3NS7B

Succinic acid amides as p2-p3 replacements for inhibitors of interleukin-1beta converting enzyme (ice or caspase 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
b'AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title Succinic acid amides as P2-P3 replacements for inhibitors of interleukin-1beta converting enzyme (ICE or caspase 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2010-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ns7B00
3RJMB 1PAUB 3KJNB 2H65B 4JB8B 1ICEB 3EDRB 2C2KB 4LSZB 2HBQB 4DCJB 1RWMB 3IBCB 1RWKB 1GFWB 1RHRB 1RHUB 2HBYB 3P45B 4ZVSB 3GJSB 3R6GB 3R6LB 2C2OB 2DKOB 1SC4B 3KJQB 4ZVRB 2HBZB 1RHQB 1RWOB 2CDRB 1BMQB 3D6HB 2CNNB 2XZDB 1RWPB 1RWXB 1RWWB 3IBFB 1SC3B 2H4WB 1SC1B 2QLBB 3GJQB 1RE1B 3GJRB 4DCPB 2C1EB 5IC4B 4DCOB 2CJYB 3GJTB 3P4UB 2XYPB 2QLJB 2H4YB 3R7SB 3KJFB 3R7NB 2QL5B 1QDUB 3D6MB 2Y1LB 3D6FB 4ZVOB 3QNWB 2QLFB 1I3OB 2C2MB 2H51B 1QTNB 3SIPB 1RHJB 2QL7B 2CNLB 1IBCB 2QL9B 1I51B 2CNKB 1RWVB 1RHKB 2XZTB 2CJXB 2H48B 3NS7B 1NMEB 3R5JB 2Y0BB 5K20B 2HBRB 3R7BB 2P2CB 2H5IB 4ZVQB 2C2ZB 4ZVPB 2FQQB 2H5JB 4ZVUB 2XYGB 4ZVTB 1RHMB 1RWNB 2XYHB 1PYOB 1F9EB 2H54B 3EDQB 2CNOB 5IC6B
chains in the Genus database with same CATH superfamily
3VVUA 4QU7A 3K2YA 3KMQA 4QR0A 2RQ4A 4D3GA 5J2PB 4TY9A 1URRA 2YQ0A 5D0HA 4B3SJ 4KB7A 2OMLA 2HQCA 3UDLA 2BW7A 3F73A 4P2FA 4ID5B 2JLFA 1NHUA 3SEOA 1YJVA 1IKVB 1Q8KA 2VDIA 4LFAF 1RT5A 2ABYA 2GGPA 4NL5A 4PXDA 1O8BA 3W61A 3A3OB 1HHQA 1VQ4S 2IY5B 1KOHA 2KM8C 1IKXA 1WG4A 4JI6J 3EZ5A 2AP6A 4KHPF 5C5JA 4DLGA 1VBXA 1PJ7A 3D6MB 2MTLA 2W25A 3RW7A 1CC8A 2RRNA 1HQUA 4ZVEA 5MAOA 2EFVA 1TMMA 4MYUA 4QIGA 2R2UA 3D3CJ 5HI7A 4BWJA 2MSSA 3AA9A 5HVFA 3OUYA 2P2CB 2X1FA 4KIAA 4CNYA 2RRBA 5DLGA 3M6XA 4CM0A 3PHEA 1LNQA 2PMHA 4YOEA 4TLQA 2E1AA 5FD1A 1VQ6S 2IRXA 5HP1B 2AZ1A 1PIEA 3IA0A 5KFAA 3SCLE 1U1PA 4LF1A 2EKNA 3F44A 2BJ8A 1RHRB 3C14B 1FEEA 5C7PA 2NCKL 1SC4B 3LGNA 2WRMA 1ELOA 2Y0SD 2WONB 3IS9B 1JX4A 3ADAC 2Z8QA 2YWHA 3HVTB 2APOA 3RR7A 2BE9B 3CT9A 4WYWA 2Z0GA 4ED0A 5KFJA 1OIAA 2XI3A 2OPRA 2Z56B 1LW0B 4KFBB 1NJZA 2C42A 3AY0A 3KKFA 2HYIB 4YN3B 4P74A 2A2DA 4MH8A 3IWXA 2XSFA 3QIPA 1VHFA 2LXFA 4Y28C 1S7HA 1U02A 4DX6A 2DR6A 3CCUS 4NYZA 1TKDA 5A8WB 4ID8A 2LLZA 2DR9A 1FKPB 3G2XA 4QYRA 3ILLA 1M5HA 1X4GA 3I9V9 5A76A 4ZVTB 2QE5A 3FBCA 1U26A 1SV5A 4KTQA 1UFWA 4MYTA 2EC0A 1NJWA 3M8PB 1EETA 5HBMA 1R8AA 3CDAA 1I94J 3DOKA 1WC0A 2D9OA 2DRAA 1LWCA 2K2PA 2V67A 4JYAJ 5IWAJ 1V5IB 2RRAA 1RWPB 5KT7A 1Q53A 4ICLA 1HBOB 3MR3A 2YKOA 4ECWA 4IH5A 4H4MA 1WEZA 1TVRA 2YH1A 4F4AA 2ZBIA 1KWMA 1VQPS 4J9VA 4DL5A 4R5PB 3V81B 2DHAA 1VCTA 1GMWA 3AJ2A 1WNEA 3EZOA 3MM9A 4ZDNA 3MPYA 2JEJA 4ZHRA 3QAEA 4QR1A 1XWLA 5D3GB 4PEOA 1MNEA 1SL0A 2C3MA 2W9CB 4MTPA 1PILA 2WVCA 2HNYA 3D1HA 3CC2S 4A8WA 3Q22A 3Q8PB 1H3DA 3US5A 2GVDA 4RU9A 3ENWA 3D6TB 3DGPA 4FF1A 4PYAA 2HZVA 3MZIA 1AFIA 3BH7B 1WORA 3JB9k 2XSJB 4LMZA 2B9YA 2GAGC 5HN0A 2GQ2A 4ES2A 3RR8A 1T95A 5ADZA 2LFVA 1OSCA 1D9AA 4CYUA 1TAQA 3O3LA 3ICLA 4WKRA 2E9TA 4C2MA 2UUBF 1RWWB 1RU1A 2F8MA 4FYYB 1U2FA 1TMJA 3MCNA 3MCSA 3LO3A 4I0WA 5FIIA 1R0AA 4FPRA 1WDTA 5KG3A 3MEGB 2EFQA 2VV5A 1MN9A 3AB2B 1BD6A 2ZKUA 3AXKA 1G4CA 1UW9A 4JI0F 4KHRA 2MQNA 1MG7A 1T9TA 2EFPA 2JVOA 2YQ1A 5E7OB 2I5JA 4ZITA 2G13A 1HBMA 2VFTA 1YVFA 2XMTA 3CUNA 2MHNA 3RW6A 2VQEJ 2HSEB 5L46A 2Q1LA 3FVYA 3KK2A 1S0VA 3KWMA 1EX8A 1RKIA 1FVSA 3H8YA 2LDIA 4A4JA 1PYOB 4U7UK 3NCRA 1D8ZA 1YJTA 1VC0A 3RRGA 4G65A 2FJAB 3UO0A 1KDNA 2PI4A 3OFEA 2IVFB 1BQXA 3AOAA 1GQEA 3MEEA 4B9UA 4P2MA 2GCFA 1MWZA 1N6QA 2NUHA 3GIIA 2K3IA 4IDKB 4I6YA 1X8DA 4YFUA 2W4DA 5C42B 2R42A 3A4TA 4CDIA 4QWBA 1ACMB 3HJFA 2C3PA 4DR5J 5KFOA 1J2VA 1K9MT 4KGVB 1HR0F 4BBYA 2GC8A 1H74A 2DT9A 2CNKB 2AU0A 1RHKB 3OTEA 4EBCA 2Y0BB 5DLFA 2CPDA 3ENVA 4WPAA 2KKHA 1QUPA 3B78A 4YR3A 4FZVA 4X2BA 1TKZA 3DI6A 2EK1A 1KNZA 1NB2A 2R9LA 4ANCA 3QLHA 4ZCIA 2MQLA 1ZH5A 3JYTA 4B9LA 3RJMB 4HHUA 2E7VA 3CB4A 4LSZB 4DSKA 5RUBA 3FC9A 4RWWA 4ZLNA 2IMWP 3MM7B 3CJRA 3MECA 4DBQA 1X7VA 1GMUA 4NEYA 4DL0C 5IT9U 1TUVA 2R7QA 3TQEA 1VHIA 2VC0A 3RTVA 3HLUA 3AOBA 1XMOJ 1NK9A 3CC7S 1TAUA 1BQNA 4Q2LA 2DGSA 3NY0A 3D2WA 1FK9B 4DFPA 4Y0FA 1V5VA 1C1BA 5HAOA 3DLJA 4LIRA 2Y1JA 2I8EA 1OJ4A 4KAIA 2UUBJ 4AUKA 3M6UA 4DV6F 3W9IA 2MKHA 1KTQA 1RT3B 2D69A 3GIJA 4NE9C 4OI2A 5D4PA 3THPA 3I4HX 3CO9A 1P1TA 2OP5A 4B08A 4IG3A 4IFYB 2JEFA 2F7VA 2M7SA 2B6AA 4WFZA 3GR0A 2H3EB 2LQ5A 5IV3A 4NA2A 1VQMS 1TU0B 1VRUA 3SSRA 1RHQB 1N32F 2YQ3A 3RGIA 2IHR1 1REVA 2DVIA 3GTYX 2OPQB 2B9WA 2JC0A 3MR2A 3W65A 4DCOB 3TEGA 1YITS 2QL5B 1VMBA 4HDGA 3H4BA 2FHKA 2VOPA 3D9BA 4X4RA 1WI6A 1B3TA 4PR6A 2NZ4A 4DV2F 3DXSX 6FD1A 3M9OB 1FDNA 1S0MA 2BKPA 1S1XA 1XIQA 4NLPA 2W4PA 4G1QA 5EUHA 3A8EA 2CPZA 1S4EA 2GV1A 1DTQB 3K5LA 2DPJA 2ZITA 4I68A 2EEYA 2VBXA 3HP6A 4C8ZA 1M5SA 4LRDA 1Q82T 1REGX 4NLYA 2VODA 4KGXB 2I6WA 1X9MA 4EBDA 2OIHA 3KLHA 5I42A 4NI2B 1HNIB 1QVGR 4DCJB 4K59A 2A10A 5B7WA 5CQGA 1KHWA 2VPXB 1YLXA 4JI2F 4RBUA 4DQSA 4CH0S 3FZBA 3S01A 2GIRA 4LR9A 1R6VA 5F8LA 3B82A 4DPYA 2NREA 4KH0B 3M2RB 1KBRA 2HQ3A 1JLBB 1U0HB 2BACA 1S6UA 3LPEA 2NSBA 3J7YU 2AGQA 1WKLA 2W9AA 1RABB 1NJYA 3OR1A 1O0PA 3OTCA 2Y1RI 3AQPA 1AA1B 4FYXB 2J0SD 3DXBA 3BO3A 3L7UA 1IWAA 4DR1F 3MCOA 1VRTA 2G0IA 2KL8A 1HKAA 1KQFB 1X60A 2F9DA 2ZJPQ 2W24A 1CQNA 5BYQA 4GVBB 2MZRA 2H5JB 1CS4A 5KT6A 2CZ9A 2PA8D 2L41A 2KHCA 4KGKA 4CT9A 2BQ3A 1HPZA 3PDNA 4ES3A 3IAS9 1IM6A 3M8QA 3NAIA 3ET6A 2N4CA 2X3GA 4KBIA 4G1IA 3OVAA 3CEDA 3Q83A 4YB5A 3FKBA 3MM5B 5ETNA 2RQMA 2XNRA 3VQTA 1FHTA 4X65J 1EB0A 4J9KA 1TK0A 3GG1A 1C1CB 3QGPA 1HI8A 2GX8A 1N33F 1ITPA 4KPYA 4ZIVA 4NZ6A 4WFAQ 2GVZB 5J1NA 4XPEA 2UV8A 2H5EA 4J9SA 2WZ1A 3RB4A 3SI8A 2D1CA 4DS4A 4PQUA 1LWEB 2JOQA 3HFVA 2XWXA 2OLWA 5CYQA 2E5LF 2VJVA 3HXMA 3CVKA 2RS8A 2DNNA 4RJVA 2QFJA 3QT7A 2M0GB 3JSMB 3H5SA 2ZH8A 4M94A 1ZYQA 2HKEA 1B99A 4UF4A 4LRCA 3EVOA 4K7QA 3CDWA 2OGUA 3UDEA 1UWBB 4N5SA 2ZH2A 2KT3A 5LM7E 5F8GA 4LR7A 3R2DJ 4X62F 4U95A 1FE0A 3BV8A 4A46A 4GMKA 3QSYB 2YNFA 3U1LA 5F8NA 4JI5J 1TL5A 2CKWA 2QLWA 1WC4A 1S77D 2HG4A 4NASA 5KT3A 2ASLA 2J0QD 2UXCJ 4C48A 2MSTA 3J7YI 2KI2A 4OYAA 1Y5NB 4PG5A 4J37A 4M5LA 4DV1J 3BGRB 3VAGA 1XNQF 4ILLA 3DYAA 1MW7A 3PO5A 3TJ8A 2IMOA 4QW9A 2IJNA 1X5TA 2QMUB 1MWYA 1HWIA 2HFNA 3QFWA 2KYXA 1IBMF 4Y2KA 2GAHC 4Q0BA 4FVCA 4OHZA 1OYEA 3DOLA 3LF0A 2BJ1A 3CJ4A 4DMZA 4A8YA 5EWEA 2DXEA 2PT0A 5GAEU 3G82B 4KY3A 4WE1A 2MZTA 1S9EB 1X4DA 4YQWA 2D3UA 2IM3A 2PN6A 1N0UA 3GV8B 2M3DA 5F8IA 1PAUB 4O3SA 3HI9A 1GMVA 4USIA 3BKFA 1UVLA 2G1DA 4CTAB 3J7A1 4USHA 3MGJA 1WG5A 3PW0A 2CDRB 4LFCF 4USWA 5EGYA 5H9FK 5KG2A 1HNZF 1IR0A 1VK3A 3IBWA 3K0JA 4DQIA 1U1NA 5HMZA 4RUBA 3OJUA 4ZJLA 3CMES 4N41A 4RNOA 4J90A 2YWGA 3DLEB 1T02A 4OQJA 4PXEA 3I0RA 2W2QP 4F2SA 4FXVA 1KLMA 3MPUB 1OYDA 2BZ2A 2OEKA 2ZFHA 3UCGA 3CSKA 2HHWA 4L72B 5K14B 5J2QB 2MQMA 3ONQA 3WIVA 1M0SA 4PG8A 1N56A 2X3DA 3WBZA 4C8NA 6AT1B 5LMUJ 4RW7B 2LDYA 2YKAA 3ZZYA 2OPSB 2QMWA 2HNZB 2UUAF 3MHYA 1YJWS 1NZ8A 3J80U 1YJNS 3LH2S 2E5LJ 3CF5Q 1NLKL 1RWOB 2LKZA 3TX8A 1VQOS 1JK9B 1RB0A 2IAJB 1W7WA 3J7Z5 2W9BB 1VOMA 1IM4A 2ZE2A 4DPWA 4I2QB 2HWTA 1V3SA 3CIZA 1VQ7S 2EKYA 1D9FA 5C2CA 1N88A 4X62J 2MJUA 3C6UA 3DMJB 2JFKA 3M8SA 4ILRA 2MJNA 2XB2D 2FJDB 4FP9A 3NWGA 2KRBA 2MYFA 3DRPA 2XO6A 4CH7A 3JAMY 4OYBA 3SSSA 4ECYA 2KTQA 1FERA 4DF4A 2WSCC 3BPDA 3W7BA 5EDWA 2DNYA 4O3OA 5GAEI 3FSIA 5CA5A 3D1QA 5KFBA 1TUWA 3NP5A 5DRKA 1EKSA 3K8WA 4RNHA 1TFYA 3KJVB 3AA8A 4RBTA 1UZDA 4F26A 3KUHA 4JI4F 2MGZA 2V69A 3M05A 2GFFA 3QFHA 6FDRA 2LQ8A 3EDQB 1XTZA 1HW8A 4N77A 3Q2TC 3E51A 1SUQA 4PXBA 3SFGA 2QG9B 3UI3A 3KTQA 1VIOA 4NXMJ 4DJBA 4OZ5A 5ITHA 2GZOA 1HYSA 3P45B 3DLKA 3MPWA 3BO2A 3NBPA 3IG1B 2DYAA 3LOUA 4DR7J 2HS3A 2VL1A 4ZA1A 2A1BA 5A8RA 4WCEQ 1LV5A 2V2VA 2V34A 2XMUA 4HR2A 3NGTA 2Z30B 4NOHA 1W2BR 2VPWB 2DNKA 2XULA 1GEHA 2KXHA 1WD6A 1RT5B 1FFGB 4AD6A 3CDEA 5J2NB 3W2VB 3VCDA 3RBZA 4ECXA 2ZH1A 1OS5A 1F1BB 5H9EK 4U96A 5J1PA 4JI7F 4OHVA 4CLWA 3G71S 2FLLA 3CJ5A 1FRHA 4IYQA 1PGZA 3DRSA 1HQUB 2VFVA 2CJ9A 3CXCR 2UU9J 3EX7B 3NGKA 4HTIA 4OYIA 4ECUA 2WOMA 2CJAA 3OUYB 3PEJA 3UN3A 4F3OA 5IS2A 1WC6A 3DLGA 3GYXB 2OSQA 3N6LA 2XMJA 3KG4A 4ZN3A 2XLKA 2LVWA 4RUHA 1TTHB 4RL1A 3LALA 2QIFA 3I5AA 2GIQA 1EIYB 1BUXA 2CQ4A 1U48A 2CJQA 3KHHA 2M70A 3P4UB 2W2PP 4EZ6A 4URSA 2UUAJ 2RDDA 3ZZOA 1K47A 1NKBA 2RF2A 1DFDA 4F4YA 2DIUA 2J9DE 2EBGA 3PM9A 2D41A 4B9MA 2OPRB 3OFFA 1FFSB 2Y3YA 4DN0A 1RT7A 2D7SA 5HQMA 3QIPB 2HIYA 4LBPA 4WFXA 4GKKF 4YB1P 3F56A 1Y9OA 2NPIA 2FIUA 2WHOA 3QRPA 2DRDA 3P5TL 3X3UA 4Q43A 2HNDA 1NSQA 3SCIE 3A3PB 3GFHA 2WW4A 4PAAA 2DHHA 2OHDA 3VHQA 4WXWA 5KG1A 2DNRA 1SV5B 1T05A 4FNIA 3B6BA 2E1PA 3IR5B 5F41A 4NYPA 1RGVA 4I2PA 1EETB 2FHMA 5HBMB 3EWGA 3M8ZA 3DOKB 3TUZC 4DFJA 2ZBQA 1LWCB 1PAEX 1SB6A 3PYDA 2ADBA 2CPHA 2WBRA 1UVNA 2QC3A 4ICLB 5AXNA 2GA7A 2E1CA 2Z58B 1XJWB 4H4MB 4TKTA 3HKZD 3ITHA 1Q95G 1SJQA 3EPIA 3EJMA 1IBKF 1I51B 3VR1A 3C8YA 2DGTA 2RH3A 1FCAA 3E01A 2FZGB 1CLFA 3CJKA 1HQ2A 4ZHRB 2MDAA 5KFQA 1QJHA 2IA6A 1YZ7A 1NK0A 2V2KA 3J81j 3CD0A 1U45A 1QSSA 3QGIA 3R3TA 2HNYB 4LREA 2V8DA 2XI2A 1H2VZ 3R1LA 3R8YA 4JI7J 2GVDB 2HBZB 3AJDA 5HVHA 3DU6A 1CJVB 1HBNA 1RZMA 1YQHA 4K4WA 2QLXA 3JSYA 1Q5VA 1R43A 3KLEB 2HAIA 4PCQA 3FGVA 1O5JA 1Y3KA 4C4WA 3DM2A 5DDPC 1JLFA 4CYUB 3I55S 3N9UC 1T03B 4FNHA 3FJ2A 3IM8A 1U7LA 3C2PA 3I9ZA 1B0VA 1S59A 1R0AB 4ED8A 1LOUA 1VQYA 3ZZTA 2B51A 2M4MA 3G8QA 3KYLA 2HVIA 1JLCA 2MY8A 3D0GE 2FC8A 4H4KC 4N8OA 2FJBB 3I4PA 4ECSA 3IFEA 4M5JA 3ZNUA 3BQ2A 4URQU 4NXNJ 2WSEC 2WB4A 2XYGB 2R8KA 1E6YA 3D5MA 4BLGA 2I5JB 3DLBA 3HT3A 3K5PA 1RSCA 2ZUAA 4E8UA 2ILZA 4UZCA 4QCLA 3GIMA 3OXFA 1KOOA 4H4OB 4PXCA 3BKUA 3UR0A 2K06A 1HI1A 4RW6A 4HI1A 4O3QA 3KNAA 1V9OA 4DR6J 1AXQA 2J7KA 3FCVA 2AEJA 3TUJC 2VFSA 3TWZA 1JQGA 2BJ3A 4X66J 1S5ZA 3MEEB 3I56S 3DRYA 1PC5A 5DM7Q 3UR3C 1OY8A 3JSRA 2JZ5A 2VICA 3AHPA 4K0KJ 5FDLA 1RHJB 3HHNB 5E3AA 5E41A 4F25A 1JLEA 4I7FB 1AYEA 1OSDA 2YX1A 1WOSA 2I0XA 2PSZA 4K2JA 4WJBA 3KK1A 3K5OA 5SZTA 4JI8F 1YK9A 2PIIA 5CZXA 3M2UA 2F40A 4AFFA 1UP1A 5KFPA 5GMDA 1A0OB 4OHYA 3JTOA 1QSLA 3A3NB 3RYLA 3KJNB 4UQTA 2ZVIA 1S1TA 4TNOA 4PUOA 2L48A 4ETZA 2OTLS 1TKZB 1ZAWA 3DI6B 1EP4A 1IBKJ 2RAQA 3QLHB 2KT5A 2ZH9A 3FFIA 3W5ZA 3IWLA 3JYTB 3CCES 3M30A 2M88A 3RB0A 3RRHA 1ZTWA 3T3FA 2JDJA 4RU2A 3H90A 2FGCA 4L74A 3ZC4A 4YB6A 3MECB 1B0TA 4P9SA 4UY8T 3Q8VA 3MFHA 4FDFA 4DV3F 1QVFR 1DQ8A 1FRLA 1FKAF 4FBTA 2ZHAA 1Q81T 3CPWR 2BXJA 5KFSA 3PX4A 1U4BA 2R3VA 3IGNA 1IKWA 1U2RA 4W4MA 3GZ7A 2HBRB 3GSDA 3DFEA 1UMJA 1NK8A 2X7IA 1NPKA 5KFLA 3EGWB 3LQVA 4LVOP 1HARA 1LXNA 3LP0A 2YKMA 4LF7J 3K8VA 2W01A 3MEDA 4V19X 3MUMP 2V68A 2FY1A 4L3NA 1F6TA 3QSIA 1KC8T 3H2VE 4ZPTR 3P6YC 3TAMB 1NDCA 4ILMA 1RLCL 4HKQA 2RB7A 2B6AB 2FJVA 2ZOMA 1X5SA 1YBAA 4TYAA 3BQ1A 5KOWA 1VRUB 2FJWA 3LP2A 4ED4A 4CT8A 1G7CB 2MEWA 5GMEA 2YPZA 4A47A 2NSCA 3DRRA 2MKKA 2M52A 5IV4A 3UN2A 2IDLA 5F9LA 2YKPA 1WHXA 1DQAA 2LMIA 3ZZZA 3BSAA 3WQPA 2CRLA 3NNHA 1F2GA 2J9EA 4EUVA 4OJGA 2AF6A 4EWTA 2X1BA 3ENQA 1S6QA 5GMKa 1S6PA 2KN4A 5HMXA 2FPHX 4ZVUB 1KKHA 4IOBA 2V2QA 2OKQA 2HRUA 3TUIC 2B7CB 4X4PA 2HURA 4G1QB 2MKJA 2A2CA 4ECRA 1TQLA 3D67A 3VTIA 2CWKA 2V63A 4J9NA 1KVIA 4IFVA 4USTA 1UA0A 3ETOA 3RBEA 3PO4A 2B5JA 2Q66A 1NPRA 3Q8QB 3TR5A 3TZXA 2O3DA 1RTDA 2PD1A 4JI8J 3KLHB 4CO3A 5I42B 3L3CA 4KPCA 2OAUA 2DIVA 3HSZA 2N3OA 3DC2A 1HNWF 1TUGB 4TXSA 1YZ6A 2HPUA 2AJ1A 4YB7A 1VQLS 5B0BA 2VG7A 5ETMA 1T11A 4WZQA 3ILJA 2Y1LB 3M9MB 3HMJG 5JMNA 2NYHA 3B8HA 1X4EA 4DUZF 2PFFB 1T94A 3OR1B 2Z4PA 5BR8F 2DNZA 1RCOB 3MTKA 1RDRA 3D54A 5KAKA 3M2VA 3A13A 4OYWA 4C0HA 3K89A 2F3JA 1H0HB 3NXZA 1NSKL 3BSOA 2GQQA 2IA0A 1SL1A 1VRTB 4ED1A 2ASDA 3RAMA 4NLRA 3PKMA 2UVUA 4L3KA 3OL8A 3S7RA 2AYEA 1WKJA 2V9KA 2HAFA 4MK9A 3NOGA 4LF9J 3W66A 1CS4B 4WXOA 3BBFA 5IT9Y 4X4VA 1KFDA 4DF8A 1RAFB 4RW8A 1HPZB 4NMLA 3OTBA 1JXEA 3M8QB 3TAPA 2DITA 3ET6B 3CCSS 2VBYA 1QTMA 5HATA 4PG7A 1N5VA 1RA7A 5AE3A 1NDPA 2LA4A 4F04B 2V0NA 2ZZNA 5I3UA 4LF8F 4B9SA 4CLSA 2H51B 2UXBJ 2W2MP 4DR2F 4CZCA 4OFZA 1R31A 3F41A 1JNRB 2WTFA 2R7RA 1S76D 2IVMA 3VGVA 4PQUB 1SBRA 1K1QA 4WTYA 2XQCA 1ZOTA 4KHMA 5CYQB 1FT8A 3PVXA 3W2WA 2RQCA 4KO0A 3PX0A 3IBCB 1PCAA 4NLQA 4J9RA 1H7WA 1U25A 2P9EA 4DPTA 2ZZMA 3OT9A 2AV5A 1S1WB 1F5CA 2E9ZA 2YNFB 1T3NA 1UJ4A 1Y5IB 4OX9F 1T0TV 5CD4A 3QWUA 2HFZA 1HWLA 3HFZB 2HGLA 2ROEA 1FJ7A 5AT1B 2QJ3A 3A8IA 1VC6A 4ED7A 2V9WA 1LFWA 2HZCA 2QRRA 1W2IA 4WP9A 1IR2A 3GU0A 4B3TF 3WZ0A 3CD7A 1N36F 2HLUA 3FBEA 4AT1B 4JBCA 1RTHA 3MI7X 5ETLA 1SJRA 4QYZK 1VJWA 1XNRF 3B54A 3ENAA 5L1LA 5F9NA 2BOAA 1C2PA 2ZC4A 2VA3A 1U1RA 2GQCA 4MFBA 1HNWJ 1FTRA 3SSQA 3K58A 3SYZA 4F7VA 3KLGB 2NUUG 1FF2A 4AL6A 4Q0BB 4WZMA 3NCPA 4I1TA 3DOLB 2XLJA 1R8HA 3QRRA 3X1LB 4JB8B 2P5VA 3W9HA 4DL6A 4NYOA 2ZOGA 2F8HA 1L3KA 2DGXA 1XMQF 2EFNA 5BR8J 4WE1B 3OLBA 2A18A 3DGVA 2BABA 5F3TA 1PYSB 2CNNB 1QAJA 2BX6A 3LGMA 4A8MP 1SIZA 3NG8A 4NLVA 1C4CA 4I67A 2OELA 3PRVA 4FXDA 3MMBB 2C2NA 4A8XA 2MKYA 5J2MA 5T41A 3MTJA 1TK8A 4AYBD 1QTNB 2CIMA 1CJKA 2V50A 3IO1A 3I0RB 4P7VA 1NDKA 3Q8YA 2FY8A 2HEKA 5DDRC 5EWGA 3FNNA 3T1YF 3POTB 3OTOJ 3BREA 5E3QA 3PIOQ 2V8HA 2XMKA 4CLZA 4X64F 1RCXB 1KVKA 3LUYA 4K4SA 4O44B 2FDNA 1PG5B 2PE8A 1QAIA 4A8FA 4FS2A 5DG8A 4LF8J 1J5EJ 2PI5A 3FQLA 3M32B 2D74B 4RBVA 4PYDA 3D0HE 2V4JA 1ZAXA 5DQHA 2O66A 4EYHB 1P27B 4EK2A 4DV5J 4RW4A 2OD4A 2AJ4A 4YR0A 5L39A 5KFTA 3C15A 3TX0A 2H1YA 2ZE2B 2RS2A 2Z57B 1QE1B 5C24A 2CQGA 2J9DA 4UZBA 3EYZA 2MZ1A 3KK3A 2DGQA 4I64A 4X4UA 1RWVB 4O0NA 2ATCB 2H48B 2R8HA 2MQPA 2FVPA 1S49A 3DRPB 4DL7A 3CTRA 1CJUA 1FA0A 3NS5A 4LF4F 3KHRA 4KGMA 5LSOA 1RXOB 3IXQA 1YIJS 4ZP9A 2HS0A 3MDFA 3AODA 3TI0A 1RAIB 3T9ZA 4J9LA 1ICEB 4QWEA 4F4WA 1UA1A 5LXRA 3R5CA 1N36J 3OW2R 4F67A 4DXLA 4OMFG 1S99A 2OSRA 4CO2A 2GO8A 2MGZB 3VVTA 1FWPA 4M95A 2CQ1A 4V1Ak 1SUQB 1A9NB 1Y4ZB 1VIXA 1NAQA 2XHCA 1HYSB 3B4MA 3VAMA 2MQQA 3DLKB 3T1HF 2E9RX 2DY1A 1BY9A 4RO0A 3LP1A 3HPOA 4LF6F 5A8RB 2BANA 4MKAA 1RYSA 1FJGF 2V6AA 2FC9A 2W4CA 2UUCF 1NKCA 4R0EA 3OV7A 1RBAA 1HW9A 5EX0A 1JNZB 2CJBA 1VQ8S 3HVWA 3QT6A 4C6AA 2JSXA 4MT1A 3MPVA 4QIFA 2YWKA 1R27B 4ZS6A 3BGUA 3NEKA 4DL3A 1SI9A 1FRJA 2IVYA 1V6HA 3ILOA 5CCLA 2GMLA 5E0OA 5KFHA 3DRSB 1Q0NA 4KC5A 4B9NA 2FJXA 1L3TA 4ZVSB 4EBEA 1D8YA 2C22A 3H59A 2VG6A 3RG6A 2BW2A 3QWPA 2WOMB 4YDXA 5ETOA 1KFSA 4ID5A 5BJRA 1N4LA 3MEKA 2ACYA 3IBFB 3Q2SC 2HHQA 4AQYJ 3T1YJ 5KTQA 3QBCA 3GG0A 4X64J 1TR0A 3HSGA 2OO4A 2OMOA 3R7NB 1NCLA 1RAJA 4RKUC 2CPEA 2MMYA 2WK4A 2VD3A 2ZWPA 3UD4P 1FDDA 4JI3J 3O6QA 2ALZA 1JIHA 2RF2B 3IM9A 2DNGA 3LAMA 3CMAS 2QA1A 5JVHQ 1OY6A 2B8PA 2ZHOA 1RT7B 4UQGA 3J80Y 3PYGA 1NZAA 3GWCA 4USJC 3KG1A 8AT1B 1AFJA 3DHXA 3QJLA 1HL6A 4PPZA 5KFRA 3VAFA 4EZ9A 2YNIB 5D15A 4HI2A 2WONA 1DTTA 2CZ4A 3DN9A 2FHJA 2HNDB 3W64A 2XY6A 5CZVA 5IT4A 4YY3F 2E7WA 4DOZA 3G6XA 3SQGA 5BYRA 2H4YB 3FBBA 3TVKA 1XBWA 4WK1A 5SUHA 3DDKA 4HL9A 4NLOA 5L9XA 4I2PB 4IG0A 4ELVA 3QJPA 1H7XA 5JJBA 2F4VJ 4XIUA 2VFRA 1IJEB 3PR5B 1VISA 2E1MC 3R7BB 1FE4A 8RUCA 1XR5A 1L3SA 1ZA1B 3ITHB 4C8OA 1FKPA 1IWGA 4J5OA 2FQQB 3MM6A 4LF6J 1SQGA 2ZBRA 2JLGA 4DV4F 2CQHA 4R8UA 1TL4A 4CM2A 4WP8A 2MKSA 2UUCJ 2CQCA 3N28A 3CC4S 5KT5A 4EMDA 3R6GB 2A6OA 4DS5A 4QWCA 4ES1A 5LSRA 3R9LA 3H2LA 2HVEA 3JSBA 2LEAA 2G2ZA 1IVZA 1HBOA 4L75A 3TA2A 1ULRA 3RBDA 3G6ES 4FS1A 4R5PA 1HBNB 5MLCV 4ALZA 2JC1A 1XERA 4P75A 4KV8A 5AJ3J 4DR4F 4KKOB 4BC9A 1X4HA 4DPUA 1WTBA 3DM2B 3MUVP 1N8RT 3TZZA 5F8JA 1QUVA 3IR6B 2DGWA 2YH0A 3KXDA 3CDBA 2R2RA 2GHVC 4RZRA 2RJZA 5JXSA 4EFAC 2KH9A 3H4DA 1X5OA 3AXMA 4I69A 1VJQA 3AH6A 2VPYB 3GFYA 2V2ZA 2J6UA 1FWKA 2KG0A 2HFSA 2LQJA 2AQ4A 4P2SA 3MXHP 1SQFA 1R8CA 3CJ2A 1GH8A 3CDUA 3OR2A 3FEXB 2AYMA 3QRQA 2MY7A 3TYTA 4LSNA 5A8KA 2N7CA 3D1OA 4M63A 5IXUA 1QM9A 2UXDJ 4DV7J 4DV0J 2AGPA 3MEGA 4UOCA 4B3OA 1VLOA 2XM3A 4RW6B 5AE1A 5KFIA 2VQFJ 5E2QA 2NLWA 2ZM6F 2ZZTA 1UW4A 1PO6A 2GIFA 5KFDA 1S0NA 4J9MA 2RUSA 3VF0B 2BOPA 1OWXA 1WG1A 2E7XA 1M5OC 2R7OA 4KRWA 4DPXA 4YY3J 5B0FA 1NJXA 2FB0A 2ZH7A 1JLEB 3L4BC 1U8WA 5AXMA 2UZAA 4NA1A 2VPZB 1Y3JA 3KK1B 4TY8A 1SKUB 3GP9A 3M2UB 4UY85 1RWMB 5D0RA 3H5XA 1RHUB 1N5YA 2DKOB 3KJQB 3D68A 2DHGA 1TV6A 3C16A 4UOGA 1S1TB 2C2DA 2B56A 3QPIA 3CIMA 4PUOB 4UOHA 3MCMA 3NMRA 1EP4B 4TYBA 4JV5F 4LF5F 1WKKA 2DCUB 3FFIB 3BYRA 1RBOB 4LFAJ 3SMZA 2BR0A 4WYLA 2P6TA 2VIHA 1WC1A 2RQKA 4ED6A 5HL7Q 5E3RA 4ZP6A 4QPTA 4LSLA 5G0RA 3EVMA 3UD3P 1FDBA 3G96A 1LQ9A 3RB3A 4KHPJ 5KG0A 2KJWA 2VBWA 2QA4G 1FFWB 1P9QC 3HVAA 5K20B 4B02A 5CYJA 2E29A 4ZVQB 2DR7A 1DAXA 4U8VA 4EO8A 2D3ZA 3EICA 3EE3A 1MROB 1UTAA 3U27A 1IKWB 4TU8A 2BRLA 4ITSA 1U47A 4U67Q 4OZNA 4Z2XA 1S12A 2J7UA 2N4DA 2VG5A 2QTWA 2AWZA 4QPXA 1Z4UA 2N7YA 3SDEA 1F3VA 3G4SS 5KFEA 1DQ9A 2BEFA 1YJUA 5D77A 3BS9A 1VFJA 3ISZA 1CULA 4WK3A 3M9NB 4OZJA 1S1VA 3LP0B 2YKMB 2YPYA 4XO0A 3AD9C 1HWJA 5A0YA 3MEDB 2V5HG 2RT3A 4OYZA 4DUYF 5KFNA 1VYAA 2MZSA 3JQKA 2W8LA 4JUZA 8ATCB 1TK5A 4JV1A 3KLFB 4C0OC 2AEMA 4U6PA 3KDOA 3RRKA 1NK4A 2BE2B 4ZPDA 5KFMA 5L1KA 2JLEA 3C46A 4OI1A 3LP2B 3ELHA 2NR0A 1OPIA 2K1RA 2XZTB 3BF4A 3HJVA 2AT1B 4KH1B 1YI2S 3N79A 3M6VA 2HK2A 1WWHA 3I31A 3OJSA 3UDCA 1GTEA 3DRRB 4KGZB 4M1KA 1F60B 4IR1A 4Q5VA 2ADCA 3UCZP 4Y2IA 2PO4A 1F9FA 1JLAA 2CXEA 1CPZA 1CC7A 3FQKA 1S6QB 4RNNA 1IBLF 1UFLA 4LFBF 3WDOA 1VQ5S 3BSNA 4F3MA 3R6LB 2QFIA 2O1PA 4X4OA 3DOMA 1CJTA 1L3VA 1BLUA 3QGHA 2VB6A 1WUUA 1VR6A 4I6WA 2HQFA 1U6ZA 3FMBA 4DL2A 1RT2A 1PKUA 2B5JB 4Y34A 3G8SA 1RTDB 2RU9A 4M5HA 1ZPVA 4IQMA 3C6TA 3QIDA 2R8JA 3FDSA 3CJ0A 2ZUGA 4NLGA 4ZPCA 2VG7B 4UT4A 1JLQA 3DRXA 4K5RA 2YTCA 4DUTA 2U2FA 1WEYA 1SJ3P 3TRGA 2M9KA 4ETXA 4QYZJ 4O4GA 4LUBA 1MMDA 1M1HA 2D3O1 2CJKA 2DD8S 2Y9HA 4PWWA 1Y5LB 2XLIA 5DGBA 2C2EA 2IYGA 2JRSA 3WX4A 4NI2A 4Z7CA 5GADU 1T9WA 2FYXA 2Y1IA 5K9FA 5LMNF 1RI7A 2EC2A 2OPPA 4O3RA 4A8QA 4OI0A 1B4SA 4M5IA 2XNQA 3M2RA 3PKYA 1C0UA 4O3PA 1JLBA 5BXIA 1SH3A 2R7VA 4IO1A 4C8MA 4TQSA 2DO0A 3NCQA 1AUSL 2PEBA 3CD5A 2WAQD 2N3LA 4RW8B 2M5YA 2JX2A 5KFCA 2ZWOA 3OQ2A 4CO1A 5B0AA 2CQPA 1UZHA 4KE5A 4WF9Q 1EZZB 2IRUA 3SQOP 3ZO7A 2P9CA 3G9CA 1GX6A 2QX0A 4MKYA 2Z2ZA 3IR7B 5I3UB 2IRYA 4EI2A 2M8DB 4JI0J 3HM9A 2DNLA 1VQ9S 2F65A 1Q8LA 5I3QA 5AE2A 3KUGA 4IUFA 3GIRA 2V4RA 1S9GA 3BO4A 5F0WA 4K4ZA 2GNKA 1R8BA 1RADB 3OSNA 4OZ2A 2YX4A 3LPYA 4DG1A 2QA2A 3GJSB 4FN5A 4DFMA 4WIIA 3T6BA 9RUBA 2VHGA 4LF2A 5DM6Q 3W2WB 4JI1F 1JJ2R 1GMWD 4P72A 1OO0B 2J8SA 1C1CA 4UUXA 1SJ4P 4M5DA 2ATLA 2GVZA 1D1UA 3MMAB 2R8GA 2Q3PA 1M5KC 4ZCLA 2C3UA 1IKYA 4HYKA 3D7SB 2JJ4D 3QZ7A 2O5DA 1U2CA 2EPIA 2BQRA 4ZVOB 1O6XA 3QYYA 1LWEA 1UJ6A 4ANEA 4R0JA 2DK2A 5F8HA 4HT7A 5D8HB 1Q86T 2R7SA 2AW0A 3NS7B 3H5UA 3KLVA 3M1VA 2LXIA 2DJWA 1HR0J 2H5IB 2WCXA 4F0HA 1Y10A 4F0MA 2ZH6A 2EK6A 3IRXB 4Q2MA 1UWBA 3R27A 5GADI 4Z37A 3QZ8A 2FVRA 2A3JA 3QT5A 1HD0A 4MFBB 4ZJOA 4DSEA 1X0FA 4WWSA 1XC9A 4WU2A 3ZZRA 1EQ0A 3H25A 2J6SA 3M8WA 2WBMA 4C8YA 1N34F 2XZDB 3GILA 3GB0A 3RBXA 2HHTA 2MQOA 3FEZA 3OHAA 3W9JA 4CIOA 2VA2A 1HMVA 3CWJA 3SCJE 3V4IA 2Q79A 1RT6A 1UEVA 1FRMA 3OXLA 5CH7B 2HWIA 2EW9A 2ERRA 2QYCA 1K0VA 1YJ7A 4WFYA 3D28A 1NPPA 4N47A 4B3RF 1ZS6A 7FD1A 4DL4A 3TZYA 3TO8A 4KT0C 1RT4A 1B7YB 2KT2A 1S0OA 2RUGA 3T5HA 1T9YA 5J2MB 1GNKA 5DS7A 2F63A 1Y00A 3G82A 4B3SF 4DV6J 4C11A 4DR3F 3C66A 3RAQA 2E5IA 3Q24A 1IJFB 2RDJA 2JVRA 2NQPA 3CCJS 2CQIA 1YWXA 3GSIA 4DDFA 3HZEA 2DR5A 2RHSB 1X31C 3KLIA 4ZP7A 2KXFA 4D3HA 3PNIA 3LGHA 1R0CB 3N6MA 2YWEA 4ZPWR 4GVLA 1RTJA 2GHPA 4ZN1A 4Y2AA 1N32J 2V4JB 3JTPA 4ZCKA 2XMMA 3B4DA 2NYIA 1TZ0A 5B0DA 2GW8A 2G2OA 3I96A 4DZ6A 1NH7A 2FLOA 1Q1KA 4U8YA 4OIXA 4CO4A 2QLFB 3R5DA 4RW4B 1SQEA 2DGVA 2ZEJA 5EX3A 2MXYA 2BVZA 4NLWA 2WW8A 5C24B 4WFNQ 5M2RA 4DV2J 4FF3A 3KK3B 2MKCA 5B0CA 4YHHF 1S4FA 1TKTB 2NZCA 1WHYA 3OLAA 4Q8FA 5L38A 3AFGA 1CJUB 1WSRA 1KRPA 1SJ1A 1RAEB 2ALYB 4BHQA 1BQMB 4K4VA 3DDNA 3U02A 1H2UX 2IAJA 2R2SA 3AT1B 2BRKA 1KQKA 4OI3A 4JI2J 3NL0A 3PCOB 2X51A 1FNMA 4XDDA 3CCRS 3DMJA 2YKQA 3PYFA 1FI4A 1ZM4A 4DZDA 2XEXA 1Q8BA 1XMBA 2G0JA 4OYOA 3SZ2A 3LP1B 3CE8A 2XC9A 3L9ZA 3UNGC 1S57A 4K5SA 2BANB 4RUAA 4U7UD 5K8OA 1WC3A 5LL6d 2DGUA 4ED5A 1WOPA 1U24A 3ZXWA 4DR1J 3UPFA 3KJVA 3BGOP 3G86A 1GXUA 3GV5B 1U6BA 3VAHA 1I94F 2KB2A 1UEKA 2XG8A 1RWNB 1IQZA 3UE2A 2HMIB 2CAJA 3QO9A 5IT0A 2I1RA 3DCAA 1T7PA 2FUG9 1D3WA 1C4AA 1UETA 2GO9A 4IKAA 1XEZA 4Q7AA 2J0WA 5DGAA 3MURP 1RA6A 4AXJA 3CJTA 1GX5A 4QZVB 1K0TA 3VGSA 2KRRA 3NWRA 2ACMA 3ZTQA 2VG6B 4L6V3 4DR3J 2Z2MA 2WVBA 1FKOA 5B08A 3M4XA 1E6VA 4X4TA 1N33J 5B0GA 2YKNB 2RKIA 3W2VA 4YS2A 5J2NA 2I9SA 2QSFA 4LR8A 2W7AA 3GQCA 1M5VC 3CCLS 1R3NA 3K7RA 2B9EA 4BCAA 4ENOA 5T7LA 3R5GA 3W5YA 4TU9A 1R0BG 2HLTA 4GKJF 1JXLA 4K4TA 1IUJA 4RR5A 2H54B 2RDIA 3HHLA 2OEJA 3CW2C 1D0EA 3ZTOA 2GMJA 2HGMA 3CNQP 2UP1A 2G4BA 3TAQA 2BJ9A 2KYZA 1S1UA 2K3KA 4AL5A 4OL8A 4RX6A 1NM2A 1TL3B 4YHHJ 3ZTSA 3MM8A 5KG5A 2HHXA 1DTTB 3BN4A 1HD1A 3QNWB 2NXEA 1AZSB 2VQEF 1XNQJ 2CG8A 3BEGB 5A2QU 3SQGB 2VUGA 4ZVHA 2DH8A 1Y0HA 3CCQS 2ZH3A 3HK2A 4P2XA 2CFXA 2AX1A 4IG0B 3ULHA 1IBMJ 1F5AA 2IYIA 1X4FA 3PG9A 4CRJA 3VZHA 4FF4A 3BM7A 2AJ2A 2BKNA 1IXKA 3AQOA 4H4KA 3TVZA 4MIBA 4OZLA 2BQUA 3KDNA 4PRFA 3GCXP 4F3QA 3MAQA 4ECTA 3EGVA 5HSPA 4PQAA 4CLTA 2XCAA 3RAXA 1R8PA 4M5GA 3MM6B 1FRKA 5I3PA 2B3TB 2UVVA 4OV1A 4QU6A 1WF1A 4R8UB 1RWXB 3KNGA 2CA9A 1TFWA 2GGPB 4NCGA 5A6WA 2ZHBA 3FRZA 3R97A 5F8MA 3RB6A 4DR5F 2Q6BA 5LSLA 2C3YA 1IKXB 4LFCJ 3UVJA 2CJYB 2R7UA 1HNZJ 4OX6A 4HH1A 2N82B 3H42A 1S10A 1X9SA 1NK7A 3PYEA 3D4JA 2QL7B 3PXGa 3KOAA 2QL9B 5KFFA 4HDHA 1OQ3A 4KV8B 1RTIA 1GTHA 2HVZA 4AE5A 2GJIA 4DPOA 3OBIA 2JEIA 3PW4A 3T19A 3CCWA 2HS4A 1YBUA 3FSYA 2RHQB 4TQRA 5LXYA 1TELA 2HFUA 3OPKA 2HFOA 3BH6B 1DURA 3NMAA 5FJ4A 1R6YA 2NS1B 1XMOF 4F0KA 1CJVA 1ZTTA 1Q7YT 3KG0A 5HQ8A 1TKXA 4GKJJ 2FHOB 1P6TA 2KFYA 2IDEA 3KLEA 1G6BA 4CLUA 2KVIA 2DXDA 2IM2A 5ETSA 2V8PA 3H40A 3R7SB 3OR2B 2XGQA 3ETMA 1T03A 1GAOA 4OHXA 2C3OA 4LSNB 3BGFA 5A8KB 3PHTA 2QT7A 1UEUA 2NXUA 3HSJA 4C3KA 1SIWB 4B3OB 2B4PA 2MPUA 4ZVFA 5I4MA 3D66A 5KFYA 2XMVA 3HO1A 2HHUA 1L5UA 1FJCA 1HA1A 5D4NA 1S72S 2DXFA 1DZ5A 3KUEA 2KO1A 4LIWA 1UAWA 3HZGA 2EFOA 4OLOA 4JI4J 5KOXA 3ISND 1VQSA 1JMTA 1OPZA 3W5XA 2EVZA 4ELUA 4A8OA 1TP7A 4H4OA 4EEYA 2ZH4A 2VJUA 1SXLA 3O8WA 4QIWD 4TY8B 2NPFA 2W2OP 3V2UC 1TVRB 1BHNA 2NXCA 3GJQB 3HKWA 1U1OA 1N5YB 4NLSA 2AKWB 3GJTB 4IRKA 1CG2A 4OHWA 1TV6B 3C16B 3MM9B 4C3LA 2YNGA 1QDUB 1G2EA 2DCLA 1NBEB 2J9CA 1RT1A 3MUTP 1LW2A 1FJEB 2L3MA 2WB1D 4I7FA 4K2XA 2PDAA 4N8NA 2COLA 3P5BP 2VZ9A 5HMWA 2CQDA 5D0GA 4I6AA 3EZUA 4NZ0A 1ROFA 2DHXA 4LSLB 5G0RB 4DEZA 3V4MA 1HBUA 2HRTA 3DGPB 2XMWA 2FGOA 2X1AA 5L1JA 1JLGA 1NDLA 3HHLD 4OJ3A 2PEHA 3M7VA 5HQLA 3NAHA 3OL9A 4PG4A 2EI5A 3TANA 2XMAA 1NK6A 3V5RA 4CH1A 2VG5B 2DH9A 1U0SA 2QLBB 2MZJA 5C25A 5ETPA 1RLDA 3SDEB 1GT8A 4OJ1A 3MMCA 5CXTA 4K4XA 2HQGA 4RNMA 3SBMA 1CULB 2XYPB 1X5PA 2UV8G 1KVJA 2HVDA 2VU5A 1S1VB 3AOCA 3AAWB 1QAYA 4GO5X 4DSFA 2CQ0A 1DLOA 4PG6A 4Z7YA 5A0YB 2J8AA 3ZTRA 3CULA 2F8EX 3T41A 2CQ3A 1OMSA 3H98A 1NB7A 4N7TA 1HBMB 2JH3A 3I32A 1U8SA 4HHHA 3J81U 2ZJRQ 2HQDA 2W7PA 4ECZA 1WHWA 3KK2B 2LA6A 4PWDA 1DHMA 3SFUA 2K1RB 2CNOB 4MK8A 4IRCA 2GHWA 4E2FB 4X65F 1YDLA 4GKKJ 1PJ5A 1U1MA 1OY9A 1Q16B 1KS2A 1YBTA 1JLAB 2E44A 4OX7A 1N6QB 2YNHA 1LKZA 3L7PA 2H4WB 1BWVA 3C19A 3TAMA 1MMLA 4U9RA 5M2PA 2W2NP 5E5NA 1CVJA 2VBZA 2E5HA 3RZAA 3BJYA 1WJ9A 3DOMB 1CJTB 4EO6A 3HT0A 3MMJA 3KJFB 2MKIA 3W60A 5DG9A 3IWNC 1PSDA 1TL1A 5D6GA 1H6KX 1RT2B 4C8LA 2MLYA 1T9XA 2L9NA 4C7QA 4Q8EA 3E8OA 3Q8UA 2L08A 1LWFA 3GV7B 3C6TB 4MKVA 1PJ6A 4ZPVR 3WHIA 4JI5F 4OJHA 2PA3A 1HFEL 1JLQB 2AHOB 1YG0A 1AUDA 1TL7A 2UXCF 5H1SV 3M6WA 4O4GB 1P9YA 2DRBA 1GFWB 2HBYB 2FZCB 3I87A 3IAM9 1QLNA 3NGRA 4DV1F 1XN9A 2RVJA 2OTJS 4X84A 4IOAQ 1KSPA 3HVRA 3QAUA 2VF3A 4PZVA 3BPSP 1NUEA 2C2RA 2BJ7A 1SC1B 4DCPB 3BR9A 2KHDA 2C1EB 4I56A 1SKRA 1BQNB 1Q8IA 1U49A 1X4AA 5ETTA 2E5JA 2QLJB 1JXVA 4J9QA 2OPPB 5HMYA 5D78A 3NGUA 4B9VA 1RJJA 4WKYA 1C1BB 2YY3A 3S6EA 1C0UB 3N5FA 3PW2A 3T6JA 5L9NA 4X4NA 1I6JA 3VALA 4DQPA 4FPIA 3WC2A 4QIVA 4OYPA 5D0EA 4QJVA 2DNOA 1VGYA 4DHVA 4DFKA 4ZLPA 3SV3A 3BDPA 4IG3B 1WEXA 5EN1A 2RILA 2B7BB 5FLXU 2KDOA 1S9GB 3MR7A 1REVB 4FKXA 2BMBA 2XO7A 2H9ZA 1BWEA 2VASA 2JL9A 4A8KA 4DG1B 4OX8A 2MLXA 2J76E 1LEOA 4USUA 5EWFA 5K8MA 3L7OA 2ZD1A 3CGIA 1SVDA 3TZWA 2B0GA 2HIQA 5HK4A 4TVAB 3P8BB 4M5DB 4F50A 3P96A 1S1XB 1Z2LA 5ETKA 1IKYB 2YBVA 2JHEA 4B9TA 5LMUF 3VQSA 4C98A 3R1HA 4DX7A 3J7AN 1MN7A 5DO2A 1LWXA 4CQ1A 4ZLJA 1Y7PA 2O67A 5IQQA 4O3NA 3M1VB 3IMQJ 4B17A 2HVHA 4OI6A 1XR6A 3EDRB 1YJ9S 1SKWA 3DLHA 2C2KB 2D3OR 1YRTA 1H72C 2W8KA 2DGOA 4G3IA 4HVZA 4W90B 3CJQA 3TQ1A 4CCHA 1KN6A 2CYYA 2DNMA 1P8GA 3VZIA 1U1KA 3EMTA 2KJVA 2W7OA 4QIEA 1S1WA 2LYVA 4C97A 4ECVA 3BDEA 1HMVB 4CO5A 4FYWB 3V4IB 3LA0A 1K1SA 1RT6B 3WIUA 4HHJA 4NLXA 4DV3J 5J1EA 1VQNS 4WFBQ 1V3RA 2BM0A 2K8GA 4DQQA 3CCMS 3OD2A 1VK8A 1Q5YA 5HANA 2YWWA 4K50A 3EVWA 2VH7A 4NXMF 5IM0A 4P10A 3Q8RB 3KLGA 2CPJA 2AMCB 1EKRA 1Q7LB 2AIRB 2V8VA 1RT4B 5KT4A 2BKOA 3T5LA 4DR7F 2QSWA 4KJIA 5DQGA 2FVCA 1H38A 4OV6A 5H9FJ 3LANA 3V6JA 2DNPA 3TNVA 1YRXA 5F3ZA 4C11B 4MMOA 1AW0A 1FD8A 2E5GA 3PR4A 9ATCB 4PPDA 3RUBL 3KMSA 3D3BJ 4FF2A 1CBKA 3KLIB 2YX7A 3MMBA 1YGYA 1G3OA 3PJWA 5AXKA 1RISA 2QGFB 1RTJB 2XS7A 2C2MB 2G1HA 1B0PA 3HHKA 3RU0A 4MAKA 4UTGA 2E66A 1RU2A 1SH0A 3CJ8A 4LRBA 5B0EA 1PBAA 2UU9F 1IN0A 4HACA 4C9DA 1N5SA 2IIHA 4ZKAA 2VDHA 1NEEA 3TA0A 3POTA 1ZETA 2DEIA 1FX2A 3HF5A 4IQXA 2XYHB 4URGA 3PIPQ 3PZPA 2KU7A 4O44A 1XK8A 3R5BA 5T14A 2GJ2A 1AB8A 1KQGB 2AD9A 3M32A 5DJBA 2I38A 2MQ8A 2ZJQQ 2MHEA 2XS2A 1DJ0A 1M1KT 1DRZA 5G4DA 1RTZA 2OI2A 3VV2B 3FZ2A 5HLFA 1N54B 5KFVA 3CCTA 3PRDA 4F4ZA 3DYAB 1SCJB 3I0SA 3ILIA 5HO4A 2BJEA 4KYZA 1QE1A 4ED2A 3SIPB 1IR1A 1Z1ZA 2VONA 2U1AA 2VOOA 2CJXB 5KT2A 2L9DA 3QMQA 3FBFA 4A48A 4HEA9 4C8KA 2LQBA 3G6YA 4DUZJ 2POKA 2ZOFA 3CJ3A 2UVWA 1MU2A 3VGTA 3VWSA 3S1TA 2IBKA 3OVBA 3MOJB 1ZM9A 3KHLA 4CO0A 2IM1A 1F2HA 1HQEA 3NOCA 3Q0AA 1ZZNA 5HJXA 1VC5A 2VKRA 1RAGB 1HNVA 7AT1B 3QO9B 2HZAA 1RBLA 4ZP8A 4IRDA 1UFKA 3R5AA 4NLUA 5LJ5Y 5CAAA 1I5OB 2PMZD 4WU3A 4YDDB 2HHPA 4MIAA 2KZZA 3BZQA 3G8TA 5H9EJ 5CYMA 1SL2A 3LWMA 2IJFA 1KLMB 2YVSA 3ZNJ1 4DX8H 1UKUA 4DU8A 1JKHA 2DY9A 2CNLB 2GS8A 3EM1A 1C0TA 3CMQA 3GE9A 1T3OA 4F4XA 5KFGA 2R7WA 1T9VA 1Q79A 4ER8A 1S7IA 1FKOB 4OYMA 5EHHA 4DQRA 1E6VB 4GC6A 1D9DA 1VQKS 3DLLQ 2RKIB 2XCPA 2CPYA 4DR2J 5IFMA 2FVQA 1HWKA 4L76A 3MAAA 4GC7A 2UVRA 3V6DA 3P3DA 3S8SA 1N0VC 1R7IA 3DNCA 5T7LB 1DBDA 5AXLA 1HHTP 1VDHA 2Z2LA 2RD5C 3PJXA 3K59A 2R7TA 5KFUA 1RAHB 3A1YG 3HHLB 3PW5A 2KVQE 1FNXH 2CG4A 1GXTA 2OH2A 4O4RA 2YXLA 3HHDA 3K5MA 2CVIA 1FVQA 4IH7A 3C6UB 1S1UB 5HROA 1DARA 1X4BA 5E3PA 2RNEA 4M8LA 1FESA 4OX9J 3MM8B 2ROGA 4JV2A 4NXNF 2E1RA 1F9HA 3VAKA 1VBZA 1Z2ZA 3NGSA 4LRAA 3BN7A 4P71A 5KFZA 4AXIA 1XQIA 4XDCA 1ZM3A 4KSEB 4B3TJ 1EARA 4NLDA 2RIJA 3HDSA 3MF5A 1S97A 1XNRJ 3GYGA 3HULA 3JQMA 4F8RA 4LJMA 1FXLA 4NX9A 2PGCA 1A7GE 4PKDB 4FYVB 3OSPA 4XAKA 3SXLA 4DR6F 3HX9A 3NBPB 1GXLA 4BWMA 3FRYA 3MD1A 3ISNC 4RW9A 4J9UE 2YNIA 3D6HB 4X66F 4HH0A 1D09B 2RSQA 4CP5A 2IC3A 3GLJA 4EU0A 1XMQJ 4CLLA 4OZ0A 4K0KF 1WC5A 4QQBA 1VBKA 4RPFA 2OD6A 1T8EA 3L95X 3PTWA 4NCGB 1PC4A 5GAGU 1U09A 1J5OA 1OQ6A 2CQBA 4UUWA 3UVJB 4C0BA 1B64A 4FXWA 3HFKA 3NKYA 2Q43A 2IM0A 5KFWA 3Q8SB 5J2PA 4YR2A 4AL7A 2DB1A 2OUGA 4P6QA 2WVDA 4LQ3A 3UN5A 3EGZA 3QQCD 3R2CJ 4ZVGA 4LQ9A 2LU2A 1IKVA 2J0XA 3L09A 3T5JA 3NS6A 1RTIB 1WELA 2MZQA 3FCWA 1SH2A 3DLGB 3K17A 3N6NA 3BQ0A 3HHLC 4QR2A 1KP6A 3LW5C 4F2RA 3KHGA 1PYTA 2FLNA 1EQMA 3GR1A 4DU7A 1BMQB 4M5MA 1SC3B 3OL7A 2KFNA 3Q89A 1L3UA 2QYGA 2XGPA 1N5QA 2LECA 1BGXT 2AJQA 2DTJA 1FDAA 1SKSA 1HWUA 4M5NA 2IBOA 1U1LA 2B9XA 1TKXB 3NNAA 4P52A 4KKOA 2DO4A 2F4FA 3UQSA 2ZBCA 4Y00A 3GCWP 1I1GA 3NRBA 4Y65A 5HP1A 1A6LA 2ASJA 2R7XA 4LF7F 1JJCB 2JNJA 3C14A 1S6OA 2BA9A 4XTTA 2AJ0A 4LBIA 3IS9A 1APSA 4UW2A 3FCHA 4LF4J 2V94A 1EJ7L 5CABA 3HVTA 1CEZA 5CCMA 1UCNA 4NWBA 2V8GA 3FMWA 2AYBA 2DHSA 3TJ9A 2C2OB 3GFXA 4DSJA 1LW0A 4KFBA 1T05B 2XTJP 3O5TB 1FEHA 2DEJA 2OFHX 1JB0C 5GAGI 3AB4B 5IQ6A 3W62A 3NNCA 5DZ7A 4KQZA 4XK8C 1MSWD 3W3SA 3W63A 5A8WA 3GIKA 3T1HJ 5DDOC 2LQ9A 4BS2A 1SC6A 5A2QY 1FRIA 3AD8C 1Q78A 5DETA 2R4FA 1FJGJ 2WVFA 3FK4A 4Y6IA 3E01B 2YNGB 4J9OA 3CJKB 1W26A 1NJIT 4IO9Q 1RT1B 3M8PA 1LW2B 4ELTA 2FTRA 4LRFA 1P1LA 2HHSA 2QMXA 1ZA2B 3I6PA 3FSXA 3TUPA 3N01A 1GK8A 4RNFA 3IN5A 2DNHA 4NMXA 3OVSA 3UCUP 1SJFA 2FJEB 1NSPA 2HHVA 4N56A 2ZNYA 3F0NA 3ZZ0A 3EXCX 4GRSA 3IP0A 2G0CA 4HT5A 1HBUB 5DZ6A 4CLPA 2P8IA 5CHCB 3V81A 3UFCX 3GMGA 1X0PA 2XS5A 3W1YC 1JLGB 2FVSA 2J5AA 4TLRA 2HHHF 1JLFB 1RWUA 2KFZA 3I5BA 1VLYA 2XY7A 2J6TA 3OTDA 5D3GA 2C28A 1DY3A 2OEMA 4OZ3A 4I4BA 1NKEA 3BBCA 3MPDA 2W9CA 3IGVA 2XY5A 4K4UA 2ILYA 5A6PA 5C25B 1HLWA 5E33A 5D4LA 3MMCB 3N5BA 2Y8YA 4EYIB 4HLBA 1JLCB 4DSLA 4B3MF 2BV3A 1M1GA 1LK7A 4QW8A 1DLOB 1F5BA 2ZC3A 2F1FA 2XSJA 1UJ5A 2HWHA 4ZCMA 3I5CA 4BDPA 4ZVPB 2CPFA 4L73A 1MROA 5CD4H 1NH8A 1E6YB 1VRQC 4LF9F 2M8HA 1UPPA 3EXYA 3PFOA 2BDPA 4PWDB 5B09A 5KG4A 4ZVRB 2HW3A 1EHWA 1X9WA 3HCXA 5DG7A 4BC7A 3O2IA 2KZMA 1NO8A 3GJRB 1K73T 4NRTA 2EG2A 2UXBF 1JJ4A 2YNHB 1N52B 3OFHA 3KLFA 1YRUA 3G6VA 2QN6B 5FDLB 2CADA 1LFPA 2BE2A 2BYCA 3MAHA 1ZM2A 3KFWX 3U7JA 1KTVA 4QBUA 4DWIA 4YUDA 1FD2A 3A12A 4USKA 3HD2A 1TL1B 1NNDA 5LT5A 3BSCA 3TW0A 1HNXF 3GFZA 2X1GA 4MKBA 1F9EB 4NCAA 1NXIA 5D4OA 1LWFB 4CWBA 1O51A 1WSVA 4IDKA 1WF2A 4DV4J 2D9PA 5C42A 4DI6A 4Q44A 3U1MA 3M30B 2AJFE 2B4VA 2IPOB 1ZAVA 3QATA 1TL7B 2ZDPA 4ZIWA 1NSAA 1URNA 3NGDA 2GJFA 3AJ1A 4K4YA 2QV6A 4O0IA 1B7FA 1WTFA 3OFGA 2J7WA 2B8QA 2DPIA 4JP8A 2CDQA 1BE4A 4ERDA 4ATNA 1S48A 3LAKA 4FBUA 1T9UA 3P49B 5IOLA 1RKJA 1NMEB 4DR4J 4PABA 2HHHJ 3CO0P 3M8YA 4J9PA 2C2ZB 4ZPBA 1UL3A 1YSJA 4YMEA 3MM7A 1RHMB 4QWDA 4PWUA 2JFDA 2NXJA 3N4WA 1RACB 2PFDA 3WC0A 2A6MA 3TOQA 2FHJD 2HBQB 4JV0A 2CWXA 2HRYA 2QZ8A 1HI0P 1ZZFA 4A8SA 4B3MJ 5L8RC 3O44A 1UVIA 3Q86A 2LEPA 1FK9A 5LOQA 5GAHU 1JWWA 3H5YA 2EFGA 4QWAA 1K44A 3LTOA 5IC4B 4GO7X 2HGNA 2K7JA 1FTCA 2Y8WA 2DNQA 1RQ0A 4IH6A 1PBUA 4FYDA 1LXJA 1RT3A 2O01C 4CLYA 4N76A 4ZOSA 3TA1A 1YHQS 3OTOF 2PC6A 1N48A 1KONA 2ZD1B 3C3LA 1KD1T 3J81Y 1RUSA 3R5JB 4IFYA 3PRBA 2ZM6J 3I82A 1S6PB 3GPAA 2VC1A 2ZKTA 1J5EF 1WACA 4ZPAA 3T9NA 1NHVA 1FXDA 3BBBA 1H98A 1FO1A 2ZBPA 3DKDA 2OPQA 1IQTA 1WF0A 1YKWA 4IFVB 2OJ3A 3UDVA 2B43A 1M5PC 4ZJQA 2BBEA 4DV5F 2AGOA 3OXGA 2V4QA 1KHVA 2HFVA 4M5KA 3HHEA 1HNXJ 2P6SA 4X4SA 4NEZA 4NZ7A 3MR5A 1NK5A 3ZZPA 1AROP 3EGNA 5THWA 3MMAA 3H2UB 1NRKA 3V6HA 4NA3A 4JV5J 4LF5J 1DTQA 3VAJA 2G9OA 3PV8A 4ECQA 3FEYB 5BYSA 4G6VB 2IJRA 4ZK7M 3A8KA 2CVEA 3M2VB 4E98A 1VS3A 2RE1A 1HNIA 3GONA 3TEHB 4J91A 4YP3A 5K8PA 4S0MA 5J1EB 3G87A 3IRXA 1WHVA 2FLPA 2YWFA 2Z2YB 2XZWA 1SPBP 4P7TA 5IM0B 2RU3A 1U0HA 2DR8A 3VGUA 3OL6A 3H7HB 5GAHI 2CUYA 3MD3A 3NLCA 3THVA 1S79A 2IFXA 4IR9A 3W8GA 1ZBTA 1KLNA 4W92B 2UUWA 1QY7A 1QAXA 3SCKE 1KEKA 4OYXA 2QO3A 3DHWC 1RE1B 3VAIA 5KFXA 2K7KA 4HTJA 2KXNB 3PY8A 3FUYA 7FDRA 2HQIA 3PFEA 3QGGA 3TJAA 1EAYC 1KR4A 3H20A 2QEXS 1FWLA 2AEFA 4DUYJ 3U1NA 4QOTA 2Q6CA 4ZLLA 4MJKA 4ZMMA 3JQJA 4W98A 1J27A 4GVBA 2BUNA 3PJ9A 2EBEA 4MIWA 1IBCB 4DSIA 2EXUA 5LJ3Y 5JVGQ 3BGLA 3CJSA 2EG1A 1NU4A 2ROPA 4DX5A 3TP2A 1G1XA 5ETVA 3CCZA 2KG1A 3IRWP 4U7CA 2DISA 2MB0B 2ZDOA 3BKTA 2CZVC 3MM5A 4KO0B 5IC6B 4HACB 4CNZA 2H65B 1UVMA 1CQMA 5FLXY 1RP5A 2W1BA 4MK7A 4AQYF 1U6FA 1YJRA 1WOOA 3TARA 1IBLJ 2B4UA 4TU7A 4E0DA 1FRXA 2M2BA 2DBBA 4LFBJ 3ZFVA 2LU1A 3DDIA 5K8NA 4DLEA 4NPOA 3BR8A 2BE7D 1JJHA 4JI3F 4RLEA 5C2GA 1H73A 3JSMA 3CD6S 3D6FB 4R25A 5HLFB 2CPXA 1R89A 2SXLA 3JAMU 1RTHB 4KR0B 1VBYA 3BB5A 2A0FB 5L1IA 3I0SB 3SV4A 4CLFA 2R2TA 5KG6A 1YTYA 4RWXA 4IOCQ 4V19J 1YX2A 1RAAB 1TKTA 3MR6A 1KQSR 3ZZUA 1F3FA 3THTA 4Y2CA 2F5GA 3K57A 1QD1A 4USVA 4WTOB 1UVKA 1Q4RA 4OZ1A 2ZNZA 1RWKB 4XPCA 1Y11A 2P9GA 1MU2B 3UW1A 3K5NA 3BGRA 1K8AT 5E3CA 4C3MA 4FKYA 1BQMA 1HIYA 2JEGA 4O23A 2MLZA 4OLPA 4RUCA 3E2EA 2LEBA 5ETQA 1HQEB 5IZHA 3T5KA 1UPMB 5LMNJ 3CCVS 1UWAA 5M2UA 3M8RA 4WP3A 2F4VF 1HNVB 2VFUA 3OHBA 5ETRA 3V6KA 2ZVSA 4FVMA 3H0PA 2R8IA 2HK3A 3DU5A 2AYGA 3W8PA 1I3OB 4WIQA 2JWNA 5HJYA 3GYNA 1CJKB 2BM1A 5JUMA 1S9EA 1S9FA 2L9WA 5CYMB 5DDQC 4NCBA 4OI4A 2CPIA 4Q45A 1JKHB 3JXOA 1RYRA 4CTAA 1C0TB 4X4QA 4LVNP 1F0XA 1FNOA 1X4CA 1RK8A 1UVJA 2HMIA 4JI6F 1BXNA 4K8RA 2QA4S 1U1QA 2PMWA 2UUTA 4J7CA 3MAAB 4Y3CA 3V6DB 5KFKA 4JOUA 2AX0A 3N0VA 2BJDA 3EUNA 2VKZG 5KG7A 3E3XA 3DLEA 5F0UA 1W25A 5AJ3F 2XWYA 2LCWA 4JI1J 4F4KA 2ZH5A 4USMA 1XR7A 5K14A 2WSFC 1NHKL 4CLKA 5J2QA 3C15B 1M90T 1MLAA 2KM8B 4LBHA 3ZTPA 1ZPWX 2YKNA 4F36A 1BC6A 3AD7C 2OFGX 5U47A 3D0IE 1HHSA 3Q23A 5HROB 1N5TA 4RW7A 4WBFA 1B70B 1RAOA 2LP4A 2OPSA 1FXRA 2HNZA 1MMNA 2XHWA 4ED3A 3PW7A 2GMHA 3JS9A 3A8JA 1VI7A 3PX6A 3UNYA 4ANDA 4G1PA 3QJJA 3MWBA 3HSDA 4Y2MA 2W9BA 2LXUA 2G2YA 4I2QA 4TN2A 3JTNA 1CSJA 1H2TZ 3MOZA 3T1AA 3PEHA 3WX8A 4NRUA 1V3ZA 2UXDF 4YEAA 4H54A 4DV7F 4DV0F 4CI0B 3IC1A 2FZKB 2VQFF 2ASYA 5GVQA 1TL3A 1N34J 3MFIA 4RW9B 3UWTA 2FD2A 2CQ2A 4DN9A 1LK5A 1WDDA 3LWLA 2NXNA 4NLTA 1WI8A 5HVGA 2IC3B 1AT1B 5K5MA 3UD5A 2WVEA 3EPGA 2AZ3A 2EWHA 1AZSA 4EGLA 2I2YA 3TVYA 2F9JA 3J7ZT 1MWQA 3QT8A 4JYAF 3O1LA 2DH7A 3PACA 5IWAF 4B3RJ 2XBPA 1FX4A 1J5OB 1QSYA 3HD1A 4UOFA 4LT6A 4F02A 4P73A 5DQIA 2RMLA 3BYPA 3IG1A 2B4OA
chains in the Genus database with same CATH topology
3RJMB 1PAUB 3KJNB 2H65B 4JB8B 1ICEB 3EDRB 2C2KB 4LSZB 2HBQB 4DCJB 1RWMB 3IBCB 1RWKB 1GFWB 1RHRB 1RHUB 2HBYB 3P45B 4ZVSB 3GJSB 3R6GB 3R6LB 2C2OB 2DKOB 1SC4B 3KJQB 4ZVRB 2HBZB 1RHQB 1RWOB 2CDRB 1BMQB 3D6HB 2CNNB 2XZDB 1RWPB 1RWXB 1RWWB 3IBFB 1SC3B 2H4WB 1SC1B 2QLBB 3GJQB 1RE1B 3GJRB 4DCPB 2C1EB 5IC4B 4DCOB 2CJYB 3GJTB 3P4UB 2XYPB 2QLJB 2H4YB 3R7SB 3KJFB 3R7NB 2QL5B 1QDUB 3D6MB 2Y1LB 3D6FB 4ZVOB 3QNWB 2QLFB 1I3OB 2C2MB 2H51B 1QTNB 3SIPB 1RHJB 2QL7B 2CNLB 1IBCB 2QL9B 1I51B 2CNKB 1RWVB 1RHKB 2XZTB 2CJXB 2H48B 3NS7B 1NMEB 3R5JB 2Y0BB 5K20B 2HBRB 3R7BB 2P2CB 2H5IB 4ZVQB 2C2ZB 4ZVPB 2FQQB 2H5JB 4ZVUB 2XYGB 4ZVTB 1RHMB 1RWNB 2XYHB 1PYOB 1F9EB 2H54B 3EDQB 2CNOB 5IC6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJM B;  1PAU B;  3KJN B;  2H65 B;  4JB8 B;  1ICE B;  3EDR B;  2C2K B;  4LSZ B;  2HBQ B;  4DCJ B;  1RWM B;  3IBC B;  1RWK B;  1GFW B;  1RHR B;  1RHU B;  2HBY B;  3P45 B;  4ZVS B;  3GJS B;  3R6G B;  3R6L B;  2C2O B;  2DKO B;  1SC4 B;  3KJQ B;  4ZVR B;  2HBZ B;  1RHQ B;  1RWO B;  2CDR B;  1BMQ B;  3D6H B;  2CNN B;  2XZD B;  1RWP B;  1RWX B;  1RWW B;  3IBF B;  1SC3 B;  2H4W B;  1SC1 B;  2QLB B;  3GJQ B;  1RE1 B;  3GJR B;  4DCP B;  2C1E B;  5IC4 B;  4DCO B;  2CJY B;  3GJT B;  3P4U B;  2XYP B;  2QLJ B;  2H4Y B;  3R7S B;  3KJF B;  3R7N B;  2QL5 B;  1QDU B;  3D6M B;  2Y1L B;  3D6F B;  4ZVO B;  3QNW B;  2QLF B;  1I3O B;  2C2M B;  2H51 B;  1QTN B;  3SIP B;  1RHJ B;  2QL7 B;  2CNL B;  1IBC B;  2QL9 B;  1I51 B;  2CNK B;  1RWV B;  1RHK B;  2XZT B;  2CJX B;  2H48 B;  3NS7 B;  1NME B;  3R5J B;  2Y0B B;  5K20 B;  2HBR B;  3R7B B;  2P2C B;  2H5I B;  4ZVQ B;  2C2Z B;  4ZVP B;  2FQQ B;  2H5J B;  4ZVU B;  2XYG B;  4ZVT B;  1RHM B;  1RWN B;  2XYH B;  1PYO B;  1F9E B;  2H54 B;  3EDQ B;  2CNO B;  5IC6 B; 
#chains in the Genus database with same CATH topology
 3VVU A;  4QU7 A;  3K2Y A;  3KMQ A;  4QR0 A;  2RQ4 A;  4D3G A;  5J2P B;  4TY9 A;  1URR A;  2YQ0 A;  5D0H A;  4B3S J;  4KB7 A;  2OML A;  2HQC A;  3UDL A;  2BW7 A;  3F73 A;  4P2F A;  4ID5 B;  2JLF A;  1NHU A;  3SEO A;  1YJV A;  1IKV B;  1Q8K A;  2VDI A;  4LFA F;  1RT5 A;  2ABY A;  2GGP A;  4NL5 A;  4PXD A;  1O8B A;  3W61 A;  3A3O B;  1HHQ A;  1VQ4 S;  2IY5 B;  1KOH A;  2KM8 C;  1IKX A;  1WG4 A;  4JI6 J;  3EZ5 A;  2AP6 A;  4KHP F;  5C5J A;  4DLG A;  1VBX A;  1PJ7 A;  3D6M B;  2MTL A;  2W25 A;  3RW7 A;  1CC8 A;  2RRN A;  1HQU A;  4ZVE A;  5MAO A;  2EFV A;  1TMM A;  4MYU A;  4QIG A;  2R2U A;  3D3C J;  5HI7 A;  4BWJ A;  2MSS A;  3AA9 A;  5HVF A;  3OUY A;  2P2C B;  2X1F A;  4KIA A;  4CNY A;  2RRB A;  5DLG A;  3M6X A;  4CM0 A;  3PHE A;  1LNQ A;  2PMH A;  4YOE A;  4TLQ A;  2E1A A;  5FD1 A;  1VQ6 S;  2IRX A;  5HP1 B;  2AZ1 A;  1PIE A;  3IA0 A;  5KFA A;  3SCL E;  1U1P A;  4LF1 A;  2EKN A;  3F44 A;  2BJ8 A;  1RHR B;  3C14 B;  1FEE A;  5C7P A;  2NCK L;  1SC4 B;  3LGN A;  2WRM A;  1ELO A;  2Y0S D;  2WON B;  3IS9 B;  1JX4 A;  3ADA C;  2Z8Q A;  2YWH A;  3HVT B;  2APO A;  3RR7 A;  2BE9 B;  3CT9 A;  4WYW A;  2Z0G A;  4ED0 A;  5KFJ A;  1OIA A;  2XI3 A;  2OPR A;  2Z56 B;  1LW0 B;  4KFB B;  1NJZ A;  2C42 A;  3AY0 A;  3KKF A;  2HYI B;  4YN3 B;  4P74 A;  2A2D A;  4MH8 A;  3IWX A;  2XSF A;  3QIP A;  1VHF A;  2LXF A;  4Y28 C;  1S7H A;  1U02 A;  4DX6 A;  2DR6 A;  3CCU S;  4NYZ A;  1TKD A;  5A8W B;  4ID8 A;  2LLZ A;  2DR9 A;  1FKP B;  3G2X A;  4QYR A;  3ILL A;  1M5H A;  1X4G A;  3I9V 9;  5A76 A;  4ZVT B;  2QE5 A;  3FBC A;  1U26 A;  1SV5 A;  4KTQ A;  1UFW A;  4MYT A;  2EC0 A;  1NJW A;  3M8P B;  1EET A;  5HBM A;  1R8A A;  3CDA A;  1I94 J;  3DOK A;  1WC0 A;  2D9O A;  2DRA A;  1LWC A;  2K2P A;  2V67 A;  4JYA J;  5IWA J;  1V5I B;  2RRA A;  1RWP B;  5KT7 A;  1Q53 A;  4ICL A;  1HBO B;  3MR3 A;  2YKO A;  4ECW A;  4IH5 A;  4H4M A;  1WEZ A;  1TVR A;  2YH1 A;  4F4A A;  2ZBI A;  1KWM A;  1VQP S;  4J9V A;  4DL5 A;  4R5P B;  3V81 B;  2DHA A;  1VCT A;  1GMW A;  3AJ2 A;  1WNE A;  3EZO A;  3MM9 A;  4ZDN A;  3MPY A;  2JEJ A;  4ZHR A;  3QAE A;  4QR1 A;  1XWL A;  5D3G B;  4PEO A;  1MNE A;  1SL0 A;  2C3M A;  2W9C B;  4MTP A;  1PIL A;  2WVC A;  2HNY A;  3D1H A;  3CC2 S;  4A8W A;  3Q22 A;  3Q8P B;  1H3D A;  3US5 A;  2GVD A;  4RU9 A;  3ENW A;  3D6T B;  3DGP A;  4FF1 A;  4PYA A;  2HZV A;  3MZI A;  1AFI A;  3BH7 B;  1WOR A;  3JB9 k;  2XSJ B;  4LMZ A;  2B9Y A;  2GAG C;  5HN0 A;  2GQ2 A;  4ES2 A;  3RR8 A;  1T95 A;  5ADZ A;  2LFV A;  1OSC A;  1D9A A;  4CYU A;  1TAQ A;  3O3L A;  3ICL A;  4WKR A;  2E9T A;  4C2M A;  2UUB F;  1RWW B;  1RU1 A;  2F8M A;  4FYY B;  1U2F A;  1TMJ A;  3MCN A;  3MCS A;  3LO3 A;  4I0W A;  5FII A;  1R0A A;  4FPR A;  1WDT A;  5KG3 A;  3MEG B;  2EFQ A;  2VV5 A;  1MN9 A;  3AB2 B;  1BD6 A;  2ZKU A;  3AXK A;  1G4C A;  1UW9 A;  4JI0 F;  4KHR A;  2MQN A;  1MG7 A;  1T9T A;  2EFP A;  2JVO A;  2YQ1 A;  5E7O B;  2I5J A;  4ZIT A;  2G13 A;  1HBM A;  2VFT A;  1YVF A;  2XMT A;  3CUN A;  2MHN A;  3RW6 A;  2VQE J;  2HSE B;  5L46 A;  2Q1L A;  3FVY A;  3KK2 A;  1S0V A;  3KWM A;  1EX8 A;  1RKI A;  1FVS A;  3H8Y A;  2LDI A;  4A4J A;  1PYO B;  4U7U K;  3NCR A;  1D8Z A;  1YJT A;  1VC0 A;  3RRG A;  4G65 A;  2FJA B;  3UO0 A;  1KDN A;  2PI4 A;  3OFE A;  2IVF B;  1BQX A;  3AOA A;  1GQE A;  3MEE A;  4B9U A;  4P2M A;  2GCF A;  1MWZ A;  1N6Q A;  2NUH A;  3GII A;  2K3I A;  4IDK B;  4I6Y A;  1X8D A;  4YFU A;  2W4D A;  5C42 B;  2R42 A;  3A4T A;  4CDI A;  4QWB A;  1ACM B;  3HJF A;  2C3P A;  4DR5 J;  5KFO A;  1J2V A;  1K9M T;  4KGV B;  1HR0 F;  4BBY A;  2GC8 A;  1H74 A;  2DT9 A;  2CNK B;  2AU0 A;  1RHK B;  3OTE A;  4EBC A;  2Y0B B;  5DLF A;  2CPD A;  3ENV A;  4WPA A;  2KKH A;  1QUP A;  3B78 A;  4YR3 A;  4FZV A;  4X2B A;  1TKZ A;  3DI6 A;  2EK1 A;  1KNZ A;  1NB2 A;  2R9L A;  4ANC A;  3QLH A;  4ZCI A;  2MQL A;  1ZH5 A;  3JYT A;  4B9L A;  3RJM B;  4HHU A;  2E7V A;  3CB4 A;  4LSZ B;  4DSK A;  5RUB A;  3FC9 A;  4RWW A;  4ZLN A;  2IMW P;  3MM7 B;  3CJR A;  3MEC A;  4DBQ A;  1X7V A;  1GMU A;  4NEY A;  4DL0 C;  5IT9 U;  1TUV A;  2R7Q A;  3TQE A;  1VHI A;  2VC0 A;  3RTV A;  3HLU A;  3AOB A;  1XMO J;  1NK9 A;  3CC7 S;  1TAU A;  1BQN A;  4Q2L A;  2DGS A;  3NY0 A;  3D2W A;  1FK9 B;  4DFP A;  4Y0F A;  1V5V A;  1C1B A;  5HAO A;  3DLJ A;  4LIR A;  2Y1J A;  2I8E A;  1OJ4 A;  4KAI A;  2UUB J;  4AUK A;  3M6U A;  4DV6 F;  3W9I A;  2MKH A;  1KTQ A;  1RT3 B;  2D69 A;  3GIJ A;  4NE9 C;  4OI2 A;  5D4P A;  3THP A;  3I4H X;  3CO9 A;  1P1T A;  2OP5 A;  4B08 A;  4IG3 A;  4IFY B;  2JEF A;  2F7V A;  2M7S A;  2B6A A;  4WFZ A;  3GR0 A;  2H3E B;  2LQ5 A;  5IV3 A;  4NA2 A;  1VQM S;  1TU0 B;  1VRU A;  3SSR A;  1RHQ B;  1N32 F;  2YQ3 A;  3RGI A;  2IHR 1;  1REV A;  2DVI A;  3GTY X;  2OPQ B;  2B9W A;  2JC0 A;  3MR2 A;  3W65 A;  4DCO B;  3TEG A;  1YIT S;  2QL5 B;  1VMB A;  4HDG A;  3H4B A;  2FHK A;  2VOP A;  3D9B A;  4X4R A;  1WI6 A;  1B3T A;  4PR6 A;  2NZ4 A;  4DV2 F;  3DXS X;  6FD1 A;  3M9O B;  1FDN A;  1S0M A;  2BKP A;  1S1X A;  1XIQ A;  4NLP A;  2W4P A;  4G1Q A;  5EUH A;  3A8E A;  2CPZ A;  1S4E A;  2GV1 A;  1DTQ B;  3K5L A;  2DPJ A;  2ZIT A;  4I68 A;  2EEY A;  2VBX A;  3HP6 A;  4C8Z A;  1M5S A;  4LRD A;  1Q82 T;  1REG X;  4NLY A;  2VOD A;  4KGX B;  2I6W A;  1X9M A;  4EBD A;  2OIH A;  3KLH A;  5I42 A;  4NI2 B;  1HNI B;  1QVG R;  4DCJ B;  4K59 A;  2A10 A;  5B7W A;  5CQG A;  1KHW A;  2VPX B;  1YLX A;  4JI2 F;  4RBU A;  4DQS A;  4CH0 S;  3FZB A;  3S01 A;  2GIR A;  4LR9 A;  1R6V A;  5F8L A;  3B82 A;  4DPY A;  2NRE A;  4KH0 B;  3M2R B;  1KBR A;  2HQ3 A;  1JLB B;  1U0H B;  2BAC A;  1S6U A;  3LPE A;  2NSB A;  3J7Y U;  2AGQ A;  1WKL A;  2W9A A;  1RAB B;  1NJY A;  3OR1 A;  1O0P A;  3OTC A;  2Y1R I;  3AQP A;  1AA1 B;  4FYX B;  2J0S D;  3DXB A;  3BO3 A;  3L7U A;  1IWA A;  4DR1 F;  3MCO A;  1VRT A;  2G0I A;  2KL8 A;  1HKA A;  1KQF B;  1X60 A;  2F9D A;  2ZJP Q;  2W24 A;  1CQN A;  5BYQ A;  4GVB B;  2MZR A;  2H5J B;  1CS4 A;  5KT6 A;  2CZ9 A;  2PA8 D;  2L41 A;  2KHC A;  4KGK A;  4CT9 A;  2BQ3 A;  1HPZ A;  3PDN A;  4ES3 A;  3IAS 9;  1IM6 A;  3M8Q A;  3NAI A;  3ET6 A;  2N4C A;  2X3G A;  4KBI A;  4G1I A;  3OVA A;  3CED A;  3Q83 A;  4YB5 A;  3FKB A;  3MM5 B;  5ETN A;  2RQM A;  2XNR A;  3VQT A;  1FHT A;  4X65 J;  1EB0 A;  4J9K A;  1TK0 A;  3GG1 A;  1C1C B;  3QGP A;  1HI8 A;  2GX8 A;  1N33 F;  1ITP A;  4KPY A;  4ZIV A;  4NZ6 A;  4WFA Q;  2GVZ B;  5J1N A;  4XPE A;  2UV8 A;  2H5E A;  4J9S A;  2WZ1 A;  3RB4 A;  3SI8 A;  2D1C A;  4DS4 A;  4PQU A;  1LWE B;  2JOQ A;  3HFV A;  2XWX A;  2OLW A;  5CYQ A;  2E5L F;  2VJV A;  3HXM A;  3CVK A;  2RS8 A;  2DNN A;  4RJV A;  2QFJ A;  3QT7 A;  2M0G B;  3JSM B;  3H5S A;  2ZH8 A;  4M94 A;  1ZYQ A;  2HKE A;  1B99 A;  4UF4 A;  4LRC A;  3EVO A;  4K7Q A;  3CDW A;  2OGU A;  3UDE A;  1UWB B;  4N5S A;  2ZH2 A;  2KT3 A;  5LM7 E;  5F8G A;  4LR7 A;  3R2D J;  4X62 F;  4U95 A;  1FE0 A;  3BV8 A;  4A46 A;  4GMK A;  3QSY B;  2YNF A;  3U1L A;  5F8N A;  4JI5 J;  1TL5 A;  2CKW A;  2QLW A;  1WC4 A;  1S77 D;  2HG4 A;  4NAS A;  5KT3 A;  2ASL A;  2J0Q D;  2UXC J;  4C48 A;  2MST A;  3J7Y I;  2KI2 A;  4OYA A;  1Y5N B;  4PG5 A;  4J37 A;  4M5L A;  4DV1 J;  3BGR B;  3VAG A;  1XNQ F;  4ILL A;  3DYA A;  1MW7 A;  3PO5 A;  3TJ8 A;  2IMO A;  4QW9 A;  2IJN A;  1X5T A;  2QMU B;  1MWY A;  1HWI A;  2HFN A;  3QFW A;  2KYX A;  1IBM F;  4Y2K A;  2GAH C;  4Q0B A;  4FVC A;  4OHZ A;  1OYE A;  3DOL A;  3LF0 A;  2BJ1 A;  3CJ4 A;  4DMZ A;  4A8Y A;  5EWE A;  2DXE A;  2PT0 A;  5GAE U;  3G82 B;  4KY3 A;  4WE1 A;  2MZT A;  1S9E B;  1X4D A;  4YQW A;  2D3U A;  2IM3 A;  2PN6 A;  1N0U A;  3GV8 B;  2M3D A;  5F8I A;  1PAU B;  4O3S A;  3HI9 A;  1GMV A;  4USI A;  3BKF A;  1UVL A;  2G1D A;  4CTA B;  3J7A 1;  4USH A;  3MGJ A;  1WG5 A;  3PW0 A;  2CDR B;  4LFC F;  4USW A;  5EGY A;  5H9F K;  5KG2 A;  1HNZ F;  1IR0 A;  1VK3 A;  3IBW A;  3K0J A;  4DQI A;  1U1N A;  5HMZ A;  4RUB A;  3OJU A;  4ZJL A;  3CME S;  4N41 A;  4RNO A;  4J90 A;  2YWG A;  3DLE B;  1T02 A;  4OQJ A;  4PXE A;  3I0R A;  2W2Q P;  4F2S A;  4FXV A;  1KLM A;  3MPU B;  1OYD A;  2BZ2 A;  2OEK A;  2ZFH A;  3UCG A;  3CSK A;  2HHW A;  4L72 B;  5K14 B;  5J2Q B;  2MQM A;  3ONQ A;  3WIV A;  1M0S A;  4PG8 A;  1N56 A;  2X3D A;  3WBZ A;  4C8N A;  6AT1 B;  5LMU J;  4RW7 B;  2LDY A;  2YKA A;  3ZZY A;  2OPS B;  2QMW A;  2HNZ B;  2UUA F;  3MHY A;  1YJW S;  1NZ8 A;  3J80 U;  1YJN S;  3LH2 S;  2E5L J;  3CF5 Q;  1NLK L;  1RWO B;  2LKZ A;  3TX8 A;  1VQO S;  1JK9 B;  1RB0 A;  2IAJ B;  1W7W A;  3J7Z 5;  2W9B B;  1VOM A;  1IM4 A;  2ZE2 A;  4DPW A;  4I2Q B;  2HWT A;  1V3S A;  3CIZ A;  1VQ7 S;  2EKY A;  1D9F A;  5C2C A;  1N88 A;  4X62 J;  2MJU A;  3C6U A;  3DMJ B;  2JFK A;  3M8S A;  4ILR A;  2MJN A;  2XB2 D;  2FJD B;  4FP9 A;  3NWG A;  2KRB A;  2MYF A;  3DRP A;  2XO6 A;  4CH7 A;  3JAM Y;  4OYB A;  3SSS A;  4ECY A;  2KTQ A;  1FER A;  4DF4 A;  2WSC C;  3BPD A;  3W7B A;  5EDW A;  2DNY A;  4O3O A;  5GAE I;  3FSI A;  5CA5 A;  3D1Q A;  5KFB A;  1TUW A;  3NP5 A;  5DRK A;  1EKS A;  3K8W A;  4RNH A;  1TFY A;  3KJV B;  3AA8 A;  4RBT A;  1UZD A;  4F26 A;  3KUH A;  4JI4 F;  2MGZ A;  2V69 A;  3M05 A;  2GFF A;  3QFH A;  6FDR A;  2LQ8 A;  3EDQ B;  1XTZ A;  1HW8 A;  4N77 A;  3Q2T C;  3E51 A;  1SUQ A;  4PXB A;  3SFG A;  2QG9 B;  3UI3 A;  3KTQ A;  1VIO A;  4NXM J;  4DJB A;  4OZ5 A;  5ITH A;  2GZO A;  1HYS A;  3P45 B;  3DLK A;  3MPW A;  3BO2 A;  3NBP A;  3IG1 B;  2DYA A;  3LOU A;  4DR7 J;  2HS3 A;  2VL1 A;  4ZA1 A;  2A1B A;  5A8R A;  4WCE Q;  1LV5 A;  2V2V A;  2V34 A;  2XMU A;  4HR2 A;  3NGT A;  2Z30 B;  4NOH A;  1W2B R;  2VPW B;  2DNK A;  2XUL A;  1GEH A;  2KXH A;  1WD6 A;  1RT5 B;  1FFG B;  4AD6 A;  3CDE A;  5J2N B;  3W2V B;  3VCD A;  3RBZ A;  4ECX A;  2ZH1 A;  1OS5 A;  1F1B B;  5H9E K;  4U96 A;  5J1P A;  4JI7 F;  4OHV A;  4CLW A;  3G71 S;  2FLL A;  3CJ5 A;  1FRH A;  4IYQ A;  1PGZ A;  3DRS A;  1HQU B;  2VFV A;  2CJ9 A;  3CXC R;  2UU9 J;  3EX7 B;  3NGK A;  4HTI A;  4OYI A;  4ECU A;  2WOM A;  2CJA A;  3OUY B;  3PEJ A;  3UN3 A;  4F3O A;  5IS2 A;  1WC6 A;  3DLG A;  3GYX B;  2OSQ A;  3N6L A;  2XMJ A;  3KG4 A;  4ZN3 A;  2XLK A;  2LVW A;  4RUH A;  1TTH B;  4RL1 A;  3LAL A;  2QIF A;  3I5A A;  2GIQ A;  1EIY B;  1BUX A;  2CQ4 A;  1U48 A;  2CJQ A;  3KHH A;  2M70 A;  3P4U B;  2W2P P;  4EZ6 A;  4URS A;  2UUA J;  2RDD A;  3ZZO A;  1K47 A;  1NKB A;  2RF2 A;  1DFD A;  4F4Y A;  2DIU A;  2J9D E;  2EBG A;  3PM9 A;  2D41 A;  4B9M A;  2OPR B;  3OFF A;  1FFS B;  2Y3Y A;  4DN0 A;  1RT7 A;  2D7S A;  5HQM A;  3QIP B;  2HIY A;  4LBP A;  4WFX A;  4GKK F;  4YB1 P;  3F56 A;  1Y9O A;  2NPI A;  2FIU A;  2WHO A;  3QRP A;  2DRD A;  3P5T L;  3X3U A;  4Q43 A;  2HND A;  1NSQ A;  3SCI E;  3A3P B;  3GFH A;  2WW4 A;  4PAA A;  2DHH A;  2OHD A;  3VHQ A;  4WXW A;  5KG1 A;  2DNR A;  1SV5 B;  1T05 A;  4FNI A;  3B6B A;  2E1P A;  3IR5 B;  5F41 A;  4NYP A;  1RGV A;  4I2P A;  1EET B;  2FHM A;  5HBM B;  3EWG A;  3M8Z A;  3DOK B;  3TUZ C;  4DFJ A;  2ZBQ A;  1LWC B;  1PAE X;  1SB6 A;  3PYD A;  2ADB A;  2CPH A;  2WBR A;  1UVN A;  2QC3 A;  4ICL B;  5AXN A;  2GA7 A;  2E1C A;  2Z58 B;  1XJW B;  4H4M B;  4TKT A;  3HKZ D;  3ITH A;  1Q95 G;  1SJQ A;  3EPI A;  3EJM A;  1IBK F;  1I51 B;  3VR1 A;  3C8Y A;  2DGT A;  2RH3 A;  1FCA A;  3E01 A;  2FZG B;  1CLF A;  3CJK A;  1HQ2 A;  4ZHR B;  2MDA A;  5KFQ A;  1QJH A;  2IA6 A;  1YZ7 A;  1NK0 A;  2V2K A;  3J81 j;  3CD0 A;  1U45 A;  1QSS A;  3QGI A;  3R3T A;  2HNY B;  4LRE A;  2V8D A;  2XI2 A;  1H2V Z;  3R1L A;  3R8Y A;  4JI7 J;  2GVD B;  2HBZ B;  3AJD A;  5HVH A;  3DU6 A;  1CJV B;  1HBN A;  1RZM A;  1YQH A;  4K4W A;  2QLX A;  3JSY A;  1Q5V A;  1R43 A;  3KLE B;  2HAI A;  4PCQ A;  3FGV A;  1O5J A;  1Y3K A;  4C4W A;  3DM2 A;  5DDP C;  1JLF A;  4CYU B;  3I55 S;  3N9U C;  1T03 B;  4FNH A;  3FJ2 A;  3IM8 A;  1U7L A;  3C2P A;  3I9Z A;  1B0V A;  1S59 A;  1R0A B;  4ED8 A;  1LOU A;  1VQY A;  3ZZT A;  2B51 A;  2M4M A;  3G8Q A;  3KYL A;  2HVI A;  1JLC A;  2MY8 A;  3D0G E;  2FC8 A;  4H4K C;  4N8O A;  2FJB B;  3I4P A;  4ECS A;  3IFE A;  4M5J A;  3ZNU A;  3BQ2 A;  4URQ U;  4NXN J;  2WSE C;  2WB4 A;  2XYG B;  2R8K A;  1E6Y A;  3D5M A;  4BLG A;  2I5J B;  3DLB A;  3HT3 A;  3K5P A;  1RSC A;  2ZUA A;  4E8U A;  2ILZ A;  4UZC A;  4QCL A;  3GIM A;  3OXF A;  1KOO A;  4H4O B;  4PXC A;  3BKU A;  3UR0 A;  2K06 A;  1HI1 A;  4RW6 A;  4HI1 A;  4O3Q A;  3KNA A;  1V9O A;  4DR6 J;  1AXQ A;  2J7K A;  3FCV A;  2AEJ A;  3TUJ C;  2VFS A;  3TWZ A;  1JQG A;  2BJ3 A;  4X66 J;  1S5Z A;  3MEE B;  3I56 S;  3DRY A;  1PC5 A;  5DM7 Q;  3UR3 C;  1OY8 A;  3JSR A;  2JZ5 A;  2VIC A;  3AHP A;  4K0K J;  5FDL A;  1RHJ B;  3HHN B;  5E3A A;  5E41 A;  4F25 A;  1JLE A;  4I7F B;  1AYE A;  1OSD A;  2YX1 A;  1WOS A;  2I0X A;  2PSZ A;  4K2J A;  4WJB A;  3KK1 A;  3K5O A;  5SZT A;  4JI8 F;  1YK9 A;  2PII A;  5CZX A;  3M2U A;  2F40 A;  4AFF A;  1UP1 A;  5KFP A;  5GMD A;  1A0O B;  4OHY A;  3JTO A;  1QSL A;  3A3N B;  3RYL A;  3KJN B;  4UQT A;  2ZVI A;  1S1T A;  4TNO A;  4PUO A;  2L48 A;  4ETZ A;  2OTL S;  1TKZ B;  1ZAW A;  3DI6 B;  1EP4 A;  1IBK J;  2RAQ A;  3QLH B;  2KT5 A;  2ZH9 A;  3FFI A;  3W5Z A;  3IWL A;  3JYT B;  3CCE S;  3M30 A;  2M88 A;  3RB0 A;  3RRH A;  1ZTW A;  3T3F A;  2JDJ A;  4RU2 A;  3H90 A;  2FGC A;  4L74 A;  3ZC4 A;  4YB6 A;  3MEC B;  1B0T A;  4P9S A;  4UY8 T;  3Q8V A;  3MFH A;  4FDF A;  4DV3 F;  1QVF R;  1DQ8 A;  1FRL A;  1FKA F;  4FBT A;  2ZHA A;  1Q81 T;  3CPW R;  2BXJ A;  5KFS A;  3PX4 A;  1U4B A;  2R3V A;  3IGN A;  1IKW A;  1U2R A;  4W4M A;  3GZ7 A;  2HBR B;  3GSD A;  3DFE A;  1UMJ A;  1NK8 A;  2X7I A;  1NPK A;  5KFL A;  3EGW B;  3LQV A;  4LVO P;  1HAR A;  1LXN A;  3LP0 A;  2YKM A;  4LF7 J;  3K8V A;  2W01 A;  3MED A;  4V19 X;  3MUM P;  2V68 A;  2FY1 A;  4L3N A;  1F6T A;  3QSI A;  1KC8 T;  3H2V E;  4ZPT R;  3P6Y C;  3TAM B;  1NDC A;  4ILM A;  1RLC L;  4HKQ A;  2RB7 A;  2B6A B;  2FJV A;  2ZOM A;  1X5S A;  1YBA A;  4TYA A;  3BQ1 A;  5KOW A;  1VRU B;  2FJW A;  3LP2 A;  4ED4 A;  4CT8 A;  1G7C B;  2MEW A;  5GME A;  2YPZ A;  4A47 A;  2NSC A;  3DRR A;  2MKK A;  2M52 A;  5IV4 A;  3UN2 A;  2IDL A;  5F9L A;  2YKP A;  1WHX A;  1DQA A;  2LMI A;  3ZZZ A;  3BSA A;  3WQP A;  2CRL A;  3NNH A;  1F2G A;  2J9E A;  4EUV A;  4OJG A;  2AF6 A;  4EWT A;  2X1B A;  3ENQ A;  1S6Q A;  5GMK a;  1S6P A;  2KN4 A;  5HMX A;  2FPH X;  4ZVU B;  1KKH A;  4IOB A;  2V2Q A;  2OKQ A;  2HRU A;  3TUI C;  2B7C B;  4X4P A;  2HUR A;  4G1Q B;  2MKJ A;  2A2C A;  4ECR A;  1TQL A;  3D67 A;  3VTI A;  2CWK A;  2V63 A;  4J9N A;  1KVI A;  4IFV A;  4UST A;  1UA0 A;  3ETO A;  3RBE A;  3PO4 A;  2B5J A;  2Q66 A;  1NPR A;  3Q8Q B;  3TR5 A;  3TZX A;  2O3D A;  1RTD A;  2PD1 A;  4JI8 J;  3KLH B;  4CO3 A;  5I42 B;  3L3C A;  4KPC A;  2OAU A;  2DIV A;  3HSZ A;  2N3O A;  3DC2 A;  1HNW F;  1TUG B;  4TXS A;  1YZ6 A;  2HPU A;  2AJ1 A;  4YB7 A;  1VQL S;  5B0B A;  2VG7 A;  5ETM A;  1T11 A;  4WZQ A;  3ILJ A;  2Y1L B;  3M9M B;  3HMJ G;  5JMN A;  2NYH A;  3B8H A;  1X4E A;  4DUZ F;  2PFF B;  1T94 A;  3OR1 B;  2Z4P A;  5BR8 F;  2DNZ A;  1RCO B;  3MTK A;  1RDR A;  3D54 A;  5KAK A;  3M2V A;  3A13 A;  4OYW A;  4C0H A;  3K89 A;  2F3J A;  1H0H B;  3NXZ A;  1NSK L;  3BSO A;  2GQQ A;  2IA0 A;  1SL1 A;  1VRT B;  4ED1 A;  2ASD A;  3RAM A;  4NLR A;  3PKM A;  2UVU A;  4L3K A;  3OL8 A;  3S7R A;  2AYE A;  1WKJ A;  2V9K A;  2HAF A;  4MK9 A;  3NOG A;  4LF9 J;  3W66 A;  1CS4 B;  4WXO A;  3BBF A;  5IT9 Y;  4X4V A;  1KFD A;  4DF8 A;  1RAF B;  4RW8 A;  1HPZ B;  4NML A;  3OTB A;  1JXE A;  3M8Q B;  3TAP A;  2DIT A;  3ET6 B;  3CCS S;  2VBY A;  1QTM A;  5HAT A;  4PG7 A;  1N5V A;  1RA7 A;  5AE3 A;  1NDP A;  2LA4 A;  4F04 B;  2V0N A;  2ZZN A;  5I3U A;  4LF8 F;  4B9S A;  4CLS A;  2H51 B;  2UXB J;  2W2M P;  4DR2 F;  4CZC A;  4OFZ A;  1R31 A;  3F41 A;  1JNR B;  2WTF A;  2R7R A;  1S76 D;  2IVM A;  3VGV A;  4PQU B;  1SBR A;  1K1Q A;  4WTY A;  2XQC A;  1ZOT A;  4KHM A;  5CYQ B;  1FT8 A;  3PVX A;  3W2W A;  2RQC A;  4KO0 A;  3PX0 A;  3IBC B;  1PCA A;  4NLQ A;  4J9R A;  1H7W A;  1U25 A;  2P9E A;  4DPT A;  2ZZM A;  3OT9 A;  2AV5 A;  1S1W B;  1F5C A;  2E9Z A;  2YNF B;  1T3N A;  1UJ4 A;  1Y5I B;  4OX9 F;  1T0T V;  5CD4 A;  3QWU A;  2HFZ A;  1HWL A;  3HFZ B;  2HGL A;  2ROE A;  1FJ7 A;  5AT1 B;  2QJ3 A;  3A8I A;  1VC6 A;  4ED7 A;  2V9W A;  1LFW A;  2HZC A;  2QRR A;  1W2I A;  4WP9 A;  1IR2 A;  3GU0 A;  4B3T F;  3WZ0 A;  3CD7 A;  1N36 F;  2HLU A;  3FBE A;  4AT1 B;  4JBC A;  1RTH A;  3MI7 X;  5ETL A;  1SJR A;  4QYZ K;  1VJW A;  1XNR F;  3B54 A;  3ENA A;  5L1L A;  5F9N A;  2BOA A;  1C2P A;  2ZC4 A;  2VA3 A;  1U1R A;  2GQC A;  4MFB A;  1HNW J;  1FTR A;  3SSQ A;  3K58 A;  3SYZ A;  4F7V A;  3KLG B;  2NUU G;  1FF2 A;  4AL6 A;  4Q0B B;  4WZM A;  3NCP A;  4I1T A;  3DOL B;  2XLJ A;  1R8H A;  3QRR A;  3X1L B;  4JB8 B;  2P5V A;  3W9H A;  4DL6 A;  4NYO A;  2ZOG A;  2F8H A;  1L3K A;  2DGX A;  1XMQ F;  2EFN A;  5BR8 J;  4WE1 B;  3OLB A;  2A18 A;  3DGV A;  2BAB A;  5F3T A;  1PYS B;  2CNN B;  1QAJ A;  2BX6 A;  3LGM A;  4A8M P;  1SIZ A;  3NG8 A;  4NLV A;  1C4C A;  4I67 A;  2OEL A;  3PRV A;  4FXD A;  3MMB B;  2C2N A;  4A8X A;  2MKY A;  5J2M A;  5T41 A;  3MTJ A;  1TK8 A;  4AYB D;  1QTN B;  2CIM A;  1CJK A;  2V50 A;  3IO1 A;  3I0R B;  4P7V A;  1NDK A;  3Q8Y A;  2FY8 A;  2HEK A;  5DDR C;  5EWG A;  3FNN A;  3T1Y F;  3POT B;  3OTO J;  3BRE A;  5E3Q A;  3PIO Q;  2V8H A;  2XMK A;  4CLZ A;  4X64 F;  1RCX B;  1KVK A;  3LUY A;  4K4S A;  4O44 B;  2FDN A;  1PG5 B;  2PE8 A;  1QAI A;  4A8F A;  4FS2 A;  5DG8 A;  4LF8 J;  1J5E J;  2PI5 A;  3FQL A;  3M32 B;  2D74 B;  4RBV A;  4PYD A;  3D0H E;  2V4J A;  1ZAX A;  5DQH A;  2O66 A;  4EYH B;  1P27 B;  4EK2 A;  4DV5 J;  4RW4 A;  2OD4 A;  2AJ4 A;  4YR0 A;  5L39 A;  5KFT A;  3C15 A;  3TX0 A;  2H1Y A;  2ZE2 B;  2RS2 A;  2Z57 B;  1QE1 B;  5C24 A;  2CQG A;  2J9D A;  4UZB A;  3EYZ A;  2MZ1 A;  3KK3 A;  2DGQ A;  4I64 A;  4X4U A;  1RWV B;  4O0N A;  2ATC B;  2H48 B;  2R8H A;  2MQP A;  2FVP A;  1S49 A;  3DRP B;  4DL7 A;  3CTR A;  1CJU A;  1FA0 A;  3NS5 A;  4LF4 F;  3KHR A;  4KGM A;  5LSO A;  1RXO B;  3IXQ A;  1YIJ S;  4ZP9 A;  2HS0 A;  3MDF A;  3AOD A;  3TI0 A;  1RAI B;  3T9Z A;  4J9L A;  1ICE B;  4QWE A;  4F4W A;  1UA1 A;  5LXR A;  3R5C A;  1N36 J;  3OW2 R;  4F67 A;  4DXL A;  4OMF G;  1S99 A;  2OSR A;  4CO2 A;  2GO8 A;  2MGZ B;  3VVT A;  1FWP A;  4M95 A;  2CQ1 A;  4V1A k;  1SUQ B;  1A9N B;  1Y4Z B;  1VIX A;  1NAQ A;  2XHC A;  1HYS B;  3B4M A;  3VAM A;  2MQQ A;  3DLK B;  3T1H F;  2E9R X;  2DY1 A;  1BY9 A;  4RO0 A;  3LP1 A;  3HPO A;  4LF6 F;  5A8R B;  2BAN A;  4MKA A;  1RYS A;  1FJG F;  2V6A A;  2FC9 A;  2W4C A;  2UUC F;  1NKC A;  4R0E A;  3OV7 A;  1RBA A;  1HW9 A;  5EX0 A;  1JNZ B;  2CJB A;  1VQ8 S;  3HVW A;  3QT6 A;  4C6A A;  2JSX A;  4MT1 A;  3MPV A;  4QIF A;  2YWK A;  1R27 B;  4ZS6 A;  3BGU A;  3NEK A;  4DL3 A;  1SI9 A;  1FRJ A;  2IVY A;  1V6H A;  3ILO A;  5CCL A;  2GML A;  5E0O A;  5KFH A;  3DRS B;  1Q0N A;  4KC5 A;  4B9N A;  2FJX A;  1L3T A;  4ZVS B;  4EBE A;  1D8Y A;  2C22 A;  3H59 A;  2VG6 A;  3RG6 A;  2BW2 A;  3QWP A;  2WOM B;  4YDX A;  5ETO A;  1KFS A;  4ID5 A;  5BJR A;  1N4L A;  3MEK A;  2ACY A;  3IBF B;  3Q2S C;  2HHQ A;  4AQY J;  3T1Y J;  5KTQ A;  3QBC A;  3GG0 A;  4X64 J;  1TR0 A;  3HSG A;  2OO4 A;  2OMO A;  3R7N B;  1NCL A;  1RAJ A;  4RKU C;  2CPE A;  2MMY A;  2WK4 A;  2VD3 A;  2ZWP A;  3UD4 P;  1FDD A;  4JI3 J;  3O6Q A;  2ALZ A;  1JIH A;  2RF2 B;  3IM9 A;  2DNG A;  3LAM A;  3CMA S;  2QA1 A;  5JVH Q;  1OY6 A;  2B8P A;  2ZHO A;  1RT7 B;  4UQG A;  3J80 Y;  3PYG A;  1NZA A;  3GWC A;  4USJ C;  3KG1 A;  8AT1 B;  1AFJ A;  3DHX A;  3QJL A;  1HL6 A;  4PPZ A;  5KFR A;  3VAF A;  4EZ9 A;  2YNI B;  5D15 A;  4HI2 A;  2WON A;  1DTT A;  2CZ4 A;  3DN9 A;  2FHJ A;  2HND B;  3W64 A;  2XY6 A;  5CZV A;  5IT4 A;  4YY3 F;  2E7W A;  4DOZ A;  3G6X A;  3SQG A;  5BYR A;  2H4Y B;  3FBB A;  3TVK A;  1XBW A;  4WK1 A;  5SUH A;  3DDK A;  4HL9 A;  4NLO A;  5L9X A;  4I2P B;  4IG0 A;  4ELV A;  3QJP A;  1H7X A;  5JJB A;  2F4V J;  4XIU A;  2VFR A;  1IJE B;  3PR5 B;  1VIS A;  2E1M C;  3R7B B;  1FE4 A;  8RUC A;  1XR5 A;  1L3S A;  1ZA1 B;  3ITH B;  4C8O A;  1FKP A;  1IWG A;  4J5O A;  2FQQ B;  3MM6 A;  4LF6 J;  1SQG A;  2ZBR A;  2JLG A;  4DV4 F;  2CQH A;  4R8U A;  1TL4 A;  4CM2 A;  4WP8 A;  2MKS A;  2UUC J;  2CQC A;  3N28 A;  3CC4 S;  5KT5 A;  4EMD A;  3R6G B;  2A6O A;  4DS5 A;  4QWC A;  4ES1 A;  5LSR A;  3R9L A;  3H2L A;  2HVE A;  3JSB A;  2LEA A;  2G2Z A;  1IVZ A;  1HBO A;  4L75 A;  3TA2 A;  1ULR A;  3RBD A;  3G6E S;  4FS1 A;  4R5P A;  1HBN B;  5MLC V;  4ALZ A;  2JC1 A;  1XER A;  4P75 A;  4KV8 A;  5AJ3 J;  4DR4 F;  4KKO B;  4BC9 A;  1X4H A;  4DPU A;  1WTB A;  3DM2 B;  3MUV P;  1N8R T;  3TZZ A;  5F8J A;  1QUV A;  3IR6 B;  2DGW A;  2YH0 A;  3KXD A;  3CDB A;  2R2R A;  2GHV C;  4RZR A;  2RJZ A;  5JXS A;  4EFA C;  2KH9 A;  3H4D A;  1X5O A;  3AXM A;  4I69 A;  1VJQ A;  3AH6 A;  2VPY B;  3GFY A;  2V2Z A;  2J6U A;  1FWK A;  2KG0 A;  2HFS A;  2LQJ A;  2AQ4 A;  4P2S A;  3MXH P;  1SQF A;  1R8C A;  3CJ2 A;  1GH8 A;  3CDU A;  3OR2 A;  3FEX B;  2AYM A;  3QRQ A;  2MY7 A;  3TYT A;  4LSN A;  5A8K A;  2N7C A;  3D1O A;  4M63 A;  5IXU A;  1QM9 A;  2UXD J;  4DV7 J;  4DV0 J;  2AGP A;  3MEG A;  4UOC A;  4B3O A;  1VLO A;  2XM3 A;  4RW6 B;  5AE1 A;  5KFI A;  2VQF J;  5E2Q A;  2NLW A;  2ZM6 F;  2ZZT A;  1UW4 A;  1PO6 A;  2GIF A;  5KFD A;  1S0N A;  4J9M A;  2RUS A;  3VF0 B;  2BOP A;  1OWX A;  1WG1 A;  2E7X A;  1M5O C;  2R7O A;  4KRW A;  4DPX A;  4YY3 J;  5B0F A;  1NJX A;  2FB0 A;  2ZH7 A;  1JLE B;  3L4B C;  1U8W A;  5AXM A;  2UZA A;  4NA1 A;  2VPZ B;  1Y3J A;  3KK1 B;  4TY8 A;  1SKU B;  3GP9 A;  3M2U B;  4UY8 5;  1RWM B;  5D0R A;  3H5X A;  1RHU B;  1N5Y A;  2DKO B;  3KJQ B;  3D68 A;  2DHG A;  1TV6 A;  3C16 A;  4UOG A;  1S1T B;  2C2D A;  2B56 A;  3QPI A;  3CIM A;  4PUO B;  4UOH A;  3MCM A;  3NMR A;  1EP4 B;  4TYB A;  4JV5 F;  4LF5 F;  1WKK A;  2DCU B;  3FFI B;  3BYR A;  1RBO B;  4LFA J;  3SMZ A;  2BR0 A;  4WYL A;  2P6T A;  2VIH A;  1WC1 A;  2RQK A;  4ED6 A;  5HL7 Q;  5E3R A;  4ZP6 A;  4QPT A;  4LSL A;  5G0R A;  3EVM A;  3UD3 P;  1FDB A;  3G96 A;  1LQ9 A;  3RB3 A;  4KHP J;  5KG0 A;  2KJW A;  2VBW A;  2QA4 G;  1FFW B;  1P9Q C;  3HVA A;  5K20 B;  4B02 A;  5CYJ A;  2E29 A;  4ZVQ B;  2DR7 A;  1DAX A;  4U8V A;  4EO8 A;  2D3Z A;  3EIC A;  3EE3 A;  1MRO B;  1UTA A;  3U27 A;  1IKW B;  4TU8 A;  2BRL A;  4ITS A;  1U47 A;  4U67 Q;  4OZN A;  4Z2X A;  1S12 A;  2J7U A;  2N4D A;  2VG5 A;  2QTW A;  2AWZ A;  4QPX A;  1Z4U A;  2N7Y A;  3SDE A;  1F3V A;  3G4S S;  5KFE A;  1DQ9 A;  2BEF A;  1YJU A;  5D77 A;  3BS9 A;  1VFJ A;  3ISZ A;  1CUL A;  4WK3 A;  3M9N B;  4OZJ A;  1S1V A;  3LP0 B;  2YKM B;  2YPY A;  4XO0 A;  3AD9 C;  1HWJ A;  5A0Y A;  3MED B;  2V5H G;  2RT3 A;  4OYZ A;  4DUY F;  5KFN A;  1VYA A;  2MZS A;  3JQK A;  2W8L A;  4JUZ A;  8ATC B;  1TK5 A;  4JV1 A;  3KLF B;  4C0O C;  2AEM A;  4U6P A;  3KDO A;  3RRK A;  1NK4 A;  2BE2 B;  4ZPD A;  5KFM A;  5L1K A;  2JLE A;  3C46 A;  4OI1 A;  3LP2 B;  3ELH A;  2NR0 A;  1OPI A;  2K1R A;  2XZT B;  3BF4 A;  3HJV A;  2AT1 B;  4KH1 B;  1YI2 S;  3N79 A;  3M6V A;  2HK2 A;  1WWH A;  3I31 A;  3OJS A;  3UDC A;  1GTE A;  3DRR B;  4KGZ B;  4M1K A;  1F60 B;  4IR1 A;  4Q5V A;  2ADC A;  3UCZ P;  4Y2I A;  2PO4 A;  1F9F A;  1JLA A;  2CXE A;  1CPZ A;  1CC7 A;  3FQK A;  1S6Q B;  4RNN A;  1IBL F;  1UFL A;  4LFB F;  3WDO A;  1VQ5 S;  3BSN A;  4F3M A;  3R6L B;  2QFI A;  2O1P A;  4X4O A;  3DOM A;  1CJT A;  1L3V A;  1BLU A;  3QGH A;  2VB6 A;  1WUU A;  1VR6 A;  4I6W A;  2HQF A;  1U6Z A;  3FMB A;  4DL2 A;  1RT2 A;  1PKU A;  2B5J B;  4Y34 A;  3G8S A;  1RTD B;  2RU9 A;  4M5H A;  1ZPV A;  4IQM A;  3C6T A;  3QID A;  2R8J A;  3FDS A;  3CJ0 A;  2ZUG A;  4NLG A;  4ZPC A;  2VG7 B;  4UT4 A;  1JLQ A;  3DRX A;  4K5R A;  2YTC A;  4DUT A;  2U2F A;  1WEY A;  1SJ3 P;  3TRG A;  2M9K A;  4ETX A;  4QYZ J;  4O4G A;  4LUB A;  1MMD A;  1M1H A;  2D3O 1;  2CJK A;  2DD8 S;  2Y9H A;  4PWW A;  1Y5L B;  2XLI A;  5DGB A;  2C2E A;  2IYG A;  2JRS A;  3WX4 A;  4NI2 A;  4Z7C A;  5GAD U;  1T9W A;  2FYX A;  2Y1I A;  5K9F A;  5LMN F;  1RI7 A;  2EC2 A;  2OPP A;  4O3R A;  4A8Q A;  4OI0 A;  1B4S A;  4M5I A;  2XNQ A;  3M2R A;  3PKY A;  1C0U A;  4O3P A;  1JLB A;  5BXI A;  1SH3 A;  2R7V A;  4IO1 A;  4C8M A;  4TQS A;  2DO0 A;  3NCQ A;  1AUS L;  2PEB A;  3CD5 A;  2WAQ D;  2N3L A;  4RW8 B;  2M5Y A;  2JX2 A;  5KFC A;  2ZWO A;  3OQ2 A;  4CO1 A;  5B0A A;  2CQP A;  1UZH A;  4KE5 A;  4WF9 Q;  1EZZ B;  2IRU A;  3SQO P;  3ZO7 A;  2P9C A;  3G9C A;  1GX6 A;  2QX0 A;  4MKY A;  2Z2Z A;  3IR7 B;  5I3U B;  2IRY A;  4EI2 A;  2M8D B;  4JI0 J;  3HM9 A;  2DNL A;  1VQ9 S;  2F65 A;  1Q8L A;  5I3Q A;  5AE2 A;  3KUG A;  4IUF A;  3GIR A;  2V4R A;  1S9G A;  3BO4 A;  5F0W A;  4K4Z A;  2GNK A;  1R8B A;  1RAD B;  3OSN A;  4OZ2 A;  2YX4 A;  3LPY A;  4DG1 A;  2QA2 A;  3GJS B;  4FN5 A;  4DFM A;  4WII A;  3T6B A;  9RUB A;  2VHG A;  4LF2 A;  5DM6 Q;  3W2W B;  4JI1 F;  1JJ2 R;  1GMW D;  4P72 A;  1OO0 B;  2J8S A;  1C1C A;  4UUX A;  1SJ4 P;  4M5D A;  2ATL A;  2GVZ A;  1D1U A;  3MMA B;  2R8G A;  2Q3P A;  1M5K C;  4ZCL A;  2C3U A;  1IKY A;  4HYK A;  3D7S B;  2JJ4 D;  3QZ7 A;  2O5D A;  1U2C A;  2EPI A;  2BQR A;  4ZVO B;  1O6X A;  3QYY A;  1LWE A;  1UJ6 A;  4ANE A;  4R0J A;  2DK2 A;  5F8H A;  4HT7 A;  5D8H B;  1Q86 T;  2R7S A;  2AW0 A;  3NS7 B;  3H5U A;  3KLV A;  3M1V A;  2LXI A;  2DJW A;  1HR0 J;  2H5I B;  2WCX A;  4F0H A;  1Y10 A;  4F0M A;  2ZH6 A;  2EK6 A;  3IRX B;  4Q2M A;  1UWB A;  3R27 A;  5GAD I;  4Z37 A;  3QZ8 A;  2FVR A;  2A3J A;  3QT5 A;  1HD0 A;  4MFB B;  4ZJO A;  4DSE A;  1X0F A;  4WWS A;  1XC9 A;  4WU2 A;  3ZZR A;  1EQ0 A;  3H25 A;  2J6S A;  3M8W A;  2WBM A;  4C8Y A;  1N34 F;  2XZD B;  3GIL A;  3GB0 A;  3RBX A;  2HHT A;  2MQO A;  3FEZ A;  3OHA A;  3W9J A;  4CIO A;  2VA2 A;  1HMV A;  3CWJ A;  3SCJ E;  3V4I A;  2Q79 A;  1RT6 A;  1UEV A;  1FRM A;  3OXL A;  5CH7 B;  2HWI A;  2EW9 A;  2ERR A;  2QYC A;  1K0V A;  1YJ7 A;  4WFY A;  3D28 A;  1NPP A;  4N47 A;  4B3R F;  1ZS6 A;  7FD1 A;  4DL4 A;  3TZY A;  3TO8 A;  4KT0 C;  1RT4 A;  1B7Y B;  2KT2 A;  1S0O A;  2RUG A;  3T5H A;  1T9Y A;  5J2M B;  1GNK A;  5DS7 A;  2F63 A;  1Y00 A;  3G82 A;  4B3S F;  4DV6 J;  4C11 A;  4DR3 F;  3C66 A;  3RAQ A;  2E5I A;  3Q24 A;  1IJF B;  2RDJ A;  2JVR A;  2NQP A;  3CCJ S;  2CQI A;  1YWX A;  3GSI A;  4DDF A;  3HZE A;  2DR5 A;  2RHS B;  1X31 C;  3KLI A;  4ZP7 A;  2KXF A;  4D3H A;  3PNI A;  3LGH A;  1R0C B;  3N6M A;  2YWE A;  4ZPW R;  4GVL A;  1RTJ A;  2GHP A;  4ZN1 A;  4Y2A A;  1N32 J;  2V4J B;  3JTP A;  4ZCK A;  2XMM A;  3B4D A;  2NYI A;  1TZ0 A;  5B0D A;  2GW8 A;  2G2O A;  3I96 A;  4DZ6 A;  1NH7 A;  2FLO A;  1Q1K A;  4U8Y A;  4OIX A;  4CO4 A;  2QLF B;  3R5D A;  4RW4 B;  1SQE A;  2DGV A;  2ZEJ A;  5EX3 A;  2MXY A;  2BVZ A;  4NLW A;  2WW8 A;  5C24 B;  4WFN Q;  5M2R A;  4DV2 J;  4FF3 A;  3KK3 B;  2MKC A;  5B0C A;  4YHH F;  1S4F A;  1TKT B;  2NZC A;  1WHY A;  3OLA A;  4Q8F A;  5L38 A;  3AFG A;  1CJU B;  1WSR A;  1KRP A;  1SJ1 A;  1RAE B;  2ALY B;  4BHQ A;  1BQM B;  4K4V A;  3DDN A;  3U02 A;  1H2U X;  2IAJ A;  2R2S A;  3AT1 B;  2BRK A;  1KQK A;  4OI3 A;  4JI2 J;  3NL0 A;  3PCO B;  2X51 A;  1FNM A;  4XDD A;  3CCR S;  3DMJ A;  2YKQ A;  3PYF A;  1FI4 A;  1ZM4 A;  4DZD A;  2XEX A;  1Q8B A;  1XMB A;  2G0J A;  4OYO A;  3SZ2 A;  3LP1 B;  3CE8 A;  2XC9 A;  3L9Z A;  3UNG C;  1S57 A;  4K5S A;  2BAN B;  4RUA A;  4U7U D;  5K8O A;  1WC3 A;  5LL6 d;  2DGU A;  4ED5 A;  1WOP A;  1U24 A;  3ZXW A;  4DR1 J;  3UPF A;  3KJV A;  3BGO P;  3G86 A;  1GXU A;  3GV5 B;  1U6B A;  3VAH A;  1I94 F;  2KB2 A;  1UEK A;  2XG8 A;  1RWN B;  1IQZ A;  3UE2 A;  2HMI B;  2CAJ A;  3QO9 A;  5IT0 A;  2I1R A;  3DCA A;  1T7P A;  2FUG 9;  1D3W A;  1C4A A;  1UET A;  2GO9 A;  4IKA A;  1XEZ A;  4Q7A A;  2J0W A;  5DGA A;  3MUR P;  1RA6 A;  4AXJ A;  3CJT A;  1GX5 A;  4QZV B;  1K0T A;  3VGS A;  2KRR A;  3NWR A;  2ACM A;  3ZTQ A;  2VG6 B;  4L6V 3;  4DR3 J;  2Z2M A;  2WVB A;  1FKO A;  5B08 A;  3M4X A;  1E6V A;  4X4T A;  1N33 J;  5B0G A;  2YKN B;  2RKI A;  3W2V A;  4YS2 A;  5J2N A;  2I9S A;  2QSF A;  4LR8 A;  2W7A A;  3GQC A;  1M5V C;  3CCL S;  1R3N A;  3K7R A;  2B9E A;  4BCA A;  4ENO A;  5T7L A;  3R5G A;  3W5Y A;  4TU9 A;  1R0B G;  2HLT A;  4GKJ F;  1JXL A;  4K4T A;  1IUJ A;  4RR5 A;  2H54 B;  2RDI A;  3HHL A;  2OEJ A;  3CW2 C;  1D0E A;  3ZTO A;  2GMJ A;  2HGM A;  3CNQ P;  2UP1 A;  2G4B A;  3TAQ A;  2BJ9 A;  2KYZ A;  1S1U A;  2K3K A;  4AL5 A;  4OL8 A;  4RX6 A;  1NM2 A;  1TL3 B;  4YHH J;  3ZTS A;  3MM8 A;  5KG5 A;  2HHX A;  1DTT B;  3BN4 A;  1HD1 A;  3QNW B;  2NXE A;  1AZS B;  2VQE F;  1XNQ J;  2CG8 A;  3BEG B;  5A2Q U;  3SQG B;  2VUG A;  4ZVH A;  2DH8 A;  1Y0H A;  3CCQ S;  2ZH3 A;  3HK2 A;  4P2X A;  2CFX A;  2AX1 A;  4IG0 B;  3ULH A;  1IBM J;  1F5A A;  2IYI A;  1X4F A;  3PG9 A;  4CRJ A;  3VZH A;  4FF4 A;  3BM7 A;  2AJ2 A;  2BKN A;  1IXK A;  3AQO A;  4H4K A;  3TVZ A;  4MIB A;  4OZL A;  2BQU A;  3KDN A;  4PRF A;  3GCX P;  4F3Q A;  3MAQ A;  4ECT A;  3EGV A;  5HSP A;  4PQA A;  4CLT A;  2XCA A;  3RAX A;  1R8P A;  4M5G A;  3MM6 B;  1FRK A;  5I3P A;  2B3T B;  2UVV A;  4OV1 A;  4QU6 A;  1WF1 A;  4R8U B;  1RWX B;  3KNG A;  2CA9 A;  1TFW A;  2GGP B;  4NCG A;  5A6W A;  2ZHB A;  3FRZ A;  3R97 A;  5F8M A;  3RB6 A;  4DR5 F;  2Q6B A;  5LSL A;  2C3Y A;  1IKX B;  4LFC J;  3UVJ A;  2CJY B;  2R7U A;  1HNZ J;  4OX6 A;  4HH1 A;  2N82 B;  3H42 A;  1S10 A;  1X9S A;  1NK7 A;  3PYE A;  3D4J A;  2QL7 B;  3PXG a;  3KOA A;  2QL9 B;  5KFF A;  4HDH A;  1OQ3 A;  4KV8 B;  1RTI A;  1GTH A;  2HVZ A;  4AE5 A;  2GJI A;  4DPO A;  3OBI A;  2JEI A;  3PW4 A;  3T19 A;  3CCW A;  2HS4 A;  1YBU A;  3FSY A;  2RHQ B;  4TQR A;  5LXY A;  1TEL A;  2HFU A;  3OPK A;  2HFO A;  3BH6 B;  1DUR A;  3NMA A;  5FJ4 A;  1R6Y A;  2NS1 B;  1XMO F;  4F0K A;  1CJV A;  1ZTT A;  1Q7Y T;  3KG0 A;  5HQ8 A;  1TKX A;  4GKJ J;  2FHO B;  1P6T A;  2KFY A;  2IDE A;  3KLE A;  1G6B A;  4CLU A;  2KVI A;  2DXD A;  2IM2 A;  5ETS A;  2V8P A;  3H40 A;  3R7S B;  3OR2 B;  2XGQ A;  3ETM A;  1T03 A;  1GAO A;  4OHX A;  2C3O A;  4LSN B;  3BGF A;  5A8K B;  3PHT A;  2QT7 A;  1UEU A;  2NXU A;  3HSJ A;  4C3K A;  1SIW B;  4B3O B;  2B4P A;  2MPU A;  4ZVF A;  5I4M A;  3D66 A;  5KFY A;  2XMV A;  3HO1 A;  2HHU A;  1L5U A;  1FJC A;  1HA1 A;  5D4N A;  1S72 S;  2DXF A;  1DZ5 A;  3KUE A;  2KO1 A;  4LIW A;  1UAW A;  3HZG A;  2EFO A;  4OLO A;  4JI4 J;  5KOX A;  3ISN D;  1VQS A;  1JMT A;  1OPZ A;  3W5X A;  2EVZ A;  4ELU A;  4A8O A;  1TP7 A;  4H4O A;  4EEY A;  2ZH4 A;  2VJU A;  1SXL A;  3O8W A;  4QIW D;  4TY8 B;  2NPF A;  2W2O P;  3V2U C;  1TVR B;  1BHN A;  2NXC A;  3GJQ B;  3HKW A;  1U1O A;  1N5Y B;  4NLS A;  2AKW B;  3GJT B;  4IRK A;  1CG2 A;  4OHW A;  1TV6 B;  3C16 B;  3MM9 B;  4C3L A;  2YNG A;  1QDU B;  1G2E A;  2DCL A;  1NBE B;  2J9C A;  1RT1 A;  3MUT P;  1LW2 A;  1FJE B;  2L3M A;  2WB1 D;  4I7F A;  4K2X A;  2PDA A;  4N8N A;  2COL A;  3P5B P;  2VZ9 A;  5HMW A;  2CQD A;  5D0G A;  4I6A A;  3EZU A;  4NZ0 A;  1ROF A;  2DHX A;  4LSL B;  5G0R B;  4DEZ A;  3V4M A;  1HBU A;  2HRT A;  3DGP B;  2XMW A;  2FGO A;  2X1A A;  5L1J A;  1JLG A;  1NDL A;  3HHL D;  4OJ3 A;  2PEH A;  3M7V A;  5HQL A;  3NAH A;  3OL9 A;  4PG4 A;  2EI5 A;  3TAN A;  2XMA A;  1NK6 A;  3V5R A;  4CH1 A;  2VG5 B;  2DH9 A;  1U0S A;  2QLB B;  2MZJ A;  5C25 A;  5ETP A;  1RLD A;  3SDE B;  1GT8 A;  4OJ1 A;  3MMC A;  5CXT A;  4K4X A;  2HQG A;  4RNM A;  3SBM A;  1CUL B;  2XYP B;  1X5P A;  2UV8 G;  1KVJ A;  2HVD A;  2VU5 A;  1S1V B;  3AOC A;  3AAW B;  1QAY A;  4GO5 X;  4DSF A;  2CQ0 A;  1DLO A;  4PG6 A;  4Z7Y A;  5A0Y B;  2J8A A;  3ZTR A;  3CUL A;  2F8E X;  3T41 A;  2CQ3 A;  1OMS A;  3H98 A;  1NB7 A;  4N7T A;  1HBM B;  2JH3 A;  3I32 A;  1U8S A;  4HHH A;  3J81 U;  2ZJR Q;  2HQD A;  2W7P A;  4ECZ A;  1WHW A;  3KK2 B;  2LA6 A;  4PWD A;  1DHM A;  3SFU A;  2K1R B;  2CNO B;  4MK8 A;  4IRC A;  2GHW A;  4E2F B;  4X65 F;  1YDL A;  4GKK J;  1PJ5 A;  1U1M A;  1OY9 A;  1Q16 B;  1KS2 A;  1YBT A;  1JLA B;  2E44 A;  4OX7 A;  1N6Q B;  2YNH A;  1LKZ A;  3L7P A;  2H4W B;  1BWV A;  3C19 A;  3TAM A;  1MML A;  4U9R A;  5M2P A;  2W2N P;  5E5N A;  1CVJ A;  2VBZ A;  2E5H A;  3RZA A;  3BJY A;  1WJ9 A;  3DOM B;  1CJT B;  4EO6 A;  3HT0 A;  3MMJ A;  3KJF B;  2MKI A;  3W60 A;  5DG9 A;  3IWN C;  1PSD A;  1TL1 A;  5D6G A;  1H6K X;  1RT2 B;  4C8L A;  2MLY A;  1T9X A;  2L9N A;  4C7Q A;  4Q8E A;  3E8O A;  3Q8U A;  2L08 A;  1LWF A;  3GV7 B;  3C6T B;  4MKV A;  1PJ6 A;  4ZPV R;  3WHI A;  4JI5 F;  4OJH A;  2PA3 A;  1HFE L;  1JLQ B;  2AHO B;  1YG0 A;  1AUD A;  1TL7 A;  2UXC F;  5H1S V;  3M6W A;  4O4G B;  1P9Y A;  2DRB A;  1GFW B;  2HBY B;  2FZC B;  3I87 A;  3IAM 9;  1QLN A;  3NGR A;  4DV1 F;  1XN9 A;  2RVJ A;  2OTJ S;  4X84 A;  4IOA Q;  1KSP A;  3HVR A;  3QAU A;  2VF3 A;  4PZV A;  3BPS P;  1NUE A;  2C2R A;  2BJ7 A;  1SC1 B;  4DCP B;  3BR9 A;  2KHD A;  2C1E B;  4I56 A;  1SKR A;  1BQN B;  1Q8I A;  1U49 A;  1X4A A;  5ETT A;  2E5J A;  2QLJ B;  1JXV A;  4J9Q A;  2OPP B;  5HMY A;  5D78 A;  3NGU A;  4B9V A;  1RJJ A;  4WKY A;  1C1B B;  2YY3 A;  3S6E A;  1C0U B;  3N5F A;  3PW2 A;  3T6J A;  5L9N A;  4X4N A;  1I6J A;  3VAL A;  4DQP A;  4FPI A;  3WC2 A;  4QIV A;  4OYP A;  5D0E A;  4QJV A;  2DNO A;  1VGY A;  4DHV A;  4DFK A;  4ZLP A;  3SV3 A;  3BDP A;  4IG3 B;  1WEX A;  5EN1 A;  2RIL A;  2B7B B;  5FLX U;  2KDO A;  1S9G B;  3MR7 A;  1REV B;  4FKX A;  2BMB A;  2XO7 A;  2H9Z A;  1BWE A;  2VAS A;  2JL9 A;  4A8K A;  4DG1 B;  4OX8 A;  2MLX A;  2J76 E;  1LEO A;  4USU A;  5EWF A;  5K8M A;  3L7O A;  2ZD1 A;  3CGI A;  1SVD A;  3TZW A;  2B0G A;  2HIQ A;  5HK4 A;  4TVA B;  3P8B B;  4M5D B;  4F50 A;  3P96 A;  1S1X B;  1Z2L A;  5ETK A;  1IKY B;  2YBV A;  2JHE A;  4B9T A;  5LMU F;  3VQS A;  4C98 A;  3R1H A;  4DX7 A;  3J7A N;  1MN7 A;  5DO2 A;  1LWX A;  4CQ1 A;  4ZLJ A;  1Y7P A;  2O67 A;  5IQQ A;  4O3N A;  3M1V B;  3IMQ J;  4B17 A;  2HVH A;  4OI6 A;  1XR6 A;  3EDR B;  1YJ9 S;  1SKW A;  3DLH A;  2C2K B;  2D3O R;  1YRT A;  1H72 C;  2W8K A;  2DGO A;  4G3I A;  4HVZ A;  4W90 B;  3CJQ A;  3TQ1 A;  4CCH A;  1KN6 A;  2CYY A;  2DNM A;  1P8G A;  3VZI A;  1U1K A;  3EMT A;  2KJV A;  2W7O A;  4QIE A;  1S1W A;  2LYV A;  4C97 A;  4ECV A;  3BDE A;  1HMV B;  4CO5 A;  4FYW B;  3V4I B;  3LA0 A;  1K1S A;  1RT6 B;  3WIU A;  4HHJ A;  4NLX A;  4DV3 J;  5J1E A;  1VQN S;  4WFB Q;  1V3R A;  2BM0 A;  2K8G A;  4DQQ A;  3CCM S;  3OD2 A;  1VK8 A;  1Q5Y A;  5HAN A;  2YWW A;  4K50 A;  3EVW A;  2VH7 A;  4NXM F;  5IM0 A;  4P10 A;  3Q8R B;  3KLG A;  2CPJ A;  2AMC B;  1EKR A;  1Q7L B;  2AIR B;  2V8V A;  1RT4 B;  5KT4 A;  2BKO A;  3T5L A;  4DR7 F;  2QSW A;  4KJI A;  5DQG A;  2FVC A;  1H38 A;  4OV6 A;  5H9F J;  3LAN A;  3V6J A;  2DNP A;  3TNV A;  1YRX A;  5F3Z A;  4C11 B;  4MMO A;  1AW0 A;  1FD8 A;  2E5G A;  3PR4 A;  9ATC B;  4PPD A;  3RUB L;  3KMS A;  3D3B J;  4FF2 A;  1CBK A;  3KLI B;  2YX7 A;  3MMB A;  1YGY A;  1G3O A;  3PJW A;  5AXK A;  1RIS A;  2QGF B;  1RTJ B;  2XS7 A;  2C2M B;  2G1H A;  1B0P A;  3HHK A;  3RU0 A;  4MAK A;  4UTG A;  2E66 A;  1RU2 A;  1SH0 A;  3CJ8 A;  4LRB A;  5B0E A;  1PBA A;  2UU9 F;  1IN0 A;  4HAC A;  4C9D A;  1N5S A;  2IIH A;  4ZKA A;  2VDH A;  1NEE A;  3TA0 A;  3POT A;  1ZET A;  2DEI A;  1FX2 A;  3HF5 A;  4IQX A;  2XYH B;  4URG A;  3PIP Q;  3PZP A;  2KU7 A;  4O44 A;  1XK8 A;  3R5B A;  5T14 A;  2GJ2 A;  1AB8 A;  1KQG B;  2AD9 A;  3M32 A;  5DJB A;  2I38 A;  2MQ8 A;  2ZJQ Q;  2MHE A;  2XS2 A;  1DJ0 A;  1M1K T;  1DRZ A;  5G4D A;  1RTZ A;  2OI2 A;  3VV2 B;  3FZ2 A;  5HLF A;  1N54 B;  5KFV A;  3CCT A;  3PRD A;  4F4Z A;  3DYA B;  1SCJ B;  3I0S A;  3ILI A;  5HO4 A;  2BJE A;  4KYZ A;  1QE1 A;  4ED2 A;  3SIP B;  1IR1 A;  1Z1Z A;  2VON A;  2U1A A;  2VOO A;  2CJX B;  5KT2 A;  2L9D A;  3QMQ A;  3FBF A;  4A48 A;  4HEA 9;  4C8K A;  2LQB A;  3G6Y A;  4DUZ J;  2POK A;  2ZOF A;  3CJ3 A;  2UVW A;  1MU2 A;  3VGT A;  3VWS A;  3S1T A;  2IBK A;  3OVB A;  3MOJ B;  1ZM9 A;  3KHL A;  4CO0 A;  2IM1 A;  1F2H A;  1HQE A;  3NOC A;  3Q0A A;  1ZZN A;  5HJX A;  1VC5 A;  2VKR A;  1RAG B;  1HNV A;  7AT1 B;  3QO9 B;  2HZA A;  1RBL A;  4ZP8 A;  4IRD A;  1UFK A;  3R5A A;  4NLU A;  5LJ5 Y;  5CAA A;  1I5O B;  2PMZ D;  4WU3 A;  4YDD B;  2HHP A;  4MIA A;  2KZZ A;  3BZQ A;  3G8T A;  5H9E J;  5CYM A;  1SL2 A;  3LWM A;  2IJF A;  1KLM B;  2YVS A;  3ZNJ 1;  4DX8 H;  1UKU A;  4DU8 A;  1JKH A;  2DY9 A;  2CNL B;  2GS8 A;  3EM1 A;  1C0T A;  3CMQ A;  3GE9 A;  1T3O A;  4F4X A;  5KFG A;  2R7W A;  1T9V A;  1Q79 A;  4ER8 A;  1S7I A;  1FKO B;  4OYM A;  5EHH A;  4DQR A;  1E6V B;  4GC6 A;  1D9D A;  1VQK S;  3DLL Q;  2RKI B;  2XCP A;  2CPY A;  4DR2 J;  5IFM A;  2FVQ A;  1HWK A;  4L76 A;  3MAA A;  4GC7 A;  2UVR A;  3V6D A;  3P3D A;  3S8S A;  1N0V C;  1R7I A;  3DNC A;  5T7L B;  1DBD A;  5AXL A;  1HHT P;  1VDH A;  2Z2L A;  2RD5 C;  3PJX A;  3K59 A;  2R7T A;  5KFU A;  1RAH B;  3A1Y G;  3HHL B;  3PW5 A;  2KVQ E;  1FNX H;  2CG4 A;  1GXT A;  2OH2 A;  4O4R A;  2YXL A;  3HHD A;  3K5M A;  2CVI A;  1FVQ A;  4IH7 A;  3C6U B;  1S1U B;  5HRO A;  1DAR A;  1X4B A;  5E3P A;  2RNE A;  4M8L A;  1FES A;  4OX9 J;  3MM8 B;  2ROG A;  4JV2 A;  4NXN F;  2E1R A;  1F9H A;  3VAK A;  1VBZ A;  1Z2Z A;  3NGS A;  4LRA A;  3BN7 A;  4P71 A;  5KFZ A;  4AXI A;  1XQI A;  4XDC A;  1ZM3 A;  4KSE B;  4B3T J;  1EAR A;  4NLD A;  2RIJ A;  3HDS A;  3MF5 A;  1S97 A;  1XNR J;  3GYG A;  3HUL A;  3JQM A;  4F8R A;  4LJM A;  1FXL A;  4NX9 A;  2PGC A;  1A7G E;  4PKD B;  4FYV B;  3OSP A;  4XAK A;  3SXL A;  4DR6 F;  3HX9 A;  3NBP B;  1GXL A;  4BWM A;  3FRY A;  3MD1 A;  3ISN C;  4RW9 A;  4J9U E;  2YNI A;  3D6H B;  4X66 F;  4HH0 A;  1D09 B;  2RSQ A;  4CP5 A;  2IC3 A;  3GLJ A;  4EU0 A;  1XMQ J;  4CLL A;  4OZ0 A;  4K0K F;  1WC5 A;  4QQB A;  1VBK A;  4RPF A;  2OD6 A;  1T8E A;  3L95 X;  3PTW A;  4NCG B;  1PC4 A;  5GAG U;  1U09 A;  1J5O A;  1OQ6 A;  2CQB A;  4UUW A;  3UVJ B;  4C0B A;  1B64 A;  4FXW A;  3HFK A;  3NKY A;  2Q43 A;  2IM0 A;  5KFW A;  3Q8S B;  5J2P A;  4YR2 A;  4AL7 A;  2DB1 A;  2OUG A;  4P6Q A;  2WVD A;  4LQ3 A;  3UN5 A;  3EGZ A;  3QQC D;  3R2C J;  4ZVG A;  4LQ9 A;  2LU2 A;  1IKV A;  2J0X A;  3L09 A;  3T5J A;  3NS6 A;  1RTI B;  1WEL A;  2MZQ A;  3FCW A;  1SH2 A;  3DLG B;  3K17 A;  3N6N A;  3BQ0 A;  3HHL C;  4QR2 A;  1KP6 A;  3LW5 C;  4F2R A;  3KHG A;  1PYT A;  2FLN A;  1EQM A;  3GR1 A;  4DU7 A;  1BMQ B;  4M5M A;  1SC3 B;  3OL7 A;  2KFN A;  3Q89 A;  1L3U A;  2QYG A;  2XGP A;  1N5Q A;  2LEC A;  1BGX T;  2AJQ A;  2DTJ A;  1FDA A;  1SKS A;  1HWU A;  4M5N A;  2IBO A;  1U1L A;  2B9X A;  1TKX B;  3NNA A;  4P52 A;  4KKO A;  2DO4 A;  2F4F A;  3UQS A;  2ZBC A;  4Y00 A;  3GCW P;  1I1G A;  3NRB A;  4Y65 A;  5HP1 A;  1A6L A;  2ASJ A;  2R7X A;  4LF7 F;  1JJC B;  2JNJ A;  3C14 A;  1S6O A;  2BA9 A;  4XTT A;  2AJ0 A;  4LBI A;  3IS9 A;  1APS A;  4UW2 A;  3FCH A;  4LF4 J;  2V94 A;  1EJ7 L;  5CAB A;  3HVT A;  1CEZ A;  5CCM A;  1UCN A;  4NWB A;  2V8G A;  3FMW A;  2AYB A;  2DHS A;  3TJ9 A;  2C2O B;  3GFX A;  4DSJ A;  1LW0 A;  4KFB A;  1T05 B;  2XTJ P;  3O5T B;  1FEH A;  2DEJ A;  2OFH X;  1JB0 C;  5GAG I;  3AB4 B;  5IQ6 A;  3W62 A;  3NNC A;  5DZ7 A;  4KQZ A;  4XK8 C;  1MSW D;  3W3S A;  3W63 A;  5A8W A;  3GIK A;  3T1H J;  5DDO C;  2LQ9 A;  4BS2 A;  1SC6 A;  5A2Q Y;  1FRI A;  3AD8 C;  1Q78 A;  5DET A;  2R4F A;  1FJG J;  2WVF A;  3FK4 A;  4Y6I A;  3E01 B;  2YNG B;  4J9O A;  3CJK B;  1W26 A;  1NJI T;  4IO9 Q;  1RT1 B;  3M8P A;  1LW2 B;  4ELT A;  2FTR A;  4LRF A;  1P1L A;  2HHS A;  2QMX A;  1ZA2 B;  3I6P A;  3FSX A;  3TUP A;  3N01 A;  1GK8 A;  4RNF A;  3IN5 A;  2DNH A;  4NMX A;  3OVS A;  3UCU P;  1SJF A;  2FJE B;  1NSP A;  2HHV A;  4N56 A;  2ZNY A;  3F0N A;  3ZZ0 A;  3EXC X;  4GRS A;  3IP0 A;  2G0C A;  4HT5 A;  1HBU B;  5DZ6 A;  4CLP A;  2P8I A;  5CHC B;  3V81 A;  3UFC X;  3GMG A;  1X0P A;  2XS5 A;  3W1Y C;  1JLG B;  2FVS A;  2J5A A;  4TLR A;  2HHH F;  1JLF B;  1RWU A;  2KFZ A;  3I5B A;  1VLY A;  2XY7 A;  2J6T A;  3OTD A;  5D3G A;  2C28 A;  1DY3 A;  2OEM A;  4OZ3 A;  4I4B A;  1NKE A;  3BBC A;  3MPD A;  2W9C A;  3IGV A;  2XY5 A;  4K4U A;  2ILY A;  5A6P A;  5C25 B;  1HLW A;  5E33 A;  5D4L A;  3MMC B;  3N5B A;  2Y8Y A;  4EYI B;  4HLB A;  1JLC B;  4DSL A;  4B3M F;  2BV3 A;  1M1G A;  1LK7 A;  4QW8 A;  1DLO B;  1F5B A;  2ZC3 A;  2F1F A;  2XSJ A;  1UJ5 A;  2HWH A;  4ZCM A;  3I5C A;  4BDP A;  4ZVP B;  2CPF A;  4L73 A;  1MRO A;  5CD4 H;  1NH8 A;  1E6Y B;  1VRQ C;  4LF9 F;  2M8H A;  1UPP A;  3EXY A;  3PFO A;  2BDP A;  4PWD B;  5B09 A;  5KG4 A;  4ZVR B;  2HW3 A;  1EHW A;  1X9W A;  3HCX A;  5DG7 A;  4BC7 A;  3O2I A;  2KZM A;  1NO8 A;  3GJR B;  1K73 T;  4NRT A;  2EG2 A;  2UXB F;  1JJ4 A;  2YNH B;  1N52 B;  3OFH A;  3KLF A;  1YRU A;  3G6V A;  2QN6 B;  5FDL B;  2CAD A;  1LFP A;  2BE2 A;  2BYC A;  3MAH A;  1ZM2 A;  3KFW X;  3U7J A;  1KTV A;  4QBU A;  4DWI A;  4YUD A;  1FD2 A;  3A12 A;  4USK A;  3HD2 A;  1TL1 B;  1NND A;  5LT5 A;  3BSC A;  3TW0 A;  1HNX F;  3GFZ A;  2X1G A;  4MKB A;  1F9E B;  4NCA A;  1NXI A;  5D4O A;  1LWF B;  4CWB A;  1O51 A;  1WSV A;  4IDK A;  1WF2 A;  4DV4 J;  2D9P A;  5C42 A;  4DI6 A;  4Q44 A;  3U1M A;  3M30 B;  2AJF E;  2B4V A;  2IPO B;  1ZAV A;  3QAT A;  1TL7 B;  2ZDP A;  4ZIW A;  1NSA A;  1URN A;  3NGD A;  2GJF A;  3AJ1 A;  4K4Y A;  2QV6 A;  4O0I A;  1B7F A;  1WTF A;  3OFG A;  2J7W A;  2B8Q A;  2DPI A;  4JP8 A;  2CDQ A;  1BE4 A;  4ERD A;  4ATN A;  1S48 A;  3LAK A;  4FBU A;  1T9U A;  3P49 B;  5IOL A;  1RKJ A;  1NME B;  4DR4 J;  4PAB A;  2HHH J;  3CO0 P;  3M8Y A;  4J9P A;  2C2Z B;  4ZPB A;  1UL3 A;  1YSJ A;  4YME A;  3MM7 A;  1RHM B;  4QWD A;  4PWU A;  2JFD A;  2NXJ A;  3N4W A;  1RAC B;  2PFD A;  3WC0 A;  2A6M A;  3TOQ A;  2FHJ D;  2HBQ B;  4JV0 A;  2CWX A;  2HRY A;  2QZ8 A;  1HI0 P;  1ZZF A;  4A8S A;  4B3M J;  5L8R C;  3O44 A;  1UVI A;  3Q86 A;  2LEP A;  1FK9 A;  5LOQ A;  5GAH U;  1JWW A;  3H5Y A;  2EFG A;  4QWA A;  1K44 A;  3LTO A;  5IC4 B;  4GO7 X;  2HGN A;  2K7J A;  1FTC A;  2Y8W A;  2DNQ A;  1RQ0 A;  4IH6 A;  1PBU A;  4FYD A;  1LXJ A;  1RT3 A;  2O01 C;  4CLY A;  4N76 A;  4ZOS A;  3TA1 A;  1YHQ S;  3OTO F;  2PC6 A;  1N48 A;  1KON A;  2ZD1 B;  3C3L A;  1KD1 T;  3J81 Y;  1RUS A;  3R5J B;  4IFY A;  3PRB A;  2ZM6 J;  3I82 A;  1S6P B;  3GPA A;  2VC1 A;  2ZKT A;  1J5E F;  1WAC A;  4ZPA A;  3T9N A;  1NHV A;  1FXD A;  3BBB A;  1H98 A;  1FO1 A;  2ZBP A;  3DKD A;  2OPQ A;  1IQT A;  1WF0 A;  1YKW A;  4IFV B;  2OJ3 A;  3UDV A;  2B43 A;  1M5P C;  4ZJQ A;  2BBE A;  4DV5 F;  2AGO A;  3OXG A;  2V4Q A;  1KHV A;  2HFV A;  4M5K A;  3HHE A;  1HNX J;  2P6S A;  4X4S A;  4NEZ A;  4NZ7 A;  3MR5 A;  1NK5 A;  3ZZP A;  1ARO P;  3EGN A;  5THW A;  3MMA A;  3H2U B;  1NRK A;  3V6H A;  4NA3 A;  4JV5 J;  4LF5 J;  1DTQ A;  3VAJ A;  2G9O A;  3PV8 A;  4ECQ A;  3FEY B;  5BYS A;  4G6V B;  2IJR A;  4ZK7 M;  3A8K A;  2CVE A;  3M2V B;  4E98 A;  1VS3 A;  2RE1 A;  1HNI A;  3GON A;  3TEH B;  4J91 A;  4YP3 A;  5K8P A;  4S0M A;  5J1E B;  3G87 A;  3IRX A;  1WHV A;  2FLP A;  2YWF A;  2Z2Y B;  2XZW A;  1SPB P;  4P7T A;  5IM0 B;  2RU3 A;  1U0H A;  2DR8 A;  3VGU A;  3OL6 A;  3H7H B;  5GAH I;  2CUY A;  3MD3 A;  3NLC A;  3THV A;  1S79 A;  2IFX A;  4IR9 A;  3W8G A;  1ZBT A;  1KLN A;  4W92 B;  2UUW A;  1QY7 A;  1QAX A;  3SCK E;  1KEK A;  4OYX A;  2QO3 A;  3DHW C;  1RE1 B;  3VAI A;  5KFX A;  2K7K A;  4HTJ A;  2KXN B;  3PY8 A;  3FUY A;  7FDR A;  2HQI A;  3PFE A;  3QGG A;  3TJA A;  1EAY C;  1KR4 A;  3H20 A;  2QEX S;  1FWL A;  2AEF A;  4DUY J;  3U1N A;  4QOT A;  2Q6C A;  4ZLL A;  4MJK A;  4ZMM A;  3JQJ A;  4W98 A;  1J27 A;  4GVB A;  2BUN A;  3PJ9 A;  2EBE A;  4MIW A;  1IBC B;  4DSI A;  2EXU A;  5LJ3 Y;  5JVG Q;  3BGL A;  3CJS A;  2EG1 A;  1NU4 A;  2ROP A;  4DX5 A;  3TP2 A;  1G1X A;  5ETV A;  3CCZ A;  2KG1 A;  3IRW P;  4U7C A;  2DIS A;  2MB0 B;  2ZDO A;  3BKT A;  2CZV C;  3MM5 A;  4KO0 B;  5IC6 B;  4HAC B;  4CNZ A;  2H65 B;  1UVM A;  1CQM A;  5FLX Y;  1RP5 A;  2W1B A;  4MK7 A;  4AQY F;  1U6F A;  1YJR A;  1WOO A;  3TAR A;  1IBL J;  2B4U A;  4TU7 A;  4E0D A;  1FRX A;  2M2B A;  2DBB A;  4LFB J;  3ZFV A;  2LU1 A;  3DDI A;  5K8N A;  4DLE A;  4NPO A;  3BR8 A;  2BE7 D;  1JJH A;  4JI3 F;  4RLE A;  5C2G A;  1H73 A;  3JSM A;  3CD6 S;  3D6F B;  4R25 A;  5HLF B;  2CPX A;  1R89 A;  2SXL A;  3JAM U;  1RTH B;  4KR0 B;  1VBY A;  3BB5 A;  2A0F B;  5L1I A;  3I0S B;  3SV4 A;  4CLF A;  2R2T A;  5KG6 A;  1YTY A;  4RWX A;  4IOC Q;  4V19 J;  1YX2 A;  1RAA B;  1TKT A;  3MR6 A;  1KQS R;  3ZZU A;  1F3F A;  3THT A;  4Y2C A;  2F5G A;  3K57 A;  1QD1 A;  4USV A;  4WTO B;  1UVK A;  1Q4R A;  4OZ1 A;  2ZNZ A;  1RWK B;  4XPC A;  1Y11 A;  2P9G A;  1MU2 B;  3UW1 A;  3K5N A;  3BGR A;  1K8A T;  5E3C A;  4C3M A;  4FKY A;  1BQM A;  1HIY A;  2JEG A;  4O23 A;  2MLZ A;  4OLP A;  4RUC A;  3E2E A;  2LEB A;  5ETQ A;  1HQE B;  5IZH A;  3T5K A;  1UPM B;  5LMN J;  3CCV S;  1UWA A;  5M2U A;  3M8R A;  4WP3 A;  2F4V F;  1HNV B;  2VFU A;  3OHB A;  5ETR A;  3V6K A;  2ZVS A;  4FVM A;  3H0P A;  2R8I A;  2HK3 A;  3DU5 A;  2AYG A;  3W8P A;  1I3O B;  4WIQ A;  2JWN A;  5HJY A;  3GYN A;  1CJK B;  2BM1 A;  5JUM A;  1S9E A;  1S9F A;  2L9W A;  5CYM B;  5DDQ C;  4NCB A;  4OI4 A;  2CPI A;  4Q45 A;  1JKH B;  3JXO A;  1RYR A;  4CTA A;  1C0T B;  4X4Q A;  4LVN P;  1F0X A;  1FNO A;  1X4C A;  1RK8 A;  1UVJ A;  2HMI A;  4JI6 F;  1BXN A;  4K8R A;  2QA4 S;  1U1Q A;  2PMW A;  2UUT A;  4J7C A;  3MAA B;  4Y3C A;  3V6D B;  5KFK A;  4JOU A;  2AX0 A;  3N0V A;  2BJD A;  3EUN A;  2VKZ G;  5KG7 A;  3E3X A;  3DLE A;  5F0U A;  1W25 A;  5AJ3 F;  2XWY A;  2LCW A;  4JI1 J;  4F4K A;  2ZH5 A;  4USM A;  1XR7 A;  5K14 A;  2WSF C;  1NHK L;  4CLK A;  5J2Q A;  3C15 B;  1M90 T;  1MLA A;  2KM8 B;  4LBH A;  3ZTP A;  1ZPW X;  2YKN A;  4F36 A;  1BC6 A;  3AD7 C;  2OFG X;  5U47 A;  3D0I E;  1HHS A;  3Q23 A;  5HRO B;  1N5T A;  4RW7 A;  4WBF A;  1B70 B;  1RAO A;  2LP4 A;  2OPS A;  1FXR A;  2HNZ A;  1MMN A;  2XHW A;  4ED3 A;  3PW7 A;  2GMH A;  3JS9 A;  3A8J A;  1VI7 A;  3PX6 A;  3UNY A;  4AND A;  4G1P A;  3QJJ A;  3MWB A;  3HSD A;  4Y2M A;  2W9B A;  2LXU A;  2G2Y A;  4I2Q A;  4TN2 A;  3JTN A;  1CSJ A;  1H2T Z;  3MOZ A;  3T1A A;  3PEH A;  3WX8 A;  4NRU A;  1V3Z A;  2UXD F;  4YEA A;  4H54 A;  4DV7 F;  4DV0 F;  4CI0 B;  3IC1 A;  2FZK B;  2VQF F;  2ASY A;  5GVQ A;  1TL3 A;  1N34 J;  3MFI A;  4RW9 B;  3UWT A;  2FD2 A;  2CQ2 A;  4DN9 A;  1LK5 A;  1WDD A;  3LWL A;  2NXN A;  4NLT A;  1WI8 A;  5HVG A;  2IC3 B;  1AT1 B;  5K5M A;  3UD5 A;  2WVE A;  3EPG A;  2AZ3 A;  2EWH A;  1AZS A;  4EGL A;  2I2Y A;  3TVY A;  2F9J A;  3J7Z T;  1MWQ A;  3QT8 A;  4JYA F;  3O1L A;  2DH7 A;  3PAC A;  5IWA F;  4B3R J;  2XBP A;  1FX4 A;  1J5O B;  1QSY A;  3HD1 A;  4UOF A;  4LT6 A;  4F02 A;  4P73 A;  5DQI A;  2RML A;  3BYP A;  3IG1 A;  2B4O A; 
#chains in the Genus database with same CATH homology
 3RJM B;  1PAU B;  3KJN B;  2H65 B;  4JB8 B;  1ICE B;  3EDR B;  2C2K B;  4LSZ B;  2HBQ B;  4DCJ B;  1RWM B;  3IBC B;  1RWK B;  1GFW B;  1RHR B;  1RHU B;  2HBY B;  3P45 B;  4ZVS B;  3GJS B;  3R6G B;  3R6L B;  2C2O B;  2DKO B;  1SC4 B;  3KJQ B;  4ZVR B;  2HBZ B;  1RHQ B;  1RWO B;  2CDR B;  1BMQ B;  3D6H B;  2CNN B;  2XZD B;  1RWP B;  1RWX B;  1RWW B;  3IBF B;  1SC3 B;  2H4W B;  1SC1 B;  2QLB B;  3GJQ B;  1RE1 B;  3GJR B;  4DCP B;  2C1E B;  5IC4 B;  4DCO B;  2CJY B;  3GJT B;  3P4U B;  2XYP B;  2QLJ B;  2H4Y B;  3R7S B;  3KJF B;  3R7N B;  2QL5 B;  1QDU B;  3D6M B;  2Y1L B;  3D6F B;  4ZVO B;  3QNW B;  2QLF B;  1I3O B;  2C2M B;  2H51 B;  1QTN B;  3SIP B;  1RHJ B;  2QL7 B;  2CNL B;  1IBC B;  2QL9 B;  1I51 B;  2CNK B;  1RWV B;  1RHK B;  2XZT B;  2CJX B;  2H48 B;  3NS7 B;  1NME B;  3R5J B;  2Y0B B;  5K20 B;  2HBR B;  3R7B B;  2P2C B;  2H5I B;  4ZVQ B;  2C2Z B;  4ZVP B;  2FQQ B;  2H5J B;  4ZVU B;  2XYG B;  4ZVT B;  1RHM B;  1RWN B;  2XYH B;  1PYO B;  1F9E B;  2H54 B;  3EDQ B;  2CNO B;  5IC6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...