3NSDA

Silver bound to the multicopper oxidase cueo (untagged)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
487
structure length
462
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 129
structure length 462
sequence length 487
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA03
2GC4C 2R7EA 2FQGA 3UGEA 1AZCA 1E5YA 1EHKB 1SHWA 1SDDA 1QLEB 2BP0B 2J57A 2XVBA 4HHWA 1GY2A 4E9SA 2HX7A 4YSQA 3DIVA 1A3ZA 4YL4A 2GI0A 5I5IA 4WKXA 4G71B 4MFHA 1ASOA 4NERA 3TU6A 1RCYA 4RH4A 5EHFA 4AI7A 1OE1A 4A2DA 4AKPA 4KOBA 2P80A 3NJFA 2DWTA 2IWKA 3FT0A 3CG8A 5I6LA 2QDWA 4F7KA 3H4HA 1NZRA 2QDVA 3EH3B 4UANA 3DTUB 2WSDA 4GP5B 1VLXA 2FNWA 3WKQA 3FPXA 2TSBA 2OJ1A 4YSCA 4A2GA 5I6OA 4KOCA 3AG4B 4YVNA 2HX9A 1XB3A 5I6NA 5D4HA 2YXWA 1J5CA 1GSKA 2YARA 2XX1A 2B3IA 3GDCA 4X4KA 1URIA 3GYRA 1NWOA 3ABLB 2UX7A 5I6MA 2QPDB 4UF7C 2FT6A 1OE3A 3SBQA 4NAJA 3EH4B 1AQ8A 3AZUA 4ENZA 1BXAA 5B1KA 3FU7A 3AW5A 1QNIA 4DP0X 1BXUA 3NT0A 3TBBA 3NJHA 1N70A 3PLYA 1OCRB 2BHFA 5PCYA 1DZ0A 4HCIA 2FQDA 4BDVB 1KYAA 1GW0A 2W88A 2PP9A 1A4BA 1JZEA 1SNRA 4GY4A 2DY2A 2IWFA 6PAZA 2FT7A 3UAEA 5FC9A 3GXUB 1PLAA 4DPAX 2WO3B 3NJGA 3X1EA 1J9TA 4AX3A 1SFDA 3JT2A 2VW7A 1ASQA 2Q9OA 2IAAC 4JHVA 4AZUA 3NP4A 1SF5A 1YLBB 2GC7C 2YXVA 1A65A 3FU9A 3NSCA 4HAKA 1KCWA 1ET5A 1WA2X 4M4RB 2YAFA 2XUWA 4DP1X 4DP9X 2BO0A 5E9NA 3ABMB 1AS8A 2BP8B 1WS8A 1GR7A 1NIAA 2CCWA 2W8CA 2JFCA 2IDTA 3UADA 2UXVA 2A3TA 3MX0B 2J56A 4DP8X 1WA0X 2R7EB 1ADWA 3ABKB 2VN3A 2BW5A 1BAWA 1SDDB 4ZK8A 1JZJA 3ZX1A 4A68A 2FT8A 3H4FA 3AG3B 1KDIA 1PF3A 3EF4A 3TA4D 2UXGA 3CVCA 2E86A 4DP7X 1W8EA 1TU2A 3PXLA 4JKNA 1ILSA 4DP4X 2BWDA 1OV8A 1ZIAA 2J55A 4N8UA 2Y1AA 1IUZA 1NIEA 2PCFA 1RZQA 2PPEA 1TKWA 2ZONA 3QJSB 3N2JA 4HIPA 2XV0A 2CALA 1MZZA 1L9QA 3T9WA 2PLTA 3UABA 4F2EA 1A8ZA 1AANA 4P5RA 2H5UA 5LDUA 3S3CB 2I7SA 4W9ZA 1AZRA 4HALA 1PY0A 4FA7B 1FA4A 2XWZA 1XMEB 5B7MA 4KO6A 1FFTB 3EHBB 1JXFA 1A4CA 3SBPA 2HLEB 2UXTA 4BXVA 5F7AA 1V55B 1ILUA 1NIFA 3C75A 4A66A 1X9RA 2NRDA 1NTDA 1AIZA 1XB8A 7PCYA 2J5WA 2XLLA 1JERA 3AG1B 1NWPA 4K9JA 4YSEA 2Y69B 3JTBA 1NDTA 2N0MA 3N55A 2YAQA 2ZWNA 1OCZB 3UAAA 3KW8A 1MG2C 4KNSA 3FU7B 3S8GB 1V10A 1NICA 3ERXA 3NSYA 4BWTA 3X1FA 5B1JC 5B7FA 1IBYA 1AOZA 1CUOA 2HRGA 2YQBA 4G72B 2PPDA 1ET8A 1M56B 3T6XA 4YSSA 2UXFA 1W6LA 2PPCA 5B1JA 4G7QB 4NB7A 1JXGA 1PCSA 1GYCA 3NJIA 2FQEA 1PLCA 1PNCA 1OOWA 1N68A 2EIJB 1JZHA 1TEFA 2TSAA 3WNJA 1JZIA 3IBOA 3OM3B 4KO5A 3ASNB 1CC3A 1JZGA 1AZUA 1SJMA 4GP8B 1JOIA 3U25A 4EF3A 5TK4A 1IKOP 1NPJA 2VM4A 3H56A 5D4JA 2P80D 2IH9A 1BYPA 1M57B 4BXSV 1KV7A 1KBVA 3NJMA 3IN0A 2VSKB 3X1NA 1AZBA 4HCFA 3QPKA 4Q8BA 3NJNA 1MZYA 1CYWA 1NPNA 1SFHA 1OCCB 1TEGA 4YVUA 1IC0A 2VMJA 3X2QB 2HX8A 1MG3C 9PCYA 2BWIA 1AAJA 1HAUA 1NINA 1IBZA 3FQ1A 1WS7A 3T71A 1PAZA 2OCCB 1ZPUA 3QQXA 1PZBA 4HHGA 1PZAA 3S3BB 2PP7A 5PAZA 3TASA 2PP8A 4JHUA 4YSTA 2AVFA 3OMAB 3PCYA 3KW7A 4BK5C 2YAPA 5D4IA 3QJTB 3X1GA 1E30A 1R1CA 2DYSB 4P5SA 2XX0A 2FWLB 3AY2A 2H47C 2IDFA 4DP5X 2ZXWB 2X88A 3RYMA 4BDVA 3WI9A 5B1BB 3FYEB 2X87A 3NJKA 4Q89A 5TK2A 4G7RB 1AG0A 1GS6X 4UAHA 4WTQA 1AG6A 1GS7A 1HAWA 2JXMA 2FQFA 2XV2A 1XB6A 4A2HA 2CJ3A 3HEIB 2CUAA 2GIMA 3OMIB 1OCOB 3HB3B 4CSPA 4DPCX 4QKTA 1M9WA 1UATA 1RZPA 4E9WA 1A4AA 2GBAA 3OQRA 4YSOA 2I85A 4KO9A 3V9CA 1PZCA 7PAZA 1BQRA 1MDAA 5B1AB 2VW4A 4E9QA 3QJUB 2XU9A 2VSMB 2IDSA 3IE9A 5F7BA 1EZLA 3OMNB 1ZV2A 1GS8A 2YAMA 4FAAB 3PAUA 1BEXA 4AKOA 3ZBMA 2DYRB 2VM3A 1AZNA 3NSFA 3CDZA 2BP8A 3OD3A 4AKQA 3X1BA 1QHQA 5AFAA 1OE2A 1J5DA 2HRHA 1AS6A 4M3HA 2DWSA 3NP3A 5B7EA 3ZIYA 2AFNA 2GHZA 4A67A 1ZIBA 1B3IA 3NJLA 5I5JA 2I7OA 2YAHA 1KGYE 3FQ2A 2MTAA 3FU8A 2FTAA 2BW4A 1KCBA 1OF0A 4KO7A 4GXFA 2OV0A 5I5MA 1NIBA 3FS9A 4E9VA 1T5KA 5I6KA 2MRYA 1I53A 1AACA 3FQYA 3G5WA 1ID2A 5I26A 2XXFA 3FSWA 2HXAA 2IDQA 2BP0A 1L9PA 1CYXA 3FSAA 1JXDA 1KDJA 4YSAA 6PCYA 3IN2A 2PPAA 1FWXA 1ZDQA 1SHXA 1PNDA 1BXVA 2LLNA 3CZUB 4PCYA 1L9OA 2HZHA 1WA1X 3DKHA 5A7EA 5B3SB 1E5ZA 4TXVB 3PPSA 4PAZA 1V54B 3CVBA 1RKRA 3BVDB 1F56A 4E9TA 2IDUA 1J9SA 3D12B 3QJQB 1J9RA 4DP2X 1KBWA 1E65A 1AR1B 1J9QA 2AANA 2YAOA 1BQKA 2JKWA 3CVDA 1L9TA 2PPFA 3AG2B 3FYIB 1BYOA 1W6WA 4E9RA 2PCYA 1PMYA 3FSVA 3QJRB 3SQRA 4QLWA 3S3DB 5IY5B 2ZOOA 2RACA 1L9SA 3MBWB 1WAEA 3TBCA 2XYBA 4CSZA 4YSDA 8PAZA 2GB2A 4BWUA 3NYKA 4N4YB 3ZDWA 5AZUA 1DYZA 2QT6A 1JVOA 1PLBA 3PAZA 1GY1A 4F2FA 1CURA 4DPBX 1ZDSA 4G7SB 2EINB 3V9EA 3L45A 2YAEA 1ASPA 1HFUA 4A2FA 2IWEA 2DV6A 1JZFA 5AKRA 2IH8A 5I6PA 3SBRA 2EILB 2XV3A 3WNIA 3IEAA 3EH5B 1X9UA 2WO2B 4YSPA 4YSRA 2GSMB 2EIMB 3NSDA 4E9YA 3WKPA 3CDZB 1L9RA 3T6ZA 4E9XA 2QPEB 2B08A 3ABGA 2CAKA 2EIKB 5ANHA 2AZUA 3WIAA 3FSZA 4KNUA 4YSUA 2AZAA 4L0PB 5I28A 2UX6A 1ETJA 3FPYA 3NJJA 2H3XC 4G70B 1E67A 2FJSA 3T6WA 4GP4B 2BZCA 3UACA 2VW6A 1BQ5A 2XXGA 4KNTA 4W1TA 4HZ1A 3WG7B 3T6VA 2CBPA 4GYBA 2BZ7A 3PAVA 2Q5BA 1NIDA 4BWWA 3S8FB 1ET7A 4DP6X 4HCGA 3QJVB 1JVLA 1SF3A 3ASOB 1AS7A 3BQVA 4A2EA
chains in the Genus database with same CATH superfamily
2YO3A 3SDXF 1WAAA 4M7KL 3LDBB 1E5YA 5I8KL 1P69B 4PRAB 4M6OL 1RPQA 5HGHA 3PU7A 1WHOA 5ICXB 3JV6A 3S97C 1R3IL 2B15A 1GY2A 2VLRD 4FEIA 2H2SC 3TJPA 1G7LA 4KK6D 5FFGA 5BOPA 2ZD0A 1AD9A 5IF0B 1CK0H 3FAXA 3OB0K 4FFWD 4D0CA 1IEAB 5D72H 1KTRL 3IFNH 1I1YB 3U1QA 1OARL 1T5XA 3K91A 4BKLB 4UDUB 2WXNA 5ID0B 1UACL 1Q9WB 2HJLB 1RCYA 5HI3D 1QRNA 2VLRE 4KMTL 2V17L 3C8HA 4YDZA 5GS0L 2F7RA 1CE6B 2GK0B 3H0TB 3NJFA 4N90D 4AYMC 1CICA 4AENB 3KXFD 4HKXB 3O3BA 5KSAB 3C2AL 1BVKA 1AGDB 3P1VA 3TIDA 4FYRA 5EC2A 1NCNA 3JV0A 2W07A 3EYOB 3KPLA 3F7LA 3FH7A 3HHSA 4FXGA 2DD8L 3D69B 4UB0L 4XPHH 2C8NA 4GLRI 3ETSA 2Q7YB 3VI4F 2BVQB 4HJJL 1LO3L 4N90E 5C0CB 1FFRA 4H2AA 1FFOB 3KXFE 4A7GA 4NYLA 2AP2A 2C34A 4K3EH 1A8JH 2VH5H 2L0DA 1OAUL 4MD5A 4NCDA 4ZMYA 1UT2A 4MDJA 3T4AA 2G2NA 3FU7A 1BZ9B 4JFUA 1RY7B 4G6JL 4G9FB 4XRCB 3V0VB 2WUCL 1QOKA 2EKJA 1URLA 2PR4L 4CRPA 4PR5B 3EYVA 2XPZA 3M7OA 2KPNA 5GZNA 2ZKYA 5JIIA 1IAMA 4NOFA 2OCFD 4GLRH 1KCLA 2LU3A 5FHBH 4UQDA 1AI1H 4YQXH 2EDBA 1JHLL 5DQDH 1VHPA 4R4BB 3TWCH 2NXYC 3MRMB 4XMXA 4MQSB 3E9UA 1K85A 4RFEA 3UAFA 4OGQC 1ZE3C 2M8XA 3VM7A 1KENH 5IREA 2X4UB 1BPLB 3BVNA 4P2CG 4JO5A 2KKQA 5F72S 4O2CB 1OK0A 4P2AA 3UZEA 4AX3A 2NX5D 1XGTA 3LEYL 1DLFH 4XH2A 3NCWA 1C7SA 4PBDA 2DI7A 1MHPL 3CFDA 5D1QD 3QI9C 4TNVK 2ORBL 3QQ3B 1TCMA 3C6SB 4KTYA 2APFA 1QAWA 4YZWA 5DJ0A 3S6CA 5GS1A 1WZAA 4JPWH 5E9NA 5M94B 4FQXD 4LIQE 2R1YB 5JHLA 2BP8B 1NIAA 1IBHA 5KVEL 2NX5E 2I07A 2NY4D 3PY9A 1BEYH 2AGJH 3JYCA 3CZJA 4YHLL 4O00A 1EO5A 1NKRA 4CSTA 5D1QE 4PBXA 2YPVL 1V05A 1ONQB 5TFSL 4HWZA 4BQCA 2D2OA 2WBJA 1QUNB 5D7LA 2VDMB 1OQOA 3LXUX 4AQEB 5DVNA 4R4FL 4JPSA 2Z8WC 3Q2VA 3MBXH 4L1SA 1RVFH 2V7NB 4V1DA 4JKNA 3R7RA 4P2OB 1IU1A 4WGWB 4TQ8A 4N1CA 4XTRC 3FO2B 5FYJH 3HC4H 3HG1A 3KLHC 2ID5A 3LKNA 1FORH 2PR9A 4QT5A 3QJSB 2C3GA 3WELA 3I02B 3ZL4L 1MF2L 3T9WA 1YECH 2D3LA 1A8ZA 5K9OA 1AVAA 3F12A 4HUVB 3L6FB 8FABA 4XO3A 3VVWA 1HWHB 4JJ5B 3QRBA 4KUCD 3V6ZA 3PGFH 4P4KB 3VXRD 4Y5YA 3VD9A 4G8GD 4HJ1A 3KPTA 2XWTA 4GSDL 2GJJA 4DAGL 3GO1L 2W81C 4CC4A 4ZS7L 3K0WA 1BD2B 4B5ZA 3Q01A 4YXHL 4KBPA 5HHVH 2YMOA 1N2RA 3K4ZA 4OH2A 1KTLB 2WNWA 5EFIB 1HIML 3TC9A 3SDYL 3UJIH 2GTWA 1E4XL 4JGMA 3UTTB 5B8CB 4X5RA 4MBRA 2Y22A 3VXRE 2KT6A 1U8QA 1CFQB 4G8GE 5DHVH 5B1CA 3AU0A 2EDXA 3K4DA 5DC0A 2YC1B 4B9PA 2K6WA 4PWHA 2W9EH 3LXCA 4LU5H 1JPTL 3ERXA 3VXSA 3QIWD 4AV4A 3NSYA 4PJCE 1DQDL 4IRJB 1UXSA 3CFBB 4J27A 4PJ5B 3POCA 4NKDA 1E90A 5KYWA 1RZJH 5A2LH 3LKSA 4ODXB 4RVBA 4PGDB 1B4LA 3ISWA 1PD1A 1MRCH 2NY7H 3MRCA 4IS6B 4LLWA 5LAXA 1XIWA 4GQPH 2JJVA 1LO0L 4Q9RH 2BCKA 1NLBL 3MACL 4G7VH 4MJ2A 3DMMA 5DHVA 2R2CA 3P9LB 3AS0A 3SYQA 2BINA 3DBSA 2CIKA 1S7VA 2HKHL 2PWDA 4WTWA 2PMZA 2BM3A 5LN8A 4GAGH 2VDNL 3O2WH 3WXWH 3IBOA 3MUUA 5IW1B 5T5FH 4GS7B 2OXGA 1S5IL 1TZHA 4F7TA 4TQIA 2LOEA 4OLZH 5TK4A 4NN5C 4ZOCA 5IKCA 1LP9F 5J57B 3ROOA 4EI5C 3TBSA 3BJ91 2HTKD 5EIIG 1XR9A 3BLKA 4OGXH 2AAVA 4NDMB 3QWOB 3DO7A 1Y1DA 1EEUA 1DFBL 1RIUL 4PRIA 3RWHB 4L1DA 1BVNT 1GGTA 3EZ8A 5KVMC 4G2AA 1QLFA 4X4MA 4HMEA 2AK4B 4OFVA 1MZYA 1I85C 5AW9B 3BP5A 4OF3A 1NPUA 3DLQR 2AHIA 3MXWH 2VRKA 4LOEA 1DP0A 3WN6A 1KCRL 3THML 5H8DA 3CX5K 1LGVA 2WWKT 2Y2YA 5BZZA 5KBMA 4JZNB 4F7CA 3U6XS 5IHBA 3NVQA 1PZBA 3U9UA 3ET9F 3OHMB 4AM0Q 2PP7A 1MVUA 4NQTA 1P0SE 2X4RA 3L3KB 4HJIA 1OHZA 4KDTC 3FU6A 1BJ1H 4G9DB 4PTTA 5KUKA 4GRLD 5LBSL 2R39A 2J8UB 3GZQA 5F7WC 2OXHB 4N2MA 1WISA 4NX0A 1G7MA 3VWKA 1YY9D 2IH1A 3HPLB 5AKTA 2AEPH 1K5WA 2VABB 1WZLA 5JW4M 1JZDC 3AGVA 1AP2B 1NBZA 3WSQL 5K1NA 3D87B 2F53A 4XVSL 1O7DE 4Y4KD 3WIIL 1LE5A 1XGQB 3KWTA 4RGMB 3OC8A 3WUWA 5CUSL 4OFIA 5EZIL 3GB7B 4PMEA 3BUYA 3G9AB 3FUMA 3MMEB 5IFHL 2L7QA 4HFWB 1F4YH 2NTSP 5GGUA 1F6FB 1K3ZA 4E9QA 4NKQB 4POZD 4X5QA 5EN2A 5IW6B 2X41A 5ESVB 4MCZB 5C9KA 4U3HA 3TONA 2A6IA 3L4VA 2Q6WB 3RBSA 1X9QA 2WAHA 3FCBA 3PIQA 1D7BA 1HNFA 3WJLC 4WSGA 3IXTB 5D1XD 3MC0A 3MRKB 4HUWB 3HZYA 1RIVL 1OGAA 2WWMD 1YDPA 3QEGL 4U1GB 3EOYG 3T0VA 1OM3H 4X9YA 4TL5A 5L2KA 2Q3XA 5E08L 3VDCA 1UZ8B 5FECA 2WIMA 3NIFF 2WUBL 2BOBA 5FXCH 4FYQA 2QTEA 1UGNA 5F7DB 1OF0A 2JKJA 2X6UA 1B4TA 1IGCH 2M83A 5D1XE 5DD3L 4UI2A 3QUXB 1ULVA 4GAFB 4WF7A 2E9IA 4P9MH 3MLSH 2MRYA 4YNYB 3VRJB 4U6TA 2BSSA 3TEYA 2BVOB 5EB9A 1JS4A 2CHWA 4YMPA 3APMA 4IU2A 2GITB 4GIOA 4KNQA 2CUIA 1ID2A 3NSJA 4P46A 1XCQA 2IDQA 3LKRB 1N6VA 5KAQG 3BVXA 4RDQG 2CGYA 3QPXH 4BZYA 1MFCL 5FF6B 1J8KA 2B14A 4FQ2L 1JYXA 1JPSH 2H32H 3VRIA 2ZCKH 4PJGA 3WFEL 1KZYA 3JWNE 4K7FA 2HZHA 3ZJAA 5ACZA 4K5OA 4TNFA 3B7TA 1J0KA 3CZNA 1Q1PA 4PJHE 5T1DH 1OPGH 1HHJA 3KG5A 2CBMA 3D39A 3CVBA 5DD0L 3RZCC 3N6YA 5CZVL 3LNFA 2CKNA 2IF7A 2H2SD 3QCTL 1KJ2L 4E5XB 1UJ3A 4NI3A 1VFAB 4EZMA 3C5ZA 3HFFA 1R46A 1OB0A 1DN0A 4DP2X 1CBVL 4X8XA 4ES9A 4F27A 1CF1A 4TNEA 1GOHA 1NAML 5ELIA 2GTQA 3AG2B 2F74B 3EIFA 4P49A 2E6PA 4NHUA 4K2UH 4H88L 1TJIL 1D6EB 3UH8A 2H32A 4E9RA 4Y2OB 4OQ1A 5J4MA 3DRQA 4GFTB 5GGTH 3SDAB 4NUGH 5J9PA 2BSTB 1JWSB 3W9EB 4MJ5B 2GB2A 4HUUB 2FZ3A 3FZUC 4QPEA 3VXPB 5IJVB 4BYHA 3U0PA 1FIGH 3G5XB 1DYZA 1JTPA 1KJ3L 4IKKA 3PAZA 4M1CC 4WWPA 5KG9A 3DX6B 3RVTC 1XF2A 4MA1C 4Z7IA 4DPBX 3V2AR 2ED7A 3QEHB 3MUY1 4DF9A 3QJHA 4HLZG 1MUJA 2DQDH 1RK0B 3MRPA 1KIUB 1IIIA 2BPBA 2K7PA 4J6IA 2A6KB 1WHPA 3WFDL 3CZFB 1X9UA 2CHZA 3DGGA 1UZGA 4W70A 4Z76A 2GSMB 1NMAL 5GGTA 2R0LL 3ZW3A 4LQ1A 4MDIA 2MQCA 4QRBA 2ZWYA 3QUZA 5KW9H 3N3EA 3KNBA 1L9RA 1I1FB 2JKXA 1KJVA 1GZQB 1QW9A 4JQXA 3GEWB 2Y06L 3QS2A 4HT1H 3VI3A 3HG5A 1C5CH 1TT6A 2X42A 3FPYA 4ZXBB 2NXYD 2QV2A 2Y6SC 5BCAA 1E67A 4GP4B 2BZCA 1TQBC 4FQLL 3G04A 4MA7H 3T6VA 1OLZA 4XCYA 2FBOJ 1UOKA 1MWAH 1RHFA 3SGJA 3H42L 4POYA 1V27A 3QDGA 4PJDB 5DUBA 3RIFK 4M6ML 5L8LB 3ECWA 1P4LA 5TDPA 1I8IB 3QI9D 4HK3N 3RTQC 1RULH 2XQBL 3MNWA 1EHKB 3OPUA 4LLDA 4L8SA 5FOJA 2BP0B 5DWPA 5T1LD 2B2XL 3SE9L 2EKSB 1E2ZA 1KCSH 4E42A 5DWUH 5CLYA 1RZ8B 3FO0L 3PWPB 1DVUA 3MNVB 4JM2D 3BQUB 3IU3B 1A3ZA 4MQTB 3EKCA 5HDQH 1ID5I 1J9CT 1HSBB 4XP1L 4Z95L 5EH1A 3PJLA 4L4VD 4JPIA 2O4EA 3DNKA 4CMHC 2G5UA 3L16A 4GRWB 4KXCA 4XI5C 1OF2A 3ARBC 3O8XB 3OAYK 1NGPH 5FA3B 1F3DJ 5DR5L 5A2JH 4NC1C 1VPOH 2AEWA 2QQKH 2DW5A 2EH7H 2P8PA 2Z91A 4XTRD 3KLHD 5F88A 3VFPB 2JVUA 3IDIB 5BJTA 2DQHH 5EO0A 4UILL 2PWEA 3IDGA 3ZKSD 4P23A 1UA6L 4L4VE 3VNZA 5CJQL 4BFIB 4JZJB 2MSPA 1DQKA 1HCYA 1YCSA 2XV6B 3C5JB 4NC2B 4JFFB 5EF0A 7CGTA 2EADA 4PREA 2YSSA 4X4KA 1BFVL 2WLLA 4G6ML 4L3AA 5LGHL 3ARRA 3BHBB 2IMMA 1A6VH 2FO8A 2M2DA 2A73B 4J39A 2DEXX 4AM0B 3MO1B 4U3SB 1NEUA 3VWJB 3OHXB 1AXTL 2DWEA 5LHDA 1ZEAL 4ZYKB 5B1KA 4QHKI 1CXHA 5DS2A 4L8DA 1H3VA 4ZMOA 3HKFA 4H8UA 3A6BH 1HX0A 1UHVA 2XIBA 5HD8C 5LXGL 2DF3A 3A21A 4Z7VF 1U41A 2VL4A 5ESAA 3SKMA 3FTXA 1IEHA 2N7BA 3K8LA 3BRDA 4XXDA 3VW3L 1JZEA 4Y19A 3FT4A 4NBYB 1HNGA 3QHTC 3GSNH 2VUYA 2L7JA 4MD0B 5TF1L 4YHNA 4KTDL 2WHVA 3B2VH 3SDXB 1A6WL 2BX5A 3VM5A 3EAKA 4BD4A 5KJRL 3OLEA 1V7MH 5GJSH 2R4SL 2ZOLB 4EQ2A 4FG2A 4MMYB 6TAAA 4MCYB 2GFBA 5DJDB 4ELME 1E3FA 2ED8A 2HWZL 4PJBF 1Y07A 4LHUA 5FHAH 4Q9QL 4C55A 3A67L 3VSTA 4JFDB 3ZHNA 1R5VA 4PP1D 1WA2X 3X12B 2HVKB 2VL5B 3LMJH 2DIJA 3NOIA 3PGCA 4YDVB 5FV2A 5KANG 3V7AG 3B9AA 2XXCB 5IBTL 3GSNA 4UM9A 1G0DA 5E6IA 5J6SA 2H9GA 3APCA 3GMLA 4PW9A 4ZUVA 3FB5B 1S8DB 2ZWSA 1PKQE 3LNGA 1AJ7L 4P9HH 3IFOA 4O2EA 3C9NA 4DP8X 2L4OA 2ZWKA 2VN3A 1A14L 5DJCA 5EU6A 2QHRL 4HIJB 4OCRH 2R29L 5TQ2H 3NZHH 2Q20A 2VR7A 3ZSSA 3U7AA 4ZK8A 2G30A 1KZQA 2FLRT 3AG3B 4E41A 5L4IA 4IRSA 4EI5D 1FRGH 3TBWA 2PYEA 5FK9B 5E8DH 1FL5A 2VZUA 5D96B 5C08D 1AD0B 3VI4B 4F91B 5IIEA 4FD0A 3VGBA 5C0EB 1X6LA 1RUKH 3BGAA 1NGXB 1XCTB 3TO4B 3IGKA 5DLLA 1FZOB 5GSRA 2UY6A 1PYWA 2F9BT 4XBGB 4JMXA 2NNCA 4KX8A 4X0KB 5J12B 1I4FB 2CALA 2DKUA 1KGIA 1H15A 5E70A 3RI5K 4QHMA 2IALA 3UTSB 4QTIH 5K5YA 2BHYA 3DSFL 3LQAL 4X5WB 3EJTA 3WHE0 1PCXA 5SV3A 3X13B 3PWVA 1L6ZA 2VZSA 1TJMA 2K8QA 5C08E 4FNUA 1HILB 2P5WD 2X6VA 3TZVC 1OAQH 4NZUH 4LCWA 1U8PB 4S2SA 3TYGH 1KYDA 5F93C 1XBDA 5B3JF 4EIUA 1OT1A 1RZGB 1CF8H 3LHAA 1FYHB 2QKSA 2OMZB 2W0KA 4X5XB 2OMTA 2H26A 2ITCB 1AIZA 3CC5A 4KGJA 5C2BH 4XPHL 4ZFOB 3NIGE 2PNDA 4NXKA 3SYPA 2P5WE 4I4WB 4OZFB 1ETB1 3AWFA 3GD1C 3IS0X 5D70H 3W81A 1Z0MA 1GYUA 2GSIB 4K3EL 1V10A 2VH5L 1SXSA 2MOQA 5DDHB 3FOMA 4N2FA 4X6CE 3E1F1 5H37G 5B1JC 5HP5A 2FCBA 3DX8A 4YSSA 5H94B 4IYKA 3KYKH 4LEOA 2NOYA 5BVPL 4J7RA 3ARPA 3DV6A 1FV1B 2DZEA 3V4VB 1OPOA 4Y9EA 2AQPA 1MJJB 4L4TD 2UWEE 1AI1L 1T0NA 1KG0A 2R1XB 5DQDL 1NDGB 3QW9A 3QFJA 1DO6A 2OAAA 1ZA3B 3H85A 3IDYB 4KRPB 4WNQA 2VDQB 5JHLL 3G6JE 1S7WA 2TSAA 4YR6B 5IBUG 4CJ0A 1GIGH 4K94H 3BZEB 1KENL 2XKUA 1FQ9C 4IW4C 1IGMH 4WEUD 5D9SA 1ZHKA 2EDJA 1NC2D 3M8OH 7FABH 5J5EA 5JW4R 1MCOL 1DLFL 1T66C 4J12A 4WHYH 3BAJA 5DLMH 1S7QA 3ZTNH 2GBUA 3U6RB 5FYKD 2A7BA 2CBTA 5D4JA 3STLB 2P52A 1HZHL 2IH9A 1A47A 2EACA 4KZCA 4MAYC 4RNRA 5GS0C 1UXWB 1QFOA 3IFLL 4R26H 2ADFL 4AVKA 4F8LA 3FN3A 4DGUA 4JPWL 1YN7B 2OX5B 1IM3A 4N0YH 1AR1C 5EF1A 2HH0H 4XP5H 2A38A 3NCJH 3FONA 2AGJL 4N85A 3CFTA 2DLEA 2WZPA 5DJ8B 3VFNA 1DVFC 1A6TB 1TLMA 5FYKE 4G8AC 3DHPA 1AAJA 1E28A 4H25B 2NYYC 4UT6A 1AIFB 4QYOB 1E6JH 2JJTC 4JFHD 5GS2D 2Z4QB 3P4LA 2CKBB 3ARFA 3MBXL 3QNZB 1RVFL 5KS9A 4AYSA 3RZCD 3CFIC 5DJYA 1L9MA 1OZUA 3AY2A 1N26A 3HC4L 2P44B 1SJEB 5JHAA 4F2MB 1FORL 1W0YT 4I3RH 3VD2A 3MBWA 1IKNA 4NENB 1F4XL 1GC1L 4WSJA 4F37F 1MQKH 1E6OH 3ARXA 3OZ9H 2XIDA 4FXKB 3L3JB 4JFHE 1FZMB 1QNZH 1HU8A 3PGFL 1RH8A 3JWDH 5BV7H 4JPQA 5FW8A 5EBLB 2OMXB 3O41B 2W91A 2WNKA 4CAGA 1HL5A 3W0WA 3PABA 4PRHD 4NP9A 3MVSA 2MQ3A 1V7NH 5BUPA 4QI3A 5HHVL 3FZUD 2BXYA 4MB4A 1S9YB 3UJIL 2FR4A 4M1CD 4PJ8B 3RVTD 5BRZB 1HEHC 3L3DB 2ZXQA 5EO9B 2XN9B 3IYLW 1RZKH 2X4TB 4OAWB 1T83A 4TLTA 4N8VG 4NO2B 2GSGB 1BOGB 5DK0B 4PRHE 3RG1C 1TQUA 2I69A 5J56B 1QHQA 4GQZA 2VLLB 3OPZH 2H0PA 1QACA 2W9EL 3V5HB 1LP9B 2MCAA 2FWUA 3TPUB 1ZIBA 5JOFA 2CXKA 1FC1A 2X44D 3QPQC 2P42B 2P8LB 3UG3A 1XX9C 1RZJL 5DD5L 3ZTEA 2QKIC 4LNRA 3S3JA 1T7ZA 1JGLH 1HS6A 2J7LA 3SDCA 1MRCL 2NY7L 1BFSA 4MMXA 4P3CL 4Q9RL 1EH9A 4B9FA 3BZ5A 2F54B 3GI9H 3RWJA 2P5ED 3FTVA 1XD1A 3GMQA 4GAGL 4EAEA 1T1YA 3O2WL 4PYHA 1FG2B 3D33A 1KDJA 5AOIA 5B39B 2ATPB 3V0FA 5CSGA 1WBXA 1NGWB 3LB6C 4OLZL 2NNAB 2B4CH 4EZKA 2JCCF 5DEFA 4NJAL 3SPGA 3TNNA 2LAGB 5LNEA 1M6OA 1QO3B 1WA1X 2P5EE 1B6DA 4PLNC 3A6CH 2V2WA 3NEOA 1HT6A 3HE7A 4GMTH 5C0FB 4OGXL 3ETBF 4Y16A 5KSAC 5D7IF 3MRHA 3MV7A 3QQDB 4PRBB 5G2NA 5JIKA 1F2XK 2G4EA 1UUNA 3HG4A 5CBEB 3F7VA 1RSFA 3SBWA 4OUUB 4D8PB 3BPLC 5INCB 2Z7ZA 4ESKA 4UQBA 3CAFA 1UB5B 3VXMB 2Y9RT 4JRWA 3REVA 2QR0A 3GINA 3L3GB 3LRHA 3ZDZF 1X5IA 1U3JA 2HLAA 2G75B 3ARBD 4P57A 43C9A 4QLWA 4ACTA 1IRAY 1KBPA 5DHXB 2ENSA 3ZHKA 1XGUB 4C4KT 3K71B 5C09B 1PKOA 2WQSA 1M7XA 5CEZD 4OD2B 1E4WH 4BWUA 3O4OB 4DCQB 1G7HB 4XN8A 3MCKA 2KHAA 1KCVL 4DW2H 2F08A 4JKPH 3UC0L 2AEPL 4XPFH 2R69H 3FQXB 1F4AA 4G3YH 2KZKA 4JO2L 3L45A 3FBQA 4X6EA 1E42A 4RDBA 5JPNB 1HFUA 5G5DB 3A23A 1MCPL 4NC1E 5DZNA 4BGDA 5JR1H 4JFXA 1E4HA 3OGCB 1JZFA 1NDMB 2K4WA 3NIFB 4MCNA 2IH8A 2EDOA 4LFHG 5CEZE 5F3BA 4JG0H 5IMOA 3VQ1C 5IQ9B 4LKCA 4DPRA 4GRMA 1F4YL 3RB7A 3RFZA 5HD8D 3KGUA 3SE4C 3I3DA 2XPYA 4RMVA 2ZUWA 1J1PH 1B6UA 4FC3E 4W9HC 4WW2C 2AZAA 4QRUB 1TJGH 5I28A 1ZT4B 2R69A 4UIKH 1OO2A 2PCPB 5EZLA 2PW2B 1I7ZB 4EI6A 1BF2A 4ABQA 4NSKB 2XXGA 1PD0A 1RJZA 2DLFH 4QCIB 3R1GL 1BQHB 1AGCA 3UOAB 2V9RA 2Q5BA 1VFUA 4JRXD 4ZX4A 2JQMA 5T1MB 5EU3B 4MJIA 2A6JA 1FDLH 4WWKC 3VFWB 3E3QC 4PJAA 1ANUA 1GMIA 4QRPA 4Z23A 2LFEA 4ZFFA 1XH3A 3T3MF 5HYJD 3BEVB 1WC7B 3MREA 1GJIA 3ZTDC 3T2LA 1IGCL 4GQ9H 4Y4HC 3UYRH 4NRYB 3WFCL 3FBKA 4P9ML 1REIA 2XVKA 2K4AA 3MLSL 4Y9FA 3BZDA 5AVVB 3ZN6A 5D6DC 4JRXE 5HXMA 1JNLL 2A4EA 4ANVA 5EOCH 5GISH 4M1DH 1SJXA 5L0QB 4FL4B 3MV8D 2XKSA 5I76B 2E59A 5DD6A 3VX1A 1NGYB 2BJMH 3B3IA 1IMHC 4IEFB 1A7NH 5HYJE 3Q2NA 4Y5XA 3QPXL 3DTXB 3BW9B 4AH2B 1U91A 4P4KC 3UPRA 2CDGA 1EO8H 2BP3A 3T0BA 5FYLH 3C60B 1IJNA 3HC3H 3QFDB 1U58B 2H1XA 1GZPB 3VU2A 5T1DL 3ROLA 3MV8E 4HUXB 3S4SB 1OPGL 3C5SB 3AM8C 5CP3H 4HZLA 3LTVA 3D34A 3GSQA 5G4NA 3V4PB 4JFOA 3CN0A 3L9EA 4G1EA 3ZT6A 4BH8B 3HG0A 3NCYP 4C8XA 4R97B 1PTZA 2TSBA 1P6AB 2X70B 4TUKL 5EZOL 1JK8A 3FO9B 3KPRB 4KOCA 1QATA 2Q8AL 3QNYA 5SX4I 3JTTB 4K3GA 4K2UL 3ULVF 1SXAA 3GYRA 5E1HB 5AVZB 1NWOA 5AD0A 2ZKHH 1OE3A 2GJZB 3N40P 4LQFH 4ZBJA 5CP3A 1HXMB 3AZUA 5GGTL 4MNHB 4ZFGH 3KHQA 4BSWA 4W9KC 3FH8A 1OCRB 1Z5YD 4JRYA 4RZCB 5HHPA 3LZRA 5F89B 2Z92B 4Z7QB 2HCZX 4HOXA 1A1NB 4HCIA 1JV5B 1EEQA 4NQEA 4OFYA 4PCTA 3O6FB 4J3BA 2DQDL 2VXVH 3SCMB 4DIXA 2C3HA 5SX4H 4Q6YA 3K6DA 4X6BB 1THAA 3I9GH 4QGTA 3PWJB 1NFDE 5FGCE 2WLJA 4MJ6B 2NQCA 4PY8J 4U1KA 4XN9A 1HHGB 4DPAX 1Q90A 5HTSA 3GRBA 5AAWC 3WS6A 1HI6B 2YGQA 1KFGA 3X1EA 2APSA 3DSNB 3GXDA 2VITA 5KW9L 2E7CA 1ZHLB 2XZZA 3VGFA 1DLHB 3LN5A 3WEXA 2Y5QA 1A65A 1WFIA 5CD3A 5FDWA 2RCSH 4BA8A 3U9WA 4WJ5A 1C5CL 3ZL1A 2BIHA 1KTDA 3K6IA 4P5KA 1HL8A 4LEXH 1ACYH 2UYLA 2VMDA 4H1LB 4YXLH 4MNGB 3TVMA 5LKNA 1T03H 3B9KA 2ADGA 4MA7L 4R83A 3RL2B 5JQHC 2W8CA 3GXPA 4A7QA 3DTDA 2YD4A 4ABWA 2JIXA 2WKOF 4KI1A 2Y7QB 2XRAH 2R0WH 4HULB 1T66D 3DROA 4NO3B 5AW7B 1OW0C 3BUBA 1ZVSB 5SWSA 3SQBA 3MRFB 1DE4B 3DOIA 4WI8A 4L9LA 4MAYD 1N5AB 1RULL 4P05A 5GS0D 2DLTA 1MJUH 2WXMA 4LO9A 3RDTB 4DP7X 2FX9H 3KWWA 5GRWA 3ZRFC 4DERA 2ZXAA 5FW6A 1KCSL 4UWQB 3ZE1F 4IIQC 3IKCA 4XZ4A 5DWUL 1NIEA 3D0LB 1RZQA 4J2XA 4TVPD 5FUCC 4PLJC 4MTMA 1DVFD 1L9QA 1QSFB 1BZDA 4MXQC 4AGQA 2BWQA 4F2EA 3KJ6L 3FF8A 4P5RA 2BNQA 5C0BD 4EN3A 5D2NB 4AW7A 2L7EA 3MA9H 4X99A 2NYYD 2DM3A 5ENWB 1OWWA 4OD1H 1I1AB 1K4DB 4KO6A 1BW8A 3S35H 3U2JA 4CU7A 4ZPVA 3QR1A 2HLEB 4TVPE 2YKLH 1VPOL 2QSCH 1G9EA 2QQKL 4N0UA 2EH7L 5HDBE 4ZI8A 2DQHL 4OI8A 2VN4A 4J3TA 3A0OA 3WAJA 5K39A 1DCEA 5F9OH 2ESVD 3GSOA 1MH5B 1YEEH 4ALAH 2P7TA 4AQ1A 3O3DB 1QR1B 2XZAH 4DGIH 1L3WA 1Y6KR 3RPKA 2JKTM 5T5NF 4LMQI 4OBRA 3KYAA 2LLGA 4TPRL 5DUJA 4TTDC 5TDNB 5E8EB 4PJXE 4FLOA 4AGLA 5I66A 1JV2A 3HE6B 5CJ8A 3UAJA 2F1BA 4OFKA 5IG7B 1R5WB 2VN6A 1D5IH 5ISZB 4PJBB 4U3CA 4OJCA 2VUKA 5LGKA 1A6UL 1QP1A 2Y1VA 3X1FA 2YZ8A 4RQQB 3FU3A 3SJVD 1W0VB 2ESVE 4ATTA 5E8PA 1E5CA 4LLQB 4E36A 3MRDB 5JPMB 2X4NB 1I9EA 3A6BL 2VLJD 2AXFA 3EO0A 5J1AB 1CWVA 3QUXC 5DSCA 2NW3B 3KJ4C 4RAHA 4G7QB 3K81A 2VAJA 1M05A 4QAWA 4FNPA 5BXFB 3GSNL 4OV5B 5F9DC 1TEYA 3SJVE 3MJ9H 3HS0B 3T08A 1JZIA 4LSUH 3B2VL 3LYRA 4NT6B 4NQSB 3VSUA 1CC3A 2VLJE 4N1EA 3RILA 1V7ML 3CFJB 2DQIL 3KDMB 3V55A 5CLTA 3HR6A 4XCNA 1JPEA 4HHAB 2AJ3B 5CJOH 3FO1A 3TXAA 4LVOC 4PJ7F 5HHMB 5KVEE 2EDQA 2PCXA 4J6RH 3LMJL 3X1NA 1JYVA 3Q6GH 4Z7NE 4R7NB 3VTMA 1MXDA 3BKCH 1NPNA 5E7BA 3EJPA 5F9WC 3I3BA 4N2HA 4JY5H 2YD6A 1WFTA 3WO4B 5IROA 1HE7A 4FS0A 3LB6D 2OMUB 1TNNA 4OLYH 4OCRL 3NZHL 4UOZA 3GJEB 1JGEB 2VJ0A 3TASA 3H2QA 3GXFA 1FRGL 2XY2A 2FGWL 1OP3H 3L9YA 2EEDA 3SDAC 4KY1H 1AYOA 2YMXH 3GKWH 3WEBA 2YD2A 2ZZUT 4U6YB 3ZZLA 5IR1B 3V7AE 3ULSB 5DJ6A 1T04A 1P7QD 2LVCA 1G7IA 1S9WA 1U8MA 2X4PA 4QXVA 2R4RL 5A2KH 1E40A 2CRMA 4K55A 4QTIL 1GS7A 1PX4A 1WUNT 2H0JA 2HP4A 4A2HA 3CHSA 1CFTB 1EZVX 3HEIB 2GIMA 3K72A 5GSVB 1GTNA 5DI8B 2JF1A 4KKLC 3D3VD 3K2KA 4Y2NA 3OQRA 2GBAA 1G6VK 5GQBA 3ZE2F 4AL8H 4DKEH 2QEJA 1MFBH 1OAQL 3NA9L 4PJEA 1ZHBB 1NM9A 4NQDA 3SEPA 3TYGL 2WZ6A 5F7FA 4QHUB 1EFXA 3ZU8A 3KL0A 4AGNA 3NTCH 2ITDB 1CF8L 2WXHA 4K9EC 4L37A 3RWDB 2XTJB 2HFEB 1S3KH 4JFQB 3TBVA 2X1PA 5C2BL 4HWEH 2QVMA 4Z7OB 4LP8A 5FB8A 2AJSH 3D3VE 4DHLA 2DS4A 1JPST 2HFGL 4IJ3B 3FN9A 1AXSB 3MNZA 1T22B 2QTVA 1PU0A 3L13A 4B3VA 5E6RB 2CR0A 5D70L 1OE2A 2AABH 4JO3H 5MEOA 4C54A 2QPSA 3P0GB 3TBTA 5BW7A 3V9FA 5A7BA 2EC9U 3CZEA 1H3UA 2KI6A 3V5HA 4QY8A 2P28B 2CSPA 3GMOA 4U1LB 5BOJA 3BIBX 2MNUA 4WW1A 3FU8A 4HXBH 3T2NL 3G6AA 5JORB 1GZHA 5AOLA 3T8VA 4MBOA 5MEQB 1EAPB 1CICC 4YGVB 1T6VN 3FQYA 5CGTA 4CADA 1J8HD 5I26A 2XXFA 1AZZC 3PFQA 1GIGL 4K94L 1KBBA 2VSDA 2DDQL 1A0QL 1MIEL 4WWKD 4YFDB 1IGFH 1IGML 1PAMA 3WUWG 4TSCL 3V8CA 1AGFA 2GYSA 2VDLH 3LQAC 3M8OL 4MNQB 5AW0B 3WN5B 4ZNEE 4HW6A 3ALWA 5AB0A 2LLNA 4NZ8A 3UYPA 5D55A 3ZTNL 1R3LA 4C4BA 3T0EA 4LCYB 4UT6L 1H3TA 3SPCA 3S5ZA 3U30B 3O8XC 4Y4HD 4BFGA 5DHMC 3Q6FB 5A7EA 3D9AL 4D94A 1J8HE 1EIBA 1HL9A 3BFOA 2FYVA 4R26L 3NZUA 3T4AC 5A43C 2DQFA 2J6WA 1AHWB 3E3QE 2J88H 2BNRB 4N0YL 3IJ7A 1Q38A 5I18H 1JZ3A 4JLRB 4XP5L 3NCJL 1S9VA 2KLSA 3RQ3A 3CVDA 4NBZB 1XH2A 3AAZB 2B0SH 3EDKA 3PXHA 3DK2A 1P7KB 1S78C 3FCTA 3MR9B 4OM0H 1BYOA 1QFPA 1IC5H 2FGZA 1N19A 3ILPA 3QJRB 1T2XA 1IEBB 2LT9A 4R0LB 3OHXC 2ZOOA 2R2HB 4MYWB 1CTNA 5CJXA 2XQYA 1CD8A 3LEXA 4JGUA 1ROCA 3G5VA 5DJXA 4R3SB 2IGLA 3ZDWA 1OVZA 4LSSL 3I6LD 4FLSA 2ZCZA 4W9IC 2F8IA 2R1WA 1BVLB 4I18A 4DKFH 4XNXL 5K9KB 1CURA 1MQKL 1E6OL 4QJ3B 3OZ9L 1KF9B 1JZ5A 3BPOC 4GPVA 2MQGA 3T3PF 2W9LA 1SLXA 1CVSC 1QNZL 2A6DB 2YAEA 3B5GA 1F3JA 3GLZA 5E6YA 4ZTPL 2C9RA 2CO3A 1LO5B 1XTLA 3JWDL 4Z7UA 5BV7L 1QA9B 3TEXA 4R5XA 3SBRA 2N7AA 2OI9B 3MJ7A 5F71A 4YSPA 3QBTB 3MUGB 2G9HA 5D7JC 5TDOA 2FEDC 3TEZA 1N6QH 3I6LE 1BV8A 3QDMD 5DRZA 1PFCA 2ZX7A 1V7NL 2QPUA 2OR7A 1BGXH 4N2KA 2ZAIA 1UD2A 5MEPA 4ZSOA 3ZE0F 3U2SB 3EFFA 4WI2A 2WBJC 3QZWG 3FULA 4H0GA 5EEWA 1AE6L 4C83B 2COQA 4CUCA 3DIFA 4LCUA 2H3XC 4G70B 5E03A 5L8KB 4AK2A 5T1KB 4R96B 3RY6A 2Y23A 3OPZL 3QDME 5I1CL 2JCCB 2DWXA 2MPAH 5D7HA 5CHNB 3O6KH 2BZ7A 3E8UH 3FCSB 1SEBA 3O4LA 3HG2A 3QNXB 2Z9TA 3QIUB 4KHXL 3H3KA 3CSBA 5DGRA 5D7IB 4MAUL 1SF3A 1D7FA 4OFDA 1TJHH 4TYUA 2EEAA 2RH0A 3MX0A 4Y5YC 3WS3A 4M8RA 4XCCH 1Z32X 5D96C 1AZCA 1QWUA 5EUOB 3H6AA 3V6BR 3EDDA 2J57A 4LRIA 2XVBA 3T0WA 4X8JB 2WQ8A 3GI9L 2IV9A 4Y2DB 4ZQKA 3WNMA 4I1NB 2R8SL 2NUPB 2YXFA 1J05B 3EJZD 3KM2A 4I0PA 4ZMLA 5KYXB 2OPCA 1MSPA 5HJ3A 4QO1A 3C09C 1GC1C 4DN4H 4O02H 3HUJF 4QNPF 4ZX6A 5K9QI 1JUFA 4E2OA 3BSHA 2B4CL 5E6ZA 4RH4A 4GSUA 3ZZSA 2APBA 1JFHA 2IPKA 2AK4E 4Y4FA 2YK1H 4OU3A 2CPUA 3A6CL 3KCWA 4GMTL 2BVTA 4FZEL 1CD1A 1P9MA 1J5HA 1Z66A 4ADIA 1OY3B 1TVHB 4HKJA 4PLJD 5E23A 1DFXA 4UM8B 3QG6A 4P3DA 4CN4A 3MFFB 2ZSVB 3P73A 2P9RA 4A1RA 4O02A 2C7UB 2WVVB 1AQMA 1E7UA 4JRLA 4YVNA 5ACMA 3VFMA 5AUMB 1T5WA 3TT1H 5DC9B 3PAYA 2J8UE 5A2FA 4Y7MA 1U8CA 4HD5A 3RGHA 5FUCE 2W95A 2CA3A 2CIIB 1HCVA 2W80C 1ZKAA 2PYFA 2YPKB 1A3QA 2BNUA 2WPGA 4LCCB 1NOAA 3SO3C 1NCBH 3NT0A 3TBBA 5ANMA 4UNIA 2I26N 2FH6A 2O5XH 2IANA 3HN8A 3OKLA 2X9ZA 4DW2L 4JKPL 4KY2A 3OV6A 1I9IL 2Z7YA 4TTDD 1YNKL 1UZ6F 1I3UA 1IAIM 2QV4A 4OKVA 3UZQA 5JR1L 43CAB 3CDYA 5K59E 1IAKB 3IJ8A 3AADB 4DZ8B 4OLUH 2CK0L 3DV4B 4L3FA 3P4MA 2F61A 1UXMA 4RSVA 1PLAA 4JG0L 4FQHA 1IGTB 4GG6E 4LFHD 3Q13A 1SFDA 1ZV5A 4JS7A 4W9JC 1RL1A 4CA4A 1H8SA 4JHVA 1J1PL 2BS8A 4QKXB 1EANA 2GC7C 3EBIA 4NO0B 2NT1A 3ARGA 3SKNB 1TJGL 5LGJB 3D0VA 1LK3H 3QYCA 2B16A 3D85B 1Z9MA 3VCLA 2Q2EB 4LVEA 2J8OA 3H2WA 2G2RA 3L1EA 3UIYA 5C6PB 3KPSB 4DTGH 1K4CB 1WS8A 4FABH 4N2LA 3MV9A 3QO0A 1RERA 2AQ3A 1PZ5A 2LVEA 4Y8DC 3VWKC 1WFOA 4X6DF 4U6VH 2VLRA 1INDH 2WNXA 2EUXA 2ZWZA 3D06A 4EVNB 3GK8H 2FL5B 1S5HB 4EXPX 3C8KA 4LPCA 3DURB 3UYRL 3NN8B 3KCPA 3QDJB 4G8IB 4J3SA 4ZOBA 4L5FE 4JY6A 4M1DL 4KGLA 5DJAB 1WGOA 2PPEA 5GISL 1UYWH 1ZA6A 3L5XH 5I1LA 1W72B 4D9LL 2GUOA 2BJML 5I0ZA 3RA7L 1CBJA 3N44F 3V4UH 3KL3A 3RGBA 1DVZA 4M6NH 1Z7JA 5LDUA 3S3CB 1NFKA 4BFOA 3B5TA 1EO8L 3FTGB 3RUGB 2O61B 4I0CC 5CJBA 4APXA 1ZSHA 3HC3L 3HI5H 5IVXB 2MNWA 5C8JA 2ZYIA 2MCPL 3GSRB 4LHUG 2YA1A 3PL6D 3UFIA 1ILUA 3QB7C 4EE2A 4G82A 2C9QA 4L23A 1AO7B 4PJ8C 3A4EA 3BMWA 2O6EA 3PNWA 1U3HB 4WTXA 5L2JB 1F02I 2FNBA 3JYBA 4WUUA 3SE3A 1J88A 4LIQH 1U93B 4P5MA 1IFHH 1RU9L 4WWNA 3GMRA 4POUB 3D5OF 2AS5M 3V6FB 5DZPA 3UG4A 1XH1A 3L3OA 1YJDL 4PS3A 1P5VA 1OCZB 1NCJA 3RPIB 4S1QH 4WRLA 5C6TL 3KH4A 4I77H 4ONHB 1M7DB 2R83A 3QQ4B 2WZ5A 2ZKHL 4DQOL 4LQFL 4Z3EA 3E2HB 2D73A 2NCMA 3ARUA 2MMXA 4GAYA 4OFPA 4QGYA 1E9PA 4LRNH 5HYQA 3ARDA 4ZFGL 3OLGA 4FCHA 2VDKB 1T0PB 1AFVH 4R9HA 4I2XE 3MUJA 5DFVC 4PB0L 4A6YH 2NX5A 2VXVL 3GSWB 1EMTL 4JBSA 3F7YA 1UJ3C 3HAEH 1I82A 1FE8H 1OHQA 3EJYC 4FGMA 2GCYA 3FHAA 4BCXA 2IOOA 1SJMA 2CHNA 5C7XL 4GP8B 2XG5A 4EF3A 1JNHB 4WWOA 35C8L 4PJIF 4B5EA 1FVCA 4ZUSA 1OTUC 2R51A 3BPNB 1JCVA 4PJ9B 2D31B 1MFMA 3UBXI 5IB5A 4H0HB 4OVUA 2RCSL 1JIBA 1M57B 2FEJA 3L5WA 1CICD 1UM6H 4A6YA 5EZJA 2ZUSA 1HH6B 4LEXL 1T03L 2OSYA 1OGTB 4W6XB 5I6XB 3IT8D 2A5UA 4HJSA 5H35B 2DMHA 1SFHA 3BCDA 3HAEA 1F0LA 2B20A 3X2QB 3BZ4A 4AJWA 1HAUA 2R0WL 2XRAL 2A74A 2AQQA 4GW4B 2NY5C 5A16B 1FLRL 4WGKA 3O8XD 4JCLA 4KQ3H 2NSXA 5SWZD 4JHUA 1HQRB 4LBEB 5E00A 1MJUL 5F7EL 2FX9L 4L0YA 4D3CH 3VYPA 2ZP9A 5JQIB 2FWLB 1AHMA 3VXRA 4TV3A 4BDVA 3M17A 3PJNA 3CFKA 5H4YA 1MFVA 5GZND 3B6SA 5ADPL 4G6FD 4UAHA 4MWFA 1SN2A 4OLWL 3UMTA 5JPNC 2P49B 5SWZE 4Z3IA 1CLCA 1S78D 3CN3A 4BQ6A 5EN3A 3MA9L 3HB3B 2FJFB 4PJCA 2YQGA 4DFIA 4OD1L 3GTVA 3I75A 5C07D 1FVEA 1IBGH 2OJZL 2YJQA 4LEBA 3ATFA 3UBXA 1MCRA 4K3JH 4PTUB 1JYWA 2QSCL 5D5MF 2LFGA 4PD4K 3S7GA 1TJXA 2VTFA 1DBBH 2V2XA 4PRDA 5FOBB 2IFGA 4ZZFA 1INQB 1UQSA 4S10A 5F9OL 3QIWA 1BVKB 1YEGH 4AYID 3QZBA 5E5MB 4ALAL 4GNKB 2W07B 2XZAL 3KPLB 5C07E 3HHSB 4FXGB 4L8SC 1QHPA 4J2QA 1I9JL 3OKEA 3DVIA 2EVFA 1D5IL 5DMYA 3NP3A 1LO4H 4WHYG 3BC9A 4OR1A 5D7JD 5B7EA 4GSRA 4EIGB 2FEDD 4MVBC 1CIDA 3B3BA 4O51A 4WDIA 1LMIA 2IXQA 4G5AA 2HG5B 2YAHA 4UNTA 1MHHB 2DRUA 1UASA 1YUHA 2Z0BA 1R75A 4MD5B 4BZ1H 3QO1B 5I2IA 2WBJD 4G8FA 5D7LD 3BVUA 5DU7A 4MGXA 2OV0A 2QFPA 3QEQA 4GXUM 4V1DD 4HSCX 1HDMA 4PS7A 5DFAA 3JV5A 5L0QC 3QUMA 1A6AB 1G1YA 2GJ6D 1OP5H 3II3A 3EO1B 4MCMA 5I74C 4YBLB 4XN5A 3B2UC 1FO0H 5D7LE 2FHFA 4J3OF 4AGPA 3BSZH 2RA1A 4WAFA 2OR8A 3QQ9C 5F9JA 3FUHA 4V1DE 1NBYA 3FHEA 4BZ1A 1PEZA 4FNQA 3QRGH 2YMTA 4S0HA 1XGTB 5CJOL 2GJ6E 4XH2B 1CG9B 1Q9OB 3L9RA 3GUFA 3D4ZA 4ABUA 5AW6B 3CSYA 3ZR5A 1BVOA 3Q6GL 3QJQB 3BKCL 3GJFH 4XHJC 3ZKNC 4R97C 4YBQC 1E65A 1H6EA 2R2BA 2EUVA 3S98A 1BQKA 1FO0A 2JKWA 4X6FB 1SVZA 4JY5L 4JR9H 1ACXA 1G7PB 3BSZA 4XP9H 2A1WH 4GRLA 3APNA 4OLYL 3EDEA 4D7BA 4UV4H 4X2UA 4AYBA 5C6WH 2QQQA 3WNNA 3VXSD 4HWZB 4KY1L 3ZDYF 2DQ6A 2YMXL 3CGTA 3GKWL 3TV8A 1UCBH 4Y4KA 4U4BA 3FFOA 5KUMA 4I3SL 1ORQA 5HYFA 5IB4A 3GJFA 4ODTH 3R06A 4LOFA 4MMZA 2CLZA 4Z5RA 3HG1B 5CR1A 2C26A 3LKNB 4J3UA 1C5BH 1J0YA 3DMMD 3GZOA 1RP8A 4U1HB 3VXSE 5D1ZB 1E8YA 5GRJH 2VDRB 4KVCH 2BOCB 3BEWB 4OF6A 1LEIA 5EPMA 5K9OB 3F12B 5E6IC 8FABB 1P1ZA 1DSWA 3IEAA 4DKEL 2WXJA 4ELDA 2MCMA 4KK9D 1ZGLM 4OLXH 1HXYB 3P3UA 3MA7A 3VVVA 2C3VB 2EIZA 2Y7MA 3JWNH 3UGXA 4E9YA 2H0FA 3NTCL 1GHFH 1Y18A 4IIZA 3T6ZA 1FAIH 3A4AA 2B08A 2WXLA 2CAKA 4YSUA 2NXZC 1N2RB 2AJSL 2GTWB 1PSKH 2Q8BH 3UBFA 2X0UA 2EYSB 2PO6B 4I87A 3STZA 1QG3A 2AABL 2MHAA 3KPPA 4JO3L 2UY7A 1KCUH 4GT7A 4M4RA 4TUOB 1QLRA 5DO2C 3QUGA 5LLIC 5KSVA 2IG2H 3LRLA 1FZKA 2Z65C 1XGRB 1FCGA 5HHQA 1O7SA 3HI6H 1NGZA 4QYAA 1A3LL 1I8UA 1JPGB 3V8OA 2AEOA 3N50A 1UXSB 4HXBL 4X8GA 4DH2A 1Z9SB 4FEMA 4NKDB 1LYQA 1X5JA 1MCSA 2ZOKA 3LKSB 1SDDA 1JDAA 1G4RA 2O26U 1VA9A 5LAXB 1XIWB 4Q6IB 2HA1A 1SJVA 3QWQB 1HSAA 2NY0D 3CIAA 4W9EC 4ONGH 4YSQA 2IJ0C 4ODUA 3VWKD 1S7VB 1U42A 2A9DA 1IGFL 4U1JB 1CLVA 2F53D 1ZT7B 1F8TH 3S3PA 1KXTA 1SMOA 3TLRA 2OXGB 4NZTH 3ZO0A 4F7TB 1F42A 1T21B 2IWKA 3VQ2C 2IAMB 1ZMYA 2MNJB 3UTZA 3T8XA 4P0DA 5I19H 2HJKA 1YMHA 3DTUB 2J88L 4U0RB 3BZFA 2P3YA 3I2CH 2R2EB 5I18L 1YY8A 2F53E 4PRIB 1YMMA 1SOSA 4JDEA 5D2LF 4OQTH 1QLFB 4XBEH 3O11A 3AG4B 3BP5B 3O9WA 2XFXA 5DK2B 1HINH 1WP6A 3ILEA 3L95B 1JPFA 1A2YA 2YXWA 2K3TA 3GPEA 3ZKQD 4IU3B 1JP5A 4NRXA 3PGDA 2ZUQB 4YFLF 4U49A 4JKMA 3ZE0B 1RK1B 1OGAD 4J8RA 4F7CB 2NY6B 3Q3GB 4HQQH 5DZJA 4TRPH 3U9UB 4M5YL 4UMSA 2C4FT 3IRPX 1MVUB 3IPEA 4ENZA 3EGDA 1KPRA 3F7KA 2F15A 3AMLA 2DLGA 5E9AA 3W11C 3WE1A 5BRZD 1ZE3H 5L88H 1J86A 3C12A 4PTTB 5C0IA 1KIRB 4PV1C 3OL2A 1C8PA 4DKFL 2WVTA 1DDHA 3FQTB 1C5DB 3CHOA 4WV1B 4OQTA 3QG7H 3RY4A 3WTSA 1OGAE 4N8CH 1G7MB 1F1DA 2W88A 4FLQA 4M00A 4KTGA 1SNRA 1VADB 5F9AC 2DY2A 3HS0C 4NNYB 1D9KC 3BESR 2NSMA 2KL6A 1E27A 4I9WD 1SGKA 5KBKA 4JGNA 5BRZE 1KB3A 1CCZA 1LE5B 1ZVYA 2FWSA 1N6QL 2X2YA 3UPCA 1BGXL 2DQGL 4IHBA 5JDSA 2Q76B 3BUYB 4JFTA 1DSYA 2CO7B 4PLOB 4BKSC 5DFVD 3KS0J 1LP9E 4U6XA 1AH1A 1KCWA 4NZRH 5EN2B 5GXBB 2F54D 3WJMA 4P06A 4I9WE 2A6IB 1ORSA 2VXUH 3PDDA 1QFWM 4HIHA 3QI9A 3LPGA 4GO6B 3O6KL 3LPPA 3E8UL 4I0KA 1IKNC 1YVLA 1NCUA 2WN3A 4K5NA 4XZUA 3QISA 4FFYH 4PJGE 5AB1A 5EEXA 4BV1A 1JK9A 3HZYB 1L7TH 2R0ZL 2YLKA 4FYTA 4LKXB 1G5AA 1OTUD 1JRHI 2F54E 1JTOA 1Z3RA 3F01A 5L2KB 2QMKA 1PF3A 3KR3H 2IGFH 1MNNA 4HDIA 2OTUA 4XCCL 2BOBB 3LNHA 2DKMA 4I89A 2KQNA 4YOKA 4GKZA 3Q44A 4IKIA 1XXDC 3Q1EA 5E4AA 4L4VA 3VFVA 3NZ8A 1HH9B 4Y5VC 3CIQA 3QUKA 4NQVA 3L4UA 4QUOA 4CSSA 2WOBA 4FFYA 4N2AA 4O02L 4DN4L 5I0XA 4P46B 5L7XH 4MQXC 3RWCA 1XCQB 5EBGA 1KYFA 1N18A 3G6DH 4KKQA 1XH0A 4X9HA 1JRHH 5EU4A 3CJJA 2H3NB 2XWZA 2C1OB 1XMEB 2XETA 3N0PB 2YK1L 3MRLA 5D2LA 5I1HH 4XB3A 5C09D 1S9XA 3BMVA 5A6LA 2F0CA 3BH8A 4ETQA 1J5OH 4PRNB 3BISA 4K7FB 1UWXH 3MJ6A 3QUZD 2JSFA 4HV8A 4A2LA 3GZKA 5FYJU 3SKOA 3SDCC 1QTYT 4JANA 1LD9A 4HJTA 3C5ZB 3FRPA 3GPSA 1DN0B 4KV5F 1KB9J 1VGEL 5C09E 4PS4L 3WL9A 4FQJH 1YC8A 2BHZA 2ROYA 3UAAA 1EPFA 4KQ0A 1MCEA 2H6PA 4YK4B 4NUPA 2DTMH 3E6FB 3QORB 5BNXD 3S8GB 1KPUB 1FCCA 4NHUB 3T5WA 4ELMA 2H32B 3HZKA 2DJSA 3CDFA 4H44C 4DGWC 5BQDA 5KSBF 2WBWB 2ZG3A 4DK6A 3QDGD 2JELH 4OIIH 3DRQB 1LO2L 1HHKA 1A9EB 2YIHA 1NCBL 1NA8A 1X5LA 2XT1B 2O5XL 1CD9B 4NUQA 1OCWH 2X12A 4NB7A 3GSXB 1G6RL 1ZSDA 3U0PB 1OANA 1XL4A 2ZNXA 5HHOB 1PLCA 1XF2B 5FKAB 3BLPX 3RWEA 3B9DA 3SBWC 3QDGE 3FRUA 3WNJA 3F85A 3K6OA 4MVBD 2GIXA 3W9DB 1JZGA 1QBLH 1WCBA 3SPIA 5IMLA 4FZ8H 1LWRA 5F0JB 3WN5C 1BIIB 1MPAH 3DGGB 3PUCA 1XF3B 4Z76B 3H6JA 4C56A 2EO1A 2B4CC 2XQYK 5L9DH 3GMNB 4Q74A 4MDIB 2ZE0A 2D7PA 3FQUA 3RNKA 1TMQA 3KNBB 4F33B 1LK3L 4PGCA 1KBVA 1KJVB 1I7RA 1FJ1A 3D2UB 1H3WM 3N44B 3TWYA 3ZPDA 1VB9A 3VI3B 4TSBH 3KVDD 4EI5A 4DTGL 4EJ1C 5JYMA 4OCLC 3PV7A 4FABL 5MEND 4Z7WF 4P3WA 1MCHA 3LIZA 3TCTA 1YQVL 3B2UD 4Z0XB 3TCLA 3ECQA 1CDJA 1A7QH 2I9TB 9PCYA 5I75B 4XCYB 5LDSA 5C0GA 3QYNA 2MWCA 3N1FC 3QQ9D 4U6VL 1AXIB 4PG9A 1ZPUA 3BFQG 3D8MA 1A4JA 4UV7H 3NGBC 4EKXA 2XA8L 5DUBB 1VGKA 3SD2A 1P4LB 3LV3A 3QA3A 5IP4A 32C2B 5MI0B 5MENE 1MN4A 4QRTA 5LXVA 2QQNH 1E3ZA 3IS1X 4XHJD 2X88A 3ZKND 2XWDA 4LLDB 4YBQD 3ZLQC 2RIKA 1OEZW 1UYWL 3AQXA 3L5XL 3L5IA 4E42B 2BVEA 5LO7A 2O5YL 5E1AB 4LPYA 3V4UL 2Y0SA 4HPYH 2CJ3A 4IGBC 4Y19D 3S3SA 1MWAB 2WLNA 4BCZA 3QAQA 1RIHH 4X6CA 1GVIA 1M2VA 4BUHA 2CMRH 4QHNA 1DL7H 4W9FC 5IFAH 3TJHC 1O5DT 3HI5L 4B53A 2A83A 3QFGA 4XMUA 5EBMA 3S2CA 1IQDA 1CGSH 2W0FB 4MJJA 2AI0H 2H6OA 2VKWA 4LT7A 2W9DH 3B1TA 3SY0B 4LHUD 4TF4A 5IEKB 5F88B 1T20A 2WSPA 5HJBA 1IC4L 4N6RA 5BQ7B 3NSFA 3G6JA 3DRTB 1N9PA 2WWNA 4P23B 5TE7H 2CCLA 1JSYA 5FYKH 2GK2A 4PJIB 1J5DA 1SJHA 3Q2WA 4S1QL 5DK3A 5E6ID 4I77L 1EVUA 4M3HA 5SWQA 3BGFB 4PREB 5AOMA 4XODA 3WJLA 1BZ7A 1ZVHA 5CU5A 2WLLB 4BH7A 5EC1A 3NJLA 4B9KC 4Y5XC 4LRNL 5EU6D 1O6SA 4OF7A 4AY0A 3TX4A 4H13C 3WGVB 3ML9A 2DWEB 4E41D 1ZWIB 2NXZD 3LZNA 1O0VA 2K45A 3QIBC 2TRYA 4IRSD 4L8DB 2PYED 4MS8D 2ZICA 1NC2A 4A6YL 4Y2DC 1HWGB 1WZ1H 2GAZB 3ZT7A 2HVJB 5DHEA 4AEIL 2EXSA 5C9JA 5EU6E 5HVFB 1FE8L 4KDVA 3U4BH 5DO2D 3FFDB 3LKQA 4M43H 3FT4B 4YSAA 3ECUA 1A9VA 2GPZA 3CXDH 4R4NC 1GOFA 4U0QB 4P2QE 3VFGH 4AQ8C 4YHNB 1H3PH 2H1PL 3CK0H 2PYEE 4L29A 2FH8A 2EJ1A 2ALWA 5I1DB 5T5NG 4FQQA 4HIEB 1XR8A 1OM9A 1OSPH 4LCWD 1E5ZA 1KGWA 1HHIA 1NGQH 3PPSA 3NRQA 2ZPKH 4OZHF 5F96L 2I24N 1EDYA 1R5VB 3A4DA 2C5DC 1WBZA 4UTBH 1HOCA 1XQ4A 2O1AA 2OSLB 5J1TC 3SGKC 2JV6A 3GT6A 2H9GB 5IOPA 5FWRA 2PPFA 1H0DB 3VTAA 5D5MB 1G9HA 1E9QA 4LCWE 1YJDC 2X6CA 4JY4B 4BFRA 1FC2D 4YHYC 3QC5X 2RFXA 4HSQA 4HKZB 2PCYA 1N8ZA 1F97A 4G1MB 5JO5A 5DJCB 4GBXB 3RVWC 3ELQA 2CRYA 3BRFA 4WTZG 2VQUA 3RHWK 4KRMB 4IK6A 4LCIH 4LCCC 4D3CL 3ARTA 3WS6C 3AT0A 4WO4C 3ARSA 1B0GA 1FN4A 3M45A 5C0AB 1JHTB 1G1OA 5T3XL 4UTBA 2D3VA 4JW3A 4O2FB 2JTDA 4G7SB 3PQYD 5T1JA 3E6HA 2AKRA 4Z7VE 5GSRB 1PYWB 1BFOA 1CFMA 2G3MA 3QEUA 3QFJD 4X5LA 3TGXA 4BCYA 4RBPH 4G42B 1EEYA 2ARJA 3B9KC 2JNZA 1IBGL 4BK5A 2VWEC 1DQJA 2BSRA 2VIRA 2IIJA 3LQZB 2EIMB 3X11A 2DI9A 2BP5M 5ECGA 3W11D 2HN7B 5I71C 3PQYE 3CDZB 2WKGA 3GLEA 3NQIA 4N0CC 4FFVC 3QFJE 4QRSA 1KIQB 3NFNB 3MRNA 1YEGL 1N3NB 1BLIA 2D7QA 2OMTB 3TFKC 2H26B 1CQYA 4JREB 4LGPB 2H41A 4AYFB 5DURB 1HYSC 2FJSA 3T6WA 3QUML 1U2HA 3AQZA 5DZ9A 4W1TA 3WLWC 1D9KD 1YNTA 1C9SA 4LASL 4OCNC 1YAZA 1QLEL 4BSJA 1LO4L 3UEZA 5MHSD 4RA3A 2WZPD 4YLBA 1U8OB 1UH2A 2VXTH 2C4XA 1BQLH 1ZPLA 3FOMB 1R3KB 4KKAD 2ZKWA 4BZ1L 1E4JA 3SOBL 2XQYG 2F68X 4KKBC 1YPZB 2GC4C 3PG2A 1KEMH 4GW5A 4LEOB 3ARFD 4YPGA 4YFEA 5IHHA 1C08A 5MHSE 2YHGA 5E5UB 3OB0H 3ULVC 3RTQA 4NKOA 3H9SB 1MJ7H 5IHZA 1FO0L 4LXFA 4WNQB 4PGBB 4IKJA 4NI6A 4AQ1C 1M1XA 1P2CA 5IMKB 3FTZA 3ZDYB 3BSZL 4MSWA 4P4RB 3IJSA 5KS9E 4K07A 3LRSB 1KTJA 2DYPA 3UX9B 4E41B 5JIDA 2ADIB 3W0WD 4ANWA 1NUDA 5ICZB 1NM4A 2A99A 4GT0A 1NCDL 2Z31C 1KWKA 3N41F 1IGYB 4N2NA 4BELD 4RNRB 5B3JE 4TNWF 5KWYC 1HK6A 3ARBA 3GGWA 1IM3B 4X0NA 1RZFL 2B5IB 4MQXD 4BQ9A 4JR9L 3ZHFA 3PDOB 2HX9A 1V3KA 3VFSA 3W0WE 2A1WL 3FONB 5ACLA 5BZDA 3OJDA 1KPVA 3EJUA 4UV4L 3ABLB 4JCMA 2QPDB 1EBPA 1BBDH 1E28B 3MLYL 4A7VA 3U4EA 4B9JA 2WGNB 4RSYA 4DQAA 1NMBL 1R3HA 3SYCA 1BAFH 4B7IA 1UCBL 4K7PH 4HXAH 1MCFA 3PJSA 3L48A 3TP4A 4YDLC 5AB2A 5DJYB 5PCYA 3SDCD 3K6SA 1DZ0A 2ZXDA 2OSXA 3B8SA 4HS3B 4UQ2A 4F3FB 1C5BL 1S7RA 4UMGA 1NMCC 4XBPA 1A4BA 3CLWA 5GRJL 2WGXA 1NCOA 4KVCL 3MLUH 5FFLA 4CVZB 3LNIA 4ONOA 3S96B 3O3EA 4L05A 1CLZH 5MERA 2QSQA 3GDBA 4OLXL 3F5WA 4I3GA 2D0HA 3WIFA 3WTXA 3WLBB 5IROC 1E9OA 1EAQA 3N85H 3ES6A 3PABB 4YDKL 1GHFL 3BPNC 4FXLA 1ASQA 4KAQL 4OZGF 5CF3A 4OGAD 1FAIL 1KTBA 2GUYA 2Y5TA 4L0ZA 1H5BC 2RR3A 2UZYA 1OLLA 2B1HH 3BGMB 2JB6B 4WFGD 5JA8B 3MV7D 3V0JA 1QVOA 3P77B 2WQAA 4L1HA 2EDYA 5HYJA 2AC0A 2VRAA 1OAKH 4OJAA 4N9GB 3P2BA 4ENEC 3VD4A 1KCUL 5EBWB 4YHIA 1LEKA 5BV7B 1MI5A 2XWBB 1R47A 2R7EB 4KVNH 1WTGT 3HI6L 1EGJA 5I8EA 4WFGE 3VH8B 3MV8A 2O6DA 3BYYA 3ZX1A 3MV7E 1JHKH 3H4FA 3D50A 4XMZA 3KYNA 5FKPA 1QI3A 4JDZA 1TU2A 4DEWA 4BZ2H 2WK2A 4WFFD 3EYFA 3PHOB 1ZVNA 5KOVC 1IM9A 1PGRB 4R6UA 3DHMA 2Y1AA 3VXQB 4ONGL 3S88L 1MFEH 2FJHA 3HC0A 3TV3H 1S7XB 4XBMA 3CBKB 3RWJB 1AKPA 2EVGA 2BDNH 3GMQB 4K0OA 3D4CA 5IVZB 5EIQA 5EORL 3K8KA 5CSZB 4G6KH 1F8TL 3CFEB 2N0KA 2YRLA 3RWIB 4WFFE 3P9MA 3S2AA 4YEFA 3BAKA 3GSVA 3ALXA 5BW7C 3OKNA 2EYTB 2R56H 2OJEA 4KTEH 2OP4H 1ZY9A 3MJ8B 4YO0A 5JOPD 2EDMA 4BZ2A 2AJZA 5I19L 1TQSA 1YNLH 4WK4B 3HE7B 4HX1B 4GMSL 4Y16B 3QVAA 1BIHA 1KUMA 3TN0C 5J6GA 1XB8A 3TZVA 3I2CL 4HLZH 2XLLA 1R5IA 4K4KA 1IL1B 4UT9H 2Y72A 1Q8MA 3F7VB 3JTBA 4OQTL 5EU5B 4XBEL 3VQMA 3U82B 8CGTA 4IGBD 1NFDA 1HINL 2J2ZA 3GMMA 4M56A 3SZ6A 5JOPE 1VZGA 2I32A 4FNTA 3TJHD 4DVBA 2PKDA 4JMNA 2QR0B 1SUHA 4MJID 4TRPL 4RFOH 4W6WB 2PPDA 3GMPB 5ILTH 5DJZB 4UQAA 2XBTA 43C9B 2FRGP 3GXTA 2XWJB 3TH3T 5CN2A 4KRLB 2HJFA 5ABDE 4M8VA 4DOHB 5L88L 1DBMH 5B1JA 3BIAX 2YRZA 4NKIL 3MCKB 4N8CL 2KLTA 3LS5L 1U8LB 1VEMA 5GGSA 3GM0A 4MJIE 1BQSA 1F6AB 2Z0UA 3BN3B 3ISRA 3UZVA 4Z78A 4KMTH 4X6EB 1X7QA 4QF1B 4YC2B 2ZSWA 4JFXB 3KPMB 4NJ9H 3ASNB 3F04A 5AW1B 2LU4A 5IHLB 3BH9A 3TT3H 1A7RL 5F3BB 2AW2A 3IJEB 1JJUA 1KT2B 5BS0A 5JHDA 2E75C 4TVPH 5BRPA 1A02N 5E2WH 2DD8H 3QIBD 4UB0H 3IJYA 1T1XB 4GRMB 3TFBA 4EIBA 4IBSA 3B9VA 4NZRL 4PGJA 1OXYA 1UKTA 4ZAKB 3MRJA 1NEZB 3LY6A 1BF8A 2H0EA 2VXUL 4DT2A 3BAEH 2WXFA 5EZLB 4MAYA 5FPIA 4FTVD 4AEHH 5DRNB 4R4ND 2VMJA 4FFYL 4EUPB 1RJZB 1L7TL 4L3EB 2W0LA 4G6JH 3TIEA 3FQ1A 1N64L 2LGNA 3EH2A 4JHAH 3T71A 3QQXA 4U1MA 1OAXH 3KPQB 1CXLA 2A6JB 3KLAB 4WENB 3KR3L 4JJOA 2PP8A 2IGFL 1DVFA 3CBRA 4PJAB 2AXWA 4QRAA 3ZDZE 4DO4A 4JHZA 4Z1PA 1KSRA 3J7HA 1JHLH 4FULA 4ZFFB 2FYYB 3MREB 4FTVE 2XX0A 3FQWA 4EN2A 5ABAA 3F05A 3RYMA 4HH9A 5F7YC 4JRYD 1FNGB 3NJKA 2FX7L 5TK2A 3CPLA 4PJXA 1DUYB 1T1ZA 4WIQA 4W4OC 3GSUA 1VENA 4NQED 2YGOA 3LEYH 4CSPA 1F11A 1WBYA 1JRHL 1P7BA 2NQDA 2P24A 2B39A 1U91B 2YLHA 4KO9A 3RVWD 5I1HL 3UPRB 3GXNA 1G4MA 3V5DA 3VRLF 3BPCB 1TETH 4J4PC 3AREB 4JRYE 4MB3A 4AE0A 2O93L 1J5OL 1CDHA 4WO4D 3MRBB 3ROLB 5F1SA 3PS6A 4NQEE 5JXAL 2MJWA 5KVEH 4HZLB 3HNTL 5KANI 3GSQB 1BEXA 3VO0A 5F21B 1WTLA 2X09A 4JFOB 4F9PC 5E1GA 4U2ZA 1PD6A 2YPVH 3HAEG 3MFGB 2DQCH 3OD3A 4G1EB 4MD4A 5TFSH 3TEWA 1AOHA 4WQOA 2Z34A 1OGPA 4MJHA 3QHZH 1IKFL 3B9KD 1OSZA 2BSED 5EF2A 4AC4A 1HEJC 3IFPB 4ACPA 4YL9A 2DWSA 4YPJA 4ZTOL 2CXGA 3V10A 1J87A 5CAYB 1PG7W 2JIXD 4U4IA 4DK3A 3BWAA 2I7OA 3VSQA 4ELKA 2JELL 3IGAA 4OIIL 1E4XI 3C6LB 5SWSD 4N0CD 4FFVD 3FFCB 2OTWB 3SYOA 3IMTA 1MF2H 4E68A 2D7TH 2C7FA 3T3ME 3D85D 3TYFB 4F15C 4Z7WB 5KVDH 3TFKD 3BO8A 4Q2ZB 4V2BA 4GG8A 3CDCA 5HHPB 1HYSD 2VWEE 3RZWA 3WLWD 1FNHA 4C47A 2P8MA 5AZEH 4N2BA 4RIRB 4B0MB 4UQIM 1S7UB 4DAGH 3NDZE 3LIZL 3F8UB 5ICXA 5SWSE 3L1GA 2WLHA 4F8NA 2WBKA 1QBLL 4OCSL 4YXHH 1HN1A 1RJCA 4HJEA 1MPAL 2VR6A 4HP5A 5IF0A 2CDEA 3SDYH 1E4XH 4KKBD 1IEAA 3CSFA 1BP3B 5L9DL 2X38A 4BKLA 5AL8A 1FI8C 2VITB 1YN6A 5LUMA 2XSKA 1JNJA 1Q9WA 1TZIB 2HJLA 2XWRA 4PAZA 4WI4A 1W0WB 3HG3A 3CVHB 3OAUH 2J6EH 2E7MA 1CE6A 3H0TA 4NQCB 4TSBL 4WJ5B 4P5KB 3TVMB 2G3NA 2UYLB 4AENA 2A4CA 5KSAA 5DUPH 3AS3A 3MROB 1AGDA 1BM3H 3MTRA 2B8OT 4P59L 3EADA 4YUEL 1DANT 1KEGH 5HDRA 4UBDC 2ZUQC 3D69A 2VR3A 3WTTA 2EDHA 2Q7YA 2YEQA 2BVQA 4N0UE 2X4SB 1PMYA 4UV7L 3DROB 4YZFF 2NY6C 3UO1L 4JJHA 3QYMA 2Z31D 5C0CA 1SVCP 1FFOA 4L9LB 5DQJA 3IJHA 3L7EA 5DA0B 5HVHC 1QQDB 4TMPA 5DC2A 2J6EA 1Y7VA 2VDNH 2WD0A 5DHYB 1XSKA 3UTOA 2DH2A 1L9NA 2H8PA 2VT0A 4J1UA 2VE6B 2W60B 1S5IH 5E8OB 2UUDH 4JQIA 4WCYH 5FCUL 4PRPB 4HPYL 4PR5A 3ML8A 5BRQA 4ZOAA 4DZBB 2DEYX 2NTFB 4XB7A 4GI6A 1RIHL 2CMRL 2DM7A 4EN3B 1JZ2A 4APQB 1DL7L 3EH5B 2QELA 4X99B 4LSDA 4R4BA 4PI0A 3MRMA 1RIUH 3DJTA 3T65A 1QTPA 1ZGLP 3NPZB 3HTLX 1I8MB 2AI0L 3K80A 4Z18A 2W9DL 2X4UA 1HJBC 2QPEB 3H8NA 4NKMA 3THMH 4X9GA 5K39B 4UNVA 3X17A 4QXTB 1CGYA 3IMUA 5TE7L 1OP4A 1FNFA 5FYKL 1CDYA 2F8XC 3QQ3A 3HZMB 3C6SA 5DC4B 3PAVA 1DVQA 4BK4A 2HKAA 4N24A 4ZNEA 2PWFA 5IROD 2R1YA 4OLEA 1YA5A 5HBBA 2OA9A 4L3CB 1I3GL 1J8HA 3ESNA 4OZHB 4H8PA 3H3PH 4FYSA 3TTYA 3B2XA 4HBCH 1S4IA 4WWKA 1NKGA 1ONQA 1U8KB 2D03H 4NWTH 5LBGA 4LVHC 4NFDA 1T7WA 2AXFB 3UGUA 5BZWB 5K33A 4GSQA 4F7MB 2GY7B 1XD0A 4LEEA 5D6CB 5HGAB 4ENED 1I7UA 4GAJH 4JFEB 1UXLA 2V7NA 3AXLA 4PIRF 4Y4HA 1E5UI 3U4BL 3ZE1E 2HUEA 2QLVB 4OZ4B 4PYGA 3OKMA 5EZIH 1R3JA 2VDOL 3SE3C 5IFHH 3FO2A 5E6SB 3VFGL 1H3PL 3CK0L 2FX8H 3TU6A 3G7TA 2DWDA 3I02A 4N3TA 2KQMA 3FTYA 1CL7I 4W6YB 4AV0A 2A2QT 2WXKA 3DI2B 4HUVA 1LDPL 3L6FA 3HI1B 3IVKB 4JJ5A 3ATAA 5GZOC 3U1SH 1YSOA 1OSPL 5T33H 4P4KA 2QDWA 4MZRA 1A9BB 3KL5A 2ZPKL 3RX8A 1RIVH 1VLXA 3SO5A 3KGRA 2N4IA 4UTBL 2CM6A 3DHUA 4DSYA 5I1KH 4YSCA 3HHMA 2YPLD 4H8WC 5E08H 1ECYA 1KTLA 2FVNA 5EFIA 2ROXA 5I9QC 4C57C 5I0VA 5B8CA 4N2OA 1J5CA 2YARA 4W9DC 3W57A 3GDCA 3AITA 5M7QA 3QORC 5I73C 1CL7H 5DD3H 4HOZA 1QPXA 2FT6A 3F84A 2P45B 4ISVB 1V3JA 5CCGE 4U1NB 4LCIL 3ECVA 5ITFB 1G7QA 4J3OG 2WC7A 4GIAA 5FO7B 1RSYA 3TN0D 2YPLE 1GKOA 4GUQA 3PF2A 3WDIA 4IRJA 3CFBA 1JL8A 4PJ5A 3QDMA 1I31A 1GW0A 1UWGH 4ODXA 1T80A 5E9DD 1U8MB 2LE9A 2X4PB 5GGQH 1PX3A 4IS6A 1OAJA 3DO3A 3WFEH 5CGMA 1ICTA 1JVKA 1FVDB 2IOMA 3VG0H 3K72B 1HTYA 3NJGA 4F1ZA 1T6WA 2W94A 3G08A 3D18B 3NABL 2HT3C 4PJEB 1HZLA 4NQDB 2NSQA 2A74C 5IW1A 3T0ED 1EFXB 5E9DE 1AC0A 1IX2A 3GI8H 2EDKA 2HFFA 1NAMH 3UPAA 3TBVB 3DBXA 4P5TB 2EEBA 5EULV 4PJ7E 4ZOEA 4H88H 3ZHLA 5FB8B 1ZK5A 1UFGA 3FTUA 1UA7A 1GR7A 1K5NB 3QWOA 5K9JH 2JFCA 3ULUL 1MHCB 3UADA 5KVGE 3RWHA 1B0IA 2VXTL 3TBTB 4Z77B 3P02A 2AK4A 4J3VA 1BQLL 3HCVB 3S5LB 3RIAF 3T0AA 3LZOA 4AVIA 2Z7UA 4HETA 2UXGA 3CVCA 2E86A 2AEIT 4PWEA 4WW1B 5HDWA 5HI4C 5DMKB 1OW0A 1FH5H 3GS0A 3Q5OA 4N28A 2BWDA 2YD1A 3SHSA 1TPXC 3L3KA 1EA9C 2PCFA 3L3IB 1OB1A 4PWKA 4JO1H 4AQOA 1FNSH 4HJ0C 4G9DA 3FJTA 2DMCA 4DUWA 2C4FU 2CG9X 3UABA 4CADB 3FUJA 1DEDA 3TESA 2J8UA 1BJ8A 1T7YA 2OXHA 4AIXA 5FAAA 4LPUA 4S0SD 1OTTC 4WUKH 1DQML 1PY0A 3HPLA 2CBQA 3P54A 4ZX3A 1AP2A 1SMDA 3ZE2E 1A4CA 3HLKA 1W15A 1XVSA 2WIIB 2JKLA 4ZUUA 4HD9A 4BXVA 4RMSA 3OF6A 1NBQA 2OS7A 2YOCA 3QH3B 3ELAT 3HLAB 4QIRA 3IAQA 4CC0A 3GB7A 4AT6A 2WMPB 1EZSA 3MMEA 1ZCRA 1TENA 2E27L 3B8YA 4MHHG 5GHWL 2WV3A 3CVIL 6CGTA 1HEZB 4M6MH 2LLLA 3N55A 5ESVA 3I6GB 2YAQA 5E2UH 2Q6WA 1MG2C 2HT2C 5DS8B 4OZGB 4RRPA 3O4LD 3L4ZA 2VDLB 4ZSOE 4J4PD 1AHKA 3IXTA 5GGVH 1AOZA 2P26A 3NG5A 3MRKA 1BAFL 1M56B 4HUWA 3SQOH 4OGYL 4HXAL 4XC3L 3FO0H