3NS4A

Structure of a c-terminal fragment of its vps53 subunit suggests similarity of garp to a family of tethering complexes
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
205
Chain Sequence
FILSQFNRDVYKWNFLDKVIDIMTTNFVSNTIRLLQPVPPFSLAGSKRKFETRTVVNIGEQLLLDLELLKEIFHTLPESVSNDSDLRENTSYKRVKRHADNNIDQLLKFIKLLMAPLDSADDYYETYSKLTNNNPDSAVWSFVLALKGIPWDLALWKKMWSAYNLETNRDLFIFKWDKVLLGQFENNLARMQDPNWSKFVRQDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a C-terminal fragment of its Vps53 subunit suggests similarity of Golgi-associated retrograde protein (GARP) complex to a family of tethering complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Vacuolar protein sorting-associated protein 53
total genus 69
structure length 205
sequence length 216
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16854 VPS53_C Vacuolar protein sorting-associated protein 53 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.110 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3ns4A00
3NS4A
chains in the Genus database with same CATH superfamily
3VOKA 3VP5A 3Q0UA 1U9OA 2PZ9A 4D7NA 3BTCA 5F0FA 3WHCA 1SGMA 1QPIA 5FHPA 2B3WA 5IOZA 5GP9A 2UXHA 2NS7A 2OF7A 3FIWA 3MNLA 3BTIA 3BRUA 3PPBA 3FK7A 3BR1A 4C2MA 3QQAA 3LSJA 3GEUA 3C2BA 2QCOA 3HE0A 1BJZA 4MK6A 4GCTA 2QWTA 2B1EA 3HGGA 3IH2A 2PBXA 5K58A 4W1UA 4KWAA 4JYKA 4MO7A 4XK4A 2IU5A 1UI6A 5J1UA 3TP3A 1JTYA 2HKUA 4U9LA 5CQGA 4IRVA 2I10A 2NP3A 4HKUA 3WHBA 2FBQA 2UXPA 4JKZA 3DU5A 2QIBA 3KZ9A 5CXIA 2XRLA 1QVUA 4V2FA 2R7UA 3LSRA 4AC0A 2R7TA 3FRQA 3ZQGA 3BR3A 4ICHA 4ABZA 3LOCA 2YVXA 5J1YA 5K7FA 5F1JA 4OD4A 3HGYA 3IH4A 2D6YA 3T6NA 2OERA 1UI5A 2EH3A 2JK3A 4NELA 2V57A 3KNWA 3KKDA 2VKEA 5H9TA 3HTHA 2RASA 3BT9A 2FQ4A 4JNNA 3NNRA 3QBMA 2Y31A 3IUVA 2GENA 4DVYP 2XGDA 5C4YA 2TCTA 4B3AA 1U9NA 2PFVA 3BR2A 5F08A 2NX4A 3EUPA 2QOPA 3O8HA 4JL3A 1T33A 4AC6A 4GCKA 4ME9A 2G0EA 3JSJA 3B6CA 5EZGA 5HAWA 3G1MA 3VUQA 3CJDA 2R7RA 3SFIA 3BNIA 3LJLA 5CW8A 4W97A 3NS4A 3ON4A 2NS8A 2VKVA 2ZCXA 5GPCA 2O7TA 3BR5A 5F0HA 3B81A 3ON2A 2ZY9A 3COLA 2ZCNA 3G1OA 3ZQHA 2X6OA 2DTZA 2Q24A 5D18A 2RHAA 2WGBA 5J3LA 2Y2ZA 2HYJA 1Z77A 5AQCA 5FKKA 2YVEA 2FX0A 5J1RA 3P9TA 2ID3A 2G7LA 4DW6A 5HBUA 5FGLA 4M3FA 3NXCA 3VIBA 2IAIA 4GFLA 4I76A 2R7VA 2R7WA 3Q3SA 2QTQA 4UDSA 3G1LA 3QPSA 3G7RA 2XPVA 4X1EA 3BJBA 2OI8A 2XGCA 2FJ1A 3BTLA 5CXGA 2OPTA 3NRGA 3VOXA 3DCFA 3GZIA 4WIBA 3DPJA 3VW0A 3S5RA 3LHQA 4M3BA 4GFKA 3E7QA 2UXOA 3LWJA 2R7QA 5IP6A 2ZCMA 2W53A 1T56A 3IH3A 1ORKA 4D7MA 4M3DA 1RKTA 2TRTA 4U9NA 2IBDA 1ZK8A 2O7OA 4AUXA 4G12A 2ZOYA 2XPUA 3BR0A 3SDGA 2DG7A 5D19A 2FJI1 3HTIA 3VPRA 1JT6A 2UXIA 2RAEA 2REKA 2G7SA 2A2FX 3VW2A 2JJ7A 1RPWA 4MXMA 4L62A 5GPAA 2DG8A 3ANGA 3F1BA 2XB5A 5F04A 3V6GA 3HIMA 3BQZA 1JUSA 2ZB9A 5FKNA 2UXUA 3ZQFA 2ZOZA 1JT0A 3BHQA 3HTJA 5FKMA 3BTJA 2R7OA 5IPAA 2HYTA 2F07A 2XDNA 3CDLA 2ID6A 4B1RA 2HXIA 5HSZA 3FHNA 3VTIA 3QKXA 2YVHA 4ACIA 4D5FA 2VPRA 2FD5A 5F0CA 3BR6A 5IOYA 3CWRA 2R7SA 3O60A 1RKWA 2XGEA 3QPLA 5K7ZA 3BCGA 4GCLA 3Q0VA 2IEKA 3Q0WA 4I6ZA 4OD5A 2QKOA 2Y30A 5K7HA 3HTAA 3V78A 3VVYA 3NPIA 5F27A 2GFNA 1ZKGA 4YZEA 4NN1A 5FMPA 3FK6A 5FKLA 3ZQIA 3DEWA 3ANPA 1JTXA 2GBYA 2HXOA 5EYRA 3B6AA 3BQYA 2GUHA 5DAJA 3VW1A 3KYLA 4V2GA 2G7GA 3AQTA 3AQSA 4PXIA 3RD3A 4AF5A 3ZQLA 3EGQA 3VVXA 3VVZA 3RH2A 1JUPA 3KKCA 1A6IA 4M3GA 5FKOA 3PM1A 3G56A 3CCYA 3PASA 3K8PC 1Z0XA 2NP5A 3F0CA 2WV1A 3TP0A 2X9DA 3CRJA 2XPWA 1QVTA 5D1RA 3MVPA 3C07A 1JUMA 2R7XA 3LSPA 4D5CA 4M3EA 3DU6A 1VI0A 2G3BA 3NI7A 5EFYA 3O8GA 5EZHA 4CGRA 2WUIA 3SWHA 2HQ5A
chains in the Genus database with same CATH topology
3FHNA 3KYLA 3VTIA 2R7UA 2R7QA 2FJI1 2B1EA 2R7TA 2R7XA 2A2FX 4DVYP 2R7SA 3DU6A 2B3WA 2R7RA 2R7VA 2R7WA 2PFVA 5CQGA 4IRVA 4OD5A 2R7OA 3NS4A 4OD4A 3DU5A 3K8PC 4C2MA 3SWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS4 A; 
#chains in the Genus database with same CATH topology
 3VOK A;  3VP5 A;  3Q0U A;  1U9O A;  2PZ9 A;  4D7N A;  3BTC A;  5F0F A;  3WHC A;  1SGM A;  1QPI A;  5FHP A;  2B3W A;  5IOZ A;  5GP9 A;  2UXH A;  2NS7 A;  2OF7 A;  3FIW A;  3MNL A;  3BTI A;  3BRU A;  3PPB A;  3FK7 A;  3BR1 A;  4C2M A;  3QQA A;  3LSJ A;  3GEU A;  3C2B A;  2QCO A;  3HE0 A;  1BJZ A;  4MK6 A;  4GCT A;  2QWT A;  2B1E A;  3HGG A;  3IH2 A;  2PBX A;  5K58 A;  4W1U A;  4KWA A;  4JYK A;  4MO7 A;  4XK4 A;  2IU5 A;  1UI6 A;  5J1U A;  3TP3 A;  1JTY A;  2HKU A;  4U9L A;  5CQG A;  4IRV A;  2I10 A;  2NP3 A;  4HKU A;  3WHB A;  2FBQ A;  2UXP A;  4JKZ A;  3DU5 A;  2QIB A;  3KZ9 A;  5CXI A;  2XRL A;  1QVU A;  4V2F A;  2R7U A;  3LSR A;  4AC0 A;  2R7T A;  3FRQ A;  3ZQG A;  3BR3 A;  4ICH A;  4ABZ A;  3LOC A;  2YVX A;  5J1Y A;  5K7F A;  5F1J A;  4OD4 A;  3HGY A;  3IH4 A;  2D6Y A;  3T6N A;  2OER A;  1UI5 A;  2EH3 A;  2JK3 A;  4NEL A;  2V57 A;  3KNW A;  3KKD A;  2VKE A;  5H9T A;  3HTH A;  2RAS A;  3BT9 A;  2FQ4 A;  4JNN A;  3NNR A;  3QBM A;  2Y31 A;  3IUV A;  2GEN A;  4DVY P;  2XGD A;  5C4Y A;  2TCT A;  4B3A A;  1U9N A;  2PFV A;  3BR2 A;  5F08 A;  2NX4 A;  3EUP A;  2QOP A;  3O8H A;  4JL3 A;  1T33 A;  4AC6 A;  4GCK A;  4ME9 A;  2G0E A;  3JSJ A;  3B6C A;  5EZG A;  5HAW A;  3G1M A;  3VUQ A;  3CJD A;  2R7R A;  3SFI A;  3BNI A;  3LJL A;  5CW8 A;  4W97 A;  3NS4 A;  3ON4 A;  2NS8 A;  2VKV A;  2ZCX A;  5GPC A;  2O7T A;  3BR5 A;  5F0H A;  3B81 A;  3ON2 A;  2ZY9 A;  3COL A;  2ZCN A;  3G1O A;  3ZQH A;  2X6O A;  2DTZ A;  2Q24 A;  5D18 A;  2RHA A;  2WGB A;  5J3L A;  2Y2Z A;  2HYJ A;  1Z77 A;  5AQC A;  5FKK A;  2YVE A;  2FX0 A;  5J1R A;  3P9T A;  2ID3 A;  2G7L A;  4DW6 A;  5HBU A;  5FGL A;  4M3F A;  3NXC A;  3VIB A;  2IAI A;  4GFL A;  4I76 A;  2R7V A;  2R7W A;  3Q3S A;  2QTQ A;  4UDS A;  3G1L A;  3QPS A;  3G7R A;  2XPV A;  4X1E A;  3BJB A;  2OI8 A;  2XGC A;  2FJ1 A;  3BTL A;  5CXG A;  2OPT A;  3NRG A;  3VOX A;  3DCF A;  3GZI A;  4WIB A;  3DPJ A;  3VW0 A;  3S5R A;  3LHQ A;  4M3B A;  4GFK A;  3E7Q A;  2UXO A;  3LWJ A;  2R7Q A;  5IP6 A;  2ZCM A;  2W53 A;  1T56 A;  3IH3 A;  1ORK A;  4D7M A;  4M3D A;  1RKT A;  2TRT A;  4U9N A;  2IBD A;  1ZK8 A;  2O7O A;  4AUX A;  4G12 A;  2ZOY A;  2XPU A;  3BR0 A;  3SDG A;  2DG7 A;  5D19 A;  2FJI 1;  3HTI A;  3VPR A;  1JT6 A;  2UXI A;  2RAE A;  2REK A;  2G7S A;  2A2F X;  3VW2 A;  2JJ7 A;  1RPW A;  4MXM A;  4L62 A;  5GPA A;  2DG8 A;  3ANG A;  3F1B A;  2XB5 A;  5F04 A;  3V6G A;  3HIM A;  3BQZ A;  1JUS A;  2ZB9 A;  5FKN A;  2UXU A;  3ZQF A;  2ZOZ A;  1JT0 A;  3BHQ A;  3HTJ A;  5FKM A;  3BTJ A;  2R7O A;  5IPA A;  2HYT A;  2F07 A;  2XDN A;  3CDL A;  2ID6 A;  4B1R A;  2HXI A;  5HSZ A;  3FHN A;  3VTI A;  3QKX A;  2YVH A;  4ACI A;  4D5F A;  2VPR A;  2FD5 A;  5F0C A;  3BR6 A;  5IOY A;  3CWR A;  2R7S A;  3O60 A;  1RKW A;  2XGE A;  3QPL A;  5K7Z A;  3BCG A;  4GCL A;  3Q0V A;  2IEK A;  3Q0W A;  4I6Z A;  4OD5 A;  2QKO A;  2Y30 A;  5K7H A;  3HTA A;  3V78 A;  3VVY A;  3NPI A;  5F27 A;  2GFN A;  1ZKG A;  4YZE A;  4NN1 A;  5FMP A;  3FK6 A;  5FKL A;  3ZQI A;  3DEW A;  3ANP A;  1JTX A;  2GBY A;  2HXO A;  5EYR A;  3B6A A;  3BQY A;  2GUH A;  5DAJ A;  3VW1 A;  3KYL A;  4V2G A;  2G7G A;  3AQT A;  3AQS A;  4PXI A;  3RD3 A;  4AF5 A;  3ZQL A;  3EGQ A;  3VVX A;  3VVZ A;  3RH2 A;  1JUP A;  3KKC A;  1A6I A;  4M3G A;  5FKO A;  3PM1 A;  3G56 A;  3CCY A;  3PAS A;  3K8P C;  1Z0X A;  2NP5 A;  3F0C A;  2WV1 A;  3TP0 A;  2X9D A;  3CRJ A;  2XPW A;  1QVT A;  5D1R A;  3MVP A;  3C07 A;  1JUM A;  2R7X A;  3LSP A;  4D5C A;  4M3E A;  3DU6 A;  1VI0 A;  2G3B A;  3NI7 A;  5EFY A;  3O8G A;  5EZH A;  4CGR A;  2WUI A;  3SWH A;  2HQ5 A; 
#chains in the Genus database with same CATH homology
 3FHN A;  3KYL A;  3VTI A;  2R7U A;  2R7Q A;  2FJI 1;  2B1E A;  2R7T A;  2R7X A;  2A2F X;  4DVY P;  2R7S A;  3DU6 A;  2B3W A;  2R7R A;  2R7V A;  2R7W A;  2PFV A;  5CQG A;  4IRV A;  4OD5 A;  2R7O A;  3NS4 A;  4OD4 A;  3DU5 A;  3K8P C;  4C2M A;  3SWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...