3NS4A

Structure of a c-terminal fragment of its vps53 subunit suggests similarity of garp to a family of tethering complexes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
205
Chain Sequence
b'FILSQFNRDVYKWNFLDKVIDIMTTNFVSNTIRLLQPVPPFSLAGSKRKFETRTVVNIGEQLLLDLELLKEIFHTLPESVSNDSDLRENTSYKRVKRHADNNIDQLLKFIKLLMAPLDSADDYYETYSKLTNNNPDSAVWSFVLALKGIPWDLALWKKMWSAYNLETNRDLFIFKWDKVLLGQFENNLARMQDPNWSKFVRQDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 53
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Structure of a C-terminal fragment of its Vps53 subunit suggests similarity of Golgi-associated retrograde protein (GARP) complex to a family of tethering complexes.
pubmed doi rcsb
total genus 69
structure length 205
sequence length 216
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16854 VPS53_C Vacuolar protein sorting-associated protein 53 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.110 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3ns4A00
3NS4A
chains in the Genus database with same CATH superfamily
2XPUA 3K8PC 3ANGA 3FRQA 2F07A 5EFYA 3GZIA 3QPSA 2NP3A 5J1YA 5FKKA 4B1RA 1QVUA 2HXOA 3ZQGA 2UXOA 3G7RA 2NS8A 3O60A 3TP0A 2UXHA 5HSZA 3WHCA 3C2BA 3Q0WA 5IPAA 4GCTA 4ICHA 3WHBA 3T6NA 3PASA 5K7FA 3DPJA 5D18A 5CXIA 3LWJA 2GUHA 5FHPA 2GFNA 3BCGA 2XGEA 1T33A 4ACIA 5GPCA 4AC0A 4GFKA 2R7SA 2R7XA 5HAWA 3ZQIA 4WIBA 5FKOA 2IEKA 3BJBA 3BR2A 3ZQFA 3KNWA 3HTHA 4M3DA 3ZQHA 3LSRA 3QBMA 3V6GA 2DG7A 3IUVA 3BTCA 2HKUA 2R7WA 2FJI1 2W53A 5F04A 2OPTA 1T56A 2XPWA 3B6AA 3AQSA 3LSPA 1UI5A 3BT9A 3HTAA 2NP5A 4OD4A 3ZQLA 2IBDA 2B1EA 4AUXA 3HGYA 3CJDA 3LHQA 3COLA 4U9LA 3O8HA 4OD5A 4D5CA 4M3GA 3HE0A 3SWHA 3VVXA 4D7NA 2O7OA 2ZCMA 3NI7A 1JT6A 2I10A 3HIMA 2REKA 2TRTA 5F0HA 3GEUA 2ZB9A 5FMPA 3MNLA 3CRJA 4D5FA 3G1MA 3E7QA 1JUMA 3B81A 3G56A 2QOPA 3PM1A 2FQ4A 3JSJA 2B3WA 4I76A 3KKCA 2ZOYA 2XPVA 2R7VA 2RASA 4PXIA 2PZ9A 4JL3A 2PFVA 2R7OA 3BRUA 3BTIA 3KZ9A 4W1UA 3Q0UA 4JNNA 2QIBA 5D19A 2IU5A 3VOXA 3BTJA 2ZOZA 2G0EA 4AF5A 4M3EA 2XGDA 2WUIA 2G7GA 3TP3A 5J3LA 3FHNA 2RAEA 4NN1A 5GP9A 2Y30A 5C4YA 3B6CA 3CDLA 3CCYA 3RD3A 4MK6A 2ID3A 3VW1A 1A6IA 3F0CA 2XRLA 4U9NA 4DW6A 2QTQA 4KWAA 2WV1A 2UXPA 3BR6A 5AQCA 1RKWA 4V2GA 1JUPA 4W97A 3BR5A 2QCOA 3BNIA 3NS4A 4IRVA 5EZGA 3DEWA 5EZHA 2G3BA 2R7TA 1BJZA 5F1JA 3V78A 3DU5A 3VP5A 5H9TA 3DU6A 3BR0A 4L62A 4JYKA 2IAIA 4G12A 3QKXA 2Q24A 2G7SA 5EYRA 2DG8A 5D1RA 4XK4A 2HXIA 2NX4A 3BR1A 4YZEA 1VI0A 4JKZA 2A2FX 3IH2A 3SDGA 4AC6A 2FX0A 3C07A 2RHAA 3FIWA 3ON2A 2UXIA 4NELA 2FBQA 5F0CA 3DCFA 3RH2A 5J1UA 3VOKA 2FJ1A 3BQZA 2XGCA 3VVZA 5IOYA 3BQYA 3LJLA 5CW8A 2Y2ZA 2HQ5A 3FK6A 2XDNA 3IH3A 4C2MA 2X9DA 2DTZA 2Y31A 2OERA 1Z0XA 4MXMA 4UDSA 4M3FA 3HGGA 3MVPA 3VVYA 2GENA 1SGMA 3LOCA 1Z77A 3ON4A 1JTYA 3KKDA 3P9TA 2WGBA 5FGLA 3BHQA 2R7RA 5K58A 3HTIA 3QQAA 4ABZA 3SFIA 4M3BA 2VKEA 3ANPA 2VKVA 1UI6A 1U9NA 2ZCXA 2UXUA 2GBYA 2YVEA 2YVXA 2V57A 1JUSA 3F1BA 3VUQA 3Q3SA 2YVHA 3NNRA 2X6OA 2PBXA 2ZY9A 2R7QA 2OF7A 4MO7A 5F08A 5F0FA 5J1RA 5FKLA 3VW2A 3VTIA 3G1LA 2G7LA 5F27A 3BTLA 4GCLA 3NRGA 4V2FA 3O8GA 5K7HA 4GCKA 4B3AA 2QWTA 5HBUA 2JJ7A 3Q0VA 3VW0A 4D7MA 3G1OA 3VIBA 5FKMA 1U9OA 2XB5A 1QPIA 5IOZA 3S5RA 4I6ZA 4X1EA 2HYJA 2D6YA 5DAJA 3QPLA 1RPWA 5GPAA 3BR3A 2TCTA 5FKNA 5IP6A 3NPIA 2VPRA 3HTJA 3VPRA 4GFLA 5CQGA 3CWRA 2R7UA 3EGQA 5K7ZA 2NS7A 2ID6A 1JT0A 3EUPA 3NXCA 4DVYP 3IH4A 4HKUA 2QKOA 2FD5A 2OI8A 4ME9A 3PPBA 1RKTA 1JTXA 3LSJA 2O7TA 1ZKGA 1ORKA 2HYTA 2ZCNA 3FK7A 3KYLA 1QVTA 2JK3A 2EH3A 4CGRA 5CXGA 1ZK8A 3AQTA
chains in the Genus database with same CATH topology
2FJI1 3K8PC 2A2FX 4C2MA 2R7SA 2R7TA 2R7RA 2R7XA 3DU5A 3FHNA 2R7VA 4OD4A 3VTIA 4DVYP 2B1EA 2PFVA 3DU6A 2R7OA 3KYLA 4OD5A 3NS4A 3SWHA 2B3WA 2R7QA 4IRVA 5CQGA 2R7UA 2R7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS4 A; 
#chains in the Genus database with same CATH topology
 2XPU A;  3K8P C;  3ANG A;  3FRQ A;  2F07 A;  5EFY A;  3GZI A;  3QPS A;  2NP3 A;  5J1Y A;  5FKK A;  4B1R A;  1QVU A;  2HXO A;  3ZQG A;  2UXO A;  3G7R A;  2NS8 A;  3O60 A;  3TP0 A;  2UXH A;  5HSZ A;  3WHC A;  3C2B A;  3Q0W A;  5IPA A;  4GCT A;  4ICH A;  3WHB A;  3T6N A;  3PAS A;  5K7F A;  3DPJ A;  5D18 A;  5CXI A;  3LWJ A;  2GUH A;  5FHP A;  2GFN A;  3BCG A;  2XGE A;  1T33 A;  4ACI A;  5GPC A;  4AC0 A;  4GFK A;  2R7S A;  2R7X A;  5HAW A;  3ZQI A;  4WIB A;  5FKO A;  2IEK A;  3BJB A;  3BR2 A;  3ZQF A;  3KNW A;  3HTH A;  4M3D A;  3ZQH A;  3LSR A;  3QBM A;  3V6G A;  2DG7 A;  3IUV A;  3BTC A;  2HKU A;  2R7W A;  2FJI 1;  2W53 A;  5F04 A;  2OPT A;  1T56 A;  2XPW A;  3B6A A;  3AQS A;  3LSP A;  1UI5 A;  3BT9 A;  3HTA A;  2NP5 A;  4OD4 A;  3ZQL A;  2IBD A;  2B1E A;  4AUX A;  3HGY A;  3CJD A;  3LHQ A;  3COL A;  4U9L A;  3O8H A;  4OD5 A;  4D5C A;  4M3G A;  3HE0 A;  3SWH A;  3VVX A;  4D7N A;  2O7O A;  2ZCM A;  3NI7 A;  1JT6 A;  2I10 A;  3HIM A;  2REK A;  2TRT A;  5F0H A;  3GEU A;  2ZB9 A;  5FMP A;  3MNL A;  3CRJ A;  4D5F A;  3G1M A;  3E7Q A;  1JUM A;  3B81 A;  3G56 A;  2QOP A;  3PM1 A;  2FQ4 A;  3JSJ A;  2B3W A;  4I76 A;  3KKC A;  2ZOY A;  2XPV A;  2R7V A;  2RAS A;  4PXI A;  2PZ9 A;  4JL3 A;  2PFV A;  2R7O A;  3BRU A;  3BTI A;  3KZ9 A;  4W1U A;  3Q0U A;  4JNN A;  2QIB A;  5D19 A;  2IU5 A;  3VOX A;  3BTJ A;  2ZOZ A;  2G0E A;  4AF5 A;  4M3E A;  2XGD A;  2WUI A;  2G7G A;  3TP3 A;  5J3L A;  3FHN A;  2RAE A;  4NN1 A;  5GP9 A;  2Y30 A;  5C4Y A;  3B6C A;  3CDL A;  3CCY A;  3RD3 A;  4MK6 A;  2ID3 A;  3VW1 A;  1A6I A;  3F0C A;  2XRL A;  4U9N A;  4DW6 A;  2QTQ A;  4KWA A;  2WV1 A;  2UXP A;  3BR6 A;  5AQC A;  1RKW A;  4V2G A;  1JUP A;  4W97 A;  3BR5 A;  2QCO A;  3BNI A;  3NS4 A;  4IRV A;  5EZG A;  3DEW A;  5EZH A;  2G3B A;  2R7T A;  1BJZ A;  5F1J A;  3V78 A;  3DU5 A;  3VP5 A;  5H9T A;  3DU6 A;  3BR0 A;  4L62 A;  4JYK A;  2IAI A;  4G12 A;  3QKX A;  2Q24 A;  2G7S A;  5EYR A;  2DG8 A;  5D1R A;  4XK4 A;  2HXI A;  2NX4 A;  3BR1 A;  4YZE A;  1VI0 A;  4JKZ A;  2A2F X;  3IH2 A;  3SDG A;  4AC6 A;  2FX0 A;  3C07 A;  2RHA A;  3FIW A;  3ON2 A;  2UXI A;  4NEL A;  2FBQ A;  5F0C A;  3DCF A;  3RH2 A;  5J1U A;  3VOK A;  2FJ1 A;  3BQZ A;  2XGC A;  3VVZ A;  5IOY A;  3BQY A;  3LJL A;  5CW8 A;  2Y2Z A;  2HQ5 A;  3FK6 A;  2XDN A;  3IH3 A;  4C2M A;  2X9D A;  2DTZ A;  2Y31 A;  2OER A;  1Z0X A;  4MXM A;  4UDS A;  4M3F A;  3HGG A;  3MVP A;  3VVY A;  2GEN A;  1SGM A;  3LOC A;  1Z77 A;  3ON4 A;  1JTY A;  3KKD A;  3P9T A;  2WGB A;  5FGL A;  3BHQ A;  2R7R A;  5K58 A;  3HTI A;  3QQA A;  4ABZ A;  3SFI A;  4M3B A;  2VKE A;  3ANP A;  2VKV A;  1UI6 A;  1U9N A;  2ZCX A;  2UXU A;  2GBY A;  2YVE A;  2YVX A;  2V57 A;  1JUS A;  3F1B A;  3VUQ A;  3Q3S A;  2YVH A;  3NNR A;  2X6O A;  2PBX A;  2ZY9 A;  2R7Q A;  2OF7 A;  4MO7 A;  5F08 A;  5F0F A;  5J1R A;  5FKL A;  3VW2 A;  3VTI A;  3G1L A;  2G7L A;  5F27 A;  3BTL A;  4GCL A;  3NRG A;  4V2F A;  3O8G A;  5K7H A;  4GCK A;  4B3A A;  2QWT A;  5HBU A;  2JJ7 A;  3Q0V A;  3VW0 A;  4D7M A;  3G1O A;  3VIB A;  5FKM A;  1U9O A;  2XB5 A;  1QPI A;  5IOZ A;  3S5R A;  4I6Z A;  4X1E A;  2HYJ A;  2D6Y A;  5DAJ A;  3QPL A;  1RPW A;  5GPA A;  3BR3 A;  2TCT A;  5FKN A;  5IP6 A;  3NPI A;  2VPR A;  3HTJ A;  3VPR A;  4GFL A;  5CQG A;  3CWR A;  2R7U A;  3EGQ A;  5K7Z A;  2NS7 A;  2ID6 A;  1JT0 A;  3EUP A;  3NXC A;  4DVY P;  3IH4 A;  4HKU A;  2QKO A;  2FD5 A;  2OI8 A;  4ME9 A;  3PPB A;  1RKT A;  1JTX A;  3LSJ A;  2O7T A;  1ZKG A;  1ORK A;  2HYT A;  2ZCN A;  3FK7 A;  3KYL A;  1QVT A;  2JK3 A;  2EH3 A;  4CGR A;  5CXG A;  1ZK8 A;  3AQT A; 
#chains in the Genus database with same CATH homology
 2FJI 1;  3K8P C;  2A2F X;  4C2M A;  2R7S A;  2R7T A;  2R7R A;  2R7X A;  3DU5 A;  3FHN A;  2R7V A;  4OD4 A;  3VTI A;  4DVY P;  2B1E A;  2PFV A;  3DU6 A;  2R7O A;  3KYL A;  4OD5 A;  3NS4 A;  3SWH A;  2B3W A;  2R7Q A;  4IRV A;  5CQG A;  2R7U A;  2R7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...