  3KFW X;  4XBF B;  5F3J A;  3LK4 2;  4V1A v;  2RP4 A;  4P09 A;  2NP9 A;  2D0U A;  2PJQ A;  2V1D B;  3N2G E;  2CEA A;  3SWH A;  4DO0 A;  2DWK A;  4JEU B;  3AVR A;  3P8C D;  4UF0 A;  2K48 A;  4U72 A;  4ANJ A;  2Z6E A;  3CX8 B;  3N9O A;  3OKQ A;  3Q2M A;  4UEM A;  4FJO A;  5JDG A;  5HYA A;  2K5B B;  2OA5 A;  2ZMA A;  4IE4 A;  2HH7 A;  1X79 A;  1ZHC A;  4O2A E;  3OBV E;  4QHO A;  3SOL A;  4KBM B;  2H7O A;  2CLY C;  5H6R B;  3V5U A;  3MZK B;  3A5X A;  2MBG A;  2C5J A;  2G0U A;  2YU1 A;  5LBM A;  3Q9D A;  4H63 V;  2CXD A;  2E9X B;  2SPC A;  3ZN0 B;  2D0T A;  1S35 A;  4B6X A;  5J2U E;  4H9S E;  5JVD E;  3CVR A;  3OJA A;  3KVB A;  5KX5 E;  3C4X A;  2LHR A;  2NTY A;  2JPF A;  4JUY A;  3JC6 C;  2LE8 A;  2KZ7 B;  2X67 A;  3HA4 A;  4IGU A;  4ADZ A;  4AKG A;  3N9N A;  2GK9 A;  2XAF B;  3PUQ A;  5LJN A;  3UUL A;  4QXC B;  3AA1 B;  2VK9 A;  1LVK A;  3I0O A;  5F8P A;  3RPU A;  4UVB B;  2JJ9 A;  2XAH B;  4UEL A;  4YLH A;  3OYZ A;  5JDQ A;  3PU8 A;  2CCQ A;  2ZM2 A;  3ETU A;  2NW7 A;  2Y48 B;  3FBZ A;  4GOU A;  3E0Z A;  2DCF A;  2JRK A;  1ZKE A;  2CWY A;  3RYC E;  3VKG A;  4HTE A;  3HKD E;  2E9X A;  5FY7 A;  2CXF A;  4ZI7 E;  1BR4 A;  4IHJ E;  2IW5 B;  1NWM X;  4HKA A;  1HCI A;  2V7J A;  3ZCI A;  4O4H E;  2LJL A;  4HE8 A;  5LHG B;  4DBR A;  3I0Q A;  5JRC A;  4YJ3 E;  4QX7 B;  3ZYL A;  1SA0 E;  3Q5X A;  3J7Y q;  2N9D A;  3JC6 D;  4HN9 A;  3U3I A;  3WAK A;  5C8Y E;  4H9Q C;  3PDY A;  1ZEE A;  3CX6 B;  1T98 A;  3BK9 A;  3EDV A;  3LK2 B;  5LHI B;  3QC9 A;  5KDM C;  1FMV A;  2LSI A;  4I55 E;  2VKH A;  4MBQ A;  5LOV E;  2A3D A;  4KUM B;  3HL6 A;  4ZOL E;  3UT5 E;  4O4L E;  4EZ4 A;  2CMR A;  5HWX A;  3PUG A;  5J1G A;  3C50 A;  4X20 E;  4UXN B;  5L2L A;  3I1A A;  1D1B A;  4ZS3 A;  3C4Z A;  3SS1 A;  4UVA B;  4DVD A;  3ANW B;  2W0G A;  1BR2 A;  4JLE A;  1YD8 G;  4IE0 A;  2HPJ A;  3EDU A;  2A72 A;  2Y8D A;  4TV8 E;  1FEW A;  2UXX B;  2K9A A;  2W00 A;  5LGN B;  3MXZ A;  2LM9 A;  4UV9 B;  3RX6 A;  3MAC A;  2ZLY A;  4UVC B;  3ZMU B;  2NOX A;  3C64 A;  2LOS A;  1KNZ A;  3RC8 A;  2ODU A;  3ZPO A;  4EZH A;  2NW9 A;  2X9X A;  5CA1 E;  2XQY A;  3O1J A;  5FY0 A;  5LXT E;  3ZEF B;  1IAP A;  1VRB A;  4UF0 B;  2NWB A;  4X1I E;  3J9X 1;  2YU2 A;  4CXX A;  4XAX B;  3T8O A;  2KIN B;  4AI6 A;  2IC9 A;  3UUM A;  4AKI A;  1MIW A;  2VKD A;  5JH7 E;  1E1H B;  4PAG A;  1MIY A;  4DBQ A;  2DLR A;  3F2E A;  4ZS2 A;  2KXP B;  4BJM A;  5IYZ E;  2V26 A;  3RC3 A;  2JMH A;  4PNI A;  5BMV E;  5JR9 C;  1IJ6 A;  4YHJ A;  4MFR A;  3ZC1 A;  2M67 A;  4UIG A;  4ERR A;  2VWA A;  4ILU A;  3ESL A;  3CQX C;  3BQI A;  3PU3 A;  1EZ3 A;  2L3L A;  3UUX B;  5EK2 A;  1LVF A;  3Q5W A;  1MMD A;  3DP7 A;  1G8X A;  3H37 A;  3EUH A;  5EZY E;  4AQF C;  2WMN A;  2H7V C;  4EYU A;  2DNX A;  1HX8 A;  2Q9Q C;  2DWG A;  2XUE A;  4WNK A;  4WW0 A;  5LP6 E;  2MTQ A;  3UTK A;  2CLY B;  3AA7 B;  5A1L A;  3E08 A;  3PTR B;  4EAH A;  1IZN B;  3U78 A;  4NUV A;  5JR9 A;  4CXY A;  5L3F B;  4BA9 A;  2ACX A;  5DQV A;  1FMW A;  3C98 B;  4A56 A;  4JEH B;  4XZC A;  3CWZ B;  3L3P A;  1FIO A;  2C5I T;  5LG4 A;  1MMG A;  2LEH A;  3K3O A;  4I4T E;  4H9O C;  1Z0P A;  1D0Y A;  4I43 B;  2IAK A;  3GN5 B;  5LJM A;  3R84 B;  4K0U A;  5JDL A;  4AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...