3NS7B

Succinic acid amides as p2-p3 replacements for inhibitors of interleukin-1beta converting enzyme (ice or caspase 1)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
88
structure length
88
Chain Sequence
AIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title Succinic acid amides as P2-P3 replacements for inhibitors of interleukin-1beta converting enzyme (ICE or caspase 1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 88
sequence length 88
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2010-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 3ns7B00
1IBCB 1RWPB 2C2MB 2XYHB 2QL5B 2CJYB 1RHKB 3R7NB 3SIPB 3D6HB 3R6GB 1RHRB 2XYGB 4JB8B 2C2KB 1RWNB 3IBCB 2XZTB 1ICEB 2CNKB 2H4YB 5K20B 4LSZB 1BMQB 2C2ZB 1PAUB 1RHQB 1RWWB 4DCPB 3EDQB 5IC4B 4ZVUB 3P45B 2DKOB 3R6LB 1NMEB 1RHUB 1RWKB 2C1EB 2CNNB 3IBFB 3R7BB 1I51B 2Y1LB 1RWVB 1SC3B 2FQQB 3EDRB 1RHMB 3GJSB 3NS7B 2QLFB 2H5IB 4ZVPB 4ZVSB 3KJFB 3R5JB 2CJXB 2XZDB 4ZVTB 2QL7B 2QL9B 3KJQB 1PYOB 3D6MB 2QLJB 2H48B 3P4UB 4ZVOB 4ZVRB 1RE1B 4DCOB 1I3OB 1RWMB 3GJRB 1RWXB 1QDUB 1RWOB 3D6FB 1RHJB 3GJQB 3GJTB 1QTNB 2XYPB 2Y0BB 2HBRB 4DCJB 2CDRB 2HBZB 2HBQB 2H4WB 1SC1B 4ZVQB 2HBYB 3KJNB 2C2OB 2CNLB 2H51B 2H5JB 1F9EB 2CNOB 1GFWB 5IC6B 3R7SB 2H65B 2QLBB 2H54B 3RJMB 3QNWB 2P2CB 1SC4B
chains in the Genus database with same CATH superfamily
1GEHA 1YK9A 1M90T 3HSGA 3BGUA 4WPAA 1WUUA 3K57A 1SKRA 4UY85 3TYTA 5C5JA 3SSSA 2E7XA 4DR2F 3R1LA 4QOTA 2GIFA 2DNMA 3X3UA 2XMTA 5RUBA 3GWCA 4QYRA 3SCJE 4CLFA 2HGMA 4HL9A 4M5JA 4A8MP 2AX0A 2VL1A 5LXYA 4DSLA 3CULA 2CPIA 2NZCA 3DOKB 2ZD1A 2WAQD 2XBPA 3QT7A 1WEXA 2FB0A 4C48A 4MIAA 2OTLS 4TY8A 3AA8A 3LH2S 2D74B 2CUYA 3FFIB 1OPIA 2BE2B 2Z30B 3BBFA 1SJ3P 4XTTA 3ZTQA 4BWJA 1M5OC 2UVVA 2MKYA 4A8SA 2MHNA 3DOMB 4FXVA 2GO9A 1YJ9S 3L3CA 2JFKA 2HLTA 2L9DA 2OSQA 1K0VA 2OEMA 1WC5A 2ZKUA 3KLFB 1GX6A 3G96A 2DNGA 2HQDA 1FVQA 1Z4UA 1NK5A 3QATA 3JTNA 3NGDA 1QE1A 1I94J 3DHWC 5BYSA 1VC6A 1RAOA 2W8KA 5IQQA 2CQ4A 4LVOP 3CDAA 2YQ3A 3CSKA 2HQGA 1FF2A 4P7VA 4MKVA 1R89A 1BQNB 1FRHA 1EP4B 1GK8A 4RUHA 1R27B 3FGVA 3DXBA 1Q5YA 2V2ZA 1G1XA 2OFGX 5CA5A 3C16A 2XS7A 1HBNA 1N48A 3L7OA 4OYBA 2JC0A 1E6YA 4TLQA 4YY3J 4I69A 2W25A 1E6VA 2DGQA 4MK7A 2UZAA 3MUVP 3QRQA 2IDEA 5LMUF 3W5XA 4WYWA 4FF4A 3HSZA 2I38A 1U45A 5D3GB 3U27A 4DBQA 1VQYA 2W2OP 5IM0A 2YWFA 4ITSA 4NEYA 4K4VA 5IZHA 1F3FA 2YX4A 4FZVA 2KN4A 4GRSA 2B5JA 1T9YA 2IYIA 3CCZA 2QFIA 5DDOC 4QIEA 2U2FA 1R8AA 4X62F 3K5NA 4KHPJ 2LP4A 2QLWA 3UW1A 1NDPA 2BX6A 2G2ZA 5L1KA 3RRHA 2QIFA 3V6KA 1UAWA 1FO1A 4X65J 2LLZA 3GJSB 4CO3A 4O23A 1WDDA 2ASDA 1SQEA 3ZZ0A 5B0EA 4M5LA 1UEUA 4RNOA 4A46A 2DNPA 2J5AA 1CULB 2OELA 2IMWP 2GNKA 2QFJA 2F5GA 4K2JA 2HVDA 3CF5Q 5LM7E 4WIQA 4DL0C 3MMBB 1UPMB 1YI2S 1A9NB 4PXEA 1VQ6S 4ZIVA 4OHZA 2BE9B 5B7WA 2Q43A 1IR1A 4DQQA 5IQ6A 3CNQP 3G8TA 2R8JA 2HHSA 3W2WA 2VG7A 1ZAWA 3NCRA 4O4GB 1VQ4S 2CA9A 2CPZA 2EBGA 4E0DA 2P8IA 4CQ1A 1CS4B 2QN6B 1ICEB 5ETKA 3UN5A 2WCXA 4DV0F 1U49A 3EICA 4B9NA 4XIUA 2LMIA 2L9NA 3M9MB 1SL0A 3FRZA 1N56A 2VIHA 1OO0B 3MMAA 4KHMA 3OT9A 7FDRA 4USKA 5A8KB 4PYDA 2OPPB 1RHMB 2HHVA 3RGIA 4DPUA 1S0VA 3CWJA 4ZHRB 4ZN3A 2ILZA 4KV8A 3R5GA 4CLUA 3IM8A 3H42A 3E01B 3IBWA 3J7A1 4I7FA 1T9UA 2HWHA 1NNDA 4KRWA 1FX4A 2HQ3A 2HHHJ 4A4JA 1FXRA 2J7UA 1B0PA 2P9EA 4WCEQ 3OL8A 4IDKB 3M8RA 2OSRA 3SFUA 4DR3J 1VBZA 2H51B 4JI4F 5F3TA 3CCJS 4PQUB 1AFJA 1RJJA 3BBBA 1RCXB 2MKCA 3QSIA 3GQCA 3H25A 1JLAA 4U8VA 4WFBQ 2UXCJ 2FJDB 4I64A 2FIUA 5GMEA 1QJHA 3DM2B 1L5UA 3QO9B 3DFEA 2KT2A 1VRUA 2XY6A 3MTKA 1VHFA 1CVJA 2W4DA 3I5AA 4B3SJ 4BC7A 3E3XA 2Y0SD 4DV7J 1RDRA 3DLGA 4Q8EA 3T5LA 4JYAJ 1DQ8A 4WFZA 2XB2D 1VQOS 2VDIA 2QEXS 2I5JB 3T6BA 3J80U 2PI4A 1QAYA 4JI0J 4KKOB 5KG7A 2RKIB 5CZXA 4NLVA 5IV3A 3IN5A 3TUPA 1H2VZ 2PI5A 4Y3CA 5AT1B 4Y2CA 3PEJA 2EK1A 3MEEA 5LT5A 3K2YA 4OI3A 1B7FA 1ZYQA 2KTQA 4M5DA 5FD1A 2D69A 3AJDA 2ZUGA 2AEMA 4AT1B 1IBCB 2MQMA 4DUZF 1SKUB 3HXMA 2N4CA 2ZNYA 4NYOA 3O8WA 2V4JB 2QLXA 1LFWA 3SYZA 5K8OA 4QR2A 2QLFB 4K4TA 4C3KA 4P72A 4JI3J 3W64A 3IAS9 2B6AB 2VG5B 4YR2A 2BANB 4ED7A 5C25B 3G6ES 1X7VA 2FHMA 4IRCA 3OXFA 1NPRA 5CCMA 3TARA 3D0GE 1BC6A 3M32B 1REVA 2G1DA 4OHXA 5KT3A 3FQLA 1ZA2B 4JI1F 1HR0F 4FF1A 2GC8A 2LQ5A 2PSZA 2R42A 4ZVGA 2J9EA 1H0HB 2XWYA 2OI2A 4QIWD 2HNYA 2AT1B 2H54B 1OIAA 1NK0A 4K0KF 4X84A 4AXJA 1RCOB 3CC7S 2BOPA 2GQ2A 3D1OA 3V81A 2RQMA 3LGMA 4DQPA 4NZ7A 2EFVA 3C14A 5KG3A 3QSYB 1IBLF 3DMJA 3IGVA 3KK3B 2EC0A 4AL6A 4K4UA 4ELVA 1TV6B 1S1TB 3WIUA 1S9FA 3CPWR 1UJ6A 4C0HA 5HP1A 3EYZA 4JI5J 1NPKA 1B70B 3DRRB 2QJ3A 1X8DA 2HZCA 2OTJS 4IFYA 2XCAA 3BPSP 3OL6A 5LJ3Y 4KPYA 4Q0BA 5DZ7A 4JI2J 2XO6A 4P2XA 3WC2A 4B9SA 3G86A 4I6WA 3R5BA 3BQ1A 2YWKA 1S0MA 2YWHA 4NL5A 4DCJB 2M4MA 1J5OA 4YHHF 2H4WB 2XMAA 4B17A 1RBOB 1OMSA 5DGBA 3KLGB 2CNOB 1CQMA 1RACB 2X1BA 2BQRA 2QE5A 1VR6A 1HQUB 1VI7A 3N28A 1G4CA 3SIPB 1XERA 5KAKA 2WTFA 3M30A 3EVOA 3MM7B 5H9EJ 1F9FA 1M5HA 1FWKA 3IMQJ 4LT6A 1DLOB 1NHKL 3R2CJ 5EGYA 3CCES 2A1BA 4ID5B 3TZZA 1U1LA 5A8RB 4OZ0A 4V1Ak 2VF3A 3T9NA 5AJ3J 2LEAA 3DOKA 2UXBF 1UCNA 4HEA9 4L3NA 4DUYJ 4QWDA 4DQIA 2W2NP 4L6V3 4IH5A 2QL9B 2VPXB 1IQZA 2LQJA 1WF1A 2BJ9A 3D3CJ 3B4MA 4AXIA 3NKYA 3KHRA 3FFIA 2RUSA 2JEIA 2KB2A 3OQ2A 4ZVEA 1SXLA 3CCTA 2DNQA 1ZZFA 4W4MA 2ZH1A 3AQOA 3RB6A 2OEJA 3DOMA 3WZ0A 2E5IA 2K1RB 2UV8A 3AQPA 2VQEJ 2MQPA 2HBYB 1FVSA 2DT9A 3KLFA 3GYNA 1OS5A 3MGJA 1Q8IA 3W61A 3W2VB 3NWGA 4OYAA 4P7TA 1RWPB 2JJ4D 1IWAA 5JVGQ 4JI7J 4B9LA 5KG1A 1WG1A 3PEHA 4NRTA 3D6TB 3DU6A 1Z2ZA 1HWKA 1P9QC 2MGZA 5KFBA 1BQNA 1EP4A 1RT2B 3JXOA 3L9ZA 3M8ZA 2AKWB 3G6VA 1VYAA 4HYKA 1TKZB 3ULHA 4OV6A 2YKAA 1O51A 3U1MA 4G65A 2C2DA 4YOEA 2R7VA 1O0PA 2IRXA 3ETOA 2JFDA 2GO8A 5E3CA 1M1GA 1ACMB 1R31A 5A2QY 3MM5A 5ETPA 1S4EA 1WC1A 1M5KC 2HFOA 4K4ZA 1NJIT 4XO0A 3G6YA 5D3GA 3BZQA 1NJZA 2OFHX 3BR8A 2ZJQQ 3HVRA 2BRKA 1BWVA 4BS2A 1SI9A 3SV3A 3V6DB 3MECB 4CCHA 1VMBA 2EFPA 3PJWA 1ZM4A 1GTHA 2QSWA 5IFMA 3DLKB 3R8YA 3BH7B 1MMNA 3TANA 2OUGA 3MMCB 4WFNQ 3TUIC 3KLVA 1OPZA 2KM8C 3PYFA 2B4VA 2M2BA 3JSBA 2BM0A 1RTIB 3FBFA 1CULA 4N56A 4TQRA 3G4SS 4ECZA 1CQNA 1WI6A 4DFKA 4C9DA 1YJ7A 1AXQA 1AB8A 5AE1A 3MMBA 3M1VB 3U1NA 3UDVA 2DGOA 4OQJA 1PBUA 1FESA 2J7WA 1KTVA 3KG1A 1RWOB 2VJVA 4DV4F 3AXMA 3PV8A 1VQNS 4B08A 1HWLA 3Q22A 3QRPA 4K59A 2AD9A 4GVLA 1RYRA 2ERRA 2V9WA 1A0OB 3GPAA 3Q8SB 2AJ4A 3MUTP 2IIHA 4ZLJA 2QYGA 2E5LF 2UUAJ 4B3OB 1LW0B 3DCAA 4DR2J 3G82B 3ENVA 2MZSA 2BZ2A 4NLXA 2IM1A 1WHXA 1QUPA 4JB8B 1OSDA 2B43A 2WSFC 5BJRA 1N0UA 5D4LA 1S1WB 3I55S 4OX7A 1AA1B 4NCGB 1RA7A 4RNFA 5A8KA 2Y1RI 2OPPA 3T1AA 1YGYA 1B99A 2J0SD 4NMLA 5L1LA 4F04B 3G87A 5KFQA 1CC8A 1I51B 2FC9A 3LGNA 4C3MA 2L9WA 2ALYB 3LWLA 3CDWA 2H5IB 1Q0NA 3E01A 2YKOA 4NASA 1NSAA 4RW7B 3D1QA 3M8YA 4PR6A 3TVZA 3I9V9 1TKTB 5E3AA 1FD8A 4PPDA 3JTPA 4IDKA 1VIOA 2JDJA 1N36F 4X4SA 4L73A 3HHEA 2FVQA 2IVFB 1NJXA 3OV7A 4J37A 2JLFA 3LWMA 2R2RA 1ZM2A 4NLWA 3BO4A 2YX7A 3D0IE 4RWXA 1OY6A 1RT6B 3DM2A 3CB4A 5DG8A 3QO9A 4UZCA 1S49A 1MLAA 1UJ5A 4DL5A 4HTJA 1NB2A 3KG0A 3OR1B 5EN1A 2E5JA 4O0NA 4E2FB 3VGUA 2H1YA 2V8GA 4NPOA 1GMWA 2F40A 4FDFA 4R5PB 5D77A 5KFUA 4YB6A 3C6UB 2I5JA 5GAGU 2F8MA 2OPSB 3RAXA 2WVDA 2QA1A 4KKOA 3NRBA 2RKIA 3GCWP 1XR6A 3BDEA 1KSPA 3W8GA 2FZKB 4ECSA 4X4QA 1NK6A 3TZYA 4XPEA 3H5XA 4M5HA 2E5HA 4WXWA 6FD1A 1NM2A 2ROEA 1S6PB 4KY3A 1U4BA 1Y7PA 3I4PA 3MPDA 4PG5A 2R7XA 3QYYA 2WZ1A 2EWHA 5HVFA 4H4OB 4EO8A 3M2RB 4X62J 4MYUA 1TUWA 5LSRA 2J6SA 2QL5B 2C2KB 5ETNA 1AYEA 1PSDA 2XS5A 2M8HA 4ZP9A 2LA4A 2J6TA 2V4JA 2D3OR 1TL7B 4ZPWR 2ZBCA 4FYXB 5C2CA 2QT7A 3K58A 1GNKA 3I5BA 3E2EA 3PG9A 2B6AA 2VG5A 2BANA 1A7GE 5IWAJ 4Q44A 4M5GA 2WVBA 4CLTA 3LGHA 1ZPWX 2V50A 5ITHA 4RW6A 4ES2A 1Y5LB 3HZEA 5KG4A 4RPFA 4AE5A 5IT9Y 4OL8A 3M32A 3FEZA 1IBMJ 3RBDA 4ATNA 4ZITA 2E9ZA 1EKSA 1TUVA 4ELUA 2KL8A 2MZTA 2MQ8A 3OW2R 2R7SA 2P5VA 2YTCA 4F0HA 3EGWB 4DS4A 5HATA 5M2UA 3RB4A 4PWDB 3DI6B 3QMQA 3N01A 1SC4B 2GW8A 4HT7A 4DR6F 2WONB 1TV6A 2O3DA 1S1TA 2FVPA 2X1GA 1QY7A 1WJ9A 4HHUA 2DNYA 4URQU 1PBAA 2J0QD 3DRRA 3SMZA 3FCHA 5GAGI 3D54A 5T14A 1RAJA 3BV8A 2F4VF 3BN4A 1S0NA 3BR9A 2AJ2A 5AXNA 1TKDA 3HT3A 1PYTA 2GV1A 1HW8A 2XI2A 1SJFA 4ECVA 1AUSL 2NUUG 2ZWOA 4IG0B 1RWXB 3V5RA 1KTQA 1RKIA 4JI4J 3Q24A 2MY8A 3I82A 3NP5A 1R8BA 1W2IA 3KLGA 1NK8A 1N33F 4WE1B 4TQSA 1HQUA 2J7KA 4CT8A 5AE3A 5AXLA 3PW0A 2BJDA 1ZM3A 4WKYA 4DU8A 3TR5A 4HTIA 3MM7A 4WK1A 2P2CB 5B0FA 2LYVA 1DLOA 2CJYB 5KFEA 2Y3YA 3HHDA 4KGXB 5A8RA 4I2QB 4Y34A 2AQ4A 2BDPA 4LF5F 1UJ4A 2N4DA 4NLTA 5J2MA 1ZTTA 2MQNA 4C6AA 3SZ2A 1NZ8A 4CO0A 4CTAB 1FI4A 2RUGA 4XAKA 4NYZA 2R4FA 4DX6A 3T9ZA 4J9NA 5KFRA 4AYBD 4IOBA 3NNCA 2F8EX 2DNNA 2HEKA 4URGA 1N5QA 2K1RA 2HQCA 5E3QA 1JWWA 3W9IA 3ZNJ1 3LA0A 1VQ9S 3EZ5A 5KFGA 4YP3A 3RW7A 5K8MA 2CG8A 2AJFE 5D15A 2YVSA 4MKBA 1DAXA 3A8KA 3W2VA 3W7BA 4LMZA 3A12A 4YDDB 1LXJA 4OZ2A 4F4WA 4NLUA 3EPIA 3ICLA 4KGZB 4FYDA 2XGQA 3ZZZA 2CQ2A 2DO0A 1RT2A 2F1FA 3KNAA 2DGVA 4LF8F 5CXTA 1TKZA 1SVDA 4ZP6A 1HPZB 5GAEU 3B6BA 1U2FA 1WTBA 2V67A 2HS4A 4CM2A 3EVWA 1WNEA 2R8KA 2HVEA 3M9NB 1BLUA 2DB1A 1VK3A 2ZH2A 3U02A 2FJEB 2NUHA 1Q4RA 2R7RA 4KSEB 4C8MA 1KLMB 1DQAA 4DX8H 5EX3A 4A47A 4OX9J 2HK3A 4K0KJ 2ZJPQ 1C0UB 2JLGA 1FKOB 1GH8A 1RAAB 3MECA 4WZQA 4OYXA 3NMAA 5E3PA 3SI8A 3KUEA 3OLBA 4ZPBA 3DLKA 4K2XA 1F5AA 2H65B 1RGVA 5KFLA 4E98A 1NHVA 2NXEA 1R6VA 4C8NA 5C7PA 3ZO7A 3LF0A 3MMCA 2D1CA 2Z57B 1YJRA 1V5IB 4FF2A 1HI1A 1UA1A 2VKRA 1FKPB 2FHKA 3LP2B 3W65A 4PXCA 4OFZA 4RUBA 1RTIA 1TL1B 2R7QA 3O44A 2BQUA 4M8LA 3R6LB 4AQYJ 2R8HA 1KQSR 5MAOA 5E7OB 5KG5A 2VB6A 1FE0A 1WC6A 4J9VA 3C15A 3PTWA 2P9CA 4UF4A 2PMZD 5KFTA 3TI0A 1F1BB 3EDRB 2DH7A 4X4RA 5KT6A 2R7UA 1RT4B 3OHAA 1N5YB 3OXLA 3BSAA 5F9NA 2DNHA 1D09B 1BE4A 1PYOB 2IJNA 2VQFF 3ETMA 4DEZA 4YHHJ 2LU2A 2N3OA 4BBYA 3U1LA 4DR4F 4B3OA 5IXUA 3FEXB 3PHEA 2FLNA 3PZPA 3G82A 2CQDA 2CVEA 2VZ9A 1WORA 1Y5IB 4YB7A 2B8PA 3AAWB 3BPDA 4QU7A 1WOOA 3Q2SC 5BYRA 5I42A 1XEZA 4NZ6A 3RG6A 4ICLB 1S1WA 4A8OA 1J5EF 3KMSA 2HVZA 4NCGA 3PKYA 1URRA 2V2QA 3T6JA 3B82A 2DIVA 1RA6A 3P96A 3Q8PB 2YKMB 1UL3A 2RDJA 1NJWA 2UXBJ 5GAEI 4QPXA 3H2LA 1QAIA 3BEGB 3I0SA 4DX5A 1SH0A 3QQCD 3CVKA 2CZ9A 4MK9A 4RW7A 4JV0A 2FZCB 2FTRA 4DU7A 1RAIB 2E9RX 4ZCKA 5A76A 1TKTA 1JJCB 4HACA 4LRBA 4GKJJ 4NLOA 2XZWA 5IS2A 4EWTA 2QTWA 5B0CA 2YWEA 3PHTA 5F8LA 1HLWA 1FRJA 5CAAA 3GG1A 3AT1B 3H5YA 5F3ZA 2JX2A 1U1KA 3TAPA 1HNWF 1RT6A 3GG0A 2HKEA 2CNLB 4C8YA 1T3OA 5KT4A 3THPA 2X3DA 2CDQA 1Q53A 3MCOA 3FSIA 4FBTA 3OR1A 3NNHA 1A6LA 1K44A 2ZZTA 1VQSA 2UXDJ 4PXDA 1D0EA 1HWUA 2M5YA 3HD1A 4DV5F 4DR7J 3HFKA 9RUBA 4LIWA 1ZOTA 2EI5A 2PC6A 2CKWA 3VAKA 1VRTB 4R5PA 3LUYA 4CZCA 3Q2TC 2OPSA 5IC4B 4LQ3A 3MWBA 4MFBB 1ULRA 2R3VA 2FJBB 3I32A 2GJIA 1S1UB 3OVAA 3R27A 1PJ5A 4USTA 1KRPA 1RAHB 1QAXA 4Z37A 5DJBA 2EPIA 2XY5A 3GJRB 1X9MA 5E3RA 4DL6A 2E1AA 3N6MA 2RDIA 4PUOA 4RU2A 1D9DA 3CGIA 4DS5A 1TU0B 2Y1JA 2V0NA 2JC1A 1YJTA 4ECTA 4ANEA 3UNGC 2LXIA 1IKYB 3VAJA 2A6OA 3OPKA 5I4MA 2RNEA 1FNXH 1HBMA 1AFIA 3M2RA 1JMTA 2IMOA 2RE1A 3OSNA 3MCMA 4OI1A 2XHCA 3HFVA 3QGGA 4V19J 5GMDA 1IQTA 4C8ZA 1DURA 4IOCQ 2QYCA 2DH9A 1TL7A 1URNA 5CYQA 2X7IA 2R7WA 4RW9B 3CJKA 2LFVA 1KQFB 2I0XA 4Y2AA 1HYSB 3IFEA 1D8ZA 1WC4A 3HHNB 1C0TB 1XK8A 4HHHA 1YBTA 3AD7C 4HLBA 1WWHA 2DR7A 1NDLA 4P9SA 1LWXA 1QD1A 1NPPA 1OQ3A 1X4FA 4NXNF 2V5HG 4NI2B 2IFXA 4C11B 3GMGA 3HULA 4ZVOB 2NCKL 2AP6A 1D3WA 3NOCA 4Y2IA 4ZLNA 1Q7LB 3HHLC 2NPFA 1FFGB 1S48A 1RB0A 2E5LJ 2HWIA 3CCRS 4P73A 2VPWB 2Z2LA 4TYAA 1NU4A 1ROFA 4DLGA 4PWDA 1H98A 2KM8B 3DI6A 3MAQA 1UVLA 4B9MA 3UI3A 3CD7A 4DJBA 4ECXA 3PVXA 4F4KA 4OI2A 3IS9B 1ZAXA 1FX2A 3UWTA 1Q16B 3R7NB 3UDLA 2UVWA 1RTHB 4U8YA 5HBMB 3B8HA 2ROPA 3OJUA 2CPFA 2VH7A 3QT5A 1RTJB 1P27B 4CRJA 3IR5B 1UA0A 2JEGA 2EEYA 2VDHA 2D3O1 2V2VA 4F8RA 4NX9A 1CC7A 4IKAA 1N36J 5F9LA 5H1SV 3DLJA 2KT5A 3N6NA 4PABA 2CQPA 1HMVB 3HKWA 2EKNA 2GHWA 4LF7F 3FJ2A 3UCZP 1UWAA 2RJZA 4M94A 4KYZA 4AUKA 4LBHA 4KE5A 4WE1A 2EKYA 4ILMA 4LF6F 4EUVA 3RAQA 2WRMA 4OYOA 3DLLQ 4ED8A 4F4ZA 4LFCF 3RR8A 1QVGR 3HSDA 3UNYA 3C8YA 4K4SA 1Y9OA 3G2XA 1PG5B 1DTTB 1APSA 3PRBA 3ZFVA 5HMWA 1R0AB 1Y5NB 4JUZA 1ZA1B 4I2QA 1J2VA 3UR3C 5A6WA 5KT2A 1LWCB 4V19X 4OZJA 4J9KA 5JUMA 3P5TL 4CTAA 4L3KA 1T05B 1YBAA 2DNLA 2EFNA 1TK5A 3UVJB 1XIQA 1GMUA 4F3OA 3JSRA 3CJSA 1S5ZA 2V4RA 3KJFB 2HSEB 1YVFA 4QIGA 1SJRA 4UQTA 4YN3B 5FIIA 3TNVA 2EFGA 3FVYA 4J91A 2KZZA 4AL7A 5HLFA 4R0EA 2XMJA 4PCQA 4KO0B 2NR0A 3P6YC 1Y3JA 2QZ8A 3POTB 1F3VA 4J9UE 3CJQA 3PW5A 4WTOB 4LQ9A 4ZVQB 5D0EA 3T5JA 5CD4A 3Q86A 3IM9A 4KJIA 3QWPA 1XR5A 4ZVFA 1LNQA 1EARA 4DQRA 3VZIA 4LFAJ 1W2BR 2KYXA 5SZTA 4IG3A 1I5OB 3LQVA 1HPZA 5LXRA 2XLJA 2VFRA 4P74A 2HVIA 3MCNA 2OMOA 5DZ6A 4PG7A 2IA0A 4GO7X 1JJHA 5CH7B 4IYQA 3DYAB 3EX7B 3QT8A 1N52B 3FRYA 1RT7B 3H5SA 3MD1A 3PY8A 1GXLA 4USUA 4LR8A 4ZCIA 2IAJB 1KLMA 4IUFA 1U1NA 2DHGA 2R8IA 1FRIA 2BJ8A 3IXQA 2MZQA 1FDAA 1FKOA 1N8RT 2KFNA 1Y3KA 2XMMA 4EU0A 3M2UB 5J2QB 1VC0A 3L7PA 1YLXA 3KLHB 1F5BA 3VF0B 1RBLA 1JXVA 3VWSA 1QSLA 1K1SA 1R0BG 2V68A 2KFZA 3HJVA 3TW0A 1JIHA 1U7LA 1YBUA 4QU6A 5G0RB 3D3BJ 3HVTB 3HHLD 1FKPA 1X5SA 3LP2A 5EWEA 4Y2MA 3C2PA 4QW9A 1TL1A 4TVAB 4U67Q 4F0KA 3QT6A 1KDNA 1RWNB 2AZ1A 1Q82T 2HHUA 2F4VJ 1BQXA 4QPTA 3K8VA 3FUYA 4GKKF 2XULA 3H5UA 1HD1A 3OSPA 2I2YA 4WTYA 1RT4A 2NSCA 1N5YA 1B0VA 4EYHB 3LPEA 4CDIA 4U96A 2HFNA 4FBUA 5KFVA 1KNZA 4I2PB 3W3SA 5ETMA 3IR6B 2KU7A 1AROP 3DC2A 3M7VA 1LK7A 2GIQA 2QGFB 1RSCA 1KKHA 4ZVRB 4ENOA 3BGLA 3GYGA 2DRAA 3TVKA 4ZS6A 1TK0A 3GTYX 3BDPA 5EDWA 1MN7A 2LA6A 2MJNA 3HK2A 3AD9C 2XY7A 3K5LA 3KHGA 2HWTA 1S7HA 2BKPA 3PR4A 1B3TA 2QO3A 1PJ6A 4ICLA 5K14B 3PYEA 3CIMA 2ZBRA 1DJ0A 4LBPA 1U1QA 2VBWA 4RX6A 2MQQA 2HNZB 3AB4B 2YKMA 1RT3B 4K4XA 3LP0B 1Y4ZB 1X5PA 4LF5J 3GP9A 3IAM9 4ECYA 5HANA 1S57A 3K17A 1JLFB 3N0VA 3ENAA 2KZMA 5U47A 1RWWB 1U09A 3LW5C 2FHJD 5HK4A 2MQOA 1H7XA 2HFVA 4HDGA 3IA0A 1P1LA 4AL5A 2HRUA 3FMBA 4PXBA 4IH6A 3TVYA 3LANA 4C7QA 5J1NA 5KFMA 1JNZB 2EXUA 5K9FA 3ET6A 2MXYA 3M9OB 1FWLA 2E1PA 1X5OA 1H7WA 4N77A 3WX8A 1U02A 2RAQA 3J81U 1U2CA 4PG4A 5CD4H 2XNRA 3R3TA 2JHEA 2RU9A 2BABA 2IBKA 4M5NA 3BO3A 2JEJA 4XK8C 2G13A 4FN5A 1VRTA 1HNVB 3MAAB 4RW4B 2DR9A 3OUYB 4X66J 3HF5A 3KDNA 4MFBA 2JOQA 4M5MA 2KYZA 2VC1A 1WC3A 1TAQA 2DRBA 2QRRA 1XNRF 5D4NA 2W2PP 4J9LA 4ZIWA 4WWSA 4K8RA 1VJQA 4IR1A 3TA2A 4Z7CA 3CD6S 3N4WA 1VBXA 3TUJC 3MF5A 1ELOA 2QA4G 1SJ4P 2LECA 2WB4A 2FY1A 3FQKA 2GIRA 3AHPA 2CQIA 3BM7A 4RJVA 1X4HA 4Y6IA 4A8QA 1IKYA 3HT0A 1XNQF 2WVFA 2Z2YB 5HAOA 4LBIA 2JZ5A 2R8GA 3JYTA 4QWBA 2BQ3A 4HI1A 1RABB 5HQ8A 2J9DE 4FNIA 4KH1B 3GIKA 4ES3A 2W7OA 3NNAA 5HI7A 3FCWA 3JSYA 3W60A 2VFVA 3TZWA 1NDKA 1IWGA 2ZVSA 1XMQJ 4RW9A 2A2DA 2UV8G 2Z2ZA 1F9HA 1HBOB 2MSTA 4C98A 5F8IA 1S6QB 1QUVA 5JXSA 4DV3F 2B3TB 2W24A 1UETA 4CLSA 1C0TA 4HDHA 1JNRB 2HVHA 4LFBJ 1QVFR 2DXEA 4G6VB 4O3NA 4NI2A 4C11A 2KH9A 2GHVC 2V94A 2PMHA 2MY7A 4DR4J 3CJ4A 3VTIA 2CPXA 4I68A 3T3FA 3CD5A 2V69A 3IO1A 1G6BA 1QDUB 2FHOB 4LF4J 1UVIA 2EBEA 5D4PA 3DRYA 4DSEA 2K2PA 5JMNA 1WSVA 4NMXA 3GU0A 1DZ5A 3R9LA 3EGVA 3ZNUA 1J5EJ 4G1PA 1MWZA 2OPQB 3IS9A 3TAMB 5DQHA 3NGSA 5HBMA 4X4TA 4C0BA 5BYQA 3HP6A 1NLKL 3S6EA 2C22A 2W2MP 2AU0A 2RILA 3BJYA 1RTJA 3W62A 2E1CA 2LQ8A 2JL9A 2Q6CA 3KMQA 4IO1A 1FK9B 1H6KX 3F56A 4Q2MA 5L1IA 2VUGA 2IYGA 2VFSA 2GMHA 4USMA 1HMVA 2V8DA 3KOAA 1K1QA 1WHWA 2OJ3A 3QZ8A 3FBBA 1S9GB 2AMCB 3D2WA 3I5CA 3E8OA 5KOXA 3I96A 2GCFA 1HNWJ 3OHBA 1B0TA 2VA2A 3GR1A 2VBXA 5KT5A 4CIOA 2RVJA 5LOQA 3CT9A 2KT3A 3QFHA 1RT5B 1TL4A 3CJ3A 4EGLA 3M6XA 2FC8A 3LAMA 4DV5J 4HI2A 3DKDA 4EYIB 2PEHA 4OYWA 5A6PA 1S79A 2DEJA 4W90B 3FSYA 1LWCA 2NYHA 1TFWA 3EXYA 5M2PA 2I8EA 3ILLA 2W9AA 2ZUAA 3PFOA 2ZHAA 1T05A 3GIIA 1VHIA 3UVJA 1UVNA 2AZ3A 5CABA 4FVMA 2HPUA 3QIDA 3TX0A 4F02A 3OR2B 3UE2A 4X64F 1VDHA 3SV4A 5DDQC 1IKXB 2AYMA 4S0MA 2GS8A 4KO0A 4LR7A 3POTA 4PYAA 2EFQA 3FSXA 2YNFB 3VAIA 1SPBP 2P9GA 3PYGA 2CZ4A 2M52A 1NH8A 4UOFA 4U95A 3R97A 4P6QA 2AYBA 4N8NA 5J1PA 3TAQA 4MT1A 2GVZB 3CIZA 2B0GA 2W7AA 2M7SA 3PO5A 2AEFA 4L74A 1YX2A 2YPZA 4NCAA 4MTPA 2V6AA 4YY3F 3PX4A 2RDDA 3DYAA 4LSZB 2ZH6A 4ALZA 2C2ZB 4NXNJ 5KG2A 1X4CA 3BSCA 1RT7A 3OL7A 2BOAA 2DR6A 2FVSA 4UW2A 4C2MA 1RADB 4NWBA 2IAJA 4G3IA 4FPIA 1IVZA 3H7HB 2LDYA 5B09A 3TJ9A 4OHVA 2QL7B 2D3ZA 1G2EA 2PO4A 2IRUA 1V3SA 2UVRA 1GT8A 3M2UA 3VVUA 3B54A 4KB7A 4USWA 3UN2A 3KLHA 4ERDA 1N0VC 1SCJB 1Y0HA 4CYUB 2ATCB 2GQQA 2ASJA 1RHJB 3M8PB 1YTYA 1T9VA 1NUEA 3QAUA 3N5BA 1VLOA 3HD2A 4GVBA 2XMWA 3HVTA 3CJ5A 2F9DA 1CJTA 2HS0A 4RUAA 5BR8F 4A8KA 3K89A 3CCMS 1SH3A 4EBCA 1Q5VA 2XNQA 2UUCF 3DOLB 1CJVB 2K06A 2LCWA 3ZTPA 3TA0A 4WJBA 3HHLB 1REGX 1YJWS 1HBUB 2KI2A 3TA1A 1WTFA 1GXUA 1Q78A 1WG4A 4I2PA 1EZZB 1NH7A 2GJFA 4LF7J 3KJVB 2FLPA 1V3RA 2ZC4A 1HD0A 4LR9A 1SKSA 3M6VA 4B3RF 1S9EB 4DV1F 3TQ1A 1PC5A 3MAHA 2VU5A 2IJRA 2WW4A 1TMJA 4K7QA 4P10A 4DL4A 3N5FA 4IFVB 4ZJQA 2DGTA 1Y10A 3KFWX 3QJLA 3BGOP 3EJMA 5K14A 2CG4A 3ADAC 2YWGA 2LU1A 5F0WA 2RU3A 2HNZA 1H72C 2FYXA 4OIXA 2DK2A 1RT3A 3LP0A 2OD4A 1RTDB 1NSKL 1XC9A 4OYMA 2GHPA 2KVQE 3H4DA 4QQBA 1JX4A 3FC9A 1JLFA 1V9OA 4RUCA 1C4CA 3MM8B 4DN0A 1N88A 1S59A 2Z58B 1JK9B 2HS3A 4FYVB 4N5SA 3P45B 3V4IB 1CG2A 3GV5B 3RRKA 4MKYA 3NWRA 2M3DA 1U25A 4FS2A 3W8PA 3FNNA 3RYLA 3OBIA 2RIJA 4RU9A 1YQHA 4WP3A 3AJ1A 3EZUA 4CH7A 1KN6A 3KK1B 3HMJG 3GE9A 5CQGA 1QE1B 1LW2B 3J7AN 8ATCB 3A1YG 2VASA 2XYPB 1IJEB 4LF9J 2MKSA 1K47A 4ZN1A 4A8YA 3CCLS 3KLIB 1YHQS 2IBOA 3SCIE 4DV7F 2PA3A 4USJC 1HNVA 1X0FA 2LKZA 1ZH5A 3MAAA 4RW4A 2ATLA 4JYAF 3R7SB 3VGTA 1RQ0A 4QIFA 1E6YB 2VONA 4JI0F 2MKJA 3FBEA 2BM1A 3R5AA 4FYWB 3RAMA 7AT1B 4A8WA 3BKFA 3ILJA 1IN0A 4CLLA 2AJ1A 3DLBA 2NZ4A 2C3UA 5KOWA 4DOZA 1FDNA 1R8PA 3QRRA 2B5JB 4ID8A 3PRVA 3MD3A 2VHGA 2DNRA 1ZZNA 4TN2A 4OZLA 4P2MA 1WKKA 1S6UA 1X4AA 2HAFA 2H3EB 3PR5B 5KG0A 2MTLA 2FJVA 1HBOA 2CJ9A 2CQ3A 2OGUA 1S6QA 4ED0A 1WOSA 4BWMA 1Q86T 4JI3F 2QLBB 2ZOMA 2W4PA 4O3PA 4ECRA 1SC6A 3EVMA 5EHHA 3CEDA 3KWMA 4USHA 1KQGB 1RZMA 3AOAA 3UD5A 2W9CB 1I1GA 3HHKA 2E5GA 5FLXY 1FRMA 2MMYA 1JJ4A 2HYIB 4N7TA 4NLPA 4XDCA 1YKWA 1UVKA 2YNHA 2B9XA 2HQIA 3NGUA 1VQ5S 2ILYA 5LMNJ 1RYSA 1T94A 4J9RA 2K3KA 2YNGA 4DFPA 3W63A 2V8HA 4MJKA 2BBEA 1NB7A 2UU9J 3IWLA 4I56A 1X31C 3AXKA 4WU2A 3PM9A 4QBUA 1CBKA 3PDNA 5KFFA 1QTNB 2HLUA 3TAMA 2DXFA 4OJ1A 2CDRB 4ES1A 4ZCLA 2C2OB 1SUQB 3O6QA 4Y28C 2JSXA 2B7BB 4I7FB 3Q8YA 1FNMA 2DD8S 4NYPA 3T5HA 1S97A 1ZTWA 1FK9A 1TUGB 4CLKA 3OTEA 3HJFA 4NA2A 2A18A 2H4YB 2E9TA 3T41A 3GFZA 1B7YB 3ZC4A 3JB9k 2UP1A 2J6UA 4DR5F 4TKTA 2BE2A 2B4PA 1S9GA 4L75A 2MSSA 5K5MA 5DG9A 1Y00A 1NSPA 3MM6B 4KC5A 1MG7A 2F4FA 2N7YA 1X0PA 3I0RB 4PWWA 3MZIA 1AUDA 4I0WA 4LRDA 4B9UA 3TQEA 2XSJB 5KFHA 3W9HA 2QV6A 1RT5A 3VAFA 1EQ0A 3I31A 1D1UA 1T3NA 1H3DA 2CFXA 4FKYA 1AT1B 4KBIA 3BGRB 3MTJA 4PAAA 3RU0A 1C1BB 1NKEA 4WYLA 1XMOJ 1CJUB 1FTCA 2BMBA 1Q1KA 4YB5A 3V2UC 4DUYF 1U6ZA 3D7SB 4B3MJ 3KTQA 4O3OA 1XNRJ 1GX5A 4IQXA 1QAJA 3UDEA 1UW4A 3UD4P 2MHEA 2XM3A 1N32F 3LOUA 1RHRB 4NA3A 2VODA 1PILA 2Y9HA 2CJQA 2CJKA 3BF4A 1U0SA 5J1EB 1MMLA 4QCLA 3OR2A 3B78A 3HCXA 3NMRA 2VQEF 2AYGA 1IKXA 2FPHX 2MQLA 2N3LA 3BKTA 4EEYA 4DF4A 1YITS 4Y0FA 4ECQA 2HHTA 1FEEA 3BYPA 1T9WA 1I3OB 3Q83A 2NXNA 1KOOA 4P52A 3IG1B 1NDCA 4DPOA 2C3MA 1CSJA 2GVZA 1CEZA 4TU9A 2L41A 4BCAA 3ZXWA 2XQCA 2RRNA 4DQSA 4DV3J 1U6BA 3H59A 2VG6B 3A8IA 4G1IA 3DRXA 1M5SA 1U8WA 2GMJA 2RF2B 2RQCA 3JSMB 5A2QU 4JV5J 1FTRA 2VA3A 2CNKB 1HL6A 2CQBA 5KFDA 1KHVA 1FJEB 1TL5A 5ETRA 1F60B 2GA7A 1TELA 1NKBA 2AV5A 5HQLA 5DETA 1CPZA 3RBZA 3O5TB 2CVIA 1VS3A 4CYUA 3CDUA 3V81B 1C4AA 1HNZF 1MMDA 5D8HB 5HL7Q 2U1AA 5L8RC 4O4GA 1R43A 4LSNB 2W2QP 1MWQA 4B9VA 1PGZA 1SB6A 1CS4A 2RT3A 5F0UA 5DG7A 1RUSA 5B0AA 1IR2A 1T11A 1BWEA 4ED4A 4D3GA 1OYEA 1WKJA 1OSCA 2OMLA 4YFUA 4QZVB 2JRSA 1HIYA 3AY0A 4ZOSA 4CP5A 2PMWA 3DOLA 1KVKA 4H4KC 2CWKA 3HHLA 2ROGA 3H2VE 4ZHRA 1F0XA 1HBUA 1UEKA 1G3OA 2RHQB 4OHWA 1RAFB 1O8BA 3ZTOA 3KJVA 3BKUA 1NK7A 1YG0A 1J5OB 3D5MA 1MU2B 4ZP7A 3BSNA 1M1HA 1IKVB 9ATCB 2VBYA 5KFJA 2CIMA 1S9EA 2UUAF 2HQFA 3C6TB 2DXDA 1C2PA 3E51A 5DQIA 1YDLA 2DCUB 4CI0B 4I1TA 4IFVA 5D78A 1HWIA 3M30B 1TAUA 1XWLA 3NAHA 3GFXA 4PQUA 2MKIA 4RNHA 4ZPVR 1KQKA 2PD1A 2AGOA 4FP9A 2VICA 1X4BA 2E1RA 2HFZA 1D9FA 2W4CA 2NREA 2D41A 4Z7YA 3CCVS 4RKUC 1OY9A 4W98A 2VKZG 3BREA 1RTDA 3T1YF 3VVTA 3VV2B 3MM8A 1BQMB 1OQ6A 5T7LB 4ZPAA 2C2MB 1S12A 1HHSA 3D6HB 2QA2A 3CCQS 3ZZUA 3V4IA 2ZE2B 3PX0A 1LOUA 5F8HA 4X64J 1S1XB 2ZNZA 4R25A 3OFGA 1U1PA 1KEKA 2FHJA 4PPZA 3WHIA 4CWBA 2NLWA 2DBBA 4PEOA 5LMUJ 2IC3B 1TVRB 3KK1A 1IKWB 2XHWA 5KFXA 3L95X 1LW2A 2J9DA 2Z56B 4DG1B 4KGMA 4I6AA 1T03B 2MGZB 4CH0S 3KHHA 2CADA 2RD5C 3KLIA 4Q45A 1W7WA 2BW7A 1UEVA 1SKWA 2X1FA 5DLFA 5GAHU 3M05A 2XI3A 3UCGA 3IR7B 3JAMU 1JKHB 4MK8A 5CYMB 2BJ1A 3BQ0A 1KD1T 3MM5B 3OFEA 3FMWA 4OZ5A 2A3JA 3AA9A 4R8UB 3M2VB 1NO8A 3EGZA 2DRDA 1EKRA 5C25A 4UOCA 4IQMA 4F2SA 1HFEL 4WFXA 2G2OA 4DHVA 1T9XA 1NMEB 3OVSA 4NLGA 5A0YB 2OKQA 1SIWB 2F8HA 4C8LA 5L38A 4W92B 1Q7YT 2Z4PA 2DIUA 1XR7A 3V6HA 4M5IA 1KVJA 2X3GA 2W8LA 3O2IA 1U1MA 1N4LA 5B0GA 3LTOA 2PFFB 3VGSA 2OPRB 3CJTA 1JLQB 3HM9A 1RE1B 1J27A 2ZEJA 4ETZA 4QW8A 2GQCA 3TWZA 2ZBIA 5BR8J 1TL3B 1SQFA 4DV0J 2D3UA 5HSPA 5IT4A 2ZH4A 5H9FK 1RI7A 4CO2A 5C42B 1DARA 1H38A 4IO9Q 1FT8A 1H2TZ 2DISA 2HBQB 3KK3A 4F67A 2UUCJ 1JLGB 2X51A 4YS2A 4ZJLA 2DNKA 1I6JA 5IWAF 2MKKA 4F25A 3QJJA 2AHOB 4J7CA 6FDRA 4XPCA 2NXUA 4DV6F 1V6HA 2W9CA 4DFMA 2KHCA 2BJEA 1RU2A 3U7JA 5IT9U 3R6GB 4N76A 1IBMF 2FVRA 3Q8QB 3PIOQ 2XLKA 4X4VA 3LO3A 4IR9A 1XTZA 5K20B 4G1QB 2ZM6F 2GMLA 4B3RJ 4DV1J 1PC4A 4M95A 2KVIA 3FDSA 1YRTA 4YUDA 4EI2A 1IR0A 3ZZRA 1M0SA 5HJXA 4RLEA 4DF8A 2QMUB 4IH7A 4ED1A 3PFEA 3QLHB 2XLIA 2E7WA 1FERA 2LXFA 4WIIA 1HNIB 4KFBB 3OVBA 2X1AA 4TU8A 2AYEA 4P75A 1SUQA 5GAHI 5GMKa 3TJAA 5DDRC 2PIIA 1WI8A 2ADBA 2FJAB 6AT1B 5C2GA 1UTAA 4FNHA 2AEJA 3UPFA 4ID5A 5L9XA 4LVNP 2V8VA 3BN7A 3G6XA 3K0JA 4KTQA 4NE9C 3RZAA 3J80Y 4ED5A 4MKAA 3NOGA 2PN6A 3UDCA 3ILIA 5J2PB 4Y65A 1K8AT 4OI0A 4XDDA 2E7VA 3CO9A 1YJUA 3KNGA 4J90A 1LXNA 5ETVA 1RHQB 1U6FA 4ZVUB 3QGPA 1U1RA 1FNOA 3MM6A 1P9YA 1FXLA 1D9AA 3R5CA 3H0PA 4RNMA 4LF1A 3I0RA 4EMDA 1SC3B 1VQ7S 2XSJA 4ZVPB 4EBEA 1FDDA 3BB5A 4LJMA 1EB0A 4NLYA 1LK5A 5THWA 3VCDA 2HGNA 3P49B 4DUZJ 3BGRA 2IM0A 3M8WA 3PNIA 3BBCA 4L72B 2WVEA 1AW0A 1C1BA 3VQSA 1LFPA 1CJUA 1EAYC 4JV2A 2QC3A 4USVA 4DSIA 1S4FA 4OYPA 1VQPS 2QA4S 3GB0A 4L76A 3SSRA 2H5JB 2OH2A 4F26A 1KONA 1F6TA 3SSQA 4K5SA 4FF3A 1HA1A 1UKUA 3L09A 4ANCA 1TTHB 2IDLA 2O01C 5J1EA 2B9WA 3NXZA 1JXLA 4LRCA 2CQHA 3VQTA 2KXHA 2KKHA 4DL2A 2Y1IA 1U47A 5E2QA 3NCPA 3TUZC 4P2SA 3MPVA 2CNNB 2DYAA 1NEEA 4YDXA 4JI1J 4UUWA 1WHVA 1KWMA 1HR0J 4MMOA 1T02A 2G4BA 2M70A 3IG1A 3KJQB 5DM7Q 3OLAA 2YNIB 4OX6A 3QGHA 1PYSB 4U7CA 3V6DA 3A3OB 3MEKA 1VQKS 2RS8A 2AGPA 1P1TA 1UZHA 4N47A 3GSDA 3D6FB 4RBVA 2Z0GA 4QWCA 1IBLJ 1UVJA 4P2FA 1S72S 2VG6A 2ACMA 3MPUB 4C3LA 1T7PA 1YJNS 1OJ4A 4DFJA 5AXMA 4A48A 4RW6B 2RF2A 2XTJP 2N7CA 3JSMA 3PX6A 2FGOA 1WD6A 3HSJA 2VFTA 1UW9A 5LSLA 3FKBA 2W9BB 4MIWA 3M1VA 2KJWA 3LALA 3BO2A 1KVIA 2HRTA 3PCOB 3J7YU 5GVQA 5ETTA 1SL1A 4OX9F 2MPUA 1KC8T 3IRXB 1RHUB 1FRLA 4QR0A 2YH0A 1GTEA 5DQGA 2FQQB 4JV1A 4ZVSB 2KFYA 5T41A 3EE3A 4LSNA 1YRUA 1LW0A 1XMBA 2QLJB 2R9LA 4K4YA 3MDFA 2R7OA 2BJ3A 1EJ7L 1IJFB 2BV3A 3JS9A 8AT1B 1IM4A 4F4YA 1N6QB 4AQYF 2YKQA 3ELHA 1TKXB 2C3OA 3WQPA 4CO1A 4NRUA 2E1MC 1MSWD 3C19A 4ED6A 3PW4A 3MMJA 1SIZA 1S99A 5B0BA 2RHSB 2CPHA 1DFDA 2FY8A 1FRKA 4DR5J 1MU2A 2XCPA 1KLNA 1IKVA 2NQPA 4ZCMA 3M8SA 4UZBA 2BKOA 1K0TA 3HLUA 4KQZA 4OYZA 4QJVA 3C6TA 1RWKB 2EC2A 1VIXA 4KGVB 1EHWA 2VJUA 2VV5A 2GJ2A 5HMYA 2PE8A 2FZGB 3G8SA 3MEGB 4JBCA 2YY3A 5JVHQ 1WF0A 5ETLA 4WKRA 4NA1A 3GJTB 3G71S 5J2MB 2HMIB 3O1LA 3S7RA 1SJ1A 1RK8A 4KH0B 1BQMA 1N34F 2DTJA 3H40A 2CXEA 3QAEA 1SC1B 4WP9A 1N32J 4DPXA 1BY9A 4DPYA 5T7LA 3C6UA 4GC7A 1UP1A 5L46A 3TEGA 3TX8A 2ZE2A 4PRFA 3GYXB 4GKJF 4HH1A 2Z8QA 2HNDB 1S1XA 4IRKA 4WK3A 4ILRA 4PWUA 3RR7A 1SBRA 3NEKA 5KT7A 1R7IA 3J7YI 1FJ7A 1L3SA 2CQ1A 2IC3A 1TVRA 2DITA 1R3NA 1IKWA 3PKMA 3D67A 4UOHA 1UWBB 2WVCA 3IWNC 1LWEB 1S6PA 2BEFA 4DG1A 3MOJB 4YQWA 1T03A 2BKNA 2HAIA 4WF9Q 2UXDF 2YWWA 2YXLA 3JQJA 4H4OA 4WU3A 4DR7F 4TLRA 2XEXA 2GFFA 2J0XA 3ISNC 3AD8C 1JKHA 5CYMA 4RBTA 4NEZA 3A3NB 3WX4A 2AIRB 2G1HA 2ZVIA 1MWYA 5HN0A 3A4TA 4R8UA 3M2VA 1RT1B 1M1KT 2FD2A 1BHNA 1FFSB 4QIVA 3K5OA 1KS2A 1CLFA 2B4UA 2KRBA 2NPIA 2WK4A 5B0DA 5KFKA 2LXUA 5EX0A 3MFIA 4QYZK 2BJ7A 5A0YA 2MLYA 2PGCA 4DV4J 1ZETA 3SFGA 4ZK7M 5FJ4A 3CMES 2DCLA 1HNZJ 5F8MA 4E8UA 2IY5B 4HH0A 4K4WA 1FJCA 3N79A 2KJVA 2OPRA 1ZBTA 1JLQA 4AD6A 3R5DA 1NK4A 4ZVHA 2F65A 3Q89A 1VJWA 4DZDA 3C3LA 1TL3A 3WIVA 3W1YC 4DI6A 3GSIA 3NS6A 5C42A 5E5NA 1HHTP 5LJ5Y 1NCLA 1JLGA 2WONA 1SV5B 2WB1D 3C15B 4O0IA 5LL6d 4GMKA 3W5ZA 4WFAQ 3DRPB 1CJKB 2IRYA 3DN9A 4URSA 1Q8KA 3ZTSA 1P8GA 2J0WA 3MM9B 3RJMB 3I4HX 3MR2A 8RUCA 4G1QA 3KKFA 5CHCB 3L7UA 2LEPA 4IG0A 3P8BB 3RB0A 3SDEB 1K9MT 2C3PA 3CO0P 2IM2A 5I3QA 3CE8A 4HKQA 2A6MA 3QLHA 2OLWA 1MROB 1YRXA 3IP0A 5I42B 2O1PA 1HW9A 2O5DA 4OHYA 1HNIA 4KFBA 3CUNA 2DGSA 3JQKA 3MPYA 1HWJA 3T1HF 4DL7A 1VLYA 2CJBA 2MDAA 3T1YJ 5DLGA 4LRAA 1AZSB 1NKCA 1QSYA 3RW6A 2CAJA 1Q8LA 3I0SB 1GMVA 2RRAA 4DSFA 3NBPB 4NCBA 2DGXA 2FUG9 4HT5A 2DNZA 1U24A 2HIQA 2B56A 4A8XA 3R1HA 3EGNA 3H98A 2Q1LA 3FBCA 4HACB 3TRGA 1GFWB 1Q8BA 1UVMA 2HZAA 5J2PA 4JOUA 1HQEB 4WZMA 4ZP8A 1NJYA 1NHUA 1RHKB 3HI9A 3K59A 4CLPA 1KR4A 1U2RA 3LP1B 1PIEA 4C4WA 5KFNA 1WACA 2XO7A 1B4SA 3KLEB 3OTCA 2CQGA 2SXLA 4KT0C 2HW3A 2C1EB 4FVCA 3SEOA 5D0HA 4IRDA 4JI8F 4ED2A 2DHXA 1RWVB 4CNZA 1RLDA 1S0OA 2COLA 1ZS6A 3K7RA 3MHYA 3K8WA 1C1CB 5EWFA 1LEOA 3JAMY 4M5KA 3NAIA 1BGXT 3S8SA 4CNYA 2VD3A 4ILLA 4NZ0A 1WKLA 1QM9A 4UOGA 3SBMA 3QIPB 2HURA 1JLEB 3NCQA 5HVGA 5F41A 4Q5VA 1VBYA 3CJ8A 4KGKA 2GAGC 2V8PA 1KP6A 2PFDA 1DTQB 4NLQA 3DGPB 4RW8B 1RAGB 1RU1A 4A8FA 4ETXA 5E41A 2XYHB 3ISND 4PUOB 1VFJA 2UUTA 4LREA 3EM1A 2C42A 2IJFA 1U1OA 1RWUA 2POKA 1Z2LA 3MR5A 1WOPA 2APOA 2ZH5A 4YMEA 1HBMB 2JVRA 3V4MA 3J7ZT 1TMMA 3PYDA 2L3MA 5AE2A 3QBCA 1QTMA 2I9SA 1YWXA 1C0UA 4GC6A 5HQMA 2YNIA 3G8QA 3I56S 2DY9A 1X9SA 4X4UA 2OAUA 4O44B 1EETB 3W9JA 2ZOFA 4ZA1A 4LFAF 4RBUA 3ZTRA 4DR1F 5CYQB 2XMKA 4MH8A 1UFKA 2F9JA 3CJKB 3VGVA 4DR6J 5KG6A 2R7TA 1V3ZA 4YB1P 4HVZA 2GGPB 2DR8A 4MIBA 1RISA 3F41A 2KG1A 4CLZA 1KFSA 3M6UA 3OTBA 1M5VC 4ZPDA 3AFGA 4ED3A 4DV6J 5DDPC 1XN9A 2OHDA 3FEYB 1WDTA 3BH6B 3KJNB 4K50A 5L39A 2W9BA 1TR0A 2LEBA 1WF2A 4F7VA 3MXHP 2D9OA 4B9TA 2M88A 1IBKF 2ZM6J 1D8YA 3FZBA 2CQCA 2XC9A 2ZWPA 1LWFB 2B4OA 2W01A 3AB2B 1L3VA 3DDKA 1JLBB 3IRXA 3PO4A 3EWGA 2RB7A 3IBCB 4EO6A 5KFSA 1U26A 2HFUA 3DHXA 3PIPQ 4TXSA 4D3HA 3W5YA 3I9ZA 4ZJOA 1N33J 3HFZB 1M5PC 3WDOA 2IVMA 1Y11A 2I1RA 2WBRA 1LQ9A 5FDLB 3QZ7A 1T8EA 2AF6A 3H4BA 1YIJS 2V4QA 3GR0A 4F3QA 2RMLA 3K5MA 1PO6A 1N6QA 3GCXP 4FXWA 2MZRA 3SQOP 1TKXA 3PRDA 3D28A 1KHWA 2IHR1 2XMUA 4MAKA 4NLSA 1PAEX 3HZGA 1DQ9A 2LDIA 3F0NA 2Q79A 4LUBA 2C2NA 2MLZA 4B3TF 2WOMB 2HHQA 3KXDA 1MW7A 3V6JA 2Q3PA 3SQGB 4OJGA 2PA8D 5J2NB 2NXCA 1WSRA 2V9KA 4DMZA 4X2BA 2YBVA 2HGLA 3BYRA 5I3UB 3GIJA 3IWXA 1S77D 3EDQB 1R8HA 3MFHA 3NGRA 2ZFHA 3IGNA 3MEGA 1FDBA 1NRKA 2BE7D 3BGFA 3CTRA 2C3YA 5K8NA 3ENQA 2ZH3A 2DH8A 2DR5A 4DL3A 5AXKA 2YX1A 2C2RA 2G0JA 2CJXB 2J76E 3NS5A 5C24B 3P4UB 2VC0A 1HHQA 3N9UC 2HMIA 4RR5A 1RP5A 5HVHA 4LF8J 4F36A 2NSBA 4TU7A 3CCWA 2F7VA 1SJQA 1GXTA 3A8EA 3J81j 4B02A 2KXNB 2F63A 2NXJA 2HNDA 1VK8A 2Q6BA 2MKHA 1W26A 1S1UA 3RUBL 2WSCC 1B64A 1W25A 3RRGA 3CXCR 4UT4A 2PEBA 3CDBA 3UFCX 5IT0A 3C46A 4PG8A 5HLFB 4IOAQ 1PKUA 1VISA 1H2UX 4YR3A 1JJ2R 2RS2A 3H8YA 1OY8A 1UWBA 1LWEA 1PAUB 4OLOA 5ADZA 2DKOB 4OI4A 5F8NA 1LKZA 2Y8WA 2XSFA 1X5TA 1R0CB 1UFLA 3QPIA 5E0OA 5EWGA 4ZPTR 4IG3B 2RSQA 3R5JB 4TY9A 4OX8A 3D66A 2UUBF 1Q81T 4DPTA 1PJ7A 1DBDA 2CQ0A 4X66F 3HVAA 4OYIA 4Q2LA 4I6YA 4LF2A 1FCAA 2K8GA 2MZJA 4LIRA 5MLCV 2FVCA 1FXDA 1RT1A 2BRLA 4FXDA 1HYSA 1WC0A 3MI7X 1OYDA 3AODA 2ASLA 2AGQA 4O3SA 5KFZA 3OTOF 5LSOA 2VQFJ 3DRSB 2CYYA 5EUHA 2O67A 3ITHB 4WBFA 3DU5A 2VFUA 4DV2F 3OFHA 3MOZA 1UFWA 1FJGF 2ZBQA 4Z2XA 2O66A 3NGTA 4I4BA 1MN9A 1XMQF 3LPYA 3Q8VA 1RTZA 1WHYA 3CDEA 7FD1A 4C8OA 1SV5A 2CPDA 3P3DA 1VRQC 3MEDB 3P5BP 3CCUS 1RTHA 3A13A 3DRPA 1CJKA 4LFBF 1JLCB 4Q8FA 3KK2B 4NXMF 3CC2S 3PJ9A 3HVWA 3MM9A 3TO8A 1WEYA 2R2UA 1RXOB 1X9WA 4DSJA 1N54B 3CCSS 3CD0A 3EXCX 3SDEA 1XBWA 2XYGB 1BXNA 2HHXA 2V63A 4LF4F 5IV4A 2CZVC 4BC9A 2JH3A 4CH1A 1MROA 2BR0A 4JI6F 1UPPA 1HNXF 4OMFG 4ZMMA 3F73A 1QSSA 3NY0A 2FJWA 4DSKA 3KUHA 5KFYA 2F3JA 4F50A 3HO1A 2GX8A 2Y1LB 2W1BA 2CRLA 4H4KA 1DY3A 1AZSA 1WEZA 3GIMA 1DTTA 2MZ1A 2AJQA 1KOHA 3NBPA 2KRRA 1N34J 3RTVA 3Q23A 1R0AA 5H9EK 3DNCA 4P71A 4LSLB 2QX0A 4M1KA 2GVDB 3ZZPA 5HROB 3AOBA 3OD2A 3I87A 1EIYB 2A2CA 3ZZYA 2ASYA 1HQEA 3US5A 1HQ2A 5KFOA 3SXLA 3KYLA 3KDOA 1YJVA 5A8WB 5GADU 4Q43A 3GFHA 3ET6B 2DHAA 4YR0A 2OO4A 3LP1A 4CT9A 1TP7A 3KLEA 3A8JA 5IOLA 2NS1B 2DO4A 5CCLA 2N82B 1JB0C 3GONA 3GV8B 2J8SA 3D68A 2K7JA 4WFYA 3IBFB 3J7Z5 3D9BA 1WG5A 5DRKA 1C1CA 2YKNB 3VAGA 1GQEA 1I94F 3D4JA 4J9MA 5KFPA 3VZHA 4RO0A 1BUXA 2H48B 5CZVA 1U0HB 4ELTA 2W7PA 3MR6A 3UCUP 3ONQA 3QIPA 1X4GA 1X4EA 4H4MB 3BQ2A 1JLEA 5BXIA 3VAMA 2IPOB 2XGPA 3M8QB 3ZZOA 3Q8RB 2FLOA 4WXOA 2A10A 3QFWA 1DTQA 3DGPA 4RW8A 3B4DA 2IVYA 3GLJA 1NSQA 3KG4A 1YSJA 3QNWB 3AJ2A 3VALA 2DGUA 1VCTA 5D0RA 4O3QA 3Q0AA 2RQ4A 2ZH8A 1FA0A 4TNOA 2XG8A 2KO1A 2MEWA 4OV1A 3G9CA 4NLRA 2ALZA 3JYTB 2K3IA 2L48A 5H9FJ 4O44A 1EETA 2HHPA 3MPWA 5J2QA 1V5VA 3UN3A 3N6LA 5DM6Q 4ANDA 2JEFA 4ZKAA 1DHMA 1SQGA 3NGKA 2NYIA 3PW2A 2HZVA 1S1VB 3R2DJ 5HMZA 4ZLPA 1XQIA 4KHPF 1H74A 2GGPA 3CMQA 1QLNA 5E33A 1TQLA 2J8AA 4PQAA 5G0RA 2VOOA 4HR2A 3MURP 4X65F 2Z2MA 2JWNA 4USIA 2ZC3A 4OZ1A 3MUMP 4KHRA 4DLEA 3DLEB 2P6TA 1R8CA 5CYJA 1SH2A 5JJBA 2KG0A 3KUGA 5GADI 1LWFA 2M9KA 1JLBA 1FKAF 2ADCA 3FK4A 3H20A 2WBMA 3F44A 1HARA 2ACYA 2K7KA 3WBZA 2DPJA 2DPIA 4FPRA 2C2EA 4ZLLA 3CJ2A 4K5RA 4LF6J 4OJ3A 3K5PA 2AX1A 5FDLA 3HKZD 4DUTA 2WSEC 3HDSA 4DZ6A 4ZDNA 3T1HJ 1Q95G 3JTOA 4LFCJ 4CM0A 2ZZNA 1FWPA 4WP8A 3JQMA 4RL1A 1ITPA 4PKDB 4OZ3A 2DGWA 2EVZA 4DCOB 1RWMB 1LV5A 2D9PA 1UMJA 2M8DB 1NXIA 2R2SA 4EZ9A 4EK2A 2ZJRQ 2ZD1B 4ER8A 2Y0BB 3LAKA 2ZDOA 2WOMA 5KFCA 1X60A 3GIRA 2ABYA 1TK8A 3SQGA 5DO2A 2AJ0A 4C8KA 4UQGA 4TY8B 5J2NA 3PXGa 5L1JA 2HHHF 4FYYB 2KDOA 4Y00A 2VOPA 2L08A 1T9TA 2CPYA 2Q66A 2WW8A 3QWUA 5I3UA 2XS2A 1RBAA 2E29A 3T5KA 4CLYA 1MNEA 4O3RA 2MLXA 4UY8T 3BSOA 4DR3F 5D4OA 4JI8J 3GILA 1VC5A 1L3TA 2OD6A 3AH6A 2V2KA 4KAIA 2E44A 2E66A 2FDNA 1YZ7A 4F2RA 2YKPA 2UXCF 3CJ0A 1O5JA 2BA9A 5C24A 4J9SA 3NS7B 3SCKE 4N41A 5HO4A 2GAHC 3HPOA 3TOQA 4OZNA 1NBEB 1L3KA 3DXSX 5D0GA 2HG4A 2DY1A 2G2YA 2B7CB 4B3SF 4OLPA 4M63A 2MJUA 1SL2A 5KTQA 4AFFA 3O3LA 3Q8UA 3QJPA 3GJQB 2ZBPA 3NG8A 3OUYA 1HI0P 3C16B 3OFFA 1HBNB 4ZPCA 2EG2A 4QWAA 4F0MA 4BDPA 1HKAA 3OTDA 4DN9A 4OI6A 3C66A 3DLHA 1KBRA 2FLLA 2HFSA 3S1TA 1E6VB 5SUHA 1YZ6A 2RRBA 4J9PA 4BLGA 4EFAC 1F2GA 3IC1A 1OWXA 4GO5X 4DWIA 2QSFA 3UO0A 5IM0B 1NAQA 2XZTB 3MCSA 4H54A 2VPYB 4C97A 1FE4A 4DX7A 1L3UA 2JNJA 3FCVA 5F8JA 4LF9F 4NOHA 4DCPB 5G4DA 4DR1J 4JP8A 2EW9A 2PDAA 1S7IA 3GFYA 2RH3A 1VQ8S 2VBZA 1TZ0A 3NLCA 3ISZA 4ZVTB 3D6MB 3DGVA 4U7UD 3CJRA 3THVA 3UQSA 3VHQA 2BVZA 3CC4S 2M0GB 1ZPVA 2QG9B 4Y2KA 4GKKJ 3AOCA 1IBKJ 2XMVA 3EPGA 4DXLA 3H2UB 2P6SA 4BHQA 2XWXA 3FZ2A 1X4DA 2CPEA 2BACA 3SCLE 3DRSA 1Q79A 5B08A 3MR3A 5ETQA 1F2HA 3ITHA 1KFDA 2G0IA 3W2WB 2VG7B 4R0JA 1T95A 5KFWA 2R2TA 3ENWA 2J9CA 4GVBB 1CJTB 2H9ZA 2DJWA 2V34A 3VAHA 3EUNA 3PACA 4O4RA 1HI8A 2OP5A 4CO4A 2OPQA 4J9QA 4J5OA 3MMAB 4U9RA 3I6PA 2G9OA 1IM6A 3MEDA 2BW2A 2D7SA 2LQ9A 3H90A 4J9OA 4JI5F 1Z1ZA 1JLCA 2HRYA 1O6XA 4KV8B 2UUWA 3KK2A 3TJ8A 3KHLA 5I3PA 4B3TJ 5DS7A 1EQMA 1S76D 5FLXU 1BD6A 3UD3P 2DHHA 2JVOA 2HBZB 4JI2F 2VPZB 3S01A 4CLWA 1UZDA 1VQLS 5LMNF 4UTGA 2BUNA 5IC6B 3GZ7A 1FEHA 2ZHOA 4KR0B 1T0TV 2UU9F 1IXKA 2OEKA 1N5SA 1FHTA 3OL9A 1XJWB 5K8PA 3TEHB 1NZAA 4ECUA 2EK6A 1G7CB 1GMWD 1JLAB 3J81Y 3BS9A 4N8OA 2CWXA 2MYFA 3HX9A 1RLCL 3EZOA 3M4XA 4FS1A 2JLEA 3PJXA 4F4XA 1VRUB 4OJHA 1ZAVA 2LQBA 3IRWP 2Y8YA 4LSLA 2XZDB 4ECWA 1P6TA 2GVDA 3RBEA 2RQKA 1U48A 3DLGB 3CMAS 3QGIA 5M2RA 5AJ3F 1IUJA 1FRXA 2HK2A 2OIHA 5HROA 3DDIA 1N5TA 4HHJA 2GZOA 3D0HE 4UUXA 5A8WA 2HHWA 3L4BC 4QWEA 2B9EA 5F8GA 3TZXA 4EBDA 2BXJA 3X1LB 1DRZA 2ZDPA 2I6WA 2ZOGA 3UR0A 4X4NA 1N5VA 3MR7A 3MEEB 4F3MA 4RWWA 3ILOA 4CO5A 2UVUA 4U7UK 1NK9A 2H5EA 1VBKA 1R6YA 1U8SA 3THTA 1ZM9A 4M5DB 2PT0A 2QMXA 2FJXA 1XNQJ 1BMQB 2BYCA 4I67A 2YQ1A 2YKNA 2KXFA 5HMXA 2UUBJ 4JI7F 2YNFA 1K73T 1XMOF 3R7BB 3PW7A 2DEIA 2ZKTA 4QR1A 2CPJA 2HIYA 1U0HA 2B9YA 4B3MF 1PCAA 1TFYA 2WHOA 4H4MA 4TYBA 3W66A 2A0FB 2EFOA 2DHSA 4Q7AA 3M8QA 4DPWA 2ZHBA 2G0CA 4QYZJ 5D6GA 2YQ0A 1FD2A 2HBRB 4RZRA 3OJSA 3OTOJ 2QMWA 4PZVA 1GAOA 2MB0B 2EG1A 4FKXA 3TP2A 1REVB 3A3PB 2YPYA 2ZH9A 3CW2C 1S6OA 1H73A 2KHDA 2DVIA 4X4OA 4PG6A 2AW0A 4DV2J 2HNYB 2C28A 3NL0A 5ETSA 2YH1A 1FFWB 1JXEA 1FJGJ 3DDNA 3GV7B 5DGAA 3RB3A 4KPCA 2DNOA 3M8PA 1F5CA 1S1VA 3C14B 4DDFA 4KIAA 3DMJB 4MYTA 3T19A 5HJYA 4YEAA 1RAEB 3D1HA 2ZZMA 5ETOA 4NLDA 5HP1B 2IA6A 1WELA 5KFAA 2ZH7A 4RNNA 3ZZTA 4NXMJ 3DLEA 1RKJA 4JV5F 3WC0A 5KFIA 4IFYB 4C0OC 5L9NA 4X4PA 4EZ6A 1CJVA 2AWZA 4Q0BB 1EX8A 4LRFA 2ZITA 3VR1A 2YNHB 2CJAA 2B8QA 3EMTA 4F4AA 2IM3A 1JQGA 2LVWA 3OXGA 3RBXA 1VGYA 1VOMA 3M6WA 2YNGB 1F9EB 2FGCA 2B51A 4U6PA 1S10A 4JI6J 1HNXJ 1VQMS
chains in the Genus database with same CATH topology
1IBCB 1RWPB 2C2MB 2XYHB 2QL5B 2CJYB 1RHKB 3R7NB 3SIPB 3D6HB 3R6GB 1RHRB 2XYGB 4JB8B 2C2KB 1RWNB 3IBCB 2XZTB 1ICEB 2CNKB 2H4YB 5K20B 4LSZB 1BMQB 2C2ZB 1PAUB 1RHQB 1RWWB 4DCPB 3EDQB 5IC4B 4ZVUB 3P45B 2DKOB 3R6LB 1NMEB 1RHUB 1RWKB 2C1EB 2CNNB 3IBFB 3R7BB 1I51B 2Y1LB 1RWVB 1SC3B 2FQQB 3EDRB 1RHMB 3GJSB 3NS7B 2QLFB 2H5IB 4ZVPB 4ZVSB 3KJFB 3R5JB 2CJXB 2XZDB 4ZVTB 2QL7B 2QL9B 3KJQB 1PYOB 3D6MB 2QLJB 2H48B 3P4UB 4ZVOB 4ZVRB 1RE1B 4DCOB 1I3OB 1RWMB 3GJRB 1RWXB 1QDUB 1RWOB 3D6FB 1RHJB 3GJQB 3GJTB 1QTNB 2XYPB 2Y0BB 2HBRB 4DCJB 2CDRB 2HBZB 2HBQB 2H4WB 1SC1B 4ZVQB 2HBYB 3KJNB 2C2OB 2CNLB 2H51B 2H5JB 1F9EB 2CNOB 1GFWB 5IC6B 3R7SB 2H65B 2QLBB 2H54B 3RJMB 3QNWB 2P2CB 1SC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBC B;  1RWP B;  2C2M B;  2XYH B;  2QL5 B;  2CJY B;  1RHK B;  3R7N B;  3SIP B;  3D6H B;  3R6G B;  1RHR B;  2XYG B;  4JB8 B;  2C2K B;  1RWN B;  3IBC B;  2XZT B;  1ICE B;  2CNK B;  2H4Y B;  5K20 B;  4LSZ B;  1BMQ B;  2C2Z B;  1PAU B;  1RHQ B;  1RWW B;  4DCP B;  3EDQ B;  5IC4 B;  4ZVU B;  3P45 B;  2DKO B;  3R6L B;  1NME B;  1RHU B;  1RWK B;  2C1E B;  2CNN B;  3IBF B;  3R7B B;  1I51 B;  2Y1L B;  1RWV B;  1SC3 B;  2FQQ B;  3EDR B;  1RHM B;  3GJS B;  3NS7 B;  2QLF B;  2H5I B;  4ZVP B;  4ZVS B;  3KJF B;  3R5J B;  2CJX B;  2XZD B;  4ZVT B;  2QL7 B;  2QL9 B;  3KJQ B;  1PYO B;  3D6M B;  2QLJ B;  2H48 B;  3P4U B;  4ZVO B;  4ZVR B;  1RE1 B;  4DCO B;  1I3O B;  1RWM B;  3GJR B;  1RWX B;  1QDU B;  1RWO B;  3D6F B;  1RHJ B;  3GJQ B;  3GJT B;  1QTN B;  2XYP B;  2Y0B B;  2HBR B;  4DCJ B;  2CDR B;  2HBZ B;  2HBQ B;  2H4W B;  1SC1 B;  4ZVQ B;  2HBY B;  3KJN B;  2C2O B;  2CNL B;  2H51 B;  2H5J B;  1F9E B;  2CNO B;  1GFW B;  5IC6 B;  3R7S B;  2H65 B;  2QLB B;  2H54 B;  3RJM B;  3QNW B;  2P2C B;  1SC4 B; 
#chains in the Genus database with same CATH topology
 1GEH A;  1YK9 A;  1M90 T;  3HSG A;  3BGU A;  4WPA A;  1WUU A;  3K57 A;  1SKR A;  4UY8 5;  3TYT A;  5C5J A;  3SSS A;  2E7X A;  4DR2 F;  3R1L A;  4QOT A;  2GIF A;  2DNM A;  3X3U A;  2XMT A;  5RUB A;  3GWC A;  4QYR A;  3SCJ E;  4CLF A;  2HGM A;  4HL9 A;  4M5J A;  4A8M P;  2AX0 A;  2VL1 A;  5LXY A;  4DSL A;  3CUL A;  2CPI A;  2NZC A;  3DOK B;  2ZD1 A;  2WAQ D;  2XBP A;  3QT7 A;  1WEX A;  2FB0 A;  4C48 A;  4MIA A;  2OTL S;  4TY8 A;  3AA8 A;  3LH2 S;  2D74 B;  2CUY A;  3FFI B;  1OPI A;  2BE2 B;  2Z30 B;  3BBF A;  1SJ3 P;  4XTT A;  3ZTQ A;  4BWJ A;  1M5O C;  2UVV A;  2MKY A;  4A8S A;  2MHN A;  3DOM B;  4FXV A;  2GO9 A;  1YJ9 S;  3L3C A;  2JFK A;  2HLT A;  2L9D A;  2OSQ A;  1K0V A;  2OEM A;  1WC5 A;  2ZKU A;  3KLF B;  1GX6 A;  3G96 A;  2DNG A;  2HQD A;  1FVQ A;  1Z4U A;  1NK5 A;  3QAT A;  3JTN A;  3NGD A;  1QE1 A;  1I94 J;  3DHW C;  5BYS A;  1VC6 A;  1RAO A;  2W8K A;  5IQQ A;  2CQ4 A;  4LVO P;  3CDA A;  2YQ3 A;  3CSK A;  2HQG A;  1FF2 A;  4P7V A;  4MKV A;  1R89 A;  1BQN B;  1FRH A;  1EP4 B;  1GK8 A;  4RUH A;  1R27 B;  3FGV A;  3DXB A;  1Q5Y A;  2V2Z A;  1G1X A;  2OFG X;  5CA5 A;  3C16 A;  2XS7 A;  1HBN A;  1N48 A;  3L7O A;  4OYB A;  2JC0 A;  1E6Y A;  4TLQ A;  4YY3 J;  4I69 A;  2W25 A;  1E6V A;  2DGQ A;  4MK7 A;  2UZA A;  3MUV P;  3QRQ A;  2IDE A;  5LMU F;  3W5X A;  4WYW A;  4FF4 A;  3HSZ A;  2I38 A;  1U45 A;  5D3G B;  3U27 A;  4DBQ A;  1VQY A;  2W2O P;  5IM0 A;  2YWF A;  4ITS A;  4NEY A;  4K4V A;  5IZH A;  1F3F A;  2YX4 A;  4FZV A;  2KN4 A;  4GRS A;  2B5J A;  1T9Y A;  2IYI A;  3CCZ A;  2QFI A;  5DDO C;  4QIE A;  2U2F A;  1R8A A;  4X62 F;  3K5N A;  4KHP J;  2LP4 A;  2QLW A;  3UW1 A;  1NDP A;  2BX6 A;  2G2Z A;  5L1K A;  3RRH A;  2QIF A;  3V6K A;  1UAW A;  1FO1 A;  4X65 J;  2LLZ A;  3GJS B;  4CO3 A;  4O23 A;  1WDD A;  2ASD A;  1SQE A;  3ZZ0 A;  5B0E A;  4M5L A;  1UEU A;  4RNO A;  4A46 A;  2DNP A;  2J5A A;  1CUL B;  2OEL A;  2IMW P;  2GNK A;  2QFJ A;  2F5G A;  4K2J A;  2HVD A;  3CF5 Q;  5LM7 E;  4WIQ A;  4DL0 C;  3MMB B;  1UPM B;  1YI2 S;  1A9N B;  4PXE A;  1VQ6 S;  4ZIV A;  4OHZ A;  2BE9 B;  5B7W A;  2Q43 A;  1IR1 A;  4DQQ A;  5IQ6 A;  3CNQ P;  3G8T A;  2R8J A;  2HHS A;  3W2W A;  2VG7 A;  1ZAW A;  3NCR A;  4O4G B;  1VQ4 S;  2CA9 A;  2CPZ A;  2EBG A;  4E0D A;  2P8I A;  4CQ1 A;  1CS4 B;  2QN6 B;  1ICE B;  5ETK A;  3UN5 A;  2WCX A;  4DV0 F;  1U49 A;  3EIC A;  4B9N A;  4XIU A;  2LMI A;  2L9N A;  3M9M B;  1SL0 A;  3FRZ A;  1N56 A;  2VIH A;  1OO0 B;  3MMA A;  4KHM A;  3OT9 A;  7FDR A;  4USK A;  5A8K B;  4PYD A;  2OPP B;  1RHM B;  2HHV A;  3RGI A;  4DPU A;  1S0V A;  3CWJ A;  4ZHR B;  4ZN3 A;  2ILZ A;  4KV8 A;  3R5G A;  4CLU A;  3IM8 A;  3H42 A;  3E01 B;  3IBW A;  3J7A 1;  4I7F A;  1T9U A;  2HWH A;  1NND A;  4KRW A;  1FX4 A;  2HQ3 A;  2HHH J;  4A4J A;  1FXR A;  2J7U A;  1B0P A;  2P9E A;  4WCE Q;  3OL8 A;  4IDK B;  3M8R A;  2OSR A;  3SFU A;  4DR3 J;  1VBZ A;  2H51 B;  4JI4 F;  5F3T A;  3CCJ S;  4PQU B;  1AFJ A;  1RJJ A;  3BBB A;  1RCX B;  2MKC A;  3QSI A;  3GQC A;  3H25 A;  1JLA A;  4U8V A;  4WFB Q;  2UXC J;  2FJD B;  4I64 A;  2FIU A;  5GME A;  1QJH A;  3DM2 B;  1L5U A;  3QO9 B;  3DFE A;  2KT2 A;  1VRU A;  2XY6 A;  3MTK A;  1VHF A;  1CVJ A;  2W4D A;  3I5A A;  4B3S J;  4BC7 A;  3E3X A;  2Y0S D;  4DV7 J;  1RDR A;  3DLG A;  4Q8E A;  3T5L A;  4JYA J;  1DQ8 A;  4WFZ A;  2XB2 D;  1VQO S;  2VDI A;  2QEX S;  2I5J B;  3T6B A;  3J80 U;  2PI4 A;  1QAY A;  4JI0 J;  4KKO B;  5KG7 A;  2RKI B;  5CZX A;  4NLV A;  5IV3 A;  3IN5 A;  3TUP A;  1H2V Z;  2PI5 A;  4Y3C A;  5AT1 B;  4Y2C A;  3PEJ A;  2EK1 A;  3MEE A;  5LT5 A;  3K2Y A;  4OI3 A;  1B7F A;  1ZYQ A;  2KTQ A;  4M5D A;  5FD1 A;  2D69 A;  3AJD A;  2ZUG A;  2AEM A;  4AT1 B;  1IBC B;  2MQM A;  4DUZ F;  1SKU B;  3HXM A;  2N4C A;  2ZNY A;  4NYO A;  3O8W A;  2V4J B;  2QLX A;  1LFW A;  3SYZ A;  5K8O A;  4QR2 A;  2QLF B;  4K4T A;  4C3K A;  4P72 A;  4JI3 J;  3W64 A;  3IAS 9;  2B6A B;  2VG5 B;  4YR2 A;  2BAN B;  4ED7 A;  5C25 B;  3G6E S;  1X7V A;  2FHM A;  4IRC A;  3OXF A;  1NPR A;  5CCM A;  3TAR A;  3D0G E;  1BC6 A;  3M32 B;  1REV A;  2G1D A;  4OHX A;  5KT3 A;  3FQL A;  1ZA2 B;  4JI1 F;  1HR0 F;  4FF1 A;  2GC8 A;  2LQ5 A;  2PSZ A;  2R42 A;  4ZVG A;  2J9E A;  1H0H B;  2XWY A;  2OI2 A;  4QIW D;  2HNY A;  2AT1 B;  2H54 B;  1OIA A;  1NK0 A;  4K0K F;  4X84 A;  4AXJ A;  1RCO B;  3CC7 S;  2BOP A;  2GQ2 A;  3D1O A;  3V81 A;  2RQM A;  3LGM A;  4DQP A;  4NZ7 A;  2EFV A;  3C14 A;  5KG3 A;  3QSY B;  1IBL F;  3DMJ A;  3IGV A;  3KK3 B;  2EC0 A;  4AL6 A;  4K4U A;  4ELV A;  1TV6 B;  1S1T B;  3WIU A;  1S9F A;  3CPW R;  1UJ6 A;  4C0H A;  5HP1 A;  3EYZ A;  4JI5 J;  1NPK A;  1B70 B;  3DRR B;  2QJ3 A;  1X8D A;  2HZC A;  2OTJ S;  4IFY A;  2XCA A;  3BPS P;  3OL6 A;  5LJ3 Y;  4KPY A;  4Q0B A;  5DZ7 A;  4JI2 J;  2XO6 A;  4P2X A;  3WC2 A;  4B9S A;  3G86 A;  4I6W A;  3R5B A;  3BQ1 A;  2YWK A;  1S0M A;  2YWH A;  4NL5 A;  4DCJ B;  2M4M A;  1J5O A;  4YHH F;  2H4W B;  2XMA A;  4B17 A;  1RBO B;  1OMS A;  5DGB A;  3KLG B;  2CNO B;  1CQM A;  1RAC B;  2X1B A;  2BQR A;  2QE5 A;  1VR6 A;  1HQU B;  1VI7 A;  3N28 A;  1G4C A;  3SIP B;  1XER A;  5KAK A;  2WTF A;  3M30 A;  3EVO A;  3MM7 B;  5H9E J;  1F9F A;  1M5H A;  1FWK A;  3IMQ J;  4LT6 A;  1DLO B;  1NHK L;  3R2C J;  5EGY A;  3CCE S;  2A1B A;  4ID5 B;  3TZZ A;  1U1L A;  5A8R B;  4OZ0 A;  4V1A k;  2VF3 A;  3T9N A;  5AJ3 J;  2LEA A;  3DOK A;  2UXB F;  1UCN A;  4HEA 9;  4L3N A;  4DUY J;  4QWD A;  4DQI A;  2W2N P;  4L6V 3;  4IH5 A;  2QL9 B;  2VPX B;  1IQZ A;  2LQJ A;  1WF1 A;  2BJ9 A;  3D3C J;  3B4M A;  4AXI A;  3NKY A;  3KHR A;  3FFI A;  2RUS A;  2JEI A;  2KB2 A;  3OQ2 A;  4ZVE A;  1SXL A;  3CCT A;  2DNQ A;  1ZZF A;  4W4M A;  2ZH1 A;  3AQO A;  3RB6 A;  2OEJ A;  3DOM A;  3WZ0 A;  2E5I A;  2K1R B;  2UV8 A;  3AQP A;  2VQE J;  2MQP A;  2HBY B;  1FVS A;  2DT9 A;  3KLF A;  3GYN A;  1OS5 A;  3MGJ A;  1Q8I A;  3W61 A;  3W2V B;  3NWG A;  4OYA A;  4P7T A;  1RWP B;  2JJ4 D;  1IWA A;  5JVG Q;  4JI7 J;  4B9L A;  5KG1 A;  1WG1 A;  3PEH A;  4NRT A;  3D6T B;  3DU6 A;  1Z2Z A;  1HWK A;  1P9Q C;  2MGZ A;  5KFB A;  1BQN A;  1EP4 A;  1RT2 B;  3JXO A;  3L9Z A;  3M8Z A;  2AKW B;  3G6V A;  1VYA A;  4HYK A;  1TKZ B;  3ULH A;  4OV6 A;  2YKA A;  1O51 A;  3U1M A;  4G65 A;  2C2D A;  4YOE A;  2R7V A;  1O0P A;  2IRX A;  3ETO A;  2JFD A;  2GO8 A;  5E3C A;  1M1G A;  1ACM B;  1R31 A;  5A2Q Y;  3MM5 A;  5ETP A;  1S4E A;  1WC1 A;  1M5K C;  2HFO A;  4K4Z A;  1NJI T;  4XO0 A;  3G6Y A;  5D3G A;  3BZQ A;  1NJZ A;  2OFH X;  3BR8 A;  2ZJQ Q;  3HVR A;  2BRK A;  1BWV A;  4BS2 A;  1SI9 A;  3SV3 A;  3V6D B;  3MEC B;  4CCH A;  1VMB A;  2EFP A;  3PJW A;  1ZM4 A;  1GTH A;  2QSW A;  5IFM A;  3DLK B;  3R8Y A;  3BH7 B;  1MMN A;  3TAN A;  2OUG A;  3MMC B;  4WFN Q;  3TUI C;  3KLV A;  1OPZ A;  2KM8 C;  3PYF A;  2B4V A;  2M2B A;  3JSB A;  2BM0 A;  1RTI B;  3FBF A;  1CUL A;  4N56 A;  4TQR A;  3G4S S;  4ECZ A;  1CQN A;  1WI6 A;  4DFK A;  4C9D A;  1YJ7 A;  1AXQ A;  1AB8 A;  5AE1 A;  3MMB A;  3M1V B;  3U1N A;  3UDV A;  2DGO A;  4OQJ A;  1PBU A;  1FES A;  2J7W A;  1KTV A;  3KG1 A;  1RWO B;  2VJV A;  4DV4 F;  3AXM A;  3PV8 A;  1VQN S;  4B08 A;  1HWL A;  3Q22 A;  3QRP A;  4K59 A;  2AD9 A;  4GVL A;  1RYR A;  2ERR A;  2V9W A;  1A0O B;  3GPA A;  3Q8S B;  2AJ4 A;  3MUT P;  2IIH A;  4ZLJ A;  2QYG A;  2E5L F;  2UUA J;  4B3O B;  1LW0 B;  3DCA A;  4DR2 J;  3G82 B;  3ENV A;  2MZS A;  2BZ2 A;  4NLX A;  2IM1 A;  1WHX A;  1QUP A;  4JB8 B;  1OSD A;  2B43 A;  2WSF C;  5BJR A;  1N0U A;  5D4L A;  1S1W B;  3I55 S;  4OX7 A;  1AA1 B;  4NCG B;  1RA7 A;  4RNF A;  5A8K A;  2Y1R I;  2OPP A;  3T1A A;  1YGY A;  1B99 A;  2J0S D;  4NML A;  5L1L A;  4F04 B;  3G87 A;  5KFQ A;  1CC8 A;  1I51 B;  2FC9 A;  3LGN A;  4C3M A;  2L9W A;  2ALY B;  3LWL A;  3CDW A;  2H5I B;  1Q0N A;  3E01 A;  2YKO A;  4NAS A;  1NSA A;  4RW7 B;  3D1Q A;  3M8Y A;  4PR6 A;  3TVZ A;  3I9V 9;  1TKT B;  5E3A A;  1FD8 A;  4PPD A;  3JTP A;  4IDK A;  1VIO A;  2JDJ A;  1N36 F;  4X4S A;  4L73 A;  3HHE A;  2FVQ A;  2IVF B;  1NJX A;  3OV7 A;  4J37 A;  2JLF A;  3LWM A;  2R2R A;  1ZM2 A;  4NLW A;  3BO4 A;  2YX7 A;  3D0I E;  4RWX A;  1OY6 A;  1RT6 B;  3DM2 A;  3CB4 A;  5DG8 A;  3QO9 A;  4UZC A;  1S49 A;  1MLA A;  1UJ5 A;  4DL5 A;  4HTJ A;  1NB2 A;  3KG0 A;  3OR1 B;  5EN1 A;  2E5J A;  4O0N A;  4E2F B;  3VGU A;  2H1Y A;  2V8G A;  4NPO A;  1GMW A;  2F40 A;  4FDF A;  4R5P B;  5D77 A;  5KFU A;  4YB6 A;  3C6U B;  2I5J A;  5GAG U;  2F8M A;  2OPS B;  3RAX A;  2WVD A;  2QA1 A;  4KKO A;  3NRB A;  2RKI A;  3GCW P;  1XR6 A;  3BDE A;  1KSP A;  3W8G A;  2FZK B;  4ECS A;  4X4Q A;  1NK6 A;  3TZY A;  4XPE A;  3H5X A;  4M5H A;  2E5H A;  4WXW A;  6FD1 A;  1NM2 A;  2ROE A;  1S6P B;  4KY3 A;  1U4B A;  1Y7P A;  3I4P A;  3MPD A;  4PG5 A;  2R7X A;  3QYY A;  2WZ1 A;  2EWH A;  5HVF A;  4H4O B;  4EO8 A;  3M2R B;  4X62 J;  4MYU A;  1TUW A;  5LSR A;  2J6S A;  2QL5 B;  2C2K B;  5ETN A;  1AYE A;  1PSD A;  2XS5 A;  2M8H A;  4ZP9 A;  2LA4 A;  2J6T A;  2V4J A;  2D3O R;  1TL7 B;  4ZPW R;  2ZBC A;  4FYX B;  5C2C A;  2QT7 A;  3K58 A;  1GNK A;  3I5B A;  3E2E A;  3PG9 A;  2B6A A;  2VG5 A;  2BAN A;  1A7G E;  5IWA J;  4Q44 A;  4M5G A;  2WVB A;  4CLT A;  3LGH A;  1ZPW X;  2V50 A;  5ITH A;  4RW6 A;  4ES2 A;  1Y5L B;  3HZE A;  5KG4 A;  4RPF A;  4AE5 A;  5IT9 Y;  4OL8 A;  3M32 A;  3FEZ A;  1IBM J;  3RBD A;  4ATN A;  4ZIT A;  2E9Z A;  1EKS A;  1TUV A;  4ELU A;  2KL8 A;  2MZT A;  2MQ8 A;  3OW2 R;  2R7S A;  2P5V A;  2YTC A;  4F0H A;  3EGW B;  4DS4 A;  5HAT A;  5M2U A;  3RB4 A;  4PWD B;  3DI6 B;  3QMQ A;  3N01 A;  1SC4 B;  2GW8 A;  4HT7 A;  4DR6 F;  2WON B;  1TV6 A;  2O3D A;  1S1T A;  2FVP A;  2X1G A;  1QY7 A;  1WJ9 A;  4HHU A;  2DNY A;  4URQ U;  1PBA A;  2J0Q D;  3DRR A;  3SMZ A;  3FCH A;  5GAG I;  3D54 A;  5T14 A;  1RAJ A;  3BV8 A;  2F4V F;  3BN4 A;  1S0N A;  3BR9 A;  2AJ2 A;  5AXN A;  1TKD A;  3HT3 A;  1PYT A;  2GV1 A;  1HW8 A;  2XI2 A;  1SJF A;  4ECV A;  1AUS L;  2NUU G;  2ZWO A;  4IG0 B;  1RWX B;  3V5R A;  1KTQ A;  1RKI A;  4JI4 J;  3Q24 A;  2MY8 A;  3I82 A;  3NP5 A;  1R8B A;  1W2I A;  3KLG A;  1NK8 A;  1N33 F;  4WE1 B;  4TQS A;  1HQU A;  2J7K A;  4CT8 A;  5AE3 A;  5AXL A;  3PW0 A;  2BJD A;  1ZM3 A;  4WKY A;  4DU8 A;  3TR5 A;  4HTI A;  3MM7 A;  4WK1 A;  2P2C B;  5B0F A;  2LYV A;  1DLO A;  2CJY B;  5KFE A;  2Y3Y A;  3HHD A;  4KGX B;  5A8R A;  4I2Q B;  4Y34 A;  2AQ4 A;  2BDP A;  4LF5 F;  1UJ4 A;  2N4D A;  4NLT A;  5J2M A;  1ZTT A;  2MQN A;  4C6A A;  3SZ2 A;  1NZ8 A;  4CO0 A;  4CTA B;  1FI4 A;  2RUG A;  4XAK A;  4NYZ A;  2R4F A;  4DX6 A;  3T9Z A;  4J9N A;  5KFR A;  4AYB D;  4IOB A;  3NNC A;  2F8E X;  2DNN A;  2HEK A;  4URG A;  1N5Q A;  2K1R A;  2HQC A;  5E3Q A;  1JWW A;  3W9I A;  3ZNJ 1;  3LA0 A;  1VQ9 S;  3EZ5 A;  5KFG A;  4YP3 A;  3RW7 A;  5K8M A;  2CG8 A;  2AJF E;  5D15 A;  2YVS A;  4MKB A;  1DAX A;  3A8K A;  3W2V A;  3W7B A;  4LMZ A;  3A12 A;  4YDD B;  1LXJ A;  4OZ2 A;  4F4W A;  4NLU A;  3EPI A;  3ICL A;  4KGZ B;  4FYD A;  2XGQ A;  3ZZZ A;  2CQ2 A;  2DO0 A;  1RT2 A;  2F1F A;  3KNA A;  2DGV A;  4LF8 F;  5CXT A;  1TKZ A;  1SVD A;  4ZP6 A;  1HPZ B;  5GAE U;  3B6B A;  1U2F A;  1WTB A;  2V67 A;  2HS4 A;  4CM2 A;  3EVW A;  1WNE A;  2R8K A;  2HVE A;  3M9N B;  1BLU A;  2DB1 A;  1VK3 A;  2ZH2 A;  3U02 A;  2FJE B;  2NUH A;  1Q4R A;  2R7R A;  4KSE B;  4C8M A;  1KLM B;  1DQA A;  4DX8 H;  5EX3 A;  4A47 A;  4OX9 J;  2HK3 A;  4K0K J;  2ZJP Q;  1C0U B;  2JLG A;  1FKO B;  1GH8 A;  1RAA B;  3MEC A;  4WZQ A;  4OYX A;  3NMA A;  5E3P A;  3SI8 A;  3KUE A;  3OLB A;  4ZPB A;  3DLK A;  4K2X A;  1F5A A;  2H65 B;  1RGV A;  5KFL A;  4E98 A;  1NHV A;  2NXE A;  1R6V A;  4C8N A;  5C7P A;  3ZO7 A;  3LF0 A;  3MMC A;  2D1C A;  2Z57 B;  1YJR A;  1V5I B;  4FF2 A;  1HI1 A;  1UA1 A;  2VKR A;  1FKP B;  2FHK A;  3LP2 B;  3W65 A;  4PXC A;  4OFZ A;  4RUB A;  1RTI A;  1TL1 B;  2R7Q A;  3O44 A;  2BQU A;  4M8L A;  3R6L B;  4AQY J;  2R8H A;  1KQS R;  5MAO A;  5E7O B;  5KG5 A;  2VB6 A;  1FE0 A;  1WC6 A;  4J9V A;  3C15 A;  3PTW A;  2P9C A;  4UF4 A;  2PMZ D;  5KFT A;  3TI0 A;  1F1B B;  3EDR B;  2DH7 A;  4X4R A;  5KT6 A;  2R7U A;  1RT4 B;  3OHA A;  1N5Y B;  3OXL A;  3BSA A;  5F9N A;  2DNH A;  1D09 B;  1BE4 A;  1PYO B;  2IJN A;  2VQF F;  3ETM A;  4DEZ A;  4YHH J;  2LU2 A;  2N3O A;  4BBY A;  3U1L A;  4DR4 F;  4B3O A;  5IXU A;  3FEX B;  3PHE A;  2FLN A;  3PZP A;  3G82 A;  2CQD A;  2CVE A;  2VZ9 A;  1WOR A;  1Y5I B;  4YB7 A;  2B8P A;  3AAW B;  3BPD A;  4QU7 A;  1WOO A;  3Q2S C;  5BYR A;  5I42 A;  1XEZ A;  4NZ6 A;  3RG6 A;  4ICL B;  1S1W A;  4A8O A;  1J5E F;  3KMS A;  2HVZ A;  4NCG A;  3PKY A;  1URR A;  2V2Q A;  3T6J A;  3B82 A;  2DIV A;  1RA6 A;  3P96 A;  3Q8P B;  2YKM B;  1UL3 A;  2RDJ A;  1NJW A;  2UXB J;  5GAE I;  4QPX A;  3H2L A;  1QAI A;  3BEG B;  3I0S A;  4DX5 A;  1SH0 A;  3QQC D;  3CVK A;  2CZ9 A;  4MK9 A;  4RW7 A;  4JV0 A;  2FZC B;  2FTR A;  4DU7 A;  1RAI B;  2E9R X;  4ZCK A;  5A76 A;  1TKT A;  1JJC B;  4HAC A;  4LRB A;  4GKJ J;  4NLO A;  2XZW A;  5IS2 A;  4EWT A;  2QTW A;  5B0C A;  2YWE A;  3PHT A;  5F8L A;  1HLW A;  1FRJ A;  5CAA A;  3GG1 A;  3AT1 B;  3H5Y A;  5F3Z A;  2JX2 A;  1U1K A;  3TAP A;  1HNW F;  1RT6 A;  3GG0 A;  2HKE A;  2CNL B;  4C8Y A;  1T3O A;  5KT4 A;  3THP A;  2X3D A;  2CDQ A;  1Q53 A;  3MCO A;  3FSI A;  4FBT A;  3OR1 A;  3NNH A;  1A6L A;  1K44 A;  2ZZT A;  1VQS A;  2UXD J;  4PXD A;  1D0E A;  1HWU A;  2M5Y A;  3HD1 A;  4DV5 F;  4DR7 J;  3HFK A;  9RUB A;  4LIW A;  1ZOT A;  2EI5 A;  2PC6 A;  2CKW A;  3VAK A;  1VRT B;  4R5P A;  3LUY A;  4CZC A;  3Q2T C;  2OPS A;  5IC4 B;  4LQ3 A;  3MWB A;  4MFB B;  1ULR A;  2R3V A;  2FJB B;  3I32 A;  2GJI A;  1S1U B;  3OVA A;  3R27 A;  1PJ5 A;  4UST A;  1KRP A;  1RAH B;  1QAX A;  4Z37 A;  5DJB A;  2EPI A;  2XY5 A;  3GJR B;  1X9M A;  5E3R A;  4DL6 A;  2E1A A;  3N6M A;  2RDI A;  4PUO A;  4RU2 A;  1D9D A;  3CGI A;  4DS5 A;  1TU0 B;  2Y1J A;  2V0N A;  2JC1 A;  1YJT A;  4ECT A;  4ANE A;  3UNG C;  2LXI A;  1IKY B;  3VAJ A;  2A6O A;  3OPK A;  5I4M A;  2RNE A;  1FNX H;  1HBM A;  1AFI A;  3M2R A;  1JMT A;  2IMO A;  2RE1 A;  3OSN A;  3MCM A;  4OI1 A;  2XHC A;  3HFV A;  3QGG A;  4V19 J;  5GMD A;  1IQT A;  4C8Z A;  1DUR A;  4IOC Q;  2QYC A;  2DH9 A;  1TL7 A;  1URN A;  5CYQ A;  2X7I A;  2R7W A;  4RW9 B;  3CJK A;  2LFV A;  1KQF B;  2I0X A;  4Y2A A;  1HYS B;  3IFE A;  1D8Z A;  1WC4 A;  3HHN B;  1C0T B;  1XK8 A;  4HHH A;  1YBT A;  3AD7 C;  4HLB A;  1WWH A;  2DR7 A;  1NDL A;  4P9S A;  1LWX A;  1QD1 A;  1NPP A;  1OQ3 A;  1X4F A;  4NXN F;  2V5H G;  4NI2 B;  2IFX A;  4C11 B;  3GMG A;  3HUL A;  4ZVO B;  2NCK L;  2AP6 A;  1D3W A;  3NOC A;  4Y2I A;  4ZLN A;  1Q7L B;  3HHL C;  2NPF A;  1FFG B;  1S48 A;  1RB0 A;  2E5L J;  2HWI A;  3CCR S;  4P73 A;  2VPW B;  2Z2L A;  4TYA A;  1NU4 A;  1ROF A;  4DLG A;  4PWD A;  1H98 A;  2KM8 B;  3DI6 A;  3MAQ A;  1UVL A;  4B9M A;  3UI3 A;  3CD7 A;  4DJB A;  4ECX A;  3PVX A;  4F4K A;  4OI2 A;  3IS9 B;  1ZAX A;  1FX2 A;  3UWT A;  1Q16 B;  3R7N B;  3UDL A;  2UVW A;  1RTH B;  4U8Y A;  5HBM B;  3B8H A;  2ROP A;  3OJU A;  2CPF A;  2VH7 A;  3QT5 A;  1RTJ B;  1P27 B;  4CRJ A;  3IR5 B;  1UA0 A;  2JEG A;  2EEY A;  2VDH A;  2D3O 1;  2V2V A;  4F8R A;  4NX9 A;  1CC7 A;  4IKA A;  1N36 J;  5F9L A;  5H1S V;  3DLJ A;  2KT5 A;  3N6N A;  4PAB A;  2CQP A;  1HMV B;  3HKW A;  2EKN A;  2GHW A;  4LF7 F;  3FJ2 A;  3UCZ P;  1UWA A;  2RJZ A;  4M94 A;  4KYZ A;  4AUK A;  4LBH A;  4KE5 A;  4WE1 A;  2EKY A;  4ILM A;  4LF6 F;  4EUV A;  3RAQ A;  2WRM A;  4OYO A;  3DLL Q;  4ED8 A;  4F4Z A;  4LFC F;  3RR8 A;  1QVG R;  3HSD A;  3UNY A;  3C8Y A;  4K4S A;  1Y9O A;  3G2X A;  1PG5 B;  1DTT B;  1APS A;  3PRB A;  3ZFV A;  5HMW A;  1R0A B;  1Y5N B;  4JUZ A;  1ZA1 B;  4I2Q A;  1J2V A;  3UR3 C;  5A6W A;  5KT2 A;  1LWC B;  4V19 X;  4OZJ A;  4J9K A;  5JUM A;  3P5T L;  4CTA A;  4L3K A;  1T05 B;  1YBA A;  2DNL A;  2EFN A;  1TK5 A;  3UVJ B;  1XIQ A;  1GMU A;  4F3O A;  3JSR A;  3CJS A;  1S5Z A;  2V4R A;  3KJF B;  2HSE B;  1YVF A;  4QIG A;  1SJR A;  4UQT A;  4YN3 B;  5FII A;  3TNV A;  2EFG A;  3FVY A;  4J91 A;  2KZZ A;  4AL7 A;  5HLF A;  4R0E A;  2XMJ A;  4PCQ A;  4KO0 B;  2NR0 A;  3P6Y C;  1Y3J A;  2QZ8 A;  3POT B;  1F3V A;  4J9U E;  3CJQ A;  3PW5 A;  4WTO B;  4LQ9 A;  4ZVQ B;  5D0E A;  3T5J A;  5CD4 A;  3Q86 A;  3IM9 A;  4KJI A;  3QWP A;  1XR5 A;  4ZVF A;  1LNQ A;  1EAR A;  4DQR A;  3VZI A;  4LFA J;  1W2B R;  2KYX A;  5SZT A;  4IG3 A;  1I5O B;  3LQV A;  1HPZ A;  5LXR A;  2XLJ A;  2VFR A;  4P74 A;  2HVI A;  3MCN A;  2OMO A;  5DZ6 A;  4PG7 A;  2IA0 A;  4GO7 X;  1JJH A;  5CH7 B;  4IYQ A;  3DYA B;  3EX7 B;  3QT8 A;  1N52 B;  3FRY A;  1RT7 B;  3H5S A;  3MD1 A;  3PY8 A;  1GXL A;  4USU A;  4LR8 A;  4ZCI A;  2IAJ B;  1KLM A;  4IUF A;  1U1N A;  2DHG A;  2R8I A;  1FRI A;  2BJ8 A;  3IXQ A;  2MZQ A;  1FDA A;  1FKO A;  1N8R T;  2KFN A;  1Y3K A;  2XMM A;  4EU0 A;  3M2U B;  5J2Q B;  1VC0 A;  3L7P A;  1YLX A;  3KLH B;  1F5B A;  3VF0 B;  1RBL A;  1JXV A;  3VWS A;  1QSL A;  1K1S A;  1R0B G;  2V68 A;  2KFZ A;  3HJV A;  3TW0 A;  1JIH A;  1U7L A;  1YBU A;  4QU6 A;  5G0R B;  3D3B J;  3HVT B;  3HHL D;  1FKP A;  1X5S A;  3LP2 A;  5EWE A;  4Y2M A;  3C2P A;  4QW9 A;  1TL1 A;  4TVA B;  4U67 Q;  4F0K A;  3QT6 A;  1KDN A;  1RWN B;  2AZ1 A;  1Q82 T;  2HHU A;  2F4V J;  1BQX A;  4QPT A;  3K8V A;  3FUY A;  4GKK F;  2XUL A;  3H5U A;  1HD1 A;  3OSP A;  2I2Y A;  4WTY A;  1RT4 A;  2NSC A;  1N5Y A;  1B0V A;  4EYH B;  3LPE A;  4CDI A;  4U96 A;  2HFN A;  4FBU A;  5KFV A;  1KNZ A;  4I2P B;  3W3S A;  5ETM A;  3IR6 B;  2KU7 A;  1ARO P;  3DC2 A;  3M7V A;  1LK7 A;  2GIQ A;  2QGF B;  1RSC A;  1KKH A;  4ZVR B;  4ENO A;  3BGL A;  3GYG A;  2DRA A;  3TVK A;  4ZS6 A;  1TK0 A;  3GTY X;  3BDP A;  5EDW A;  1MN7 A;  2LA6 A;  2MJN A;  3HK2 A;  3AD9 C;  2XY7 A;  3K5L A;  3KHG A;  2HWT A;  1S7H A;  2BKP A;  3PR4 A;  1B3T A;  2QO3 A;  1PJ6 A;  4ICL A;  5K14 B;  3PYE A;  3CIM A;  2ZBR A;  1DJ0 A;  4LBP A;  1U1Q A;  2VBW A;  4RX6 A;  2MQQ A;  2HNZ B;  3AB4 B;  2YKM A;  1RT3 B;  4K4X A;  3LP0 B;  1Y4Z B;  1X5P A;  4LF5 J;  3GP9 A;  3IAM 9;  4ECY A;  5HAN A;  1S57 A;  3K17 A;  1JLF B;  3N0V A;  3ENA A;  2KZM A;  5U47 A;  1RWW B;  1U09 A;  3LW5 C;  2FHJ D;  5HK4 A;  2MQO A;  1H7X A;  2HFV A;  4HDG A;  3IA0 A;  1P1L A;  4AL5 A;  2HRU A;  3FMB A;  4PXB A;  4IH6 A;  3TVY A;  3LAN A;  4C7Q A;  5J1N A;  5KFM A;  1JNZ B;  2EXU A;  5K9F A;  3ET6 A;  2MXY A;  3M9O B;  1FWL A;  2E1P A;  1X5O A;  1H7W A;  4N77 A;  3WX8 A;  1U02 A;  2RAQ A;  3J81 U;  1U2C A;  4PG4 A;  5CD4 H;  2XNR A;  3R3T A;  2JHE A;  2RU9 A;  2BAB A;  2IBK A;  4M5N A;  3BO3 A;  2JEJ A;  4XK8 C;  2G13 A;  4FN5 A;  1VRT A;  1HNV B;  3MAA B;  4RW4 B;  2DR9 A;  3OUY B;  4X66 J;  3HF5 A;  3KDN A;  4MFB A;  2JOQ A;  4M5M A;  2KYZ A;  2VC1 A;  1WC3 A;  1TAQ A;  2DRB A;  2QRR A;  1XNR F;  5D4N A;  2W2P P;  4J9L A;  4ZIW A;  4WWS A;  4K8R A;  1VJQ A;  4IR1 A;  3TA2 A;  4Z7C A;  3CD6 S;  3N4W A;  1VBX A;  3TUJ C;  3MF5 A;  1ELO A;  2QA4 G;  1SJ4 P;  2LEC A;  2WB4 A;  2FY1 A;  3FQK A;  2GIR A;  3AHP A;  2CQI A;  3BM7 A;  4RJV A;  1X4H A;  4Y6I A;  4A8Q A;  1IKY A;  3HT0 A;  1XNQ F;  2WVF A;  2Z2Y B;  5HAO A;  4LBI A;  2JZ5 A;  2R8G A;  3JYT A;  4QWB A;  2BQ3 A;  4HI1 A;  1RAB B;  5HQ8 A;  2J9D E;  4FNI A;  4KH1 B;  3GIK A;  4ES3 A;  2W7O A;  3NNA A;  5HI7 A;  3FCW A;  3JSY A;  3W60 A;  2VFV A;  3TZW A;  1NDK A;  1IWG A;  2ZVS A;  1XMQ J;  4RW9 A;  2A2D A;  2UV8 G;  2Z2Z A;  1F9H A;  1HBO B;  2MST A;  4C98 A;  5F8I A;  1S6Q B;  1QUV A;  5JXS A;  4DV3 F;  2B3T B;  2W24 A;  1UET A;  4CLS A;  1C0T A;  4HDH A;  1JNR B;  2HVH A;  4LFB J;  1QVF R;  2DXE A;  4G6V B;  4O3N A;  4NI2 A;  4C11 A;  2KH9 A;  2GHV C;  2V94 A;  2PMH A;  2MY7 A;  4DR4 J;  3CJ4 A;  3VTI A;  2CPX A;  4I68 A;  3T3F A;  3CD5 A;  2V69 A;  3IO1 A;  1G6B A;  1QDU B;  2FHO B;  4LF4 J;  1UVI A;  2EBE A;  5D4P A;  3DRY A;  4DSE A;  2K2P A;  5JMN A;  1WSV A;  4NMX A;  3GU0 A;  1DZ5 A;  3R9L A;  3EGV A;  3ZNU A;  1J5E J;  4G1P A;  1MWZ A;  2OPQ B;  3IS9 A;  3TAM B;  5DQH A;  3NGS A;  5HBM A;  4X4T A;  4C0B A;  5BYQ A;  3HP6 A;  1NLK L;  3S6E A;  2C22 A;  2W2M P;  2AU0 A;  2RIL A;  3BJY A;  1RTJ A;  3W62 A;  2E1C A;  2LQ8 A;  2JL9 A;  2Q6C A;  3KMQ A;  4IO1 A;  1FK9 B;  1H6K X;  3F56 A;  4Q2M A;  5L1I A;  2VUG A;  2IYG A;  2VFS A;  2GMH A;  4USM A;  1HMV A;  2V8D A;  3KOA A;  1K1Q A;  1WHW A;  2OJ3 A;  3QZ8 A;  3FBB A;  1S9G B;  2AMC B;  3D2W A;  3I5C A;  3E8O A;  5KOX A;  3I96 A;  2GCF A;  1HNW J;  3OHB A;  1B0T A;  2VA2 A;  3GR1 A;  2VBX A;  5KT5 A;  4CIO A;  2RVJ A;  5LOQ A;  3CT9 A;  2KT3 A;  3QFH A;  1RT5 B;  1TL4 A;  3CJ3 A;  4EGL A;  3M6X A;  2FC8 A;  3LAM A;  4DV5 J;  4HI2 A;  3DKD A;  4EYI B;  2PEH A;  4OYW A;  5A6P A;  1S79 A;  2DEJ A;  4W90 B;  3FSY A;  1LWC A;  2NYH A;  1TFW A;  3EXY A;  5M2P A;  2I8E A;  3ILL A;  2W9A A;  2ZUA A;  3PFO A;  2ZHA A;  1T05 A;  3GII A;  1VHI A;  3UVJ A;  1UVN A;  2AZ3 A;  5CAB A;  4FVM A;  2HPU A;  3QID A;  3TX0 A;  4F02 A;  3OR2 B;  3UE2 A;  4X64 F;  1VDH A;  3SV4 A;  5DDQ C;  1IKX B;  2AYM A;  4S0M A;  2GS8 A;  4KO0 A;  4LR7 A;  3POT A;  4PYA A;  2EFQ A;  3FSX A;  2YNF B;  3VAI A;  1SPB P;  2P9G A;  3PYG A;  2CZ4 A;  2M52 A;  1NH8 A;  4UOF A;  4U95 A;  3R97 A;  4P6Q A;  2AYB A;  4N8N A;  5J1P A;  3TAQ A;  4MT1 A;  2GVZ B;  3CIZ A;  2B0G A;  2W7A A;  2M7S A;  3PO5 A;  2AEF A;  4L74 A;  1YX2 A;  2YPZ A;  4NCA A;  4MTP A;  2V6A A;  4YY3 F;  3PX4 A;  2RDD A;  3DYA A;  4LSZ B;  2ZH6 A;  4ALZ A;  2C2Z B;  4NXN J;  5KG2 A;  1X4C A;  3BSC A;  1RT7 A;  3OL7 A;  2BOA A;  2DR6 A;  2FVS A;  4UW2 A;  4C2M A;  1RAD B;  4NWB A;  2IAJ A;  4G3I A;  4FPI A;  1IVZ A;  3H7H B;  2LDY A;  5B09 A;  3TJ9 A;  4OHV A;  2QL7 B;  2D3Z A;  1G2E A;  2PO4 A;  2IRU A;  1V3S A;  2UVR A;  1GT8 A;  3M2U A;  3VVU A;  3B54 A;  4KB7 A;  4USW A;  3UN2 A;  3KLH A;  4ERD A;  1N0V C;  1SCJ B;  1Y0H A;  4CYU B;  2ATC B;  2GQQ A;  2ASJ A;  1RHJ B;  3M8P B;  1YTY A;  1T9V A;  1NUE A;  3QAU A;  3N5B A;  1VLO A;  3HD2 A;  4GVB A;  2XMW A;  3HVT A;  3CJ5 A;  2F9D A;  1CJT A;  2HS0 A;  4RUA A;  5BR8 F;  4A8K A;  3K89 A;  3CCM S;  1SH3 A;  4EBC A;  1Q5V A;  2XNQ A;  2UUC F;  3DOL B;  1CJV B;  2K06 A;  2LCW A;  3ZTP A;  3TA0 A;  4WJB A;  3HHL B;  1REG X;  1YJW S;  1HBU B;  2KI2 A;  3TA1 A;  1WTF A;  1GXU A;  1Q78 A;  1WG4 A;  4I2P A;  1EZZ B;  1NH7 A;  2GJF A;  4LF7 J;  3KJV B;  2FLP A;  1V3R A;  2ZC4 A;  1HD0 A;  4LR9 A;  1SKS A;  3M6V A;  4B3R F;  1S9E B;  4DV1 F;  3TQ1 A;  1PC5 A;  3MAH A;  2VU5 A;  2IJR A;  2WW4 A;  1TMJ A;  4K7Q A;  4P10 A;  4DL4 A;  3N5F A;  4IFV B;  4ZJQ A;  2DGT A;  1Y10 A;  3KFW X;  3QJL A;  3BGO P;  3EJM A;  5K14 A;  2CG4 A;  3ADA C;  2YWG A;  2LU1 A;  5F0W A;  2RU3 A;  2HNZ A;  1H72 C;  2FYX A;  4OIX A;  2DK2 A;  1RT3 A;  3LP0 A;  2OD4 A;  1RTD B;  1NSK L;  1XC9 A;  4OYM A;  2GHP A;  2KVQ E;  3H4D A;  4QQB A;  1JX4 A;  3FC9 A;  1JLF A;  1V9O A;  4RUC A;  1C4C A;  3MM8 B;  4DN0 A;  1N88 A;  1S59 A;  2Z58 B;  1JK9 B;  2HS3 A;  4FYV B;  4N5S A;  3P45 B;  3V4I B;  1CG2 A;  3GV5 B;  3RRK A;  4MKY A;  3NWR A;  2M3D A;  1U25 A;  4FS2 A;  3W8P A;  3FNN A;  3RYL A;  3OBI A;  2RIJ A;  4RU9 A;  1YQH A;  4WP3 A;  3AJ1 A;  3EZU A;  4CH7 A;  1KN6 A;  3KK1 B;  3HMJ G;  3GE9 A;  5CQG A;  1QE1 B;  1LW2 B;  3J7A N;  8ATC B;  3A1Y G;  2VAS A;  2XYP B;  1IJE B;  4LF9 J;  2MKS A;  1K47 A;  4ZN1 A;  4A8Y A;  3CCL S;  3KLI B;  1YHQ S;  2IBO A;  3SCI E;  4DV7 F;  2PA3 A;  4USJ C;  1HNV A;  1X0F A;  2LKZ A;  1ZH5 A;  3MAA A;  4RW4 A;  2ATL A;  4JYA F;  3R7S B;  3VGT A;  1RQ0 A;  4QIF A;  1E6Y B;  2VON A;  4JI0 F;  2MKJ A;  3FBE A;  2BM1 A;  3R5A A;  4FYW B;  3RAM A;  7AT1 B;  4A8W A;  3BKF A;  3ILJ A;  1IN0 A;  4CLL A;  2AJ1 A;  3DLB A;  2NZ4 A;  2C3U A;  5KOW A;  4DOZ A;  1FDN A;  1R8P A;  3QRR A;  2B5J B;  4ID8 A;  3PRV A;  3MD3 A;  2VHG A;  2DNR A;  1ZZN A;  4TN2 A;  4OZL A;  4P2M A;  1WKK A;  1S6U A;  1X4A A;  2HAF A;  2H3E B;  3PR5 B;  5KG0 A;  2MTL A;  2FJV A;  1HBO A;  2CJ9 A;  2CQ3 A;  2OGU A;  1S6Q A;  4ED0 A;  1WOS A;  4BWM A;  1Q86 T;  4JI3 F;  2QLB B;  2ZOM A;  2W4P A;  4O3P A;  4ECR A;  1SC6 A;  3EVM A;  5EHH A;  3CED A;  3KWM A;  4USH A;  1KQG B;  1RZM A;  3AOA A;  3UD5 A;  2W9C B;  1I1G A;  3HHK A;  2E5G A;  5FLX Y;  1FRM A;  2MMY A;  1JJ4 A;  2HYI B;  4N7T A;  4NLP A;  4XDC A;  1YKW A;  1UVK A;  2YNH A;  2B9X A;  2HQI A;  3NGU A;  1VQ5 S;  2ILY A;  5LMN J;  1RYS A;  1T94 A;  4J9R A;  2K3K A;  2YNG A;  4DFP A;  3W63 A;  2V8H A;  4MJK A;  2BBE A;  1NB7 A;  2UU9 J;  3IWL A;  4I56 A;  1X31 C;  3AXK A;  4WU2 A;  3PM9 A;  4QBU A;  1CBK A;  3PDN A;  5KFF A;  1QTN B;  2HLU A;  3TAM A;  2DXF A;  4OJ1 A;  2CDR B;  4ES1 A;  4ZCL A;  2C2O B;  1SUQ B;  3O6Q A;  4Y28 C;  2JSX A;  2B7B B;  4I7F B;  3Q8Y A;  1FNM A;  2DD8 S;  4NYP A;  3T5H A;  1S97 A;  1ZTW A;  1FK9 A;  1TUG B;  4CLK A;  3OTE A;  3HJF A;  4NA2 A;  2A18 A;  2H4Y B;  2E9T A;  3T41 A;  3GFZ A;  1B7Y B;  3ZC4 A;  3JB9 k;  2UP1 A;  2J6U A;  4DR5 F;  4TKT A;  2BE2 A;  2B4P A;  1S9G A;  4L75 A;  2MSS A;  5K5M A;  5DG9 A;  1Y00 A;  1NSP A;  3MM6 B;  4KC5 A;  1MG7 A;  2F4F A;  2N7Y A;  1X0P A;  3I0R B;  4PWW A;  3MZI A;  1AUD A;  4I0W A;  4LRD A;  4B9U A;  3TQE A;  2XSJ B;  5KFH A;  3W9H A;  2QV6 A;  1RT5 A;  3VAF A;  1EQ0 A;  3I31 A;  1D1U A;  1T3N A;  1H3D A;  2CFX A;  4FKY A;  1AT1 B;  4KBI A;  3BGR B;  3MTJ A;  4PAA A;  3RU0 A;  1C1B B;  1NKE A;  4WYL A;  1XMO J;  1CJU B;  1FTC A;  2BMB A;  1Q1K A;  4YB5 A;  3V2U C;  4DUY F;  1U6Z A;  3D7S B;  4B3M J;  3KTQ A;  4O3O A;  1XNR J;  1GX5 A;  4IQX A;  1QAJ A;  3UDE A;  1UW4 A;  3UD4 P;  2MHE A;  2XM3 A;  1N32 F;  3LOU A;  1RHR B;  4NA3 A;  2VOD A;  1PIL A;  2Y9H A;  2CJQ A;  2CJK A;  3BF4 A;  1U0S A;  5J1E B;  1MML A;  4QCL A;  3OR2 A;  3B78 A;  3HCX A;  3NMR A;  2VQE F;  2AYG A;  1IKX A;  2FPH X;  2MQL A;  2N3L A;  3BKT A;  4EEY A;  4DF4 A;  1YIT S;  4Y0F A;  4ECQ A;  2HHT A;  1FEE A;  3BYP A;  1T9W A;  1I3O B;  3Q83 A;  2NXN A;  1KOO A;  4P52 A;  3IG1 B;  1NDC A;  4DPO A;  2C3M A;  1CSJ A;  2GVZ A;  1CEZ A;  4TU9 A;  2L41 A;  4BCA A;  3ZXW A;  2XQC A;  2RRN A;  4DQS A;  4DV3 J;  1U6B A;  3H59 A;  2VG6 B;  3A8I A;  4G1I A;  3DRX A;  1M5S A;  1U8W A;  2GMJ A;  2RF2 B;  2RQC A;  3JSM B;  5A2Q U;  4JV5 J;  1FTR A;  2VA3 A;  2CNK B;  1HL6 A;  2CQB A;  5KFD A;  1KHV A;  1FJE B;  1TL5 A;  5ETR A;  1F60 B;  2GA7 A;  1TEL A;  1NKB A;  2AV5 A;  5HQL A;  5DET A;  1CPZ A;  3RBZ A;  3O5T B;  2CVI A;  1VS3 A;  4CYU A;  3CDU A;  3V81 B;  1C4A A;  1HNZ F;  1MMD A;  5D8H B;  5HL7 Q;  2U1A A;  5L8R C;  4O4G A;  1R43 A;  4LSN B;  2W2Q P;  1MWQ A;  4B9V A;  1PGZ A;  1SB6 A;  1CS4 A;  2RT3 A;  5F0U A;  5DG7 A;  1RUS A;  5B0A A;  1IR2 A;  1T11 A;  1BWE A;  4ED4 A;  4D3G A;  1OYE A;  1WKJ A;  1OSC A;  2OML A;  4YFU A;  4QZV B;  2JRS A;  1HIY A;  3AY0 A;  4ZOS A;  4CP5 A;  2PMW A;  3DOL A;  1KVK A;  4H4K C;  2CWK A;  3HHL A;  2ROG A;  3H2V E;  4ZHR A;  1F0X A;  1HBU A;  1UEK A;  1G3O A;  2RHQ B;  4OHW A;  1RAF B;  1O8B A;  3ZTO A;  3KJV A;  3BKU A;  1NK7 A;  1YG0 A;  1J5O B;  3D5M A;  1MU2 B;  4ZP7 A;  3BSN A;  1M1H A;  1IKV B;  9ATC B;  2VBY A;  5KFJ A;  2CIM A;  1S9E A;  2UUA F;  2HQF A;  3C6T B;  2DXD A;  1C2P A;  3E51 A;  5DQI A;  1YDL A;  2DCU B;  4CI0 B;  4I1T A;  4IFV A;  5D78 A;  1HWI A;  3M30 B;  1TAU A;  1XWL A;  3NAH A;  3GFX A;  4PQU A;  2MKI A;  4RNH A;  4ZPV R;  1KQK A;  2PD1 A;  2AGO A;  4FP9 A;  2VIC A;  1X4B A;  2E1R A;  2HFZ A;  1D9F A;  2W4C A;  2NRE A;  2D41 A;  4Z7Y A;  3CCV S;  4RKU C;  1OY9 A;  4W98 A;  2VKZ G;  3BRE A;  1RTD A;  3T1Y F;  3VVT A;  3VV2 B;  3MM8 A;  1BQM B;  1OQ6 A;  5T7L B;  4ZPA A;  2C2M B;  1S12 A;  1HHS A;  3D6H B;  2QA2 A;  3CCQ S;  3ZZU A;  3V4I A;  2ZE2 B;  3PX0 A;  1LOU A;  5F8H A;  4X64 J;  1S1X B;  2ZNZ A;  4R25 A;  3OFG A;  1U1P A;  1KEK A;  2FHJ A;  4PPZ A;  3WHI A;  4CWB A;  2NLW A;  2DBB A;  4PEO A;  5LMU J;  2IC3 B;  1TVR B;  3KK1 A;  1IKW B;  2XHW A;  5KFX A;  3L95 X;  1LW2 A;  2J9D A;  2Z56 B;  4DG1 B;  4KGM A;  4I6A A;  1T03 B;  2MGZ B;  4CH0 S;  3KHH A;  2CAD A;  2RD5 C;  3KLI A;  4Q45 A;  1W7W A;  2BW7 A;  1UEV A;  1SKW A;  2X1F A;  5DLF A;  5GAH U;  3M05 A;  2XI3 A;  3UCG A;  3IR7 B;  3JAM U;  1JKH B;  4MK8 A;  5CYM B;  2BJ1 A;  3BQ0 A;  1KD1 T;  3MM5 B;  3OFE A;  3FMW A;  4OZ5 A;  2A3J A;  3AA9 A;  4R8U B;  3M2V B;  1NO8 A;  3EGZ A;  2DRD A;  1EKR A;  5C25 A;  4UOC A;  4IQM A;  4F2S A;  1HFE L;  4WFX A;  2G2O A;  4DHV A;  1T9X A;  1NME B;  3OVS A;  4NLG A;  5A0Y B;  2OKQ A;  1SIW B;  2F8H A;  4C8L A;  5L38 A;  4W92 B;  1Q7Y T;  2Z4P A;  2DIU A;  1XR7 A;  3V6H A;  4M5I A;  1KVJ A;  2X3G A;  2W8L A;  3O2I A;  1U1M A;  1N4L A;  5B0G A;  3LTO A;  2PFF B;  3VGS A;  2OPR B;  3CJT A;  1JLQ B;  3HM9 A;  1RE1 B;  1J27 A;  2ZEJ A;  4ETZ A;  4QW8 A;  2GQC A;  3TWZ A;  2ZBI A;  5BR8 J;  1TL3 B;  1SQF A;  4DV0 J;  2D3U A;  5HSP A;  5IT4 A;  2ZH4 A;  5H9F K;  1RI7 A;  4CO2 A;  5C42 B;  1DAR A;  1H38 A;  4IO9 Q;  1FT8 A;  1H2T Z;  2DIS A;  2HBQ B;  3KK3 A;  4F67 A;  2UUC J;  1JLG B;  2X51 A;  4YS2 A;  4ZJL A;  2DNK A;  1I6J A;  5IWA F;  2MKK A;  4F25 A;  3QJJ A;  2AHO B;  4J7C A;  6FDR A;  4XPC A;  2NXU A;  4DV6 F;  1V6H A;  2W9C A;  4DFM A;  2KHC A;  2BJE A;  1RU2 A;  3U7J A;  5IT9 U;  3R6G B;  4N76 A;  1IBM F;  2FVR A;  3Q8Q B;  3PIO Q;  2XLK A;  4X4V A;  3LO3 A;  4IR9 A;  1XTZ A;  5K20 B;  4G1Q B;  2ZM6 F;  2GML A;  4B3R J;  4DV1 J;  1PC4 A;  4M95 A;  2KVI A;  3FDS A;  1YRT A;  4YUD A;  4EI2 A;  1IR0 A;  3ZZR A;  1M0S A;  5HJX A;  4RLE A;  4DF8 A;  2QMU B;  4IH7 A;  4ED1 A;  3PFE A;  3QLH B;  2XLI A;  2E7W A;  1FER A;  2LXF A;  4WII A;  1HNI B;  4KFB B;  3OVB A;  2X1A A;  4TU8 A;  2AYE A;  4P75 A;  1SUQ A;  5GAH I;  5GMK a;  3TJA A;  5DDR C;  2PII A;  1WI8 A;  2ADB A;  2FJA B;  6AT1 B;  5C2G A;  1UTA A;  4FNH A;  2AEJ A;  3UPF A;  4ID5 A;  5L9X A;  4LVN P;  2V8V A;  3BN7 A;  3G6X A;  3K0J A;  4KTQ A;  4NE9 C;  3RZA A;  3J80 Y;  4ED5 A;  4MKA A;  3NOG A;  2PN6 A;  3UDC A;  3ILI A;  5J2P B;  4Y65 A;  1K8A T;  4OI0 A;  4XDD A;  2E7V A;  3CO9 A;  1YJU A;  3KNG A;  4J90 A;  1LXN A;  5ETV A;  1RHQ B;  1U6F A;  4ZVU B;  3QGP A;  1U1R A;  1FNO A;  3MM6 A;  1P9Y A;  1FXL A;  1D9A A;  3R5C A;  3H0P A;  4RNM A;  4LF1 A;  3I0R A;  4EMD A;  1SC3 B;  1VQ7 S;  2XSJ A;  4ZVP B;  4EBE A;  1FDD A;  3BB5 A;  4LJM A;  1EB0 A;  4NLY A;  1LK5 A;  5THW A;  3VCD A;  2HGN A;  3P49 B;  4DUZ J;  3BGR A;  2IM0 A;  3M8W A;  3PNI A;  3BBC A;  4L72 B;  2WVE A;  1AW0 A;  1C1B A;  3VQS A;  1LFP A;  1CJU A;  1EAY C;  4JV2 A;  2QC3 A;  4USV A;  4DSI A;  1S4F A;  4OYP A;  1VQP S;  2QA4 S;  3GB0 A;  4L76 A;  3SSR A;  2H5J B;  2OH2 A;  4F26 A;  1KON A;  1F6T A;  3SSQ A;  4K5S A;  4FF3 A;  1HA1 A;  1UKU A;  3L09 A;  4ANC A;  1TTH B;  2IDL A;  2O01 C;  5J1E A;  2B9W A;  3NXZ A;  1JXL A;  4LRC A;  2CQH A;  3VQT A;  2KXH A;  2KKH A;  4DL2 A;  2Y1I A;  1U47 A;  5E2Q A;  3NCP A;  3TUZ C;  4P2S A;  3MPV A;  2CNN B;  2DYA A;  1NEE A;  4YDX A;  4JI1 J;  4UUW A;  1WHV A;  1KWM A;  1HR0 J;  4MMO A;  1T02 A;  2G4B A;  2M70 A;  3IG1 A;  3KJQ B;  5DM7 Q;  3OLA A;  2YNI B;  4OX6 A;  3QGH A;  1PYS B;  4U7C A;  3V6D A;  3A3O B;  3MEK A;  1VQK S;  2RS8 A;  2AGP A;  1P1T A;  1UZH A;  4N47 A;  3GSD A;  3D6F B;  4RBV A;  2Z0G A;  4QWC A;  1IBL J;  1UVJ A;  4P2F A;  1S72 S;  2VG6 A;  2ACM A;  3MPU B;  4C3L A;  1T7P A;  1YJN S;  1OJ4 A;  4DFJ A;  5AXM A;  4A48 A;  4RW6 B;  2RF2 A;  2XTJ P;  2N7C A;  3JSM A;  3PX6 A;  2FGO A;  1WD6 A;  3HSJ A;  2VFT A;  1UW9 A;  5LSL A;  3FKB A;  2W9B B;  4MIW A;  3M1V A;  2KJW A;  3LAL A;  3BO2 A;  1KVI A;  2HRT A;  3PCO B;  3J7Y U;  5GVQ A;  5ETT A;  1SL1 A;  4OX9 F;  2MPU A;  1KC8 T;  3IRX B;  1RHU B;  1FRL A;  4QR0 A;  2YH0 A;  1GTE A;  5DQG A;  2FQQ B;  4JV1 A;  4ZVS B;  2KFY A;  5T41 A;  3EE3 A;  4LSN A;  1YRU A;  1LW0 A;  1XMB A;  2QLJ B;  2R9L A;  4K4Y A;  3MDF A;  2R7O A;  2BJ3 A;  1EJ7 L;  1IJF B;  2BV3 A;  3JS9 A;  8AT1 B;  1IM4 A;  4F4Y A;  1N6Q B;  4AQY F;  2YKQ A;  3ELH A;  1TKX B;  2C3O A;  3WQP A;  4CO1 A;  4NRU A;  2E1M C;  1MSW D;  3C19 A;  4ED6 A;  3PW4 A;  3MMJ A;  1SIZ A;  1S99 A;  5B0B A;  2RHS B;  2CPH A;  1DFD A;  2FY8 A;  1FRK A;  4DR5 J;  1MU2 A;  2XCP A;  1KLN A;  1IKV A;  2NQP A;  4ZCM A;  3M8S A;  4UZB A;  2BKO A;  1K0T A;  3HLU A;  4KQZ A;  4OYZ A;  4QJV A;  3C6T A;  1RWK B;  2EC2 A;  1VIX A;  4KGV B;  1EHW A;  2VJU A;  2VV5 A;  2GJ2 A;  5HMY A;  2PE8 A;  2FZG B;  3G8S A;  3MEG B;  4JBC A;  2YY3 A;  5JVH Q;  1WF0 A;  5ETL A;  4WKR A;  4NA1 A;  3GJT B;  3G71 S;  5J2M B;  2HMI B;  3O1L A;  3S7R A;  1SJ1 A;  1RK8 A;  4KH0 B;  1BQM A;  1N34 F;  2DTJ A;  3H40 A;  2CXE A;  3QAE A;  1SC1 B;  4WP9 A;  1N32 J;  4DPX A;  1BY9 A;  4DPY A;  5T7L A;  3C6U A;  4GC7 A;  1UP1 A;  5L46 A;  3TEG A;  3TX8 A;  2ZE2 A;  4PRF A;  3GYX B;  4GKJ F;  4HH1 A;  2Z8Q A;  2HND B;  1S1X A;  4IRK A;  4WK3 A;  4ILR A;  4PWU A;  3RR7 A;  1SBR A;  3NEK A;  5KT7 A;  1R7I A;  3J7Y I;  1FJ7 A;  1L3S A;  2CQ1 A;  2IC3 A;  1TVR A;  2DIT A;  1R3N A;  1IKW A;  3PKM A;  3D67 A;  4UOH A;  1UWB B;  2WVC A;  3IWN C;  1LWE B;  1S6P A;  2BEF A;  4DG1 A;  3MOJ B;  4YQW A;  1T03 A;  2BKN A;  2HAI A;  4WF9 Q;  2UXD F;  2YWW A;  2YXL A;  3JQJ A;  4H4O A;  4WU3 A;  4DR7 F;  4TLR A;  2XEX A;  2GFF A;  2J0X A;  3ISN C;  3AD8 C;  1JKH A;  5CYM A;  4RBT A;  4NEZ A;  3A3N B;  3WX4 A;  2AIR B;  2G1H A;  2ZVI A;  1MWY A;  5HN0 A;  3A4T A;  4R8U A;  3M2V A;  1RT1 B;  1M1K T;  2FD2 A;  1BHN A;  1FFS B;  4QIV A;  3K5O A;  1KS2 A;  1CLF A;  2B4U A;  2KRB A;  2NPI A;  2WK4 A;  5B0D A;  5KFK A;  2LXU A;  5EX0 A;  3MFI A;  4QYZ K;  2BJ7 A;  5A0Y A;  2MLY A;  2PGC A;  4DV4 J;  1ZET A;  3SFG A;  4ZK7 M;  5FJ4 A;  3CME S;  2DCL A;  1HNZ J;  5F8M A;  4E8U A;  2IY5 B;  4HH0 A;  4K4W A;  1FJC A;  3N79 A;  2KJV A;  2OPR A;  1ZBT A;  1JLQ A;  4AD6 A;  3R5D A;  1NK4 A;  4ZVH A;  2F65 A;  3Q89 A;  1VJW A;  4DZD A;  3C3L A;  1TL3 A;  3WIV A;  3W1Y C;  4DI6 A;  3GSI A;  3NS6 A;  5C42 A;  5E5N A;  1HHT P;  5LJ5 Y;  1NCL A;  1JLG A;  2WON A;  1SV5 B;  2WB1 D;  3C15 B;  4O0I A;  5LL6 d;  4GMK A;  3W5Z A;  4WFA Q;  3DRP B;  1CJK B;  2IRY A;  3DN9 A;  4URS A;  1Q8K A;  3ZTS A;  1P8G A;  2J0W A;  3MM9 B;  3RJM B;  3I4H X;  3MR2 A;  8RUC A;  4G1Q A;  3KKF A;  5CHC B;  3L7U A;  2LEP A;  4IG0 A;  3P8B B;  3RB0 A;  3SDE B;  1K9M T;  2C3P A;  3CO0 P;  2IM2 A;  5I3Q A;  3CE8 A;  4HKQ A;  2A6M A;  3QLH A;  2OLW A;  1MRO B;  1YRX A;  3IP0 A;  5I42 B;  2O1P A;  1HW9 A;  2O5D A;  4OHY A;  1HNI A;  4KFB A;  3CUN A;  2DGS A;  3JQK A;  3MPY A;  1HWJ A;  3T1H F;  4DL7 A;  1VLY A;  2CJB A;  2MDA A;  3T1Y J;  5DLG A;  4LRA A;  1AZS B;  1NKC A;  1QSY A;  3RW6 A;  2CAJ A;  1Q8L A;  3I0S B;  1GMV A;  2RRA A;  4DSF A;  3NBP B;  4NCB A;  2DGX A;  2FUG 9;  4HT5 A;  2DNZ A;  1U24 A;  2HIQ A;  2B56 A;  4A8X A;  3R1H A;  3EGN A;  3H98 A;  2Q1L A;  3FBC A;  4HAC B;  3TRG A;  1GFW B;  1Q8B A;  1UVM A;  2HZA A;  5J2P A;  4JOU A;  1HQE B;  4WZM A;  4ZP8 A;  1NJY A;  1NHU A;  1RHK B;  3HI9 A;  3K59 A;  4CLP A;  1KR4 A;  1U2R A;  3LP1 B;  1PIE A;  4C4W A;  5KFN A;  1WAC A;  2XO7 A;  1B4S A;  3KLE B;  3OTC A;  2CQG A;  2SXL A;  4KT0 C;  2HW3 A;  2C1E B;  4FVC A;  3SEO A;  5D0H A;  4IRD A;  4JI8 F;  4ED2 A;  2DHX A;  1RWV B;  4CNZ A;  1RLD A;  1S0O A;  2COL A;  1ZS6 A;  3K7R A;  3MHY A;  3K8W A;  1C1C B;  5EWF A;  1LEO A;  3JAM Y;  4M5K A;  3NAI A;  1BGX T;  3S8S A;  4CNY A;  2VD3 A;  4ILL A;  4NZ0 A;  1WKL A;  1QM9 A;  4UOG A;  3SBM A;  3QIP B;  2HUR A;  1JLE B;  3NCQ A;  5HVG A;  5F41 A;  4Q5V A;  1VBY A;  3CJ8 A;  4KGK A;  2GAG C;  2V8P A;  1KP6 A;  2PFD A;  1DTQ B;  4NLQ A;  3DGP B;  4RW8 B;  1RAG B;  1RU1 A;  4A8F A;  4ETX A;  5E41 A;  2XYH B;  3ISN D;  4PUO B;  1VFJ A;  2UUT A;  4LRE A;  3EM1 A;  2C42 A;  2IJF A;  1U1O A;  1RWU A;  2POK A;  1Z2L A;  3MR5 A;  1WOP A;  2APO A;  2ZH5 A;  4YME A;  1HBM B;  2JVR A;  3V4M A;  3J7Z T;  1TMM A;  3PYD A;  2L3M A;  5AE2 A;  3QBC A;  1QTM A;  2I9S A;  1YWX A;  1C0U A;  4GC6 A;  5HQM A;  2YNI A;  3G8Q A;  3I56 S;  2DY9 A;  1X9S A;  4X4U A;  2OAU A;  4O44 B;  1EET B;  3W9J A;  2ZOF A;  4ZA1 A;  4LFA F;  4RBU A;  3ZTR A;  4DR1 F;  5CYQ B;  2XMK A;  4MH8 A;  1UFK A;  2F9J A;  3CJK B;  3VGV A;  4DR6 J;  5KG6 A;  2R7T A;  1V3Z A;  4YB1 P;  4HVZ A;  2GGP B;  2DR8 A;  4MIB A;  1RIS A;  3F41 A;  2KG1 A;  4CLZ A;  1KFS A;  3M6U A;  3OTB A;  1M5V C;  4ZPD A;  3AFG A;  4ED3 A;  4DV6 J;  5DDP C;  1XN9 A;  2OHD A;  3FEY B;  1WDT A;  3BH6 B;  3KJN B;  4K50 A;  5L39 A;  2W9B A;  1TR0 A;  2LEB A;  1WF2 A;  4F7V A;  3MXH P;  2D9O A;  4B9T A;  2M88 A;  1IBK F;  2ZM6 J;  1D8Y A;  3FZB A;  2CQC A;  2XC9 A;  2ZWP A;  1LWF B;  2B4O A;  2W01 A;  3AB2 B;  1L3V A;  3DDK A;  1JLB B;  3IRX A;  3PO4 A;  3EWG A;  2RB7 A;  3IBC B;  4EO6 A;  5KFS A;  1U26 A;  2HFU A;  3DHX A;  3PIP Q;  4TXS A;  4D3H A;  3W5Y A;  3I9Z A;  4ZJO A;  1N33 J;  3HFZ B;  1M5P C;  3WDO A;  2IVM A;  1Y11 A;  2I1R A;  2WBR A;  1LQ9 A;  5FDL B;  3QZ7 A;  1T8E A;  2AF6 A;  3H4B A;  1YIJ S;  2V4Q A;  3GR0 A;  4F3Q A;  2RML A;  3K5M A;  1PO6 A;  1N6Q A;  3GCX P;  4FXW A;  2MZR A;  3SQO P;  1TKX A;  3PRD A;  3D28 A;  1KHW A;  2IHR 1;  2XMU A;  4MAK A;  4NLS A;  1PAE X;  3HZG A;  1DQ9 A;  2LDI A;  3F0N A;  2Q79 A;  4LUB A;  2C2N A;  2MLZ A;  4B3T F;  2WOM B;  2HHQ A;  3KXD A;  1MW7 A;  3V6J A;  2Q3P A;  3SQG B;  4OJG A;  2PA8 D;  5J2N B;  2NXC A;  1WSR A;  2V9K A;  4DMZ A;  4X2B A;  2YBV A;  2HGL A;  3BYR A;  5I3U B;  3GIJ A;  3IWX A;  1S77 D;  3EDQ B;  1R8H A;  3MFH A;  3NGR A;  2ZFH A;  3IGN A;  3MEG A;  1FDB A;  1NRK A;  2BE7 D;  3BGF A;  3CTR A;  2C3Y A;  5K8N A;  3ENQ A;  2ZH3 A;  2DH8 A;  2DR5 A;  4DL3 A;  5AXK A;  2YX1 A;  2C2R A;  2G0J A;  2CJX B;  2J76 E;  3NS5 A;  5C24 B;  3P4U B;  2VC0 A;  1HHQ A;  3N9U C;  2HMI A;  4RR5 A;  1RP5 A;  5HVH A;  4LF8 J;  4F36 A;  2NSB A;  4TU7 A;  3CCW A;  2F7V A;  1SJQ A;  1GXT A;  3A8E A;  3J81 j;  4B02 A;  2KXN B;  2F63 A;  2NXJ A;  2HND A;  1VK8 A;  2Q6B A;  2MKH A;  1W26 A;  1S1U A;  3RUB L;  2WSC C;  1B64 A;  1W25 A;  3RRG A;  3CXC R;  4UT4 A;  2PEB A;  3CDB A;  3UFC X;  5IT0 A;  3C46 A;  4PG8 A;  5HLF B;  4IOA Q;  1PKU A;  1VIS A;  1H2U X;  4YR3 A;  1JJ2 R;  2RS2 A;  3H8Y A;  1OY8 A;  1UWB A;  1LWE A;  1PAU B;  4OLO A;  5ADZ A;  2DKO B;  4OI4 A;  5F8N A;  1LKZ A;  2Y8W A;  2XSF A;  1X5T A;  1R0C B;  1UFL A;  3QPI A;  5E0O A;  5EWG A;  4ZPT R;  4IG3 B;  2RSQ A;  3R5J B;  4TY9 A;  4OX8 A;  3D66 A;  2UUB F;  1Q81 T;  4DPT A;  1PJ7 A;  1DBD A;  2CQ0 A;  4X66 F;  3HVA A;  4OYI A;  4Q2L A;  4I6Y A;  4LF2 A;  1FCA A;  2K8G A;  2MZJ A;  4LIR A;  5MLC V;  2FVC A;  1FXD A;  1RT1 A;  2BRL A;  4FXD A;  1HYS A;  1WC0 A;  3MI7 X;  1OYD A;  3AOD A;  2ASL A;  2AGQ A;  4O3S A;  5KFZ A;  3OTO F;  5LSO A;  2VQF J;  3DRS B;  2CYY A;  5EUH A;  2O67 A;  3ITH B;  4WBF A;  3DU5 A;  2VFU A;  4DV2 F;  3OFH A;  3MOZ A;  1UFW A;  1FJG F;  2ZBQ A;  4Z2X A;  2O66 A;  3NGT A;  4I4B A;  1MN9 A;  1XMQ F;  3LPY A;  3Q8V A;  1RTZ A;  1WHY A;  3CDE A;  7FD1 A;  4C8O A;  1SV5 A;  2CPD A;  3P3D A;  1VRQ C;  3MED B;  3P5B P;  3CCU S;  1RTH A;  3A13 A;  3DRP A;  1CJK A;  4LFB F;  1JLC B;  4Q8F A;  3KK2 B;  4NXM F;  3CC2 S;  3PJ9 A;  3HVW A;  3MM9 A;  3TO8 A;  1WEY A;  2R2U A;  1RXO B;  1X9W A;  4DSJ A;  1N54 B;  3CCS S;  3CD0 A;  3EXC X;  3SDE A;  1XBW A;  2XYG B;  1BXN A;  2HHX A;  2V63 A;  4LF4 F;  5IV4 A;  2CZV C;  4BC9 A;  2JH3 A;  4CH1 A;  1MRO A;  2BR0 A;  4JI6 F;  1UPP A;  1HNX F;  4OMF G;  4ZMM A;  3F73 A;  1QSS A;  3NY0 A;  2FJW A;  4DSK A;  3KUH A;  5KFY A;  2F3J A;  4F50 A;  3HO1 A;  2GX8 A;  2Y1L B;  2W1B A;  2CRL A;  4H4K A;  1DY3 A;  1AZS A;  1WEZ A;  3GIM A;  1DTT A;  2MZ1 A;  2AJQ A;  1KOH A;  3NBP A;  2KRR A;  1N34 J;  3RTV A;  3Q23 A;  1R0A A;  5H9E K;  3DNC A;  4P71 A;  4LSL B;  2QX0 A;  4M1K A;  2GVD B;  3ZZP A;  5HRO B;  3AOB A;  3OD2 A;  3I87 A;  1EIY B;  2A2C A;  3ZZY A;  2ASY A;  1HQE A;  3US5 A;  1HQ2 A;  5KFO A;  3SXL A;  3KYL A;  3KDO A;  1YJV A;  5A8W B;  5GAD U;  4Q43 A;  3GFH A;  3ET6 B;  2DHA A;  4YR0 A;  2OO4 A;  3LP1 A;  4CT9 A;  1TP7 A;  3KLE A;  3A8J A;  5IOL A;  2NS1 B;  2DO4 A;  5CCL A;  2N82 B;  1JB0 C;  3GON A;  3GV8 B;  2J8S A;  3D68 A;  2K7J A;  4WFY A;  3IBF B;  3J7Z 5;  3D9B A;  1WG5 A;  5DRK A;  1C1C A;  2YKN B;  3VAG A;  1GQE A;  1I94 F;  3D4J A;  4J9M A;  5KFP A;  3VZH A;  4RO0 A;  1BUX A;  2H48 B;  5CZV A;  1U0H B;  4ELT A;  2W7P A;  3MR6 A;  3UCU P;  3ONQ A;  3QIP A;  1X4G A;  1X4E A;  4H4M B;  3BQ2 A;  1JLE A;  5BXI A;  3VAM A;  2IPO B;  2XGP A;  3M8Q B;  3ZZO A;  3Q8R B;  2FLO A;  4WXO A;  2A10 A;  3QFW A;  1DTQ A;  3DGP A;  4RW8 A;  3B4D A;  2IVY A;  3GLJ A;  1NSQ A;  3KG4 A;  1YSJ A;  3QNW B;  3AJ2 A;  3VAL A;  2DGU A;  1VCT A;  5D0R A;  4O3Q A;  3Q0A A;  2RQ4 A;  2ZH8 A;  1FA0 A;  4TNO A;  2XG8 A;  2KO1 A;  2MEW A;  4OV1 A;  3G9C A;  4NLR A;  2ALZ A;  3JYT B;  2K3I A;  2L48 A;  5H9F J;  4O44 A;  1EET A;  2HHP A;  3MPW A;  5J2Q A;  1V5V A;  3UN3 A;  3N6L A;  5DM6 Q;  4AND A;  2JEF A;  4ZKA A;  1DHM A;  1SQG A;  3NGK A;  2NYI A;  3PW2 A;  2HZV A;  1S1V B;  3R2D J;  5HMZ A;  4ZLP A;  1XQI A;  4KHP F;  1H74 A;  2GGP A;  3CMQ A;  1QLN A;  5E33 A;  1TQL A;  2J8A A;  4PQA A;  5G0R A;  2VOO A;  4HR2 A;  3MUR P;  4X65 F;  2Z2M A;  2JWN A;  4USI A;  2ZC3 A;  4OZ1 A;  3MUM P;  4KHR A;  4DLE A;  3DLE B;  2P6T A;  1R8C A;  5CYJ A;  1SH2 A;  5JJB A;  2KG0 A;  3KUG A;  5GAD I;  1LWF A;  2M9K A;  1JLB A;  1FKA F;  2ADC A;  3FK4 A;  3H20 A;  2WBM A;  3F44 A;  1HAR A;  2ACY A;  2K7K A;  3WBZ A;  2DPJ A;  2DPI A;  4FPR A;  2C2E A;  4ZLL A;  3CJ2 A;  4K5R A;  4LF6 J;  4OJ3 A;  3K5P A;  2AX1 A;  5FDL A;  3HKZ D;  4DUT A;  2WSE C;  3HDS A;  4DZ6 A;  4ZDN A;  3T1H J;  1Q95 G;  3JTO A;  4LFC J;  4CM0 A;  2ZZN A;  1FWP A;  4WP8 A;  3JQM A;  4RL1 A;  1ITP A;  4PKD B;  4OZ3 A;  2DGW A;  2EVZ A;  4DCO B;  1RWM B;  1LV5 A;  2D9P A;  1UMJ A;  2M8D B;  1NXI A;  2R2S A;  4EZ9 A;  4EK2 A;  2ZJR Q;  2ZD1 B;  4ER8 A;  2Y0B B;  3LAK A;  2ZDO A;  2WOM A;  5KFC A;  1X60 A;  3GIR A;  2ABY A;  1TK8 A;  3SQG A;  5DO2 A;  2AJ0 A;  4C8K A;  4UQG A;  4TY8 B;  5J2N A;  3PXG a;  5L1J A;  2HHH F;  4FYY B;  2KDO A;  4Y00 A;  2VOP A;  2L08 A;  1T9T A;  2CPY A;  2Q66 A;  2WW8 A;  3QWU A;  5I3U A;  2XS2 A;  1RBA A;  2E29 A;  3T5K A;  4CLY A;  1MNE A;  4O3R A;  2MLX A;  4UY8 T;  3BSO A;  4DR3 F;  5D4O A;  4JI8 J;  3GIL A;  1VC5 A;  1L3T A;  2OD6 A;  3AH6 A;  2V2K A;  4KAI A;  2E44 A;  2E66 A;  2FDN A;  1YZ7 A;  4F2R A;  2YKP A;  2UXC F;  3CJ0 A;  1O5J A;  2BA9 A;  5C24 A;  4J9S A;  3NS7 B;  3SCK E;  4N41 A;  5HO4 A;  2GAH C;  3HPO A;  3TOQ A;  4OZN A;  1NBE B;  1L3K A;  3DXS X;  5D0G A;  2HG4 A;  2DY1 A;  2G2Y A;  2B7C B;  4B3S F;  4OLP A;  4M63 A;  2MJU A;  1SL2 A;  5KTQ A;  4AFF A;  3O3L A;  3Q8U A;  3QJP A;  3GJQ B;  2ZBP A;  3NG8 A;  3OUY A;  1HI0 P;  3C16 B;  3OFF A;  1HBN B;  4ZPC A;  2EG2 A;  4QWA A;  4F0M A;  4BDP A;  1HKA A;  3OTD A;  4DN9 A;  4OI6 A;  3C66 A;  3DLH A;  1KBR A;  2FLL A;  2HFS A;  3S1T A;  1E6V B;  5SUH A;  1YZ6 A;  2RRB A;  4J9P A;  4BLG A;  4EFA C;  1F2G A;  3IC1 A;  1OWX A;  4GO5 X;  4DWI A;  2QSF A;  3UO0 A;  5IM0 B;  1NAQ A;  2XZT B;  3MCS A;  4H54 A;  2VPY B;  4C97 A;  1FE4 A;  4DX7 A;  1L3U A;  2JNJ A;  3FCV A;  5F8J A;  4LF9 F;  4NOH A;  4DCP B;  5G4D A;  4DR1 J;  4JP8 A;  2EW9 A;  2PDA A;  1S7I A;  3GFY A;  2RH3 A;  1VQ8 S;  2VBZ A;  1TZ0 A;  3NLC A;  3ISZ A;  4ZVT B;  3D6M B;  3DGV A;  4U7U D;  3CJR A;  3THV A;  3UQS A;  3VHQ A;  2BVZ A;  3CC4 S;  2M0G B;  1ZPV A;  2QG9 B;  4Y2K A;  4GKK J;  3AOC A;  1IBK J;  2XMV A;  3EPG A;  4DXL A;  3H2U B;  2P6S A;  4BHQ A;  2XWX A;  3FZ2 A;  1X4D A;  2CPE A;  2BAC A;  3SCL E;  3DRS A;  1Q79 A;  5B08 A;  3MR3 A;  5ETQ A;  1F2H A;  3ITH A;  1KFD A;  2G0I A;  3W2W B;  2VG7 B;  4R0J A;  1T95 A;  5KFW A;  2R2T A;  3ENW A;  2J9C A;  4GVB B;  1CJT B;  2H9Z A;  2DJW A;  2V34 A;  3VAH A;  3EUN A;  3PAC A;  4O4R A;  1HI8 A;  2OP5 A;  4CO4 A;  2OPQ A;  4J9Q A;  4J5O A;  3MMA B;  4U9R A;  3I6P A;  2G9O A;  1IM6 A;  3MED A;  2BW2 A;  2D7S A;  2LQ9 A;  3H90 A;  4J9O A;  4JI5 F;  1Z1Z A;  1JLC A;  2HRY A;  1O6X A;  4KV8 B;  2UUW A;  3KK2 A;  3TJ8 A;  3KHL A;  5I3P A;  4B3T J;  5DS7 A;  1EQM A;  1S76 D;  5FLX U;  1BD6 A;  3UD3 P;  2DHH A;  2JVO A;  2HBZ B;  4JI2 F;  2VPZ B;  3S01 A;  4CLW A;  1UZD A;  1VQL S;  5LMN F;  4UTG A;  2BUN A;  5IC6 B;  3GZ7 A;  1FEH A;  2ZHO A;  4KR0 B;  1T0T V;  2UU9 F;  1IXK A;  2OEK A;  1N5S A;  1FHT A;  3OL9 A;  1XJW B;  5K8P A;  3TEH B;  1NZA A;  4ECU A;  2EK6 A;  1G7C B;  1GMW D;  1JLA B;  3J81 Y;  3BS9 A;  4N8O A;  2CWX A;  2MYF A;  3HX9 A;  1RLC L;  3EZO A;  3M4X A;  4FS1 A;  2JLE A;  3PJX A;  4F4X A;  1VRU B;  4OJH A;  1ZAV A;  2LQB A;  3IRW P;  2Y8Y A;  4LSL A;  2XZD B;  4ECW A;  1P6T A;  2GVD A;  3RBE A;  2RQK A;  1U48 A;  3DLG B;  3CMA S;  3QGI A;  5M2R A;  5AJ3 F;  1IUJ A;  1FRX A;  2HK2 A;  2OIH A;  5HRO A;  3DDI A;  1N5T A;  4HHJ A;  2GZO A;  3D0H E;  4UUX A;  5A8W A;  2HHW A;  3L4B C;  4QWE A;  2B9E A;  5F8G A;  3TZX A;  4EBD A;  2BXJ A;  3X1L B;  1DRZ A;  2ZDP A;  2I6W A;  2ZOG A;  3UR0 A;  4X4N A;  1N5V A;  3MR7 A;  3MEE B;  4F3M A;  4RWW A;  3ILO A;  4CO5 A;  2UVU A;  4U7U K;  1NK9 A;  2H5E A;  1VBK A;  1R6Y A;  1U8S A;  3THT A;  1ZM9 A;  4M5D B;  2PT0 A;  2QMX A;  2FJX A;  1XNQ J;  1BMQ B;  2BYC A;  4I67 A;  2YQ1 A;  2YKN A;  2KXF A;  5HMX A;  2UUB J;  4JI7 F;  2YNF A;  1K73 T;  1XMO F;  3R7B B;  3PW7 A;  2DEI A;  2ZKT A;  4QR1 A;  2CPJ A;  2HIY A;  1U0H A;  2B9Y A;  4B3M F;  1PCA A;  1TFY A;  2WHO A;  4H4M A;  4TYB A;  3W66 A;  2A0F B;  2EFO A;  2DHS A;  4Q7A A;  3M8Q A;  4DPW A;  2ZHB A;  2G0C A;  4QYZ J;  5D6G A;  2YQ0 A;  1FD2 A;  2HBR B;  4RZR A;  3OJS A;  3OTO J;  2QMW A;  4PZV A;  1GAO A;  2MB0 B;  2EG1 A;  4FKX A;  3TP2 A;  1REV B;  3A3P B;  2YPY A;  2ZH9 A;  3CW2 C;  1S6O A;  1H73 A;  2KHD A;  2DVI A;  4X4O A;  4PG6 A;  2AW0 A;  4DV2 J;  2HNY B;  2C28 A;  3NL0 A;  5ETS A;  2YH1 A;  1FFW B;  1JXE A;  1FJG J;  3DDN A;  3GV7 B;  5DGA A;  3RB3 A;  4KPC A;  2DNO A;  3M8P A;  1F5C A;  1S1V A;  3C14 B;  4DDF A;  4KIA A;  3DMJ B;  4MYT A;  3T19 A;  5HJY A;  4YEA A;  1RAE B;  3D1H A;  2ZZM A;  5ETO A;  4NLD A;  5HP1 B;  2IA6 A;  1WEL A;  5KFA A;  2ZH7 A;  4RNN A;  3ZZT A;  4NXM J;  3DLE A;  1RKJ A;  4JV5 F;  3WC0 A;  5KFI A;  4IFY B;  4C0O C;  5L9N A;  4X4P A;  4EZ6 A;  1CJV A;  2AWZ A;  4Q0B B;  1EX8 A;  4LRF A;  2ZIT A;  3VR1 A;  2YNH B;  2CJA A;  2B8Q A;  3EMT A;  4F4A A;  2IM3 A;  1JQG A;  2LVW A;  3OXG A;  3RBX A;  1VGY A;  1VOM A;  3M6W A;  2YNG B;  1F9E B;  2FGC A;  2B51 A;  4U6P A;  1S10 A;  4JI6 J;  1HNX J;  1VQM S; 
#chains in the Genus database with same CATH homology
 1IBC B;  1RWP B;  2C2M B;  2XYH B;  2QL5 B;  2CJY B;  1RHK B;  3R7N B;  3SIP B;  3D6H B;  3R6G B;  1RHR B;  2XYG B;  4JB8 B;  2C2K B;  1RWN B;  3IBC B;  2XZT B;  1ICE B;  2CNK B;  2H4Y B;  5K20 B;  4LSZ B;  1BMQ B;  2C2Z B;  1PAU B;  1RHQ B;  1RWW B;  4DCP B;  3EDQ B;  5IC4 B;  4ZVU B;  3P45 B;  2DKO B;  3R6L B;  1NME B;  1RHU B;  1RWK B;  2C1E B;  2CNN B;  3IBF B;  3R7B B;  1I51 B;  2Y1L B;  1RWV B;  1SC3 B;  2FQQ B;  3EDR B;  1RHM B;  3GJS B;  3NS7 B;  2QLF B;  2H5I B;  4ZVP B;  4ZVS B;  3KJF B;  3R5J B;  2CJX B;  2XZD B;  4ZVT B;  2QL7 B;  2QL9 B;  3KJQ B;  1PYO B;  3D6M B;  2QLJ B;  2H48 B;  3P4U B;  4ZVO B;  4ZVR B;  1RE1 B;  4DCO B;  1I3O B;  1RWM B;  3GJR B;  1RWX B;  1QDU B;  1RWO B;  3D6F B;  1RHJ B;  3GJQ B;  3GJT B;  1QTN B;  2XYP B;  2Y0B B;  2HBR B;  4DCJ B;  2CDR B;  2HBZ B;  2HBQ B;  2H4W B;  1SC1 B;  4ZVQ B;  2HBY B;  3KJN B;  2C2O B;  2CNL B;  2H51 B;  2H5J B;  1F9E B;  2CNO B;  1GFW B;  5IC6 B;  3R7S B;  2H65 B;  2QLB B;  2H54 B;  3RJM B;  3QNW B;  2P2C B;  1SC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...