3NS7A

Succinic acid amides as p2-p3 replacements for inhibitors of interleukin-1beta converting enzyme (ice or caspase 1)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
CSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Succinic acid amides as P2-P3 replacements for inhibitors of interleukin-1beta converting enzyme (ICE or caspase 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
total genus 43
structure length 162
sequence length 162
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2010-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ns7A00
2QL9A 2AR9A 1BMQA 2C2ZA 3KJFA 4ZVUA 2CJXA 3K7EA 2H48A 3DEHA 1RWWA 1ICEA 3NR2A 4NBLA 3IBFA 4IEFB 1SC1A 4NBKA 3P4UA 5LUBA 4EHDA 4ZVOA 4FDLA 5IAEA 4EHNA 4JJ8A 3UO8B 1K88A 5IANA 4FEAA 4PS0A 4QUBA 4DCOA 3R6GA 2FQQA 1F9EA 1NW9B 3NS7A 3SIPA 4JB8A 2H5IA 2J32A 4ZVQA 2CNKA 4AWBA 4QUHA 4DCPA 1RWVA 4FXOA 2HBQA 3V55A 5IC4A 2J31A 2J30A 4JR2A 3H11A 3SIRA 4QUIA 3H0EA 4EHLA 1QDUA 2QL5A 4EHFA 5I9BA 4NOKA 5IAKA 3R7SA 3H13A 4DCJA 3D6HA 3H1PA 4N6GA 4D3YA 4JR0A 3E4CA 2C1EA 4FGUA 2XZDA 4I1RA 5IARA 2FP3A 4QULA 1NMQA 1K86A 3GJTA 4EHAA 2H4YA 4QU5A 4QUDA 1RHQA 3D6FA 3D6MA 3S8EA 3DEJA 3EDQA 1I51A 4QUJA 1RWXA 4JQZA 1RWPA 4PS1A 5IABA 2XZTA 3H11B 1RE1A 2J33A 3P45A 3R5KA 4NOJA 3R7NA 5IBCA 2FUNB 1RWOA 5IAJA 3V6LA 4I1PA 1RWMA 2Y0BA 3PD1A 4ZVTA 1PYOA 3PCXA 2H4WA 4QTXA 4ZVPA 4QUAA 4N7MA 5IC6A 5LU8A 1SC4A 3OD5A 1SHJA 1KMCA 1IBCA 2QLBA 3GJSA 4IYRA 4QU9A 4QUGA 4N6OA 4AWAA 2NN3C 4EHKA 5LU9A 1I4EB 1GFWA 3ITNA 3GJQA 2CDRA 4NOLA 3V3KA 2K7ZA 4QU0A 4N7JA 1I4OA 3DEKA 4QU8A 2HBZA 1M72A 2C2KA 2WDPA 4NOMA 3V6MA 2H65A 3PD0A 3R6LA 4NBNA 3RJMA 1I3OA 5IBRA 1NMSA 1SHLA 4JR1A 3R5JA 2QLJA 1RHMA 3DEIA 3S70A 5IASA 2DKOA 2C2OA 4JJ7A 1GQFA 2Y1LA 3KJQA 4HVAA 2H5JA 4HQRA 1QTNA 2H51A 2P2CA 1CP3A 4LSZA 4N5DA 4PRZA 2QL7A 1RWKA 4D3XA 4HQ0A 2XYPA 1SC3A 4M9RA 3V4LA 2HBYA 4D3ZA 1NMEA 2C2MA 5LUAA 1RWNA 5H0IA 3NKFA 5K20A 4EHHA 4QUEA 1RHUA 4ZVSA 2XYGA 4N6NA 4PRYA 1RHRA 3BIJA 3V4OA 4EJFA 3GJRA 4AW9A 1F1JA 4ZVRA 4QTYA 5JFTA 5IAGA 3R7BA 1RHJA 5I9TA 1PAUA 1JXQA 2CNLA 3IBCA 5IBPA 2H54A 2CJYA 1CVRA 1RHKA 1QX3A 2QLFA 3KJNA 3EDRA 3QNWA 4JQYA 2CNNA 2CNOA 2HBRA 4JJEA 3UOAB 2XYHA
chains in the Genus database with same CATH superfamily
3EE6A 2BHRA 1ND6A 1X70A 4OU5A 1VJ0A 1AGYA 4J49A 2BE7A 4HFJA 3L2OB 1U5BA 2QRZA 1AK1A 3EZLA 2ZYGA 4B4KA 4DC0A 1DCTA 4QPPA 2JDID 1W19A 1SOVA 5H3LA 2W2MA 3SDBA 2PGXA 3C6ZA 3TOZA 1CF4A 4KW7A 1I0ZA 1HSZA 2JIZD 3ED1A 1F06A 4IHJF 3LDHA 3WIBA 5KVVA 2VDWA 1UBJS 4GVLA 3ZTYA 3NHLA 1U0NA 4TTRA 1OWOA 1GTVA 1QIDA 3CVVA 3B9PA 2LV8A 2PGDA 3NAMA 4O4HA 3R6GA 1DIAA 3A1SA 3DTTA 4GR9A 5JNUA 2LCFA 3G9ZA 3NIBA 4R69A 5EMLA 1WB4A 4HGPA 2WWVD 3K32A 4L16A 4TXNA 3ODGA 4RZXA 5HKOA 4LCBA 4TWBA 1AK2A 3CEPB 4XWGA 3ANTA 2CVFA 3DB2A 5T3UA 1JRLA 3ZZ0A 3JQBA 5AJVB 2D2VA 5I9BA 4R4JA 2XITA 1R18A 4BGVA 4DJEC 3HDTA 1XAJA 2R44A 4KBFA 1MAVA 1I0LA 1P6XA 5I9SA 1QV6A 3MTQA 4MYUA 5GPBA 1W2GA 3G2NA 3CUEF 5CT8A 1NSFA 6CHYA 5JFOA 4BMCA 1AT1A 3JQ9A 3KEMA 4N0MA 1E5XA 2X1LA 2X9VA 2VR1A 4RHYA 1J33A 1UBUS 3GFQA 3ZD7A 4CEIB 1J39A 4JU8A 3ZHCA 3TSZA 1R8QA 1E1CB 1NVWQ 2ODTX 2WJZB 3GMIA 2F2TA 2ROQA 3TPZA 2PKYX 2ZRDA 2J6HA 2QYOA 2WNHA 3QBDA 1PW5A 1RAIA 2R1ZA 4QGGA 2CLIB 4QTXA 1Y6ZA 1GRRA 4FBGA 4XRRA 5THXA 4JI1B 1GLNA 2GH1A 1I2MA 3ICVA 4WZAA 5L3ZA 3W2IA 2A1UB 2E7ZA 3LQ4A 5BQOA 1IN5A 1ATIA 1HQKA 1M1ZA 2ZOSA 3JYPA 2V4UA 3EIQA 4YRQA 4JQCA 3P26A 4CN8A 1E1CA 3IR6A 4HWRA 3VRHA 4MZXA 1R2QA 3V1MA 4Y2XA 4OQ4A 1RQ7A 4GMDA 5I3CA 3CG4A 1BDIA 4I5EA 5KIAA 2RBKA 5A0VA 3QVXA 2OKCA 1FFWA 1YCDA 4ZO4A 1T4BA 4YAEA 2REOA 1XNQB 6REQA 4YFYA 4FMPA 5BMVA 4PPQA 2VPXA 3BJZA 1GEGA 6PFKA 2OCYC 1O87A 3Q8LA 1XA0A 2VZEA 2QPOA 1ZZEA 3DR3A 4G23A 4D8UA 5TIIA 3VX3A 4OHMA 5E95A 5F4ZA 2JG3A 1TAUA 2P9CA 3O0DA 3TOVA 3C16C 1FSGA 1XQXA 1QTRA 3OJWA 5G0SA 2VBIA 3F7NA 4MEBA 4M1SA 5TMBA 3IOBA 3H04A 4HGNA 3ZE7A 4DQUA 3I5MA 2JEZA 4HGRA 4LYYA 4HAOA 2JC3A 3MTIA 1FTYA 2H2WA 5H83A 2AV6A 1M8PA 1UFRA 2WFAA 1DBWA 1Z74A 2XVAA 4N40A 4MQMA 1P5ZB 2JGJA 4CM9A 3FVTA 2AFHB 4KPFC 3ZY3A 4NULA 1C3XA 1QRRA 1M8KA 1NR1A 4X5OA 3RHFA 4BNDA 1CVRA 4KFCA 1PFVA 2ONYA 3EDRA 3CBGA 2CNOA 3I6YA 4N3CA 5IT9A 1RZ3A 3KZCA 4LCEA 4KTVE 2XWQA 4WXMA 4DV7B 5LD2B 1D1TA 3EQ7A 3R0VA 4OMFG 1RVV1 2A3NA 3BXHA 5TXGA 4JV5B 3S28A 5T5QA 3CUKA 4KN8A 4LHYA 4OH1A 5JSFA 5FI0B 5FO1A 2AJDA 2O1XA 5D5QA 1D5WA 4B32A 2HJGA 4I1YA 4CQJA 1YJCA 1OIXA 4KVAA 5FD8A 3TDKA 2ZKLA 3OICA 1XL1A 1KO7A 2G25A 4MUIA 2E37A 3Q9UA 1HTBA 3PDJA 4TTTS 1RQPA 2ZJ8A 2P6NA 4NTZA 3WGOA 5LWQA 7AT1A 3NOXA 2FW6A 2VPQA 4UTOA 2PUTA 4LYAA 2X77A 1AUPA 4QDOA 5NULA 4IDNA 3ZNPA 3OCJA 1D0IA 4WK2B 3R0IA 2FMHA 1N3IA 4KLZA 2HA5A 4GOLD 2RG7A 3CSSA 1YQUA 3ZZMA 4FX2A 3D3JA 3WLPA 1SHKA 2PWYA 2WYHA 4H16A 5K8VA 4WOPA 2ODQA 4F3RA 1VPDA 2ILTA 5HGXA 3GLHA 3W3ZB 4BFZA 1ZHHA 5JV5A 1GPMA 1NVBA 4C7VA 5ALOA 4BQFA 2YRXA 1ESEA 3FE2A 3JYLA 4QNMA 3LKBA 1U1GA 3IPAA 4UQLA 3O84A 3JWEA 1W85A 4HT3B 1ZAYA 4ARCA 2JJYA 2ODAA 3EDQA 3GBPA 8ATCA 5EZ5A 1Y3AA 3LUHA 4YP5A 1C7EA 2J33A 2OTCA 3OCXA 4G0WA 1BFDA 5F3WB 4R0VA 3AKCA 3LJKA 3FVWA 3LVFO 3PDHA 4YV2A 3GLIA 5M34A 1P7CA 1E18A 5TF4A 5AO9A 4ENUA 5LJLA 3U49A 3DG9A 3UT0A 3EQ9A 4HPJB 2C9ZA 3KJGA 3R5HA 4NHOA 2RK6A 1PZEA 1Q7BA 1E58A 2ECKA 2FG5A 2QMZA 2GF0A 4MRMB 4MA0A 2CDRA 3I92A 5JQGA 3EZGA 1XCLA 3OBBA 4O63O 4WN3A 2OAQ1 4HS4A 2Q21A 1X3LA 3LHDA 4DXDA 2X22A 2PR2A 1U2TA 3LUKA 1J7JA 1DKQA 2J9YB 2W6OA 1JI0A 1QTIA 1V45E 2PKQP 1EMDA 2MYNA 2Q6KA 4OGGA 4US0R 5KVAA 3LA8A 4JVMA 4RM2A 3WWYA 1R4ZA 3EULA 2Q1XA 1ZGJA 1K7EB 2CNWA 4BV2A 4R1UA 1YVDA 1NNSA 4D46A 3ABIA 1E9BA 1Q15A 1NP7A 1QTNA 1FFSA 5T4HA 2PVCA 1ECGA 2DLDA 4B2LA 4CL0A 1U8XX 1GZ5A 5DI9A 5JQGB 3WLNA 3KQTA 2NSHA 3L6EA 5CLIA 1TU3A 2B6NA 3II6X 4LOIA 4BCBA 2R47A 4CF5A 3GBVA 4KJXA 3USCS 4JI2B 4IH1A 5ADVA 1NIJA 4GC5A 1G8GA 2IDMA 4N1AA 3TX2A 5ICSA 2ZIXA 4CTMA 5IF3A 3R7AA 2J9FA 3IDOA 3H7AA 3OJ0A 3AQIA 1TF2A 4E4TA 4F46A 1KP2A 4OXQA 1NBHA 2CNLA 2ZRPA 2QHXA 5FOWA 2B82A 3O9VA 4G0PA 2PMWB 4MPTA 3UCFA 4IIUA 1FTWA 1SK9A 3TNFA 3VHQA 2D62A 1M83A 3GRYA 1IU9A 2GF9A 2CVPA 1TMKA 1ZP6A 2AYXA 1F8GA 2FJ0A 3LQRA 4QARA 1KQNA 1KEPA 1PEDA 3D4OA 1CR0A 2BM8A 9ABPA 1N57A 3E5HA 3FN4A 4UBIA 4ZC8A 1PJLA 1IHUA 2J0EA 4EKYA 1H2FA 1E89A 1MOSA 2VP9A 3STWA 3E48A 4KTTE 5J40A 1DE0A 3G0CA 1OASA 2VCHA 2H92A 2O14A 3HRKA 4FS8A 3CXRA 4DTIA 5LIRA 2R7NA 1HYBA 2RJ3A 2C8KA 3DL7A 1SIOA 1UWKA 4TWRA 4G2TA 5TMEA 2NUAB 2I91A 5JALA 3EG9A 2R2AA 4MB0A 2ZIZA 5BP7A 3WLMA 4BKPA 4YB8A 3VH1A 3CH5A 3GNQA 1BDHA 4FR5A 3IP3A 2H2IA 5EWMA 3DAHA 1BN6A 4KIUA 1P5RA 4GVXA 2INGX 1S3FA 1U04A 3DFIA 5JS8A 4WIAA 4BMZA 3ZDDA 1GKKA 2QT0A 1OJLA 4ROSA 1P4AA 4CETA 2ZTLA 1SUCA 1QDUA 3DE6X 1LDGA 2QL5A 3QVSA 4A7PA 3WHPA 2AK2A 2BBOA 2HU5A 1WR8A 1WBJB 2WAMA 2PNFA 3MRSA 2F1IA 2OV4A 3NC4A 2GVZC 3FNGA 4DUPA 2O4CA 2HDHA 4CKZA 1I3LA 1THMA 2JAPA 1U28A 4UNQA 5SV2A 2Y1XA 2HNKA 1M2JA 3UANA 4DLLA 2HMTA 4S3MA 3EPRA 2IWHA 2YQZA 1Y1LA 2YZ2A 3IDZA 3OZSA 2EKBA 1O0SA 4MSUA 1IONA 1UBOS 2HXYA 4IEIA 2AG0A 4MCJA 5LQCA 4FW8A 5KB3A 2AZ4A 3AF3A 2ENWA 3VOTA 1JE0A 5EKXA 3GAMA 5IK2A 2ZB3A 1R6BX 3QFRA 5G02A 1PGPA 1GZ7A 1Q14A 1S7GA 1SZDA 2XD9A 3VPXA 5A5GA 1UMBA 1ZK0A 2Q1UA 4ZO9A 5FR2A 5LU9A 2G4CA 1IY1A 1TZJA 4EI7A 2YJ4A 1Y82A 2Q6TA 4EEKA 4BVFA 5AI4A 1GTRA 2QZ4A 1GCUA 1DDOA 1XLWA 3WWDA 2A9PA 3NKLA 5TV2A 1OBOA 4PF1A 1M72A 5CVJA 4EGFA 2PX0A 2GF2A 3WGKA 1L5NA 1DWUA 1WPXA 2NUPB 3G59A 3PD0A 5KNBD 1DTWB 2Z3VA 1KIAA 1WXXA 3TVDA 2QMEA 5SYAA 2BSXA 1MGPA 4WJZA 3SD7A 5KSYA 4MXDA 5CK4A 1XZDA 4M60A 1IK4A 1KMIY 5JNTA 2ZQ5A 3VAYA 3AHCA 1CJVC 3VR4A 5ALTA 2OOSA 1X42A 1KWKA 4OP2A 2ZRLA 1R66A 5FA6A 3BAFA 4R7TA 4RTPA 3ZX4A 3R0JA 4UOQA 4D97A 3DV0B 3W5DA 4IXWA 4E3ZA 3PCRB 1JJVA 5LUAA 2I4NA 3FSJX 4L5CA 4F9GA 5NLLA 4R98A 2V1UA 4QFDA 3E7FA 2WT9A 5AT1A 3M1YA 3HCWA 1VKJA 4YVFA 1N5JA 5KTMA 3NHBA 1LPPA 2PZAA 2VXBA 1D4ZA 2XQFA 3V4PB 4F4HA 4BB5A 2FA9A 2W2OA 5CDGA 3CIOA 4EUFA 1V3VA 4O33A 4OHOA 1B6SA 2CV2A 4CW7A 1N0WA 1SUEA 2L2QA 1VHLA 3DVAA 1FYWA 2WJJA 4FGZA 5EOVA 2F55A 1B26A 1KVRA 4ZDKA 2I6GA 4V0QA 1KETA 2ZRJA 3LCCA 3AVUA 9MHTA 1HT1E 3NPMA 3Q3GE 3E84A 3FCUB 4MWTA 5LXTF 2F17A 4QOIA 1VHQA 3PNVA 5EY5B 3RYCB 4AS1A 4KQJA 1EBFA 3H97A 5FBLB 5C53B 1AV6A 4ENTA 1YZHA 1H4QA 3QTTA 4GPD1 2Q45A 1UFQA 1NQ5A 2PMEA 1CUJA 4NBVA 4FCCA 4TTQA 2B8WA 4JJ8A 5BRAA 4DSOA 3P1JA 1JDUA 1Z0FA 3S4YA 4IUYA 2W8ZA 2PD4A 3TEMA 3PF8A 1XQ1A 4Z2YA 4YUYA 4JT4A 2II6A 4ARZB 1KO4A 1WUYA 5JWRA 1I6MA 1P33A 3ANSA 5LA6A 1MC5A 4ZYWA 1F48A 2SICE 4GOMD 5DHPA 2AGVA 4JASB 1XCBA 3C3PA 3ADKA 3AEQB 5KNCH 3TJZA 2BKUA 3HA5A 2CJPA 3JATA 4EZBA 3MWEB 4E13A 5A5DA 1YGYA 2WIBA 4N6GA 2FWIA 1N92A 4YQEA 9LDTA 2TMKA 3H86A 4Y2TA 1UOEA 4BTVA 2VBFA 3BSWA 3HWWA 3OAAA 4OSOA 4OD0A 1AZLA 3M3PA 4QOFA 5H02A 1TEZA 1JXOA 3Q9LA 2CMGA 3I6MA 5F33A 2ZSKA 2JCGA 1UJBA 4KDFA 3SE0A 1O0BA 1ULUA 2NZ8A 3DOJA 4GGOA 5CM8B 3U80A 4QVIA 1W94A 2KX7A 2PYDA 3TN7A 1CWUA 4GUAA 4CT4B 1RYNA 2QRGA 4GL4A 4BUZA 1HFWA 2JD0A 4CF3A 3QU7A 1HYQA 4OXYA 4F1WA 1VJ5A 3PXDA 3IMFA 3BM5A 2NVBA 2V6IA 3WG9A 4DJ5X 5T8KC 3DE0X 4Q9HA 3WNDA 1PRYA 4WADA 4L07A 3U4AA 3C4QA 3WTBA 1WKVA 1XDZA 1UPBA 3QE3A 4LBWA 1ND5A 4WNCA 3DHNA 4V0NA 4XUDA 4DB4A 3UICA 2IV7A 4ND3A 5TGTA 2QP9X 1OT3A 4MS1A 3LT4A 2QDKA 1G8KA 1KYWA 1OC2A 1ZM9A 2IDKA 2XSZA 3F2VA 4WESB 3SLGA 3GLQA 4MUMA 3C2QA 3AKYA 2FNAA 4BQIA 1JEQA 3OURA 4PSVA 3OLZA 4QODA 3AZQA 4RVFA 2FPMA 1N2GA 3SM3A 1R0KA 4KO8A 1HEYA 1VQ1A 3O91A 1WSWA 2JH9A 5E1OA 3GXOA 4K9QA 4BMPB 4HFNA 5LVAA 1VDZA 1I7DA 4BEWA 1A5BB 3ZKWA 1VL8A 3I28A 2ZUWA 3UUEA 3VR5A 3OE5A 2NIPA 3A05A 2QTVB 3NT4A 4L2IB 4E6PA 4CUZA 5CXUA 1YRBA 1Z62A 1LSSA 2DUWA 1SPBS 3LVRE 5EIEA 3KXPA 2OA0A 3S27A 1ENOA 1NASA 2Z9BA 4HP8A 4PQFA 5JDCA 4JP1A 4HC4A 2FP4B 1JI3A 3WRXA 1MVOA 2FPUA 3R7WB 1NKSA 3IKJA 3W5UA 1J7KA 5J9FA 2G77B 3R7BA 4XWTA 5D7BA 4R8MA 4Z5XA 3DS8A 1SVLA 2WFMA 2CL7X 4RK5A 4KK3A 5DNAA 4EFKA 1PL7A 4ZGGA 2Q6OA 4YBZA 2NUTB 2SCUA 3IHKA 1K6EA 3KJZA 1FMCA 1TM1E 1BMQA 1CY1A 4OQQA 3COVA 4Z4QA 3VHLB 2HF2A 5FWNA 2AB0A 3BWMA 1Z29A 2P3OA 4NPCA 1PJ4A 4XB6B 1RDFA 1LX7A 3ESBA 4HN9A 4R81A 1SCUA 2C96A 1JHPA 5CX1A 5EXPA 3ROXA 4BC1A 3OIDA 1WHSA 1AVTA 3AFIA 3H5LA 4RLHA 1ULSA 4EHIA 1I1OA 4AULA 4GZLA 1MJNA 1C7RA 1PWEA 1CJBA 3K6JA 2YV3A 3OCVA 1Q1EA 4CKEB 5C4GB 4KE6A 1BS1A 2JGRA 3RU3A 1G7CA 4LOHA 5AHRA 1UKEA 4ZYVA 3RTCA 4D5EA 3TTYA 3UPUA 1C8LA 2PSHA 3NGMA 3WP0A 1N2CB 4FIZA 5HS4A 3HDQA 1L8AA 4A26A 3H42B 4XLLA 2EFJA 4DAOA 3Q8WA 1FL9A 2P9EA 3HY4A 5C80A 5FHRA 1H8ED 3GUHA 3QFHA 4IF6A 3H2GA 1Z7EA 3HU2A 3UHOA 3QBTA 3BGVA 2UVPA 3BJMA 2AK3A 2SECE 3UFXA 1J0BA 1Z3IX 3CW9A 4MGIR 1SVUA 1ORIA 1Q7RA 2J5XA 5F9HA 1TTTA 3DC7A 4I55F 3T8YA 1N5KA 4WY8A 3R4VA 5MN5A 1U90A 3AHHA 3IEUA 5DISB 4QXAA 4PAGA 3LQQA 5G40A 4YA6A 4YR9A 4BZPA 2P6OA 2IT1A 3A4YA 4UFNA 4AYXA 5KWVA 2UXCB 4ETIA 4ER7A 1TM7E 3REGA 2EARA 4IL5A 2X7JA 1H2HA 2VTVA 3ZCSA 1RYMA 3RAJA 2EXXA 4BNUA 1C1DA 3A6DA 4R54A 2A88A 3GJZA 4ND8B 4G1FA 5BUQA 3CZAA 4K2AA 1II0A 1QHEA 3NC1C 3QU9A 1NVGA 4FVTA 3WIDA 1X7ZA 1ZUNB 1AC5A 2VUIB 1XA4A 4JI8B 2WUFA 4L95C 1YV9A 4G8JA 4RSMA 3V48A 4JZYA 4BP3A 4DA7A 4U2DA 5L4LA 2RGNA 3R44A 3TIFA 4AURA 2WIJA 2G17A 1X1BA 3D6AA 2B78A 4UVIA 4XKJA 1NLUA 4WXHA 4AN0A 1AKUA 1Z5NA 2JD1A 3K5PA 5JROA 1PEAA 3IERA 1LY1A 3RU9A 1Q0QA 3HJNA 5ESWA 4HDCA 2EGGA 1PSDA 4IKEA 4DLAA 4JXJA 4F6RA 3WJ1A 1JVNA 3K6SB 1ZJWA 4CF6A 2XZPA 1X6VA 2AG5A 5EFZA 1M1NB 4XYLA 3OC6A 4O4IB 3T9AA 4HHEA 5J4HA 1NVEA 2D5IA 2DB3A 2BZ0A 2Q5EA 2HOQA 2TYSB 3UB3A 4B0PA 5TVGA 3CSUA 1UXOA 1KVSA 3JQCA 3HWX1 4KQXA 5C9ZA 3EFOB 1UODA 1P9WA 2AN3A 4YP0A 3AVYA 1XC7A 5FIUA 4Q9AA 2UYYA 1BE6A 2ZRKA 4AX4A 3G0HA 4AY3A 4EA6A 4OLJA 4F6RB 2FPLA 4EJFA 1U7PA 3GFVA 5A6SB 1DC8A 4LWPA 2CNBA 3D6VA 3HP4A 2J3EA 4UBJA 3SF8B 1TTHA 4W6ZA 1UMKA 5AW1A 3IA2A 2XE4A 3AQ4A 2GBGA 4OMCA 1S1CA 2BCJQ 1A97A 2WP8J 3ZV4A 4I9NA 4PTZA 5FOTA 5B3KA 5CBPA 2QTGA 3AP3A 1EVLA 4RHUA 2YR0A 2PGAA 1LWNA 4EPTA 5AW2A 4K81B 4I7EA 3MD9A 3JD3A 1V5IA 4BYGA 1AN0A 5C5EA 4J0EA 1DZ3A 2NZYA 1DRKA 3OPYB 1Z38A 2HY7A 5DX0A 4EABA 5A6SA 3ZNOA 1KMQA 1UBSB 2YW9A 3KKNA 4PONA 4M1EA 4TLLB 5SZIA 2DYKA 2UVQA 3RGGA 1U3VA 1N2ZA 1MX3A 4CCAA 3PYLA 1E2FA 5IC5A 4WE3A 4C0JA 1MJHA 4L9RA 1TQ6A 3GVIA 1VCOA 3H5OA 2D5LA 1PW7A 4I3HA 2AF3C 1FX1A 1JR3E 1N2CE 1JAZA 2PUAA 1RPJA 3TYXA 2V8BA 2OG2A 3QFFA 4WOBA 4C1BA 2HW8A 5BVGB 4EGQA 4ZTUB 5J43A 3AHEA 4RF3A 2J0SA 4D1YA 2NO1A 2WM9B 2WTBA 3L43A 1XMSA 4FLEA 3VV2A 1J8YF 4CUKA 3V34A 2X4LA 3LPLA 2RH4A 2H1WA 1M2GA 5C81A 5DM0A 1H6AA 2OOKA 5KJ6A 1UAAA 4YDSA 2FYTA 2JIMA 4QULA 4GECA 2FDCA 2JS7A 2HLPA 2FCRA 2PQ0A 4XFDA 3SQOA 2QTLA 4IV0A 1BMDA 5FTLA 2N75A 3PDUA 1OXTA 1RLOA 3Q12A 3BD8A 1KH2A 3A6JA 4IAOA 1X1CA 4YP6A 4NV0A 4JQZA 4UMDA 3ZQUA 2B4YA 4M8LA 2ZYSA 3Q5DA 4NECA 4H0CA 2MSLA 1UDRA 4R2MA 2WSIA 5K03A 3A6GA 4TV8B 3B7PA 4R1QA 5ULLA 2YYAA 4WZ6A 3GLGE 3I8XA 2HTEA 3NKVA 2QM7A 4ZT3A 3UQZA 4XPZA 4ESHA 3DLIA 1SC4A 2Q5OA 4RAOA 1EX6A 3SYMA 4BP8A 4Z6KA 1RC1A 1MC8A 2FSSA 1FVOA 2NYUA 2KWIA 2VDRB 1PD0A 1OX4B 2A0FA 1SWVA 3K4PA 3D2AA 2OXRA 4DLZA 1O57A 3L0CA 1B00A 5HIKA 1XRQA 2V0NA 3GRVA 3RB8A 5MHTA 4MYRA 4BZQA 4KWEA 2R1UA 4J76A 3PFGA 3LBHA 2P9BA 2GDJA 3RWMB 1KI7A 4ZZIA 4RIHA 1AN9A 3AF2A 3INGA 4KXLA 1EK0A 4KI7A 4Y1FA 3ZH2A 4B7AA 5LOVA 3TQSA 3KQQA 4KBGA 3UCEA 2ZP1A 2OHHA 1ZUWA 1I1HA 4BVAA 2PUDA 4QOHA 1QIIA 4X1YB 1TX4B 1V37A 3CLSD 1JXMA 1GLVA 1P1JA 2DE0X 1OYWA 3ELUA 1IUKA 2QP3A 2P6PA 3CC8A 3OOWA 4AJPA 1N9ZA 4E30A 4N01A 3H9QA 1EK6A 1GA4A 4TV9A 2W6MA 4RDHA 5E2BA 1KJIA 1PT6A 3CCFA 3LOUA 3NHPA 3RRYA 4A8HA 4N3AA 4DQ0A 1NAIA 3BWXA 1TECE 4IUBS 1SCAA 2AG8A 5AW9A 3BE5A 1U7HA 3GJ4A 3RIGA 4ER5A 3C8DA 2RH8A 1V6SA 3GX1A 2H0RA 2J3KA 4OHZA 3E05A 4XIJA 2R5NA 4XE5A 1V9SA 4QTTB 4WCFA 4WOJA 1TCUA 3OJOA 4B73A 3U7GA 5TQVA 4EMBA 2NO7A 1H2XA 1H9BA 4YCMA 5ITVA 3B6IA 3R1IA 5C3MA 2VQ3A 1CJUC 1PL8A 1P1RA 2XYQA 5EC8A 5AR1A 4MIEA 1KEEA 1ONBA 3MQ2A 1XU9A 4H7EA 2ONCA 3DLAA 3MC1A 1KY3A 4TTAA 1X7XA 3DONA 3B1XA 4C7BA 4BUJA 3EZ2A 2CD9A 5HR5A 1CZHA 5U4XA 3ZUGA 4O4IF 4XR9A 3RF6A 4EARA 4YK7A 4XGNA 3UGKA 2FFBA 4H3KB 1A9PA 3AEQA 3PNBA 1FS6A 3MXTA 3P4UA 5K09A 1OXXK 4HH4A 3I0NA 4UEJA 1NVUQ 3WRXC 4DCSA 2O1EA 3HPQA 1QRSA 1GZ3A 3PHIA 3D31A 4N3GA 4BB9A 2BTQB 1GT6A 1UBCA 2FSVC 3KKMA 2M6LA 3KZNA 4PQGA 1LC3A 2B4KA 2J32A 1R8XA 3DBLA 4FWIB 1JVBA 1U6JA 4POOA 2WTNA 5CTJA 4BVBA 5JXIA 4AK9A 5CDYA 2WF8A 3C3DA 4E2ZA 1Q5PA 4JNCA 3RREA 2BPOA 3T3DA 2W4MA 1E59A 3SJCA 5B7NA 4BQNA 3LZ6A 8ABPA 4P2GA 1E6LA 4QSMA 1GZHB 1ORWA 4EY8A 4G56A 5HZGA 4FSXA 4C2BA 3VZCA 2CSUA 2WZQA 3FTNA 3ZZUA 1YT5A 3WYEA 4EVRA 3JALA 1HLDA 1ZICA 2ADOA 1DO2A 2PV0A 4I1RA 2XDWA 3KQNA 1QK5A 2P2DA 4BQPA 4WKOA 3HJGA 1IY0A 3X1WA 3HVIA 2XUDA 4XX0B 4P1ZA 5SZHB 4F21A 4YPFA 2FEKA 2XZTA 3QEJA 1N6NA 2Q07A 1GLGA 2Y9PB 2YTZA 3MMZA 4O4JF 3VU0A 2AOTA 1SUAA 2HSWA 2A3RA 4HN2A 4P7GA 2ZSDA 4RKQA 3BMXA 2IC5A 4M8KA 4EPYA 1ZI9A 4PTLA 4I4TB 1W4AA 1BMFA 1O2DA 1QZXA 4RK4A 1Q0LA 5KYYA 3OQJA 1FP7A 2J7KA 3CR3C 3FFBA 4RJKA 5I45A 3CVYA 3K0HA 2WUDA 4ZCSA 2W4IA 4FYVA 4U5XA 3U7IA 1BS9A 1M10A 1BNCA 3VU1A 2LDXA 3KVVA 4MVYA 4QIHA 3R24A 3E9RA 3I72A 5JEEA 3AONB 3N1UA 3NYWA 3HEMA 2EAUA 2IZ5A 2RHTA 4C06A 3GRFA 3UC5A 1W0KD 5E7IA 1C3LA 4FZRA 2NSYA 1A1VA 5KYYB 2W90A 3BB1A 1BE1A 4FFRA 4IW3B 3WY9A 4RZIA 4DA4A 2D2XA 4PZ9A 5KQSA 4U02A 4RKEA 5DSTA 3SYRA 4NMHA 2OQIA 3IT2A 3SPXA 4K9PA 5ICEA 1WPGA 2LIPA 3NTLA 2FEOA 2H1CA 1QC5B 3B1YA 1GPBA 2DP4E 5JJ5A 1NJ6A 1S1MA 3E0QA 5EPUA 3EMDA 2SCUB 4PZAA 3AKEA 2FEMA 1LQ2A 3WIEA 3QP9A 2C5LA 1ZIDA 2EZUA 3ZHBA 1HDYA 4KUHA 4Z9BA 2GARA 3NHKA 1TRKA 3FWKA 3G2PA 1CY2A 3EF3A 3VI3B 4X20B 2G9UA 1G2OA 1HRDA 3U39A 4KAAA 2B25A 1G20B 1RLTA 3G9UA 1DQZA 1T36B 4RVSA 4TRMA 5TQ2B 5AVZA 4M1ZA 3EB9A 4JJAA 3DZKA 1UBHS 3EDCA 3TAHA 1ZGGA 2YNMA 1V1JA 1V16A 5CA1A 3ZHUA 1EXNA 1HC7A 2VS1A 2Z2JA 4EG7A 1YU6A 2GPTA 1Q6ZA 3PEWA 3HZZA 2DOKA 2ZI4A 3LGSA 3O83A 1JHQA 3ZQ6A 3EVGA 4QQKA 3TZKA 2PD3A 4HG2A 3JQAB 2EKZA 3Q9NA 4NKRA 2VQSA 1G20A 1LB1B 1UQTA 2FFJA 3GN2A 3LQYA 5DW0A 2FN7A 3SHFA 4GP9A 4TM7A 1GNRA 1WW8A 1EFDN 1NXXA 1TGYA 3DUWA 1OI2A 3PNKA 4TM8A 5H82A 4DF3A 5BUZA 1H3EA 4KB5A 3OUTA 3FIJA 1QPGA 5BXQC 5JMTA 1FZTA 1L5GB 4HNGA 2JANA 4JOBA 4TVOA 3VDNB 2GZMA 2P7HA 5LA6F 3U4IA 2ODPA 1QYCA 2RH9B 3L7YA 3BIOA 5KTSA 2JGAA 3UBTA 3FZGA 4FGJA 5G0UA 2JI8A 2XRYA 1YC2A 5JCZA 5F76A 3U09A 1NHGA 1PBNA 3R3ZA 4C1NA 3NI2A 1XTZA 1A98A 1MLDA 4HATA 4QUDA 3DDNA 1N2HA 3I09A 4OAOA 4RK0A 4F91B 3N8GA 4UUOA 4WKCA 4I0WB 1J5PA 1JFLA 1F8UA 1B42A 1PD1A 5DBEX 4YCNA 3NORA 5C52B 3JAKB 3A0RB 4UHBA 1E0DA 1H22A 2C97A 4DIFA 4P98A 5CFPA 5IUNC 4YGXB 3ZI4A 5AVJA 1FDOA 2BI4A 3KU4A 3IE2A 3UA4A 1E8NA 4MRSA 1PT5A 3EDMA 2B20A 2CVOA 1ZJYA 4HDOB 3LI2A 4UVHA 5BV2P 3GWGA 5EJ9A 3NBQA 1OAOA 4U9IS 4LJ4A 1Q6YA 2ATVA 4EYEA 4FT2A 3F5MA 4RGYA 1RC0A 5FFFA 1T9HA 1ZM3A 4NABA 3KT0A 4KO3S 1TPZA 2ZETA 4HQFA 2BKLA 4IX9A 4RVDA 3WL6A 5IJ0B 3PUVA 4W9NA 5JS1A 2O8NA 3O73A 3Q1LA 4FZVA 1V7QA 4HL6A 1O94A 1RYZA 1X38A 2PVSA 4JLAA 4MQEB 4BFSA 3AHJA 5CDTA 2IVZA 4UZFA 2BKEA 4YRFA 2RIPA 3I2YX 1P0FA 2GBIA 1H5NA 3RC2A 3T38A 3IAS1 2I67A 2IZOA 2QS9A 3BDIA 5D2CA 3T0GA 1RPZA 4TWIA 2DXIA 2Q29A 4K8OA 4JC8A 1L4KA 1XA3A 2W93A 1XF9A 4EKDA 1RWNA 1HDCA 3CPJB 1VBKA 3KZMA 3BXOA 3OIYA 3H75A 2G5CA 4BLTA 4F93B 1P4RA 1YR9A 3TW4A 1B76A 1YA6A 3IMKA 4TVBA 2COKA 1SBTA 2H9IA 1YQDA 1NM5C 3PQ3A 2QTBA 1RI3A 4ZOAA 1TC2A 2R1TB 3FSRA 2QN2A 4BO0A 4Y6LA 1FQKA 1P2BA 2JJ2D 4KN6A 4P4SA 2IIBA 1KRXA 1ZZGA 1PSZA 5TT0A 3THXA 1GQRA 3QQ5A 4EZIA 4PYIA 3PLRA 1MTZA 3L0PA 3LRXA 2VT6A 2ZTHA 3NUGA 1FQOA 4DY4A 4B43A 2GILA 2J85A 1XAGA 4FBLA 4UCXA 1UWCA 2GPNA 4RENA 2Z4TA 3VHXB 2XCTB 3TINA 2G82A 2ZYIA 2YY7A 2QENA 1GXSB 2PRZA 1CUYA 2QSZA 3BHJA 3OEYA 1OH8A 4QDUA 1MNAA 3AM5A 4FK8A 3SQLA 4A16A 4F5WA 3ZHVA 3F74A 3G85A 2D0PB 4HRYA 4CU5A 3WLRA 1SMKA 2QD4A 2DFNA 1QOPB 4JL8A 5LPNA 3B6JA 6ABPA 1F60A 4QWWA 2G4LA 3HZHA 3MRVA 1T13A 2FK8A 4RGVA 5J1TB 1D2NA 3W6OA 1WB5A 3PA8A 3THXB 4LXTA 1MHPA 4W63A 4QJBA 1BYIA 1YFZA 2BHNA 2ZSAA 3FPSA 4HQOA 3ZY6A 2WIKA 3I01A 4DLRA 1TE2A 1U5AA 3HCFA 2B35A 3SJZA 4JLJA 4A8TA 1DUIA 5IZ4A 2HIAA 3TLYA 4AWBA 5KOYA 4KE9A 3A37A 5AK4A 3VM6A 2AZXA 4L8VA 1UXKA 4B83A 1NBMA 1FTSA 1NQTA 1PS9A 1SBCA 4Q0MA 3CR7A 4PG6A 5B4TA 4Q6WA 3M6WA 4WSOA 2D7DA 2NU8B 3OQBA 2AEFA 1LX6A 4W8HA 4AZ0A 4EF4A 2J6BA 4NV1A 2HR1A 2DT5A 3A6LA 3DGEC 3DNFA 3DZHA 2LD4A 2LNDA 1KSJA 1UMBB 2R7AA 1V26A 3INRA 5FUVA 3ZDEA 1CRWG 3BGOS 3DC2A 5EJ4A 5HK9A 3QVVA 1KJJA 3L82B 5KTKA 1DAOA 4MYTA 5LQJA 5FDFA 1J90A 3H3FA 4LV5B 2IGTA 7MHTA 3WOVA 1ZOPA 1FFYA 2NXNA 3Q7QA 2GD0A 3AL3A 4G65A 1Z5PA 1V25A 4K7JA 4KQKA 2XB6A 1DTWA 4BX8A 1HM5A 2C1ZA 1NWHA 4ARAA 2VNKA 4ZVPA 1FYXA 1EXWA 2FR0A 3HA7A 1DIGA 2Y92A 4KKVA 4AZ0B 2BW0A 4BN4A 2WWXA 4GMHA 2UUCB 3BX1A 2XMZA 4UE6A 5JO0A 1A8IA 1ISSA 2QV0A 4QO7A 4Y9UA 3AFNA 1NW6A 1DAHA 3OHPA 1RJ9B 4YRRA 4PXYA 4C4PA 3IJPA 1Z4QA 2WJPA 3O90A 4TV9B 4DMUB 4AAYA 5I6DA 4BJHB 3JRXA 3K8OE 4IHJB 1BRMA 1E2NA 1SEPA 1EFCA 4TWJA 1V5GA 4DLVA 1Z6PA 4U9HS 1R4MA 3DEIA 5DVZA 3PKIA 4H15A 3GCXA 2PLNA 4GXNA 3DULA 1TT7A 2RONA 2OP1A 1CRZA 5KHAA 2Y0DA 3I3SR 1Q17A 4Q7LA 2QQ0A 4ID3A 1M67A 1XZHA 3MJFA 2ZAYA 1V35A 4P5EA 1IVYA 3VMMA 2XA9A 3DA8A 1DTEA 3EVDA 1GZ4A 5ALYA 1I2AA 2IDJA 1USKA 1ZEJA 2PDAA 4QYTA 5F21A 4D8WA 4IDQA 4GWKA 4RZ3A 2I03A 4U7HA 1ITZA 5JO9A 4Z53A 1VJTA 2HO5A 2WZDA 1JXQA 1E7RA 3OF2A 3S40A 4DBLC 1VSQA 4D79A 1JQJC 3ZHOA 5LLDA 4ZAXA 3LQFA 2FX2A 3UAYA 1UEJA 5B7QA 2QL9A 4P81A 2OGTA 3PF9A 4QG3A 4N3BA 3M81A 2QP4A 2RFLA 3WQBA 3PGLA 1GGEA 2OWDA 2D74A 2PH5A 4OOEA 4PYRA 2WUGA 4I4TF 4YAJA 6YASA 3QLUA 3F5SA 2JCSA 1V41E 4G8DA 1BD4A 4MICA 2Y9MB 3NWEA 2O2JA 2NYAA 4XB1A 4RD3A 5ED0A 4EJ2A 3KFVA 3UJ9A 4FKZA 4G67A 3OLWA 1E1QA 3L84A 1Y3DE 3LYHA 4EHDA 4W9MC 4B6SA 4EIWA 4HB2A 1RAFA 4YREA 4D98A 4TYMA 4DCOA 4RULA 1R5JA 1DAEA 1Q2XA 4FE3A 4TMZA 4WLUA 3EIFA 5AXBA 3GLIB 3SIPA 3WGVA 1QHHA 3S6JA 2C2XA 5DGCA 5LLTA 1HDIA 1LI5A 2VDMB 3PJDA 4N5NA 4E31A 3R23A 4F1KA 1B74A 4MV7A 2P75A 3RFCA 2CXXA 4RDIA 1WETA 4KPUA 3C98A 1ZVKA 1E4EA 2VAPA 2C8JA 4LY6A 1RLUA 3RTGA 1VIVA 3ZWVA 1TK9A 3OPMA 3H99A 2AH5A 4G09A 5ETJA 3IT0A 4W6QA 3TM4A 5BN5A 3KAPA 3H5TA 4EGSA 2ZCUA 4GOJA 3O2NA 3Q11A 3Q7PA 4JVNA 3F5FA 1YKSA 1XR3A 3UK1A 3BD9A 3QBJA 4NFLA 4MVJA 1K0FA 4ZI5A 4XOIA 4K6GA 5M29A 2OBMA 2I5PO 3IIKA 4AKGA 5KI6A 3DE3X 1W4LA 1LTQA 1XAHA 2QN1A 2C1XA 1F1BA 1I0IA 4PPYA 1ZI6A 3OIFA 4X7MA 1QVVA 4XCVA 3A3NA 3EGVA 1V8ZA 2E85A 3MMPA 2GB4A 4QELA 3N0VA 3CRMA 3LCRA 1CQPA 4LYDA 3HXQA 4LQCA 3ZKWB 4JJGA 3X44A 3V7WA 3T3EA 3CURA 2FPGA 1BWQA 2FUCA 3DBOB 4L0MA 5F1KA 3DFZA 4CM5A 5F7JA 1FB5A 3PR1A 4CG1A 2X6TA 4NOMA 1TVCA 3CKKA 4AO6A 8OHMA 5ES4B 1I7SB 3DOOA 4P3PA 1KDRA 1T3HA 5FPTA 2KJQA 2FEWB 3X2FA 4RVHA 4B4UA 4BEJA 4KXWA 1L5SA 3ECAA 3N2ZB 4F2HA 2WJHA 1ZMOA 2QD5A 2WE8A 5EG5A 2VK1A 1MQAA 5EJ6A 4MMZB 2ALJA 1Z88A 4BLPA 3OOEA 2C2WA 2J46A 4L8YA 2ZE6A 3DCJA 1WXWA 521PA 1L1EA 3PGMA 1IAVA 5ALXA 5BR7A 1WD7A 2VTEA 2CV1A 3VPGA 1VLZA 1W48A 3N7UA 5BW8A 4DUGA 3A31A 5GVRA 1RXIA 4XAQA 1RP7A 1AS2A 4OX9Y 1E6UA 4B8WA 1EESA 1T5HX 1P7VA 5T41A 1FP4A 5LNK6 2P3LA 4DXAA 1YSCA 3S7ZA 3ZD6A 5CLGA 3RBAA 4Q4DA 2JHCA 4CLOA 1HF3A 4M54A 5E38A 1NQOA 2JZCA 1XB2A 4U6QA 3DTVB 3WIUA 2AEMA 4R1SA 3RYFB 3UJBA 1JQBA 3CPSA 4X41A 3VNSA 1QP4A 1YE5A 5U4QA 1KZ7B 2FPXA 3KLPX 2R97A 5JI3E 3M6MD 1JG2A 2PSDA 2VPPA 4JA0A 3M49A 2DPGA 2ZRQA 2AJTA 1MNQA 4AJEA 2H57A 5EKTA 1W30A 2REXB 3I04M 3TRKA 3BFJA 3CTPA 4AZ3A 3SQXA 2P4EA 3K0KA 2HHHB 1PQYA 1N9GB 2J3IA 1FUYB 3JYHA 4V39A 1CDOA 4AY5A 3N39C 1JQ3A 1ZJ6A 4IILA 3PENA 4ZT6A 2E2WA 4W1SA 1QRAA 3DBHB 2DJIA 3P27A 4WNIA 4DA8A 3FFWA 2PRJA 3RROA 3KYJB 1JIXA 4B3GA 4X91A 1PYGA 2E6UX 3SBOA 4UTPA 4GWGA 1F6DA 2JJMA 3ZDQA 5CB6A 4N0EA 4H18A 2ZVDA 4OATA 1MXFA 1PWYE 2WAYA 5ALUA 1YS7A 3RWOA 2JKZA 3AU9A 4O4LA 5KOHA 2FRXA 1NRIA 2WF6A 2I2XB 2JFXA 1HT3A 3WIVA 4OYHA 5JD4A 2H1RA 3OIVA 2PV7A 4WOCA 1I30A 1G5IA 2OZVA 4JEHA 2R9VA 4RABA 3RARA 1N9GA 1Z15A 2QAJA 1G3RA 3HS3A 3KALA 3D1VA 1SFRA 3DWIA 1B8VA 2FVXA 4KMRA 2FMFA 4NC9A 5CLLA 5CU7A 5GJWC 5K3FA 3DHEA 1LPSA 1G5PA 4CN9A 1GD1O 2B99A 5BSKA 5I7AA 5C1BA 3KFLA 1QS0A 4YJ3A 3NHWA 5E0KB 2H3EA 3KZXA 2NUPA 4E4YA 4UM9B 1P60A 3VXKA 1VJ1A 1HKUA 1VG1A 1P8AA 1WCV1 2XVZA 3UB2A 5TQ0B 5CYGA 5IMBA 4WK4B 5JAOA 5GINE 3IUEA 4K0KB 4OB7A 4HR7A 1KH1A 1NT4A 2OFFA 4YAUA 4U3JB 2ZSJA 5J1SB 1N2BA 1EI9A 1EVJA 2JFFA 2ZJ4A 3GJ8A 2GN8A 2I6QA 4G84A 3W5IA 3C41J 1UDAA 2WWGA 3QPBA 3NANA 3EDOA 1FS5A 3HUUA 4Z9AA 4CM9D 1NDHA 4CV1A 4DG9A 2JGEA 5BW6B 1K2WA 3SZRA 5I4BA 5MF6A 3QA3E 2AOUB 4E5PA 5AVRA 5CFZA 3MBKA 3DO6A 1LF5A 2IXGA 3BFXA 5EVJA 3DM9B 5LLSA 2PS1A 4H77A 1Q19A 2H1LA 1EX7A 1QVAA 3RJTA 4BZWA 4IV8A 2EBFX 3P4YA 4MVJE 4EYOA 4OV6B 1PJCA 1YWGO 3KSZO 3ZE6A 3U16A 3G2KA 3BHIA 3ZVMA 3FAZA 1QIJA 1E6CA 1GT91 1XTQA 1UADA 1VMAA 4NP6A 2DMRA 1JPJA 3VKVA 3V9PA 1TAHA 1V5EA 1Z07A 1XPJA 3W04A 4E15A 3MAJA 4YPOA 2PSJA 4HAWA 1GRCA 3B2NA 4FHFA 4RCZA 1TF7A 4WL0A 1ZVVA 3D7SA 4PLFA 4LSZA 5BN3A 3PNYA 3UWDA 1XTKA 3PQ7A 1OT5A 3OWXA 3CH7A 4IRXA 4EMSA 2YX1A 3USES 4B76A 4K1LA 4O4JB 1I01A 3R8CA 3FLMA 3MAGA 1KA9H 1SKUA 3B1WA 3KR9A 3EVZA 4LXYA 5DMHA 4DSTA 3HUTA 5JNSA 1B8PA 3VUFA 4AIIA 3IUSA 1YVRA 3HM2A 1YI0A 1E9SA 3ZQKA 1Y8ZA 3RO7A 5KNCA 1FDSA 5B2FA 1BTOA 4P82A 2V7VA 1VL1A 2UYGA 3LQKA 3L7BA 4R6WA 4XJTA 4XTRA 3BREA 5IAGA 4A0FA 1FFBA 2F7SA 1SHTX 4ARZA 2IH2A 1LK5A 1RPTA 2DJ5A 4EVSA 3AR6A 4D0RA 4U2BA 4ZEVA 2PBLA 1OXMA 5DM2A 4BGUA 2ZUSA 1C9EA 3A14A 4ENRA 1YUNA 1VLMA 1Z83A 2JCBA 1OZ0A 2UZ1A 4I9HA 4MS4A 2HCFA 4ZU1X 3C6QA 3DBRB 5HCIA 5F23A 2M9MA 2P8SA 1WXGA 3PXUA 2VC2B 1F0NA 4OJNA 5AVSA 4YGYA 4PZDA 1G64A 4IUDS 3AV0B 5SICE 4CMBA 1KMNA 2ZT5A 4MI9A 4Q19A 2LDBA 3H5WA 3Q10A 4UVGA 3DGFC 1Z4PX 2XRMA 3AY7A 5JCXA 3SOZA 2VSNA 4FB5A 3B8EA 5CW1A 4PAOA 1NI5A 1F9EA 3I9FA 4MWSA 4BVKA 4AX8A 3Q6MA 4AU1A 3ZZTA 5JECA 1CUCA 3N58A 2W83A 4QQNA 1QZ3A 4CU2A 3FD8A 2V03A 2HLHA 3R0ZA 3OZRA 4JGIA 4M1YA 1TA9A 4CMKA 5HVNA 4CIVA 1E0JA 3I0ZA 1FNCA 4HB4A 1QMGA 4E08A 2ZUUA 2PZBA 3GVXA 3PX7A 2AS0A 5A9TA 1IB6A 4DS3A 2RK3A 3CG0A 5HDQA 2VJMB 2ZJ2A 1GVNB 2D00A 3EH1A 3L40A 4G6ZA 4J1NA 2LIVA 2QORA 3E7WA 1OC4A 3EF0A 4ZAFA 3V2UA 3T5PA 2R4TA 2XXAA 3GXBA 3MUOA 4QNRA 1YB1A 3TW8A 4PS1A 3JZIA 4XQ0A 3VU3A 3PWZA 2I4OA 4F8JA 4KQHA 2B37A 2FFRA 1FMLA 1XMIA 1LDBA 2PTHA 1SKBA 2JEYA 3LKDA 3QX9A 4MB2A 4R41A 2I4RA 1R8SA 1YR1A 1Y4ZA 1HY3A 9LDBA 3O1JC 2H9AA 4LOLA 3N2GB 4W82A 1Z12A 5CJJA 4YCBA 3RIHA 3ZCPA 5JNLA 4G36A 4DR4B 1A2OA 2GESA 3FTDA 4OQPA 4GI1A 1TIBA 4BLSA 4WVFA 5F5LA 2F48A 3AF5A 3V6MA 2ESRA 1VMIA 3PKJA 4KUEA 1N7GA 3AETB 3RK4A 3RU2A 3WDKA 1BXKA 3OA2A 4ZP1A 3ZIAD 1VRVA 4PFQA 3ABSB 4YT4A 1RHMA 2A1TR 1S3IA 5G0VA 3RNOA 1YDMA 1PV1A 1NFFA 5ECGC 4UVEA 3SS9X 3GLHE 1X80A 2MYTA 3QK7A 2JLQA 3WRWA 1QPZA 2A5DA 2NTJA 2Q49A 2YJTD 3RLFA 5IHPA 1QYWA 5CA1B 1XAIA 4EYQA 4LF5B 2IF2A 3VR3A 3UM9A 1KXZA 4C4RA 2TMYA 4DWWA 2QUAA 5FWYB 3A6EA 2XYPA 3SR4A 1QQ7A 4Z7QB 4OHKA 4N3NA 5JZ9A 1WCWA 4ECAA 2O3SA 1U8AA 2LPMA 3MTJA 1ARZA 2PWPA 1P2UA 4OB6A 4TRNA 4C5CA 1UIRA 1XXHE 1X94A 4D9GA 4DMKA 3KJEA 1X19A 2QKYA 1E4VA 3ASVA 3ME5A 1RRKA 4PE5B 1MGOA 3ETLA 3DOEA 4OQMA 1SKQA 2I71A 2YC2C 3EEFA 3WGYA 5HZKA 2YHIB 2MJLA 5KYUA 4PG5A 4RTNA 2Q62A 5CNMA 4MIKA 5EXXA 3SSOA 1CJTC 1SQFA 2HJ9A 3H3XA 4RD0A 3AUSA 5BSHA 1KAGA 2HDNB 2IP2A 2OCXA 1DRVA 4GRAA 4TSFA 3RJ9A 1P45A 1B6GA 1L7NA 1W59A 3KPUA 4JL5A 4DARA 5K8LA 2B98A 4Q7QA 3I4LA 4UTRA 3RRNA 2XOEA 4Y7CA 1FNSA 3CGGA 5E6UA 5IVIA 4RETA 2FW8A 1XCOA 4X1KB 5CITA 4QXMA 4YDRA 3IH5A 3QUTA 4UTVA 4JODA 1A2QA 1R12A 2VA8A 5FA8A 1Q1QA 4UFPA 3K4HA 1C4KA 1XXLA 3L6RA 4GSLA 1NBWB 2OCKA 4RPLA 2JLZA 1H4TA 1A71A 3DZGA 4AG6A 1XZKA 2W2LD 1XU4A 4KQ1A 4XCXA 4XGQA 2IK8A 4QGBA 3GA5A 2WY2D 4K9LA 2CN1A 4RIFA 2J6CA 3H2IA 4X3PA 4URWR 3QEMB 1DC4A 4IZOA 4TVKA 4KRYA 1NXOA 4PBSA 5A1JA 2D2FA 2VJQA 1KHTA 1PR3A 1DJPA 3TO5A 4KACA 2XAAA 1G21E 4RHXA 3PFCA 3R2JA 1WVMA 3AEKB 1OMOA 1Z22A 3NHRA 3VSBA 1T26A 2VJBA 3IMCA 5IUKC 1J07A 3G8CA 3RGWS 1QGAA 3C8UA 2WHRA 3CPHA 2V7QA 3K1AA 4E1BA 4EFDA 5CFNA 2PL3A 3KO8A 2O05A 2ODNA 4J3FA 1IBMB 4YUAA 1YFJA 1QOQB 1MABB 3HEAA 4QHTA 5IG2A 5EWLB 4Q7KA 4YJDA 1DBQA 3EYAA 1DO0A 1ZIPA 2BM1A 1M1YB 4DLBA 3IR5A 3GG2A 5AW0A 5KU7A 1W4RA 2H2DA 1YNSA 3OQMA 3GVCA 5AVUA 5J5VA 1XPUA 4JJ4A 1RE1A 4NXNB 4NOJA 2O54A 2GZAA 4C0HA 1M2VB 1T2CA 4CPDA 4Q9KA 3BBPA 3UMRA 3UOGA 4R1TA 1FX0B 3VPDA 3VO8A 3KVOA 4FNOA 4TXMA 2EFGA 4C0SA 2CYCA 1JDZA 3D2CA 2XF8A 2EDCA 3IA7A 3KQVA 3OU2A 4F3CA 4F7DA 5J47A 1AHPA 3ID6C 2FGKA 2XA2A 4R51A 3V32A 1BFKA 1OGIA 3FUCA 4IXNA 4U7GA 3L06A 2HLDA 1SBQA 1ZK1A 1GRNA 2WJGA 3G3EA 4IRUB 4JWTA 4F04A 3P9CA 3B7WA 3HBJA 2CDAA 4YUVA 3R6LA 3FYUC 2PQ6A 3ANMA 1T9DA 2FMXA 4F92B 1XCJA 1NXWA 2OORA 3IP8A 4QPDA 2ZTSA 3IIIA 2QRPA 3U40A 5CBPB 3OPVA 1WG8A 2Q1TA 5KKCA 4KI0A 2NU6A 3SXPA 2XLBA 1N5LA 1UBRS 1IXKA 3K1JA 3E5MA 2VDPB 2ZBDA 3LECA 4ZGWA 4M0PA 5AM0A 5J4VA 1YCGA 1JKJB 2BGGA 3U3KA 4Z8XA 3TQQA 1UK7A 3KB1A 3SDSA 4TKVA 3B85A 2WAXA 1J22A 1XEWY 3IJRA 3WMFA 2PHZA 4ILEA 4IDFA 1ISPA 3A1FA 2D1SA 3FDXA 2QLTA 3Q7RA 5CGQB 5HX7A 2DCUA 1ODIA 4MHTA 3T1HB 1RW4A 4KLRA 1FPQA 4YO7A 2JIOA 5FA5A 1Y89A 5LC1A 4DB2A 3NFRA 3KJNA 4MV8A 4BTLA 4HUQB 3DXFA 4M0DA 4ZQGA 4HH1A 2JI9A 5FNVB 1H3NA 5A7FA 3UWPA 4G8CA 3A1TA 2F43A 1JF8A 1OJ7A 2V5UA 2V59A 3R3JA 4R9RA 4CCYB 3U4GA 1R0CA 1NXQA 1TEHA 2YMQA 3IAEA 4Y9SA 2PUHA 4QT4A 1T1EA 2QG4A 4RZUA 2UV8A 2C59A 3HWRA 4A82A 4CMEA 1PNRA 1VMKA 1VPEA 1WY5A 4L7VA 4P58A 4Z0HO 5F5NA 1ULHA 3ZYCA 2HCRA 2YWDA 4B3BA 1G291 1L4BA 4EO7A 1FMFA 1ZCZA 4I19A 4BIMA 1JKFA 2JBAA 2QEQA 2XE8A 3PQ5A 3UYKA 4J16C 1X0VA 3CLUC 2AFIE 3RNLA 4GPZA 3QMPA 3PTZA 1W8IA 2JIRA 1B0UA 1D2RA 2FLWA 3HR8A 1J42A 2PXCA 5DE3A 2GMWA 4N5IX 3ZHQA 4ENVA 4JI4B 3P32A 2VTBA 2KMLA 1H05A 4I55A 4OMDA 2BTEA 2VUSA 5AK3A 1XQ9A 2QMYA 4HTFB 1BQ3A 3OX3A 4INZA 3D3NA 3IVXA 3C45A 4GOKA 1JIQA 5KUTA 4HLNA 3ZVNA 1Y37A 2ZAIA 5KVQA 3WB9A 2DWOA 5BSEA 5L3QB 3QFSA 4RSGA 3U7EB 5AVQA 1NVDA 2FPIA 2HFJA 4D74A 5HKKA 2ECPA 4K2HA 3I2FA 3AVTA 3R77A 4LYEA 4Q16A 4ZQIA 3FCCA 2ZITA 4AD8A 3OOJA 5KYVA 4MPRA 4V0RA 4TOIA 2VJPA 3BWCA 3O21A 5FBVB 3RANA 1E5VA 3EVFA 1QDEA 3H5IA 5FI3A 2YKGA 2VXOA 5CB4F 4A8JA 1L5VA 1XZMA 4FNAA 4J6FA 2JH3A 1VSVA 1KHHA 1NW4A 5KAPA 4DNXA 3LW7A 2TRSB 1SVWA 3IXMA 3JQQA 1BA3A 3CW2A 1WQ1R 3AP1A 3OCZA 4R7ZA 5JBIA 2ZVJA 1EIWA 2NV0A 2RARA 1C81A 2AF4C 4KUGA 4BQEA 1B8NA 4KDRA 3WL5A 3WWCA 1YKFA 1YUMA 1AZSC 3GFOA 3ZK7A 4EEZA 2Z1MA 3ITDA 2H65A 5AHKA 4FTWA 1RYYA 5K3DA 1K6JA 2WF5A 1SPXA 4JJ6A 2NPFA 5DN6D 2ZJFA 1EVYA 1A8PA 2EW2A 3DWGA 5C1OA 2Y1EA 2IELA 3DKPA 3H9UA 2XVXA 3NWPA 4I50A 2Q9UA 3S2YA 4JJ7A 5B12A 1C30B 1YDWA 5HJ5A 4RFLA 3NHFA 4BPBA 2WVJA 2DU8A 1M5TA 5CLHA 4YS6A 1ESNA 1M0SA 4EMUA 3RC7A 2R6DA 4ZYXA 2IOFA 3A4TA 1ZD8A 2Y27A 2DHDA 2JHPA 3R7DA 4P92A 3IP6A 3CVWA 1AIPA 3KSRA 4UDNA 1JYSA 1H0SA 1E1RA 4UDYX 5DM60 4LPSA 4BHTA 3QXXA 2OQ2A 2FW1A 3DF9A 4Q7JB 4YT5A 2CLOB 2HF8A 3KBBA 4EKGA 4LZJA 1G17A 2DHRA 4EJ6A 2WSMA 3GGDA 4AO7A 2KLBA 3ICPA 3OZCA 2DPLA 3PHBE 1IJEA 4TLAA 4LYHA 4O02B 3R3YA 4YFVA 3TAXA 1FFXB 1GQOA 4ZQHA 4L4ZA 1RWBA 2ZE8A 1CY8A 3HCAA 3X2SA 2AE2A 3F4KA 1XEXA 3OWOA 1NRWA 4MUGA 5B3JA 5L9AA 3FYUA 4ZVUA 4TV8F 3BCSA 1XLVA 4KPUB 3WTCA 1P81A 1MMFB 4HFRA 1M1UA 1GA1A 1ICEA 2Z56A 3CLRD 4IMJB 2B34A 2VOJA 4IXDA 4N54A 5FI5A 3TSCA 4BV9A 2V3CC 4YROA 1DLIA 2K4MA 4ZTZB 4IXTA 4MX8A 5LDHA 1R0YA 4NE9A 1H0KA 4BNLA 4EECA 4G2NA 2OLJA 2JLRA 1B73A 3T9DA 3BXXA 3UN1A 4P53A 3UO8B 1EFPA 1K88A 3OLVA 4D8YA 4IHKA 5GIPE 2OGSA 4Q00A 4X3OA 1CFJA 2JK1A 3G9XA 3F6PA 1NQXA 2BGNA 3E27A 3MLBA 5LBUA 5K4AA 5HYVA 3K31A 1XD2A 2FSHA 5FR1A 4U9UA 5EP3A 1JDSA 1XDUA 2AEJA 4TS3A 5IX8A 3MCZA 4W7SA 3EIOA 2GK3A 1FVXA 1R8YA 2PZ8A 2ZRFA 3G7SA 3KYIB 3PFNA 3TLGB 5ADWA 4F1JA 1QCYA 3IE1A 1V5WA 3UQYS 1QCDA 1KNXA 2PZFA 1I7QB 5F9FA 2QV7A 3DT6A 4QZVA 1EFPB 2QPAA 3DOCA 3GEPA 1J1ZA 2X9LA 4ZRMA 3U1VA 3UZUA 3I9JA 2JPDA 2QUBA 1M74A 5HSGA 1I32A 2WHXA 1LQUA 3HDVA 5BN1A 1IXSB 3S68A 2L19A 1P0IA 2ACVA 1G8FA 4HK4A 3HYCA 3BUSA 2Q7DA 1M76A 1CS4C 2PRKA 4Y0AA 3C8ZA 2RHOA 3KK0A 5I7FA 1T29A 5KWSA 2VUHB 4ZVLA 5L3RA 4DNOA 3F7TA 2G5GX 5EMNA 2VHZA 4WLVA 2AI2A 3FUTA 3JQ6A 1DB3A 4IO0A 3RS3A 1NQWA 4F3KA 1F8YA 3OZVA 2REQB 4BEVA 1X7WB 1KEWA 2A35A 2P9YA 4LFCB 1HMPA 4D99A 8GPBA 1RZRD 1EBUA 3QPAA 2FZLA 4YMHA 1NN1A 5L6MB 3CF0A 3U0BA 3P9ZA 1OV4A 4Z4CA 2C4KA 4AY2A 3QUCA 3AHDA 4JI0B 4DMLA 4GPAA 2BFDB 2OPHA 3QXSA 3LW8A 3LGAA 4BO2A 4HX2A 3L8HA 4RUKA 4DR6B 4JKYA 5ELLA 3ZIAA 4OVKA 3CZ9A 1P8JA 4LV8B 3OTQA 1WW2A 1PE0A 1YJ8A 4LOKA 1NV9A 1X14A 3E9ZA 3CLKA 3BSFA 3PE4A 4OKSA 5DBGA 2IBTA 3KKOA 4BE7B 2XF2A 1YTUA 4G89A 2E5LB 1PZNA 1T9GR 4MCAA 1TGVA 3LLUA 3H9CA 1P1KA 2C2MA 4FINA 4D6PA 4HVCA 3RVJA 2ZR7A 1W5SA 3DKRA 4YALA 1KFKB 2PA0A 3ADBA 2Q5FA 3KD2A 4A2QA 5ER6A 3W9YA 5FQNA 1KK3A 1AXGA 3KJXA 2IS6A 3U9TA 1EDBA 2ZUBA 3UATA 3VNBA 3NTOA 1PNOA 5E1MA 5LYYA 2IWRA 5DBOA 1VG8A 1QX3A 4HKTA 5C7OO 1EG7A 4XB2A 3SHWA 1LRKA 3BD6A 3ZE8A 4FMCB 4BLRA 2PYZA 2WIFA 4LWQA 3ETHA 5SYNA 2N46A 4CMGA 3OT5A 3RT7A 4W8GA 2WZBA 2V9PA 2RHBA 1KVTA 4FIDA 1EWQA 4Q3BA 1CF9A 5DBHX 2VH5R 4N5HX 2XE6A 3G2MA 2OEPA 2CE2X 1PUJA 1X8KA 4OYRA 3W2GA 5CVDA 1WX1A 5KNLA 2YJ3A 3AB7A 4B84A 1ID8A 2R8XA 2C88A 3OECA 5FB3A 3KE9A 3CVUA 1NTRA 1ZQ1A 1FU7A 2FK7A 2XB4A 3PDCA 3PDWA 1BGXT 3FPBA 2W48A 4R3UC 5HA5A 1QM5A 1OZGA 5F3DA 5JU6A 1UDCA 4YMWA 4PC6A 5CH5A 1V7ZA 2Z2XA 3AVQA 1NE2A 3A9VA 1KZ1A 4H0NA 3DYIA 2YQ5A 3WYNA 4AJ9A 1MPTA 2F8TA 4L3WA 1FSZA 1BMFD 1JMVA 1TNDA 1Q22A 3H11A 1O6ZA 3P0FA 2Z5FA 4Y18A 2FN8A 2X9GA 2CUNA 4AC9A 1MB4A 1B93A 4CM4B 2VTDA 1GQSA 3KQLA 3H3JA 4M0MA 1WMSA 4PX3A 4K0RA 3GOQA 1D1PA 1P61B 4NAHA 3U0VA 4DCJA 1VRWA 3ZCXA 3D8TA 4ZJYA 2WKRA 1V2HE 4FE7A 1QIEA 1QFSA 1ZGCA 2CEKA 2JLWA 5H80A 5BSGA 1YIDA 1UUFA 1G38A 2NVUB 1XEFA 4V02A 1ZC4A 1OZAA 4Y1EA 3JU3A 1CV2A 4LMPA 4S1WA 1U65A 1GYQA 1FUUA 1T2EA 3PC8C 4QOJA 3DLBA 3C14C 3CZCA 1KYXA 4DQXA 1DSSG 4K9RA 2XQGA 3W8EA 3KT3A 1BWPA 4B8YA 5K6RA 3NBZC 1PK7A 2QLBA 1I4TD 3B13B 1MO4A 4UULA 2XBLA 4ZC1A 2I87A 4DMHA 4CJXA 4XIIA 1OFHA 3ZDAA 4FGLA 5A3VA 4DLNA 3CE6A 2AR0A 4M1WA 5AI5A 5G53C 1UR5A 1TQHA 4Q4CA 3LXMA 1JZQA 3HB9A 1FSPA 3PICA 2D7JA 3D54D 4KQWA 2IIQA 2JRLA 4INJA 3MSXA 3DDSA 4Q4JB 4CKBB 4DBVO 3F73A 4GOND 1A9XB 4A27A 3DL2A 2JD2A 2GZDA 1YBVA 3IEPA 4J07A 2Q7OE 4IMRA 3H7IA 3RRFA 3ZEIA 2MR5A 3G8DA 5JNVA 4ZQEA 5LCXA 3L6UA 3I34X 3IAUA 1MO6A 1NMXA 4TUYF 1OTYA 2I7XA 4X20A 4N39A 3CS3A 1N8TA 3I61A 2ZBUA 4MVJP 4QBIA 3F90A 2QUIA 4YWHA 2J5KA 2RBGA 2P2SA 3GV0A 1GKIA 3LGXA 4HUQA 3BB3A 3QYAA 1W9HA 5AOCA 3FMPB 5MFPA 4KX5A 1E0SA 4CCYA 4ND5A 1SOAA 4HZUA 2PQMA 1C1XA 1JA1A 3GF4A 4TL9A 1AKMA 2J4CA 4PRYA 3ONVA 3UIEA 3VR6H 1GDHA 4DBLE 4M87A 2ERYA 4MP6A 1XZEA 2QTNA 2EX1A 1SIBE 4EF5A 2E4VA 2JHAA 2P5SA 4QXPA 5LYJB 2DFDA 3BHMA 5FPHA 5A5EA 4Y2JA 2QY9A 2C9YA 2KBFA 2PXHA 1B0ZA 2QLFA 2GYYA 3GARA 1DQRA 4LC0A 4MVXA 1OXSC 5F7XA 2V74B 2VDOB 3NHAA 4L50A 4GVPA 4YRTA 3CNQS 4GM0A 1IOZA 3H9JA 1TXGA 3PVCA 2WTEA 3FF4A 3TRIA 3NC0C 4NG5A 1JDNA 5JQWA 2BEVA 5CIQA 4YRPA 1AU9A 3VBCA 3WYFA 2V7EA 4UE2A 2HV8A 2XXAB 2JJQA 3OE4A 4G63A 1V8FA 3CJRA 1DFGA 1OI3A 2WSYB 4NFHA 3SKXA 3UK2A 1YR6A 3FTCA 4YJFB 4YCJA 4F06A 1SCQA 2OLEA 3OFND 4MUYA 2XT9A 2Z58A 2V6FA 4FYPA 1UMCB 2HX1A 2CMKA 5JMOA 1D0SA 2B1QA 3KL4A 2PH3A 4NARA 2XNJA 5EJ2A 4BAUA 2XCSB 5K0EA 4TMWA 3LU1A 1YL5A 1WPQA 3ZTTA 1ZW6A 2IIPA 3H0EA 1TTQB 1Z0JA 4OJTA 3S2EA 4CLDA 3B2QA 1ZVQA 1ZUD1 1Z4MA 1KR2A 3PPYA 4YEDA 5LBIA 3U7FB 2VWQA 1QHXA 1ORVA 1H66A 1OLUB 3IQHX 1LNSA 1GKLA 3H8WA 4UCQA 4XUGB 1J5XA 4WLFA 3OG9A 1WCYA 2YIDA 1E69A 3I39X 4E07A 3DEJA 2GM5A 1JG7A 4KO1S 2ZRAA 3PC2A 3O4VA 2UAGA 1ISFA 1L1FA 1N2IA 1VGVA 2NUBA 3HV2A 1LF0A 3QF4A 4IH4A 3OFJA 3EEQA 2ODEA 5TPWA 121PA 3GEHA 2ZJ5A 1C9DB 4WUTA 5EWJA 3P2YA 4D9NA 5LMCA 3IURA 1GEEA 1SHJA 3G88A 5KNCD 1H2BA 4P33A 1GFWA 5E7QA 2ZCVA 3OCYA 4ZT4A 1DC6A 2NU7B 4KN9S 3UMVA 3JCZA 2X9NA 2YIMA 3E18A 3U44B 4MW1A 3WLHA 1R0RE 2C3UA 4IR7A 2E89A 1SU4A 1BHO1 3BMCB 4O4JA 1RBYA 3M1AA 2QTWB 1E2HA 821PA 4JS0A 2AHRA 3OP4A 2B0CA 2ZULA 5IS2A 1U1DA 2O2HA 1OHHD 3VSEA 1K89A 1N5DA 3U19A 3WK8A 2WMDA 1ZGBA 3A9CA 3R0XA 3B36A 5AVYA 3TECE 2BLNA 4Y98A 3DXYA 2BJWA 5K8CA 1EAYA 4DV1B 3IYLW 3C3KA 4QYSA 4TKUA 4IIYA 1F12A 2O8FB 4HMPA 4E88A 4V38A 3N6RA 1GFSA 1ZGAA 4AMVA 1QUEA 2Z5LA 2G1JA 5F52A 5CEEA 4GKJB 1LFDB 3I05A 3GPCA 1RI5A 5KC9A 10MHA 4EW1A 1JIVA 4FM9A 1GUYA 1X8XA 1PFYA 1VYTA 1ZMTA 3OZTA 3BIWA 5BPHA 1XHEA 1HKHA 1Q3TA 1TQDA 4KWIA 5HTOA 3JXEA 2JVIA 4JUFA 1WF6A 1YB7A 2O2ZA 4LZOA 1GAEO 3SJUA 1MRSA 2WBLC 2CL5A 2WOOA 2CVHA 4MO2A 4MHOA 2DPXA 5IWAB 4MQFB 3E9NA 2QAIA 3H6KA 1RXUA 2VPIA 3N2YA 1XJ5A 1MQ8B 1H69A 2XNDA 1X7YB 3W5AA 3IHLA 5GY7A 1KOJA 5CB4A 4IIEA 4XJSA 1Q7GA 2HJWA 3KXDA 4R1MA 4C89A 5E1BA 2CF6A 2V5VA 4CQMD 1WMAA 3KZOA 2I2WA 3AUUA 1RPAA 3NR2A 3L46A 1KL7A 4J43A 4K9NA 3FHJA 1YGPA 1R9MA 4G41A 2HZ7A 4RIIA 4XPIA 5CYOA 4RHCA 1U94A 1G19A 1EIZA 1I2ZA 5IJXA 1W0JD 1YJQA 4RKRA 4WKPA 1W36B 5GQSA 1Y42X 1GGFA 1Z6QA 3GRKA 1N4DA 4KMSA 5FLYA 2AQHA 4OJQA 4A6PA 3ENKA 3H19A 2I6SA 3NAQA 2WPNA 4M2LA 2BEUA 5G1OA 1OPRA 3WK5A 4QO8A 3KTOA 4LZPA 3VZSA 4BX3A 1AGRA 3KDSE 3K09A 1LZKA 1AQYA 3OA0A 3L7CA 3IP1A 3TXYA 4MRRA 3DZJA 4M53A 1RYHA 2HO4A 1L5KA 1LPAB 2HPAA 3M9WA 3OQNA 2AA3A 3DXZA 3N86A 4B79A 2OM2A 1PG2A 1KIMA 1WRBA 1YJ5A 3OX1A 3ZBTA 4IDOA 5F2EA 1F20A 3GVHA 4DHWA 4ZI3A 3BTOA 3SBXA 2AJLI 2REQA 6AT1A 5GVSA 3LP8A 2BEWA 2BFEB 4CF4A 2IV2X 2PRSA 4ZI7B 4HWOA 4MUXA 3VYVA 5JCOC 1SQ5A 3KQSA 3KSMA 2MWMA 2GWRA 1C2TA 3A1VA 2N47A 2NU6B 3C43A 5TSDA 1AE1A 4DLTA 2EQBA 2XADA 1CUWA 1PQPA 4IHJA 1HPLA 5BSRA 1LLDA 3BFPA 4YCAA 3SQNA 3BXGA 5A03A 4CIAA 3HH8A 4FGKA 2ZBPA 2DFKB 2C78A 2R7LA 2XOXA 2IH5A 4V3BA 5KMGA 3BGSA 1NUHA 2WYWA 4HCJA 2R48A 2TS1A 4J2OA 2YVAA 2MHCA 3SU8A 2C9OA 1H6BA 3FY4A 1IBLB 3TL6A 2WWYA 3V46A 2BGTA 4IIJA 1RTKA 3UWOA 2RE8A 4ARIA 4KR2A 1GCIA 3HRHA 1WQ4A 1AQLA 2Q50A 5CUQA 5IRCD 1T0PA 4LNUB 4OUDB 4PWZA 3CT4A 5FBRB 4EB8A 2ZT7A 2BGUA 2CBXA 4G1UC 4ER6A 1SXJA 3WMGA 4PO3X 2IYEA 3N3AC 3N53A 4H3HB 3U4QB 3T52A 1HDGO 2FPWA 1B0AA 1WXDA 3I2HA 1THTA 2OZPA 4ND6A 2QI9C 3G8BA 1OSNA 1JJFA 4BKUA 3V4LA 4C05A 1THGA 1XD9A 5TEVA 3NHMA 3C3WA 4C4TA 3OIUA 4DJAA 2FPPA 3KWMA 4KEAA 4KIFA 4FEGA 1VOTA 3SMQA 3A2MA 4BNIA 2XCUA 2C7RA 1GN9A 4FGWA 4OQLA 2IU3A 3G6KA 3GFFA 3BF7A 2QWXA 3UW3A 4UJ3A 1OA0A 4JXKA 4I6EA 4U8HA 1G7RA 4GBJA 4C4OA 1OILA 4TS9A 4WZZA 4XWKA 3GPLA 4LJ5A 5I8WA 2DTEA 3KQWA 1P2FA 4PY2A 3T5TA 2FPPB 1NNLA 4FOSA 1ZN7A 1CUHA 2ZJ6A 3LX5A 1E9EA 3H87A 3AVXA 2TSYB 1A9TA 2GRAA 1XKTA 3PNPA 4ATNA 4F4FA 4X1OA 4JFRA 4L5BA 3N07A 4LJ9A 3KTAA 4JI3B 3PRJA 4BLUA 1HEUA 4JH0A 5A6VA 1XRJA 2HAEA 2V1XA 3O2SB 2CD7A 2LE0A 5ITZB 3TEFA 1R9JA 2K7FA 1E79A 1KZ9A 4OQNA 3NV9A 3QFCA 4NMXB 4J7XA 2OYRA 4O2AB 2BIFA 3LZCA 4L5AA 2I9PA 2R85A 1W581 2FWPA 3OFSA 5G1NA 5GV8A 2G08A 4EY6A 2PCLA 5L45A 1FBNA 1C1DB 2J9RA 3CRNA 1Q83A 5REQA 2QQEA 3GRUA 2YQ4A 3HKDA 1XJWA 5DB4A 3UYLA 5BNTA 2PL1A 3O6VA 4YP7A 1FA9A 2RHGB 4D0SA 4RTOA 3AJDA 3WS7A 5H8WA 1NP3A 3ZXIA 1XHLA 2GXAA 4GMGA 3BJEA 4QDKA 2IYRA 4ZRDA 3OEEA 4P4NA 4KWHA 4TMYA 4I2VA 721PA 1EWYA 3KHUA 1E77A 5FRDA 2O3RA 1E9FA 4DSNA 4X92A 2Q8PA 4KCGA 3HCRA 3L0BA 1XV5A 4PG7A 1JLLA 2E1PA 3K8YA 3RPEA 3CX6A 4PLZA 3TKYA 1XZLA 1CIVA 3G8YA 2FKAA 1ODTC 2XNKA 3ES9A 4EPRA 1TO1E 2AXQA 2X2FA 3DDUA 2LR0A 2GZSA 2AJ8A 2FMUA 3QZUA 1J70A 1Z6AA 4ZA2A 1JSRA 1E9VA 4Q4JA 4BTEA 5JHHB 6ADHA 4ALLA 2RHRA 5FH9A 4MW0A 2DETA 1QKIA 3CMMA 2I4LA 1XRNA 1ENYA 3D8SA 4MGHA 2W22A 3C7AA 3NM5A 5HILA 3QU4A 2J48A 2GD6A 3ZHYA 3X1KA 2PXAA 3UH1A 3H2BA 1XZFA 3P20A 4IFEA 4X7BA 1MEEA 3WWZA 1ES9A 3DZBA 1WQ3A 3TG2A 4J0DA 1JIUA 1T2NA 3OFNA 2P9GA 3F9RA 4D9EA 3ABQB 1V47A 3H8SA 3NHSA 4X65B 4EL5A 3WFIA 4W5QA 4AJ4A 1CC1S 3AWIA 1JPUA 1P9RA 1PFQA 4P4SB 1DC7A 2O3UA 3D8NA 4F9TA 3GY0A 3KR0A 5IEJA 1WNTA 2OC9A 3IDSA 3WYGA 3NZEA 2PS9A 3PI7A 3QE9Y 3DEYX 4WN9B 2VTKA 1P73A 1PDVA 1Y33E 1TJ4A 1ZESA 4EW2A 3HXOA 3PFKA 1FNBA 4W5TA 4XEUA 5EZYF 3VR1A 5ER9A 5ERYA 3WLEA 4JB2A 2OILA 2VKQA 3OZDA 5AHOA 1CE8A 1N78A 1HO3A 1RIIA 2O0HA 2QF7A 4Q12A 4M22A 3G13A 4CKCA 1Q7CA 1KI6B 3NBUA 5SY4A 2CFOA 4IJVA 2YYYA 1K5DA 4LDAA 5K0CA 1XX6A 1MB9A 2G1KA 3EUAA 3IO3A 3LH5A 4JP3A 3SC2B 1EZZA 1YR3A 3A26A 5K8UA 1SXJE 1X1DA 2BFOA 2J7PD 3K3PA 3ONFA 4DGSA 3MWDB 2QLNA 1E5LA 3ILSA 1TT5A 3BZBA 3BE8A 2HWUA 3CZRA 3G49A 4M1OA 1QSGA 4BRWA 3HM9A 4P4UA 1DZIA 3EVTA 2AG6A 2C58A 1U3GA 1BIFA 2DF8A 2P0EA 3P97A 4BB6A 1NYTA 1BXZA 3HBFA 1IIBA 1VG0B 3HPRA 4QYWA 5DHAA 3DMYA 3N75A 1DFHA 3K9LA 1NUUA 1YZKA 1UMDB 1WIWA 3KYCA 3QVLA 4KX3A 4MKRA 4OG2A 4XASA 4Y3UA 3RKUA 5GIOE 2P8JA 1RAEA 3O8BA 2GRJA 3IR7A 3WO0A 4D7AA 1EP1B 1O08A 4BX0A 2LCIA 3G79A 4TXLA 4JOSA 3VSDA 1DPGA 1O95C 3CQ9A 1M2EA 2VJMA 1TT5B 3GK3A 3KPJA 3CR8A 1FFEA 1ZUHA 2IY9A 1T2AA 1Y0BA 4NBKA 4OGLA 3T99A 4YRGA 1Q1ZA 3BRWD 2WJVA 3OZWA 3G7NA 3K1ZA 3OUUA 3BN3A 2ISQA 2X58A 5BSUA 4KLCA 5EMMA 3ZWOA 4OFXA 5LZ8A 1NW9B 2AFHA 4OX9B 1IWOA 2GZHA 4LOJA 5DT2A 1QZTA 4A8JC 4DV6B 3JQEA 3MELA 4LDPA 5DOZA 4I81A 4RA6B 2Q7XA 1MKYA 4XFKA 2AJCA 2V6BA 5LB2A 1H8HA 1ONOA 1Y5MA 1IHDA 4UATA 1JSLA 2CWDA 3ND7A 4QM6A 1UK6A 3RYHA 3SX2A 3H13A 2WG1A 4UU0A 3H1PA 3R3VA 4X93A 1WHTB 2NGRA 3TLJA 2YUTA 2QIOA 3AESB 3IS3A 3B6MA 1Y8RB 3A2LA 4F2PA 1KJNA 1WS6A 2ZYUX 3AETA 4GMFA 2VA9A 3GMDA 2B7BA 1Z4LA 4P7FA 3UJCA 5KAMA 1RM5A 1ML4A 1TW2A 2C9DA 4TX1A 4NAUA 1U8YA 1ZW1A 4NK4A 2XGGA 4LHSA 1TYAE 2GO1A 2JLSA 4KQFA 3U17A 3HJAA 4W7IA 3U31A 4B4OA 3TG8A 3RK1A 4YONB 4M1QA 5IT5A 1SCBA 1WHTA 3U4CA 2H4WA 2PH7A 1Y98A 1DDGA 2HM7A 2IBMA 3HMQA 1XWWA 1JSXA 4ARBA 4CTKA 1IBCA 5KYGA 1D6JA 1ONSA 2EIHA 1Z56C 1LXCA 1W76A 1Z4NA 2IGBA 4LDJA 2O2EA 4OXXA 3V3KA 3MCAA 3LKVA 1R1DA 2FEPA 3P2JA 4JC5A 5EI5A 5IYZA 2O8FA 1PJQA 2CB0A 1N8SA 2Y76A 3HFGA 4DMCA 4XVUA 4NI5A 1UM9B 4TSKA 4XUEA 1WCXA 2PX5A 4DQDA 2YL2A 3CF4G 1ZM7A 2EG5A 1NVMB 3LOPA 5EVCA 3ZU3A 4PWYA 1PYDA 3QEOA 3LFTA 4M88A 3QG1A 1SKAA 3NTQA 3ZV7A 3AUAA 4Q15A 3V2IA 1IQ0A 3W8NA 3WDLA 1MX1A 4AG5A 3FAKA 3K96A 2C2HA 1HV8A 2X3UA 1U3WA 3JRNA 4X1KA 4ZHQB 1FYFA 1MF7A 1GL9B 1NLMA 3ESZA 1ZA1A 1V3TA 4NYIR 3R3SA 4BFLA 4Q9JA 1QP7A 2X0NA 3MMNA 3MWYW 1W47A 3HBAA 4RHTA 2PX8A 1MH9A 2KB0A 5CMLA 4ZT2A 3ZS9A 3TXXA 4IDCA 2WEKA 5IJZA 4HX5A 1WL8A 3JZMA 3W3AA 4QLBA 4JROA 2J3HA 1Q1NA 2J0UA 3MGCA 3WLJA 4C29A 2PGIA 5ELXA 3Q8KA 1ZKMA 4YQYA 5DIFA 4BV3A 3HGMA 4CBVA 5KEIA 1GV1A 5JFTA 3Q0EA 1RLMA 2XRZA 4A6EA 2FI1A 4R3WA 4BNXA 4AP6A 2NO9A 1DMRA 5B6PA 3LE8A 3LWBA 5CDFE 1IIRA 1ADCA 2HSEA 3HLYA 4PCLA 1X1TA 2DKNA 3BWVA 3TTWA 1PT8A 3Q98A 4MVJI 1J2RA 4UBMA 3T9BA 1ZMBA 4HN4B 1KK1A 1VJGA 3GO4A 3RIXA 4JI7B 1N33B 4MHSA 3UKJA 1OW3B 3FVVA 4CL3A 2I6TA 3CISA 5BOSA 2MYPA 3B9QA 1G63A 2DC1A 1OI4A 4AJHA 4NZZA 5BR4A 3J7AC 4YMGA 2I6XA 1SVSA 3GLGA 4BNHA 3KETA 2BHLA 1NM5A 2FRDA 4P7KA 4P3YA 3I0MA 3AVPA 1RYFA 4LSMA 1N6OA 2ZIFA 4NBSA 1EGMB 3WAJA 2O5VA 4LVCA 1LPNA 3BMOB 3K8QA 3P7MA 1Z0SA 4OHVA 1E92A 2X2EA 4FXOA 2HBQA 2VIIA 3P2EA 2J31A 1YQGA 1W52X 2NV2B 1UPCA 3GP5A 3N5KA 4LHVA 4K9SA 1RRFA 3NJRA 4PYKA 2QUZA 4Q3KA 1IN1A 3ZXUB 4U6SA 4PZCA 3E22B 1U3TA 5EMKA 1TZKA 2MINA 1B0PA 1CNMA 5F4BA 4B2IA 3D7NA 4NFYA 1N6HA 4MV9A 3A9WA 3F47A 3PXXA 4R83A 2H59A 4X8OA 3MB8A 3BEOA 1X3SA 2G36A 3ZG6A 3DOIA 1ZK3A 4J3JA 4L1KA 4N18A 2AWOA 2P9HA 5EMHA 2X5OA 4M9XA 3RAGA 1P19A 5DRTA 1J06A 1R16A 5T67A 5JLJA 3EBOA 3LQ1A 1WZIA 2SHKA 3B8HA 4RE6A 4EG0A 2XMGA 3AKZA 4FDAA 3H1GA 3GP3A 1MV5A 3BBLA 1E3EA 4JITA 1PLJA 1RSZA 2FSVA 3PV0A 2ZZNA 3EXEB 3H2SA 4GYKA 4PHGA 5AVVA 1DIBA 3HP1A 5K0JA 1EDEA 5KWJA 1PZXA 3MTBA 3F6CA 3KPWA 1DX4A 2BJVA 5BWCA