3NSDA

Silver bound to the multicopper oxidase cueo (untagged)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
487
structure length
462
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 129
structure length 462
sequence length 487
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA03
3NYKA 5B7FA 1JZHA 4BWUA 2DWTA 4M4RB 3PAZA 2XVBA 1ET5A 3TASA 1TKWA 3S8GB 4FA7B 1N68A 3N55A 4E9RA 4KOCA 3PLYA 5AFAA 2Y1AA 2AANA 1TEGA 1L9OA 2QDWA 3SQRA 2AZAA 3UADA 4W1TA 2NRDA 1KDJA 1J9TA 2OJ1A 1SNRA 2TSBA 3CDZB 1AOZA 4DP7X 2GBAA 2IWFA 3ASNB 1KBWA 1L9SA 2IWEA 3WNJA 1NIAA 1KYAA 4BXVA 1PF3A 3H4HA 2FTAA 4DP5X 2FQFA 1WS8A 3CDZA 3NJLA 5B1JA 6PAZA 1OV8A 4YL4A 3DKHA 3JT2A 2BHFA 1JVOA 3IBOA 2BWDA 2HX8A 4FAAB 1IUZA 2CAKA 1NIBA 2J57A 2P80A 3UACA 4YSQA 2BP8A 4YSTA 2AZUA 2GC7C 8PAZA 4YSDA 3QJVB 4HHWA 4MFHA 4YSPA 3V9EA 2J55A 4DPCX 4YSAA 2BZ7A 2H3XC 4QKTA 3FQ1A 2YAHA 4HHGA 5AKRA 1N70A 1CC3A 2PP7A 5B1AB 5TK4A 3DTUB 5B7EA 4E9YA 3SBRA 1J9SA 3EHBB 1AZRA 5I6NA 2CCWA 1IKOP 4KOBA 2YAFA 4A2EA 2HX9A 1OE1A 1XMEB 1HAUA 2ZONA 4KO5A 1SJMA 3FSWA 2DYSB 2BWIA 1KGYE 5FC9A 1URIA 2FQDA 2E86A 1BEXA 4A66A 2HXAA 2YAOA 3AG4B 1BQ5A 3AG3B 2FWLB 4KO6A 7PAZA 4N8UA 1KV7A 1X9UA 1BQKA 5AZUA 5I6OA 1CYWA 1AQ8A 1L9TA 1T5KA 2GHZA 2OCCB 2FT8A 4YSCA 1FA4A 1WAEA 4GXFA 2VMJA 3MX0B 1SF5A 1I53A 2ZOOA 4N4YB 3NSYA 1AS6A 3UAEA 2XV2A 4BXSV 1HFUA 3NJKA 4TXVB 1BQRA 4G7QB 3WI9A 3AG1B 5B7MA 1E5YA 2PPAA 4BWWA 1AS8A 4ENZA 2CALA 3KW8A 4GYBA 1ET8A 1PZBA 1XB3A 2GIMA 1QLEB 2HRHA 2W88A 4YSSA 3CZUB 2YXVA 2VM4A 4A2HA 4BWTA 1R1CA 3FPXA 3PAVA 2IDUA 3WKQA 4E9QA 2RACA 4GP5B 3WIAA 6PCYA 2J5WA 3EH5B 2H47C 1CURA 1CYXA 3WG7B 4AKQA 1GY1A 2I7SA 2R7EA 2EIKB 4NERA 5I6MA 3FSAA 1W8EA 2LLNA 2GI0A 3FS9A 3FQ2A 3WNIA 1JXDA 2VM3A 2UX7A 1TU2A 3FU7A 3FSVA 2WO3B 1V55B 1RZPA 3CVBA 4F2FA 1OCZB 2I85A 3C75A 1GW0A 2IDFA 1NIFA 1BAWA 2R7EB 2JXMA 3MBWB 3SBQA 2PLTA 2QT6A 3ERXA 1OCOB 3NJIA 3FT0A 1PCSA 3FU9A 2YXWA 1AZNA 2XXFA 3GYRA 1AR1B 2DYRB 1YLBB 4G72B 3FYEB 1AZUA 1SFDA 4YSOA 3OMNB 3OD3A 1RCYA 2FNWA 1JZIA 1NZRA 4KO7A 2DV6A 5F7AA 4A67A 3NP4A 4YSUA 4F7KA 1E65A 2XLLA 1A65A 1GS6X 2BO0A 4BK5C 1JOIA 2XV3A 1A8ZA 1E30A 3IE9A 1MG3C 3X1FA 4JHUA 3AZUA 4X4KA 1IBYA 4HCIA 3UAAA 2GB2A 3FU7B 1FFTB 4G70B 1RKRA 1ID2A 1JVLA 4GP8B 2JKWA 4Q89A 3N2JA 1NPNA 3S8FB 4DP4X 7PCYA 1VLXA 1DZ0A 1PY0A 2DWSA 1SHWA 2GC4C 4KNSA 1SF3A 3NSFA 3ABMB 2B3IA 4A2FA 3S3CB 4AZUA 1OOWA 2IDTA 3HB3B 4ZK8A 2IDSA 4E9TA 3FYIB 4RH4A 1GSKA 4AKOA 2EIMB 4CSZA 3X1BA 2YARA 2WO2B 2WSDA 3FU8A 3NJJA 3HEIB 1TEFA 1PZCA 4P5RA 2MTAA 3X1NA 1XB8A 1ILSA 2XU9A 1AS7A 5I5IA 2HZHA 1ASPA 2BP0B 1EHKB 3X1GA 3TU6A 1E5ZA 2XXGA 3CVDA 1M56B 1AACA 3X1EA 1WA2X 2OV0A 1L9RA 5TK2A 4E9WA 3QJSB 1BXVA 4BDVB 3FPYA 4A2GA 5D4HA 5I6KA 3EF4A 4DPBX 5I6PA 2FT7A 1KCBA 4M3HA 4A68A 5I6LA 4AI7A 1SDDA 2DY2A 4L0PB 2PP9A 2TSAA 2FQEA 1ETJA 1KDIA 4DP8X 1V10A 3NP3A 4K9JA 1A4AA 3NSCA 1ET7A 3QQXA 1J9RA 1AG6A 2BP8B 1AZCA 1SDDB 2IWKA 3RYMA 3G5WA 1JZGA 1NIEA 3JTBA 3PPSA 4JHVA 1PLCA 1L9QA 2FT6A 4HCFA 2YAPA 2PCYA 3T6WA 4DP1X 1JZEA 2HLEB 5B1BB 3DIVA 4NB7A 2PPFA 3UABA 2UX6A 3D12B 4BDVA 2XUWA 4G7SB 1MDAA 3ASOB 3TA4D 1OCCB 5PCYA 2A3TA 2BW5A 3NJHA 3ZX1A 1BYOA 1GS8A 3NJNA 2BP0A 1A4BA 2EINB 3QJQB 2H5UA 1ZDSA 2PPCA 4GP4B 4P5SA 2FJSA 1ILUA 4KNTA 2PPDA 5I5JA 4DPAX 3PCYA 4G71B 1X9RA 2W8CA 2XX1A 3PXLA 1BXUA 1GYCA 4YSRA 1JZJA 3OMIB 4UANA 1ASOA 4YVNA 3ABLB 3T6ZA 2QPDB 1IBZA 3OM3B 5I5MA 2YAMA 1ZV2A 2HRGA 5ANHA 3NSDA 3IN2A 3PAUA 4HCGA 1OCRB 1WA1X 1OE3A 4E9VA 1SFHA 1AANA 1MZYA 1BYPA 1FWXA 3SBPA 4QLWA 1PMYA 4KO9A 3BVDB 5PAZA 3ZIYA 1ZPUA 2N0MA 4YSEA 1JXGA 1JZFA 2EIJB 2VN3A 3AG2B 4AKPA 1M9WA 2VW4A 1F56A 1GS7A 4DP6X 2UXTA 2GSMB 3WKPA 1OE2A 1ZDQA 1ZIAA 3H4FA 3T9WA 4DP9X 4EF3A 2BZCA 2ZXWB 1AAJA 2EILB 4WKXA 2VSKB 3U25A 3QJUB 4G7RB 2IAAC 4KNUA 1BXAA 1GR7A 2I7OA 1KBVA 3AY2A 1ASQA 4UAHA 2XYBA 4YVUA 3UGEA 1NICA 3NJGA 1HAWA 2YQBA 3FQYA 1PAZA 2VW6A 3KW7A 2AFNA 5IY5B 2YAEA 1ADWA 1WA0X 5A7EA 1J5CA 2BW4A 3IEAA 4DP0X 1PLBA 2PCFA 3FSZA 2UXFA 2XX0A 1MG2C 1EZLA 1KCWA 3CVCA 2UXGA 1JERA 1PNCA 1PLAA 1SHXA 1NTDA 1A3ZA 2JFCA 1WS7A 3V9CA 2QDVA 5B1JC 5B3SB 5I28A 3CG8A 2B08A 4HALA 3NT0A 1V54B 1W6LA 1AZBA 1W6WA 3QJTB 5EHFA 2P80D 4PCYA 3QPKA 3GDCA 2AVFA 1IC0A 2CUAA 5I26A 2FQGA 3S3BB 1JXFA 2X88A 4HZ1A 1DYZA 1QHQA 4WTQA 4CSPA 1NWPA 1MZZA 4GY4A 2IH9A 1NPJA 3TBBA 2MRYA 3ZDWA 3T6VA 3NJFA 4HAKA 1NDTA 3NJMA 2HX7A 3ZBMA 4NAJA 1CUOA 2QPEB 4AX3A 1E67A 1QNIA 4HIPA 4UF7C 3OMAB 2CJ3A 5D4IA 3QJRB 1M57B 2PP8A 4PAZA 5B1KA 4E9XA 9PCYA 1PNDA 4F2EA 3GXUB 2ZWNA 1RZQA 4Q8BA 3IN0A 3T6XA 1ZIBA 1AIZA 1L9PA 3X2QB 1NIDA 3BQVA 3OQRA 4W9ZA 3ABKB 1A4CA 5D4JA 2IH8A 5F7BA 5LDUA 2Q9OA 4JKNA 3AW5A 2X87A 3H56A 1GY2A 3ABGA 4DP2X 3EH3B 1J5DA 2PPEA 1B3IA 3L45A 1PZAA 2VSMB 4E9SA 2XWZA 1NINA 3TBCA 1NWOA 4A2DA 2VW7A 2J56A 2UXVA 2XV0A 3EH4B 3T71A 2CBPA 1AG0A 1J9QA 1UATA 2Q5BA 2Y69B 2YAQA 3S3DB 2IDQA 5E9NA 1XB6A 1OF0A
chains in the Genus database with same CATH superfamily
5F0JB 1FGNL 1F90H 4CAGA 5C2BH 1Q72H 1M05A 3BH4A 1T2JA 4NYLA 1RZJH 3FZUD 4Y16B 1MQKH 5CBAA 2OKMA 4HOWA 1QLFA 4OFPA 1TG8A 3GTVA 4L3ED 1X5AA 3QG7H 4XN9A 4ECNA 4ZSOB 4P9ML 1ED3B 1IILE 3VXRA 4WJ5A 4BSVA 4IMKA 5D7LB 1TEGA 5KYUA 3FMGH 1J0YA 1J5HA 3C6SA 3UADA 2EDLA 1F90L 25C8L 3IE4A 4NKDA 4ZUTB 3T0VA 4ORGA 2FYVA 4NI3A 5JYLA 2K6YA 3HC4L 1MCSA 3LPOA 4AUUA 3IDYC 1IVTA 3GS4A 1KYAA 3C08L 4WCYH 3QYCA 5IMKA 3RZCB 4RMWA 4Q9BA 2H8PB 4P57B 3CCHB 4W6YB 4KX7A 4NNPH 4B9PA 3U7AA 3LQMA 2HX8A 2DWXA 1GRWA 3IDXL 5EZJA 3EDDA 3EJYC 2J57A 4P5TA 5F0LB 1JZ3A 5IG7A 2HFGL 2W94A 3NFNA 1EANA 3D69A 3AS3A 8PAZA 5IW3A 3LKSB 3MV7B 2R83A 1IGTB 3MRIA 3ZE2B 2WXQA 4MX7A 2OSYA 1DQVA 2NY1C 5F88B 1TJXA 5I6XC 5LQBL 2DM3A 3BSZA 3C5JB 4JPVL 1TVHA 5IHZB 1G6RL 3BD5A 4DTGH 1FAIL 3AGWA 3BZDA 5IW1A 3WL9A 3OMZA 4N2KA 1DJHA 1KCLA 2F53E 1I3UA 3MRKB 5C7ZA 3UYOD 2N1TE 5HY9B 1EFQA 2P45B 2B1HL 3C2AH 4HWEH 4EI0A 1IKOP 4H1LH 4HGMA 4LHUG 3WE6B 3ROLA 4G7VH 3RAJL 3SO5A 2DL9A 2EXYC 1CBJA 2Y6SC 1B2WH 3EF7A 2X2IA 2BCMA 4XNBA 1IIKA 3OAYK 5CP7A 4LMQE 4N9GB 5IF0B 4NHCH 3PABB 4WEUD 3Q2NA 5C07D 4JM4L 5BZDB 2FX8H 3QUZB 1GJWA 3UPRB 4Y2DB 1S9WA 1E27B 5I1LB 1AGEA 4XAWL 2F54E 1PJ9A 4MZRA 1FGVH 4EN3D 5HYIA 1BQKA 1YNLH 3DUSA 4DZBB 4ZNEA 2VAAB 3UIZA 3QI9B 5EEYA 5TE7L 4CVUA 3DRTB 4MB5A 1JWUB 1CF8H 1YPZE 2MKWA 4OCWL 2OJEB 3QHFH 5C92A 4N4YB 2L7JA 1IC7H 4PJ5E 2EEAA 1WFJA 2Y24A 2EDKA 4F92B 1FE8L 2Y5TA 2DMGA 4F9PA 5K59E 1SHSA 4ODWA 2DB8A 5ECJE 5I9QB 1SXSA 5DA0B 5T1KB 5T5NG 5KAQG 1KB5B 1C8QA 1WZAA 2C7UA 2EYSA 3B8SA 2AQQA 4AIZB 4FQXD 3GSNH 1K2DA 3GUTB 4PJXB 4YHLH 2ISDA 4ZAKC 4WW2A 4LNVA 3K2MC 1YEKL 5J9PA 4UIKL 2JQZA 4Z76B 5FYLL 2W9DL 3O3BB 1QLEB 2BH0A 5DUPH 2D3VA 2EXWC 2YXVA 4U0RB 5C3TA 4Y2DD 1TT6A 2YPKB 3TO2B 4L4VE 3W2DH 4JVPA 4EN3B 1UM6H 1DJZA 1YNKH 4PS4H 1I7ZB 4PWFA 4NO0A 5DVNA 1EZVY 2Y7QA 2X0WA 4TQEH 5TDPA 2R4RH 4W9GC 3CQQA 1GY1A 1WWWX 2ZUXA 4CSSA 3EJYD 3KXFB 1OSZB 5GSVB 3NZHL 1BJMA 5KUKA 5T1KD 2F58L 4WTZA 1A6WL 3WNIA 5H8DA 4PYGA 3FU7A 1U36A 1KGXA 4KC3B 4HZLB 1NAMA 2WXNA 1XCQA 2GY5A 1KPRA 1KFAH 4LPTA 2OR7A 1K72A 2WLKA 4AQOA 4B9JA 4AOFA 1XGZA 1I8MB 4IQHA 4A39A 3VTMA 1OGTB 4O2CA 1AO7E 1CICD 2FEDC 4XXWC 2JCWA 3OWRA 4GS7B 3F7YB 3BGAA 4FFZA 1NGPL 3FCTA 5BVJA 2FJHA 2UZXA 3F62A 4JFFA 2VDQH 1FC2D 3DX9A 3OD3A 2FNWA 1JZIA 2Y6SD 3FT2A 1KFAL 4KO7A 5FCUH 3T4AB 3UTQB 4ENEC 2UZIL 2E7DA 1XCTB 3P4LA 4NJ9H 4NRXB 1MWOA 2OSLA 2XV6B 3SCMA 3MXVH 5ITBL 4JHWH 1EBPA 4DKFL 2CK0L 3L3JB 2HB0A 1ZEAH 4UU9A 2WBJD 3JWNE 4Z0BL 4IRSD 2WSPA 1BX2A 3NZHH 5F9WB 4X4KA 3V5HA 4KXBA 1QTPA 3RA7H 3BH9B 5E08H 3KYNA 3MV9E 1M3JA 5J12C 1R17A 4AM0A 1F3RB 1RVFL 2P4AB 4LRIA 4TNWF 4YZWA 2WB1A 5CEZL 3GSVA 5F44A 1N3NA 1YEWA 4GKSB 1EEYA 4NWUL 3P77B 5CCKH 1KN2H 1QRNE 4FFWC 1N8ZB 1FPTL 2E46A 4M29A 1DUYB 4LDLB 3VD0A 2BP3A 3HS0B 3HG1E 4C56B 2UV3A 5CIPH 2ZCHH 3EJSA 3H0TA 1U6AH 4ZUUB 5ID0B 2IVFC 1SMAA 3WXVH 4XWOD 1MELA 1MWAH 2ZYIA 4MMXB 4NKOB 5KS9A 3LRLA 3C6LC 4LSSL 4UM8A 1BBDH 1XB8A 1HHKB 4LSRH 3SE8L 2V17H 4XN7A 4B7IA 5BV7H 4DKFH 3QQ9C 2G0KA 3OLEA 1Z5LA 4Q4EA 3TVMD 5I1HL 4JGNA 5D7EA 2JMRA 1HZHH 2Y25A 3DK2A 4NXKA 1RZIA 3FT4B 1H9VA 1WT5C 3IFPB 4S1DD 5IZ7A 1IX2A 1Z9MA 4JJ5A 1KJMB 2OL3A 2AXHA 1WEJL 3FH7A 1P6WA 4EMZA 4QGYA 2FD6L 2N7SA 4C47A 3S96A 2XICA 1TKWB 1KDIA 1KTRL 5I0XA 1T5XA 3E6FA 1OF2A 5DJ6B 5KVEL 3NP3A 5AYQA 5T1DH 1UWGL 1DDTA 4X80H 5D71H 5DI8A 3KYAA 3QQXA 5AWNL 3D9AL 4MQTB 3IMSA 2FWSA 1DQLH 2Q8AL 4CU6A 3I6KA 4JHVA 1WT5A 1X7QA 2ARJB 2KBGA 2XBTA 4DVRH 1BFTA 4WQOA 1YAZA 5AVYB 4B60A 1O9VA 2OS7A 4P4KD 4JDVB 1HSBA 4B41A 4G7SB 5GRJH 3TA4D 5F1KC 1O9ZA 1Q0EA 5FUZH 4HG4J 4Z9KB 1HOCB 3EO0B 4P3CH 1GS8A 4FQXA 5FO8A 1UA3A 4MNGA 5HPMA 2B4CC 2X4NB 2H5UA 3TIEB 4S0HA 5LN4A 3BLBA 1JV2B 3Q6GL 5IQOA 1QRKA 1TO5A 2W8CA 2ATKB 4FFVD 4PVMA 2FJUB 2NX5B 4B6ZA 3VW3L 1MFVA 1VKXA 4I9XA 1QEWB 3FU5A 3QJHB 4PWIA 3WTSA 4CJ0A 5I75C 1JZJA 4OCYH 4H8WC 1MAML 4UANA 4IKKA 5IROD 1UH2A 2X4TA 3SE3C 3DURB 3T0ED 5HGHA 4RGMB 4OCNC 3Q3GB 1TZOA 2OMVB 1HJCA 2P24A 3IDMA 1OCRB 4G6KH 4LSVL 4XMLH 3O6KH 3T3MB 4EO5A 3VXSD 3PWPD 1U2HA 4LSPL 4W6XB 4Y4KC 1BD2B 1R3IH 5JHDE 1ZLSH 4Y9BA 5LBSA 5HGGS 5JPNC 2DLFL 2GTWB 3LEYL 1F86A 1T6BX 3RURA 4CVZB 4L4TA 3G5ZA 4K71C 4E2OA 4DKTA 1RMFL 2M8XA 2XZAH 3DXAD 1A2YB 3V4PH 3Q7JA 3WFHB 3CTTA 1J0KA 1JHTB 1E4JA 3WDHA 4UOW1 4DGUA 3EG9B 4RAHA 5DJXB 1U95A 1UD2A 2FRGP 1NKOA 2BMKA 4HJIA 1YEFL 3KBEA 3LRHA 2A6DB 2DIBA 3NUKA 3B5HA 4NLAA 2AQPA 3NFSH 4WI8A 4DWHA 4LQ1A 4F57L 2BVUA 1TQVA 3FRPG 3QZBA 4OB5H 4LCUB 4KNUA 4KROD 3CDGB 5FYLD 3RWHA 2I7OA 2J1WA 2F19L 3L5IA 3QQDB 3SGDH 4KDVA 4CN4A 2VDLB 2WLZA 2X10A 4GIOA 5T3ZH 3V4PL 3CZEA 4PJXE 3STZB 4XCEA 3WE1A 1DTUA 3CV5A 1PD6A 1ADWA 1IZKA 1I4FA 3EYQD 3WS6C 3MLTB 3DYOA 2V8LA 3WD5L 4TOYL 3TA3D 3WU1A 4ATTA 5D7IB 4PW3A 4HUVA 3C60A 2NSQA 5DC9B 3A4EA 4J6RL 4NKMA 1PNCA 1NGZB 2CDFA 3HG1A 4PJEF 1WZ1L 3LS5L 2AJVL 5IVXF 3WTUA 2ATPB 3V9CA 1FIGL 4JY4A 5KS9E 3L7EB 2FR4A 5DHYB 1N8OE 4C56E 1LEKA 1TFPA 1FORH 4M62L 2HG5B 4D9RE 4NQUA 3FB5A 3BWUF 3SGEH 1TZIB 2MH4A 5GXBB 3PREA 4HWBA 1HESA 2K6ZA 5CBEB 1OQOA 3QC5X 3QR1A 3S3BB 5CLWA 5BUAA 1YRKA 1PCXA 5BPPA 1WAAF 3LH9A 5CSZB 5GZOA 1NPJA 3BKML 3GIVA 4G8IA 5KUMA 3T0WA 5BXFA 4UZUA 2B59A 3ZDWA 2WIIB 4RRPG 1RLWA 2UYLB 4LPWA 5K9KA 5EF1A 1LE5A 1A5FL 2ARWA 2FX9H 4NUJB 5GIRB 1NDTA 3LMJH 5CUSH 5C6TH 3RWIA 4NFCA 3RPIA 1AO7B 4P2RD 4B9KC 4UDTA 3ZKND 2LFEA 5CJOH 4HIPA 4PJBF 1CXFA 4L8CB 3IMBA 1QO3A 1UWGH 3BJ91 5D71L 5AB9A 1RHHB 5H37G 3VXSA 35C8H 1KYDA 3ATEA 3DX0A 2IMNA 4YIQA 2O61A 1I3GL 1FH5H 2DQCH 3QXWA 2BK8A 2I9TB 1NGQL 2ODIA 4C57C 2KLTA 2A0LD 1KB5H 5B4MC 3D1MC 3KJ6L 4APQC 1ZIBA 2BOBB 5E2JA 4D94A 4N26A 1OB1A 2B20A 1J5OL 1AHWA 1Y0LA 4TQPA 4XPGL 5EIIG 1CR9H 3B3IB 4B0MM 1UD3A 2E7MA 1NSNL 2DLIA 5LXVA 1GHFH 1JJUA 1VESA 1P7KA 2ATPA 3BAEH 5D2NA 5A3IC 5JO5A 1KYUA 5CFAA 1BVLA 5A16B 3GS7A 1NMBL 4UTBH 2A9NH 3DMMD 3NMEA 4XPAH 2PPEA 1SBBA 3BDYH 1QBML 3GLEA 3L45A 4U1IB 4XCCH 2VSMB 3NZUA 5AYUH 3VD5A 3QORD 3MFFA 1QNZH 1V8HA 1DHKA 3B3IA 5LGKA 3CK0H 4U1JB 4P9HC 1K6QL 1AXSA 2ESVD 2XV0A 5A2LH 2CBPA 1FZKA 1X5JA 4WI0A 5DJ8B 4HIXL 4GMSL 3G7TA 2IDQA 3V0DA 4WGVB 2BSEA 2IGFH 3KBPA 2A6IA 1QFUH 5E23A 1CFNA 3APDA 2BSTA 4BWUA 3KVQA 5CSZA 1QO3B 3EYQC 1ET5A 3SKJH 3DX6B 1OTUD 1G6VK 3U4EB 4F7EA 1DBMH 3ILEA 1BHGA 5JORB 1N68A 1EUTA 5ETUB 1RUQH 3SYAA 4P59L 1G7JB 2Y1AA 4FXLA 4Z7UA 2ZX5A 1L9OA 5HHNB 2PWDA 3HC3L 4P4KA 4W1TA 5INCB 4O2FB 5IVXA 1YMME 2OJ1A 3HE6A 1RSFA 2WBKA 1ZA6B 5EEVA 1TZHB 3AT9A 4KRMB 1KTLA 1T4WA 2EVHA 4JFZH 2X7LB 2I07A 3QZPA 2IWEA 2HLAA 3N06B 5E9DE 1NCWH 5FYKH 4YHZH 3VH8B 4Q6KA 1XTLA 2CLVB 1ZOXA 2X0VA 1D7CA 4JW3A 4M43H 4APXA 3VFUB 3DLQR 4I0PC 3FH5A 5FCUL 3TPKA 2GTQA 2FVNA 3C9NA 3IJ9A 3CDGA 1CFTB 2F53B 1JWMA 3GSUB 4TSCH 3D48R 3MYJB 3DRQB 1DVFC 1HINH 4FNRA 2WVSA 1MRCL 1F41A 1CC3A 1UEYA 4HKXA 4ISVB 3PWUB 2O30A 5ISZA 1BSIA 5IB1B 1IE5A 3QFJE 1ID5I 2FLBT 1Q9OB 1MEXH 3GTNA 4FQXB 5FO8B 3FN0H 1BFOA 5B4MD 3WFCH 4GRWH 2HX9A 5F72S 3K8MA 2ITCA 5BW7A 3VXUB 3GSWB 1HZLA 1OGSA 2M2DA 3U9WA 4HH8A 4HMEA 1QKZH 3KL3A 5IM7B 1URIA 1U30A 3T4YB 5E8OA 3MNVB 1S5HB 3QZWA 4GAJH 4PGCA 2C3VB 4MA8L 3NN8B 3U9UB 1RJYA 7PAZA 1JNNL 5KG9A 1TZGL 4HJGB 1FI8C 2X4TB 3FFOA 4Y19A 1JD9A 2W07B 1T5XB 3RP1A 4HQQH 2CHDA 4PG9B 5FYKE 3I74A 4ZX6A 5HHOE 4Q4IA 3PJNA 5TPWH 2AQNA 2HA1A 1JDAA 4POZD 5CZKA 4EN2A 4L1DA 3P2BA 1MHHA 2QVTA 3RDTC 1DJIA 3HE7C 1MW2A 1KC5H 3WY2A 5IIEB 3VXUD 1CLCA 4O9HL 1V7NL 1NOAA 4LLVA 4WHCA 1EA9C 2DQMA 3Q8CA 4X0KA 1KEMH 1MI5D 5DDHB 5E7BA 2WZPA 1DVFB 4XMWA 3ZHDA 5F1NA 4N2FA 5SWQB 2CALA 3KW8A 2J6EL 4FTVD 4G1MB 5E8PA 5DGRA 3RFZB 1S78C 4L18A 3M88A 4JM4H 4O00A 3CZUB 5E99L 4UQ2A 4OUOA 1GMIA 1FO0H 5HPMB 1A6ZB 2YMTA 3FTWA 4YQXL 3RWEA 4XNUL 1HI6A 2IQAB 4JQVC 4Y16C 3FQNA 1DUYA 2AABL 4OB5L 5DXWA 3NH7L 2BVOA 4KXAA 2PF6A 2J21A 2DQFB 2MPVA 5ESQB 4NO5B 2YS4A 1E42A 1U3HD 4X9GA 4MNQA 1N3NB 3ZGHA 8FABA 3QWRA 1NC2A 3V8CA 3MGAA 3W9EB 2E4TA 4LOEA 3U36A 4V2CB 3IRZA 4LL4A 4PTUB 3NA4A 1FRGH 5JPNA 2VM3A 2X6BA 5CMAA 1O6SB 4K9EH 2OMZA 1WFOA 4K23H 3P4MA 2EDDA 1R5WB 2I85A 5EUOA 3FO0L 4NO5A 3L9EA 1DJSA 4HVBA 3ZRSA 4JPSA 4UBDD 4DUXA 4YWGL 1CBVL 4GRLB 5BCAA 1Z1WA 2WQWA 1FIGH 2PETA 2YXWA 4PLOB 5CLTA 1AKJB 1WFTA 3JWOL 2FO4A 4ZFZB 1KXQE 5E4OA 5EULV 1YEDA 2BHUA 5GGVL 5ILTL 4EKXA 3N6YA 4WKZB 1RIUL 1KLUA 3BH8A 5EEWA 5GRUL 2DV6A 3FT3B 1SOXA 5DURD 2UUDK 4CUCA 3HC4H 3RGBA 4F7KA 4Y5VA 4AK2A 3RFZA 1UTDA 2NY3B 4HLZH 2NXZD 3PIQA 4HUUB 4HUUA 1E50A 4M7KH 1QX1A 2Q10A 3U4AA 3W0WD 4K7PX 1IBYA 3APFA 4K3EH 4N6RA 1BQHG 3MZTA 2IBZY 4QRUB 3SE4C 3WS3A 2VZSA 3AABA 4KNQA 4WKZA 1GZPA 2J6EA 3QG7L 3RNKA 3PL6B 4JGMA 3H9HA 5GSVA 2HJLB 5DRXA 2ZICA 3A47A 5E0QA 3ARSA 4H26B 1DLHB 2KHAA 5F7MC 2V2WA 1FGNH 3O2VL 3OPZL 4BUHA 4K3HA 1OOWA 4YFDB 4P5TC 1PLGH 1CTNA 3P4MB 2WV3A 3FYIB 4O02B 3PV6B 2X1XR 3HNTH 5MHSD 2IH3B 2QKIB 1E6JL 3IJ8A 4FQJL 4XPTH 2CRYA 3RTLA 3WJMA 4IMLA 2V2XA 3F7VA 3KPRE 3FFCA 3L3GA 3FQUB 1FO0L 1P4LA 4H25B 1F1AA 1R3IL 4P5RA 1I7TB 2JJTC 4KI5D 3U30B 2BP0B 4DEWA 3F5WB 4OM0L 1FCCA 2PYFB 3DTXB 3B2VH 2F8XC 1M56B 1AACA 2DMHA 5C71A 3GUTA 3VFOB 2Y72A 2YPLA 3FAWA 1CJYA 2CHWA 3GD1C 4GIAA 4IRJA 1D7BA 4IRZH 2K1MA 4YHNA 5IMMB 1FNGB 1MRDL 3D4CA 4HZLA 5BVJB 4FA6A 4YHZL 4KY1L 2E6PA 2CGRL 1KCBA 1VEPA 2NY3C 2X44D 3EGDB 4JLRA 1WE5A 1WD8A 4WWNA 2DY2A 1OP5H 4LLQB 3MJWA 3VFWA 2W80C 4Z77A 3RY6C 4BFBD 2HT4C 2VDLL 4ZZFA 4K9JA 2VDOB 4NZUH 1Q9LA 4E41E 2ADGA 5CEZE 1ZAGA 4ODXB 4EN3C 3BJLA 4FG6D 1NIEA 2ESVE 5E5UB 4ZTPL 5EORL 2Z8WC 2FT6A 1FZJA 1NBYA 1KB3A 5GHWL 3SEPA 4IKNA 4X50A 3L4ZA 1V3MA 4MA3A 2YKLH 3EOBA 5LGJA 4PG9A 5E6SB 1VFMA 3RVXD 1OCCB 2A3TA 5DEFA 2FH6A 3VACA 4HS8L 3S34H 4IKJA 5DJ2A 5EU6E 1SVZA 2R1YA 2CKBL 1JIBA 3GZPA 2C8NA 5CJQH 1A4BA 4JVUA 3WJLA 4PP2B 5IVXB 3FNKA 2GUOB 3ESMA 4N2LA 2IAMC 2XJLA 2VWEC 5IQ9B 4G71B 1ZSDB 2JCCB 1U93B 2HJFB 3MLXL 1R5IB 1O5PA 3FBQA 5SV3A 3WUZA 3D06A 4TKWA 1N6VA 4MGXA 3O2DH 3B9KC 4N2CA 3WFDL 3OM3B 1Q9OA 1U9KA 3ULUH 1GGTA 3NAAH 2UY6A 3GO1L 4GLRI 5E5LA 1WA1X 2XN1A 4FQ2H 4PJ7F 3AS2A 2BRRL 3UYRH 3DVGA 3KG5A 1MJ8L 3PRZA 5F9DC 1EK3A 1AQDB 3KJ4C 5EO9B 4WDIA 3TN0B 4AH2A 3VWKB 2IJ0C 4DN4H 5MEQA 2F53A 1B0RA 3DRTA 1HL5A 3KE0A 5E2TH 5DEGA 1G7IA 4P0DA 4H5SB 3PP4H 4GSXA 4YDLC 3TV8A 4BK4A 3C6SB 1GCFA 1HXYA 3BKCL 1N6QL 2J1XA 1SXNA 3S0PA 2OULB 4XNQA 2ZOLB 3EFFB 5EB9A 1K8DA 4PUBL 4X6EA 1ZIAA 4NWUH 5CCKL 1ZRUA 3OHMB 2H32H 3IJSA 2CG9X 3J8F7 4J8QA 4X83A 5HHVH 1UKTA 2XIDA 4LK4A 4TUKH 5HGAA 5H2BA 4TQEL 4ERSL 4LPXA 3FAXA 4ES9A 3DDGA 1SJVA 4R97B 4MS8C 3NJGA 4PJ9A 1QFPA 2YQBA 5F9AC 3LV3B 5DUBB 4BCXA 1T0NA 4XI5C 2VXTL 5T5FH 2OLDA 1QUNA 4HIXH 4CMHB 3SO3B 4OD2B 2COQA 3L16A 1UXLA 2VXSH 4PGDB 3ARGC 5JORA 3KNBA 2D0HA 1BPVA 4OAWB 3W1ZA 5E2UL 5IMKB 4HPOH 3RZCA 4PCTA 3CVCA 4QOKE 1KCWA 1N2RA 4HJTA 2DTML 3ECUA 4QEGA 1G7QB 2YJLA 3WFEH 4F8PA 5B3JF 3MV8D 2P7TB 4IRZL 5D1QC 1DBBL 5B1JC 4AE0A 3R8QA 1AE6H 4L8SC 4OF5A 2AHIA 3FCUB 4OU3A 4X6CF 5I8EA 3ARPA 4ABWA 2WGXA 1K4DB 3SCMC 3VXRB 1KBPA 5D2LE 3ZYIA 3QULB 1TVBB 2BVTA 2AVFA 4PLNC 2FQGA 4NO0D 2GSGA 4CSPA 4JFDA 3GGWA 1MW0A 5EOTB 3WLBA 1PEWA 1ZANL 4NYLB 1QSFA 1BVLB 2J5LC 3C6LD 3SHSA 3D18A 1GYWA 4RNRA 1EZVX 4RZCB 3TNNA 4J3OC 4MAUL 3EHBC 3WN5A 4ETQA 1PL3A 1PU0A 2DM7A 3MV9B 1T2QH 4PY7B 1N59B 3HC0A 4WFGD 5BW7C 2EVGA 1ONQA 1FZOB 4U0RC 4F2EA 4NT6A 5JOPE 4OZ4B 4U1MB 3T2NL 4UYQA 4PR5A 1GGBH 3HR6A 2CBOA 2PR4H 4G9FA 1KCVH 1I8LA 4PVLA 1CFBA 3BQVA 4PJIB 1GYVA 5E99H 5JIHA 3UO1H 4D0DA 1IGCH 5H35A 3ZDYB 2X38A 1EFXB 3BT2L 2ZXDA 2XVGA 2CKBB 3O6ML 5GGUB 1WAAA 1NCNA 4U6VL 5DR5H 2ZXEB 1UYWL 3MCG1 2P5WA 2Z35B 5DQDL 2MOVA 4XPFL 3TFBA 5LXGH 4ZTOL 4P4KC 3LRSA 2VTFA 4JZJC 5AW4B 3RWDA 4FI6A 1PZUB 3QXUA 1XR8A 2J56A 3CFDB 4JRXB 4JRLA 5TDNA 5IUSA 2AEWA 4F20A 2AJSH 1PG7X 1YNLL 1SEBB 3K3QA 4KUZH 1JZ6A 5AAMA 1TXKA 5IBLD 4TVSa 2BVYA 1G4MA 3L4XA 2BS8A 1NDGA 1UADC 1GGBL 2VMEA 4N9OB 1FLRH 5IEHB 4HT1L 3UJTH 1HQRA 4LCCC 5FF6A 4TLSA 4BCZA 1FL3B 4FA7B 3AQXA 2FBRA 4E9RA 4K0OA 2D3LA 3PLYA 1DFBL 4RAUB 5EF2A 1FVDA 2YD0A 2AANA 5DD3L 1WCBB 1K3IA 4UWQB 2D03L 5C0NC 1BJ1H 3ARGA 1OW0C 3O4OB 5DRZA 2DQIL 4FTVA 4DGVH 3AJ7A 2IWFA 2W81C 4N2MA 4PJ5D 3WNJA 4EI5B 1M3IA 1A6VH 2NDGA 4GBXD 3L1EA 1ZXQA 3Q8BA 1RZKC 5MEPA 4FMFA 3SPHA 1XD0A 1D9KA 1R5VB 1S7WB 2P8MB 4ANKA 1OAQL 5EZIH 3TEZA 4OLVH 1OV8A 1R3LB 2X5PA 3LRKA 2LAAA 4NP9A 2YEZB 4ODSH 5DHVH 4A2LA 1JHTA 1HINL 4FLSA 3DXAA 4A7GA 5HDBB 1ZK9A 3BO8A 4XMLL 4KRPC 1D6EB 3HRZC 4NC1C 4WJG3 3PQYA 4PJ8C 3P2DA 1P1VA 3P4NB 3P4NA 4YSTA 1BD2D 5FM4A 1F6AB 3A22A 3QJVB 2YRPA 3WKYA 2GJ6B 2IANB 1RQ5A 3O6FC 3DWTA 4GAYA 4IEFB 3BD3A 4I3SL 4Z0XB 5T1MA 5CD5D 4CBPA 1P5VA 3H3BC 2YAHA 5C9JB 2Z31A 3DXAB 3ULUL 4YAQB 3OXRA 4FZEL 4Y1AD 4OLUL 3WIFB 1X4ZA 3WLWC 3IU4L 1HOEA 2O6FA 5I76B 3A6CL 3GKWH 3L81A 3QUXB 5KVDH 1HAUA 3SDYL 2HPOA 5J4MA 4FTVB 1KJ2H 3FCGA 1NBZB 3B2UD 2BWIA 2NNAA 5DRZB 5DMIH 2G30A 3V2AR 2E47A 1Q1PA 1BQ5A 3EFDH 3EYFA 3S48A 3KDMB 4HEPG 1HQRB 4JHWL 3WTVA 3EO1A 1LDPL 3Q06A 3BN9C 4WWID 1F11A 2ED9A 3BFWA 4RGND 1I1AD 3HZMB 2YLKA 1I53A 1N0LB 2JB6B 3OLDA 1UJTA 4YDZA 5FW7A 1RJZA 3VNYA 3ZKMC 2R8SL 3CFMA 5TDNB 1JYNA 3FN9A 4CN1A 4WUUD 3GMNB 4JZJA 2Q86B 4ELMB 3DYPA 4B53A 4IU3B 5FA3B 1M4KA 3UO8B 2YBRA 2RMNA 4BM7A 2HP4A 1JN6A 2IOIA 5E6ZA 1H8SA 1BQHB 2Q3XA 1UA7A 1ORSA 5ICXB 4UZGA 2NTFB 3FONA 5JHMA 1A14L 4QHKJ 3VA2C 2MPAH 5GGUA 5JOEA 5D7KE 3UGXA 4Z7QE 4QIRA 1ZS8A 3BWAA 4N2HA 1KZYA 3HFML 1LDSA 1UOKA 4HA1A 3T4AA 5I15L 4S1SL 3S6CA 2KLRA 1NCHA 3DUHA 3QJFA 3RZCD 3G5YA 4GBXC 2VRKA 1P84J 1IQDA 4NZTH 1ONQB 4GP5B 3OX8A 4OJAA 1GCYA 5AW8B 4BELD 5IJVB 4U1MA 2V6HA 1RUKL 5BJTB 4JRWA 4YDVA 1CURA 1JGVH 2XG5B 2C1OA 2BXZA 4IU2B 1NCAL 4ZFOB 2FSEB 2JLLA 3FRUB 3HBGA 2R7EA 2WNKA 4ZO6A 5FW8A 2O5ZL 3QIBC 3P2TA 2WXGA 2OP4H 5A3ID 5KS9F 3W2DL 4RFNB 3WN5C 1JPTH 3MRHB 4XN5A 2G5RA 1BF5A 1BV8A 1XZ0A 2W91A 2CHZA 3O3AB 4F8NA 1KUMA 1BZEA 1XF4B 1T20A 3DOSB 3TYGH 1O7DC 1QA9B 5CLXA 4I77H 2IBBA 5G4OA 3BQUC 1PJWA 5JW3L 4GKSA 4L2YA 2C5DC 4FZ8L 3FT9A 5T8IA 1XSIA 3HLAB 5FYJL 2O72A 1QWNA 3EZ8A 4UIMA 4WSGA 1XGPB 4LBAA 3KYNB 3SDDC 4PJBB 1JK8A 4HIJB 4W9IC 3ZL1A 3GBLA 3B2UC 1N2RB 3EUDA 5JDSB 2XLLA 2WINA 1LP9A 3ARTA 3TYFB 4BK5C 2YMXH 2ZUWA 5DO2D 2LU3A 1TEYA 3MLUL 1RZGB 5JZ7D 4KJPD 4Y4FD 4WW2B 4Q9QL 1EFXA 1OAQH 5EZIL 2H32B 3APMA 2R0LL 2AXJA 3NFPB 2GB2A 1HN1A 2X4UA 4QCIA 1MNNA 4G70B 3DXAE 1NUNB 4PJ5A 2WK2A 4F9LA 2JCCE 5DFWH 1O7VA 3Q2WA 3R1GL 4BZ2H 3I6LE 3PNRB 4PR5B 4TPRH 2XI9A 4OZ4A 2O93L 3ZYJA 1W72L 5C0IB 1SF3A 2Y2YA 1B0GB 1AXIB 4NI6A 1OAJA 2F1AA 1PSKL 1CFQA 4YUEH 5KZCD 4U49A 1GSKA 2Q0ZX 5F89B 5HI4D 3S4SG 1I85C 4OV6F 2W1NA 4PP1C 3HB3C 1N64H 1SRDA 3WFZA 2BHZA 1OK8A 2YZ8A 2KLSA 3NIGF 5HI5D 3BQUB 5HYFA 2GT9A 1VIWA 3PQYD 3TU6A 1MIEL 4WFGE 1B0RB 3LEYH 4MQ7A 5E5RB 1PFCA 1JFQL 1BZ8A 1AFVL 1P4BH 1L9RA 3RUGB 4K3DH 1AGBB 3H1ZA 1N0XH 5K39A 1A9BB 4HSCX 3BRDA 4ZOCA 4JFPB 4YDKL 5I6KA 1ZJBA 4HWUA 5C0JA 3P40A 2J5LB 3SGJA 1UWFA 3BXNA 4Y1AE 1QRNB 1WPCA 5T1LB 3HAEH 3B2VL 1IM9A 3CHQA 3ULUF 4DESA 2CO2A 1H8LA 5J6GA 3E8UH 4UQCA 5J6GB 1AG6A 1OARH 1T4KB 3KNBB 4B3EA 2ICES 2DH3A 4JRXE 1JZGA 3ZR6A 1PLCA 3WJJA 4XE0A 4D7BA 3K7UA 2MFNA 2LTQC 1VFUA 4NRZB 2XUWA 3V4UL 3LHPL 4E5XG 3UTSB 1MUJA 1R3HA 1OTSC 2DN7A 2VDOH 3ZU8A 1E2ZA 4HUNB 3U46B 2LLLA 4GW1B 3ZTNL 3AQYA 3QQ4A 4MA7L 4MQ7B 4P9MH 3L5XH 4PJIE 3D0LA 1FZJB 2GT9B 2YA2A 3DO4A 4DGYL 1R19A 5JHDB 3T1WA 1OTTD 6FABL 1ILUA 2YC1B 2PPDA 4DF9A 4FQCH 2VZ3A 4BSJA 1ED3A 1G9ML 4AEIH 3MRMB 3US1A 1C5CL 4MMZC 2MQCA 2BS9A 4FQQB 4OCLC 2F9BT 4X6FA 4YC2C 4TN9A 4MSWB 2APFA 4YDNA 4Z77B 4BFIA 2XZCH 1KEML 3MAWA 2AEIT 4AH2B 1E4XL 4ANWA 3BI9X 1XCWA 2HRGA 4G9FD 1XGTA 2OSWA 4NQVA 2VYRE 3ZO0A 5I1EH 1Y18B 2BP5M 3IDXH 4J28A 5HDBE 4MJ5B 2AV1A 1OM3H 3D52A 4V1DD 4UV4H 2JKJA 4C56D 1KG0A 1S7QA 2IPKA 4HXBH 2VDKL 2ZUVA 4G7YL 2LVCA 5F88A 4W9JC 3B7SA 3O2DL 3J2PA 4EVNA 3NIGB 4HF5L 4P5KA 1JXGA 3FT1A 3TN0C 3EBGA 4HIHB 1IT9L 4LKCB 3SOTA 3UDWA 3TYFA 4I3RH 4L4JA 3QIUB 4ZPVA 5EWIH 4JN1H 3TBYA 1IAIM 5ENWB 1QOKA 2CO1A 2W60A 4IKIA 5I1IH 3VGBA 1WUNT 4U7KA 3TH2T 4M03A 4JG9A 5FGBC 3T9WA 3EW3B 2XZQL 5ES4B 4S1RH 3HG3A 3MX0A 3SDAB 1YMMD 5ICYA 2V2WB 3VFTA 4Z7QB 1T22A 4LHQB 3ALWA 2A77L 1BMWA 3K6DA 4GKNB 4ODHL 4UTAH 5I0WA 5FHBH 3QDHA 5CZXC 3O2WL 3KW7A 1RVFH 3H9HB 4V1DB 1KV3A 4HV8B 3RNKB 5IY5B 3JV5A 3GSQA 5DVLA 5GGRB 1SBSH 4KHTH 2K0RA 4FN0A 5M94B 5HTSA 3F12A 3CSPA 4F33B 4N6RB 3SE4A 2FO1A 2JCCF 5E00A 3BWUC 1FFQA 2XC8A 4MASA 1M05B 4RGNE 1T0PB 2OX5B 3ZSTA 1DFXA 1QFWM 4LSUL 3PPEA 2A6JA 3JUZA 1NTDA 4WO0A 4XBGA 1WIUA 2G4GA 2JFCA 3D87B 4UTAA 4GQ9L 3OX8B 3OF6D 4U1KA 3WEBA 1JZ7A 1IQDB 1MLCA 2SEBB 4F93B 4HALA 2WXJA 3BSGA 3MA9H 3HAEG 1A7OH 4ZFFB 4OZIA 4P5TD 2XYCA 3FFDA 4MCYB 2ICWA 1MI5A 4TL5A 1DVYA 1VAHA 2HFFA 2NX5D 3ZDZE 1FFNA 4I18C 1FL6B 1I7TA 5DJDA 1I1RA 5FFGA 3IAQA 5T5NF 5KAQF 4PTUA 3ZO9A 1BQHA 1O6SA 4I4WB 4HAKA 1THAA 5CMAB 2NYYD 1FO0B 1S9VB 2X4PA 4L9LA 2ZCLH 2M26A 1JNHA 4HJSA 1XQ4A 2ZT9C 5ANMA 3VA6A 5BRPA 4FXGB 5D1XE 3KPPA 1TMQA 2FHCA 2O26U 4DIXA 4H26A 3WIHH 3FQNB 4XZ4A 4P07A 4HS6A 5HYSG 1BGXH 3CLWA 3TO4A 4PLJC 4IBQA 4UOZA 2G2RA 3CVHA 4KTDL 5C8JB 5IK3A 1SMDA 4S1QL 4KZEL 1L3NA 4UQ2B 1AIZA 3ATAA 1WHPA 1XWVA 3QNZB 3GMOA 5HYJA 1KBGL 1PEZA 1SLUA 2IH8A 5F7BA 5EDXA 4F8LA 5LDUA 2YD2A 3RU8L 1JHKH 5F7DB 3QWRD 4D9LH 3EYUL 1ETZA 4AYGA 3LKPA 5JW5B 4JN2A 4JHZA 2XN9D 4DFIA 1WWBX 4WHYH 1CL7H 4MD4A 1Q0YL 3SKNA 4XZUA 3EH4B 3WO4C 4UDUA 3RVXC 2DAVA 1FAKT 1A4JB 1OP4A 4XP6L 3R7QA 3ZMNA 2CR6A 4XCNB 3LIZA 1Q9WB 3JWNC 4R9HA 2IXQB 1XV8A 3MRCB 4QTHA 1M7DA 3IGAA 1CF8L 3NEOA 1JMXA 3BEWA 4Z5RB 4HJGA 5J6HA 4L3EE 3FO0H 4N86A 2WANA 4J8RB 4RCAA 1A6VL 4W9LC 4ZMAT 2C4FU 4XVSH 5E1QA 5E8OB 1DSFL 2XVKA 3BVWA 3Q44A 3LN5B 4RRPM 3FSOA 3QZOA 5F9JA 3DBXB 4NOBA 3Q0HA 4I2XE 3T0DA 3IXTB 4CJ1A 4D8PB 3HMXH 2JJSA 1DJXA 3KCPB 4N1EA 4KRNA 3B9AA 3MMEB 5I0YA 2OMTA 1KBWA 4A6YB 4LEXH 2CH8A 3DX7A 2WBXA 1IKFH 2WUBH 1JMZA 3IDIB 1WS8A 2X6MA 4OBSA 3KEHA 2X4OB 3OR7B 2MWCA 1A66A 3EYOA 3K4AA 3IBOA 2FEEI 1MCEA 4JDTH 3GSNL 5E5MA 4AL8C 5C2UB 5FOJA 3FU6A 2ZF8A 2HVJA 5AVZB 1EHAA 4X0KB 1CE1L 3OGCA 4NZDA 1T7YA 3FFCD 4BFEA 4UINL 4KZCA 3ARBB 4EQ3A 2AC0A 4G6JL 4PY8J 3VFUA 3U0PA 1E9PA 2J7LA 3VSTA 3KPTA 1QUPA 3BUIA 5AL8A 3L9RB 3WD5H 1D7FA 1MCKA 3H9SA 3MCLL 5A7BA 5DK2B 3IDGB 4QXGL 1XDTT 2VXQA 4KH9A 5HJBA 3T2LA 4RBPK 4KROB 4TS6A 2W9EH 2AEPL 3ZLQC 3V8OA 4CDHA 1WFUA 5C1MB 2DQJH 3HE6B 5FS5A 5KYWB 4K5NA 3LDBB 1VPOL 5FC9A 3UBXB 3GMMA 1EEZB 3KLHC 5EU6A 2WWOA 2VN5A 2VLME 4M7ZC 1U8IA 3N1MC 4WRLA 5BQ7B 4PJDB 3C2AL 4HWEL 4PRIA 2Z92B 5IR1A 5IBUB 1Z6JT 4ZXBA 1VADB 1L9TA 1T5KA 4YSCA 2FLMA 2XWTB 5C70A 4IJTA 4N8CH 1FZOA 5I8OH 5B21A 1EZUA 3ARBD 1G6RH 4DTGL 2DS4A 4M3JA 1FG2A 1MDTA 5L4FA 4WK4B 4Y4HC 5FLUA 3GLAA 4FG4A 4K9EC 3I50H 2DTSA 1Z9LA 5DJ0A 5C0BA 5IGXL 1M6OA 4GW4A 2W5PA 3C6LA 3O0LA 4LMQI 5K9QI 3WCYA 3TURA 1LILA 3KWXA 3GSUA 5EIVA 3VXPA 1FFRA 5D1XA 3QDAA 4ODUA 4PREB 3TLRA 3NCBB 1P9MC 1SJEA 2DJ4A 1E5YA 3O3EA 2WVUA 3F7QA 4DO4A 4F5CE 2ZKXA 3HE6D 4XNMA 4NHUB 4ENZA 1UFGA 1YN6A 2ITEA 3KYMB 4X5WA 2DTMH 3U0TA 2Y7NA 4FQ2L 1AHWB 1Y0LB 2AGJL 4L4VD 3C6LB 3SE9L 4PRAA 3IRPX 4P2RB 3PWPA 2P1YA 4Y5XA 3RU8H 1RAMA 2RACA 5I8KL 2QQLH 4R26H 1CXIA 2Y7OA 4KZDL 3S98A 1RUML 4LNRB 1LJMA 3GM0A 5C3LD 4JREC 3MLRH 3ARFC 3AB0B 3GHBL 4PRIB 1DEDA 3CWGA 5I1GH 1TCRB 1UACH 4LAQH 4Y4KA 1B4RA 4IHOB 2EIBA 5CJQL 4ICWA 4EAEA 5CGBA 5JHAA 1XT5A 1A7PH 1MN4A 1X5HA 4C59B 2DM4A 4I0KA 1HJBC 3LV3A 5DUBA 1J88A 5ISZD 1T1WB 1EFXD 5AVWB 1TTUA 5J1TC 3SBQA 2QT6A 5A2JH 2Z93A 4MBOA 2EECA 3ABZA 4E42A 1XR9B 5I71C 2HG5A 1AZNA 5FX3A 1TZIA 2VR5A 4ZTPH 2IH1A 2NSXA 3UZVA 4P99A 2Y5EA 2NY0C 5CEXB 4YSOA 1K6QH 3SDCB 3CPLA 4XB8A 1NZRA 3KYMA 3WTWA 1TJIH 4KJWD 1G0DA 4M6NL 4X5RA 3VJ6A 1G94A 2VDLH 4N2IA 4OI7A 3IVKA 4X6CE 1Q4NX 2BO0A 5FYJD 4D7PA 3EYUH 1ML0A 4PRID 5SWZE 1AC0A 1FNSH 3A67H 2BCKB 5D7IA 3X1FA 1P7KB 3V4LA 2FBJL 4HCIA 4ZW5A 1SJXA 1NFDE 1B4TA 3NIDB 1QSVA 3VSQA 1ID2A 1QSFE 5DU7A 4MNQE 5KWYC 1M6OB 1S7UB 3UEQA 3VFPB 4AUJA 1PYWA 3T77A 1QRND 1AGDB 3Q9QA 2EKJA 1VLXA 3RWHB 5FUZL 5ESAA 1SHWA 2N01B 1P7QD 4OCSH 2DWEA 2B3IA 7CGTA 4BUGA 4Y1SA 1ZT1A 3GMRB 2DQHH 3HMWH 2AK1L 4JFHE 3UDWC 1ES0B 4G8GD 1XGQB 4MQSB 4ABUA 1XL4A 4XC3H 2BMKB 1WBXA 2OL3L 4PBWD 3MUY1 4HAFA 4UDTB 1FL5B 3CFJB 3HHRB 3KM1A 4OKVB 4BA0A 2QSQA 5DEZA 1DQLL 3BUYB 1A2YA 1E9QB 3KPNB 3PWVA 4O02L 1QP1A 3WFHA 5F3HA 1KIUB 2MTAA 4I0CC 2FIRT 3BZ5A 2VZOA 3RB5A 3B1TA 4N28A 5HDRA 2DQEL 2Y9RT 4L1SA 4FNUA 5I74B 2RQEA 4FYSA 2I24N 2LFGA 2R69A 5GGTA 5GS1B 1U92B 1L6ZA 3ENEA 3H9SB 1INDH 4UB0H 1DN0B 1J0IA 4I5BA 4FABH 4HXBL 1TF4A 2LVEA 3SBWC 5G2NA 5HGHB 1I3RA 3VXOA 4JN2B 5E9AA 3VCLB 4Z7VF 1NC4A 1GL4B 1F3DJ 3WELA 4X6DF 3P3TA 3T0XA 2NX5A 5GSRB 3F8UB 3G5WA 2GBUA 4PFEA 3VFWB 4JO2L 4LLQA 5DWUH 5DJ0B 1JGDB 5AKTA 1HCZA 4XVOA 4HH9A 3TEYA 3FUJA 1BVOA 1WFMA 3HVNA 3H9ZA 1A1NA 3ARVA 3QIWC 4M5TA 4P3DA 1BLNB 4XO8A 3C6EA 3DECA 3O81A 4M7LL 2WLYA 4ZD3L 5IB2B 4KITB 1JGLH 1KN2L 3S88L 3ROOB 2DJMA 3T1FB 4KQ4L 2VABB 5EU5B 3QIUD 4OGAD 4W4NA 2BP0A 3K6SA 2YUXA 3IXTA 2FECI 1FN4A 1E8WA 5B39G 3W0WB 4JPIB 3EUUA 4NQDA 1EEZA 2XTJC 4X8GA 2CJUH 1WISA 4ELDA 3JVGA 2BNQE 2XWJA 3NH7H 5D1QB 4M7LT 5DEJA 4NZUL 5D1XD 4AQEB 3PL6D 3ES6B 1JVKA 2F61A 5GQBA 1MI5B 3FQWA 4QTHB 1Z0MA 2MHAA 4X9FA 2WWMC 3ABLB 1IC4L 2I5YH 2Z0UA 1TUPA 4O51B 2WMPB 2P47B 2YAMA 2NY2D 4UT9L 5AAWA 3BHBB 4D8OA 1CF1A 4ZTOH 4AW7A 3MRDB 1G9NH 1OSYA 4OQ1A 2MIZA 1T3FA 1YY9C 3QNYB 4A7TA 5BO0D 1P9MA 3GHPA 2GCYB 4NSKA 4DEUA 3VDCA 1NQBA 5H37A 3IFPA 3N40P 2W0PA 4D9RD 3OHXB 1MCWM 3PWNB 5C0BD 1BZDA 4ZTEA 2MQ3A 3MV8E 2EIJB 2ZIDA 3T4AC 1OPOA 3OC5A 3TZVD 1GS7A 6FABH 5CIPA 3CFIC 3BH8B 1RIVH 3RIFF 3QNZA 3OR7A 1BM3H 3GQFA 4K3JH 1QHPA 3RVVC 2ZYHA 3V52H 1FBIL 1JI2A 2ZXWB 3O9WA 1MCJA 2FEEL 1Z9OA 1FNEB 4K5PA 1IM3B 1XD1A 5D7IE 4N8CL 3P77A 3LHPH 4X4MA 3KPRB 2OZ4L 5F6HJ 1NICA 4J6IA 5EUOB 1H6TA 4WFEE 2ZP0T 4Y5VC 3JVFC 2JKNA 3ZMRA 12E8L 1EGJA 5J89A 1YNTA 3L08A 3MR9B 2VDQB 4G8FB 5JHBA 4R2GD 1JUFB 1D5IH 3IGLA 3EADA 1OP3H 1O7SA 3BIKA 1JGEB 1R3JA 3L3JA 1SDAB 2DD8L 4Z23A 1QBBA 5IBUG 4GSQA 4YEEA 5DD0H 1TQUA 2P26A 4LAJH 3DSNB 3VRIB 3GJFH 3FFDB 4WI6A 3UTQA 3MRRB 3TJHD 2ZJSH 3MREB 4P49A 3FCTB 4Z8FH 3WMQA 4Z7WA 4XBGB 1F4WH 3A6BL 3VB8A 5I26A 4N0UA 4MSWA 3GRWH 5G4MA 3U82B 1AFVH 4A2MA 4MS6A 4LLMA 3KCWA 1UZ8A 5C0DA 5AVTB 3QRLA 1W8NA 5JQ6L 4BGDA 4R2GB 1OAKL 4LRIC 3U1PA 3ESPA 5IQMA 2GIXA 5TQ0H 1EBAA 2ADFL 1U6AL 5SWSD 4L0YA 4GAAA 3BP4A 2LLGA 4IRSA 4FA8A 1E67A 1OSZA 3MNZA 3KVPA 2C3GA 1RFDH 1HHJB 4QRRB 2ZNXA 3DV4A 4M93C 5ICYB 2NY7L 4C83A 4L0ZA 2O5ZH 1XAKA 4P23A 3GSNB 2ZWNA 3QUML 4Q8BA 3WNOA 3HRZB 1WICA 2HSIA 4R0LA 3FUKA 1U33A 1ZLVH 2IGTA 1M6UA 3MXWL 3OZLA 3WDIA 2ICCA 3DTDA 4E36A 5BRZA 1A9EA 4KDWA 4NP4H 1XXFC 4Y2OB 2CLZA 2IG2L 1CT8B 3QUKB 5T1LD 4Y7OC 3VXUA 5GS2D 3DO3A 2ICWB 2W38A 1E6OL 3RNQB 4Y4FA 3GO1H 4O5LL 1OPGL 4JM0A 3D85B 3T71A 5KSBA 1URLA 3UAFA 2AJ3A 4R4FL 2CBMA 2YLHA 4GSDH 5KVDE 4AG4L 4QHUA 1J8HA 2X6CA 1S8DA 4YPGA 1S2EA 2GFBB 1RPQA 4LIQH 2X4SB 4X6FB 1NCCH 3ULVL 1U8JB 3QS3A 3TCTA 4XO9A 4AQAA 3IGFA 5DVKA 2NW2B 5D6CA 5IB5A 1YEGL 3QUGA 5DUJA 1TTCA 2AMGA 4Y2DA 4PJCF 3QUZA 4P2QE 5E8EA 1FSKB 2CA3A 4Z7OE 4YE4H 1IEBB 1RLBA 4FKHA 5DCCA 3TONA 5C2BL 2AK1H 1X5YA 4PRPA 4MNGE 3ASNB 2J73A 2HLAB 4JX0A 2ZSWB 3DBSA 4GW5A 5I8CB 4MVBC 2KMWA 3H4HA 4IHBA 4KQ4H 4NO0B 1CS6A 4K4KA 1BREA 1WBYA 1DBKL 5CF3A 5MP6L 4LEOA 2LAGB 3NJLA 5E24E 4NQDD 3QUMA 4AYSA 4O2FA 3GMQA 3N1QC 4QRQB 1S7RA 4UUJB 4LEBA 5GS0D 3ZYOA 2E6QA 4PGEB 3QIUA 4ZPVB 2J3SA 1ROWA 4ALAC 3OKYA 2EDYA 1T89A 3UCRA 2PNDA 3CZLA 1GGCH 3QEUB 4WHTA 1ICTA 2F8IA 4MFHA 4YSPA 4OV5B 2XTSA 3V9EA 3BXNB 3LQAC 1QBMH 4M3KB 4XCCL 1NOLA 5LBGA 4RFOL 3OJ2C 3QCTL 4GUCA 5CM1A 4JHAH 4ZXBC 2QVKA 1LEGA 1ZHBA 2JKLA 3HLAA 1FE8H 4WI0B 5DJ8A 5K39B 1J9SA 1C1EL 1XGTB 4WFFD 1AGBA 5E7FA 2YKKA 2H4EA 4F5CA 2B1OA 4HKBB 3QIBB 3C8KA 4LCIL 5L2KA 3MFFB 4ODVH 1XSJA 1MREH 5GGTL 4D9QE 1YVLA 3UP6A 5AALA 2OR9H 5E94B 2RFXB 2A74A 4S0SD 4IGBB 5BZWA 2H1LM 4OQTL 3V7AG 4XAKD 4ZSOA 4A66A 5HDBF 3REWB 5GRWA 3QDGD 2ICEA 2FWLB 2XA3A 1WCQA 1SYVA 2JK5B 3D39D 4HJJL 4H7VA 4IBLT 3FRUA 4HG4K 1AQ8A 1S7TA 4FF9A 4HS8H 5KVDL 2WZ0A 4RDQG 3GSRB 5LO7A 3X3GL 4KZDH 2NY6D 3GHEH 3MO1B 4MXVF 4OVVA 2Y07H 1MAJA 2A9BA 3B2XA 2R69H 1AXTH 4IIZA 4NCDA 5CINH 3ORJA 1AKPA 4EIZC 4QCIB 3NFPA 4JAMA 4XMZA 3BPLC 4P46B 1BQRA 3RNQA 2DJUA 4JY6B 3AG1B 4U0QB 1FZMA 1SQ2N 4PJDF 3D5OF 4XHJD 4XHQA 1LP9B 2RH0A 4KU1A 3VWJC 1O9WA 3L3IA 5AENA 1CWVA 2Y1YA 4IGBD 4IOSA 2D31A 4DUWA 4IRSC 2J2ZB 4WW1A 5GPRA 3O6LH 1PZBA 3QXDB 4F58H 4TTGA 1GGYA 1XGPA 2NXYB 5JHLL 3JWOH 1ACYH 3VX1A 5K33A 3SODB 2OJZL 3WKQA 2IMMA 5L7XL 3DYMA 3L5WA 5HBBA 2XFXB 5ICUA 2GEQA 3P73A 1ADQA 3DPBB 5E2WH 5IEKA 1SM3H 1V7ML 2Z4QB 5I8OL 2VQUA 1I8AA 3RVWD 2RR3A 5EZLB 1NGZA 2CDFB 1NLBH 3JWDC 5IW6B 2XBDA 3R4DA 2AEQH 4FS0A 2W65B 1SY6A 2ADIA 3B7TA 1LWHA 4EXPX 1B2WL 2Q2LA 1U8OA 5CD3B 2WJ7A 4MXWH 3H53A 4WJ5B 4BSVB 3FKUS 3ECBB 3UZEA 1J1PL 3P9MB 4LPUA 2AXFB 4NQXB 3U79A 1XH1A 2XFGB 4QTFA 1OIOA 2R7EB 1DUZA 5I18H 2ID5A 5EV7A 4G8GB 2HVKA 4MDIB 2LHAA 5CP3H 3NIGE 4HP5A 5HYEA 3U9PH 5I1AA 4OI8A 2ITFA 2JELH 3QFDB 2EE3A 1Y1UA 5IB3A 1JPFA 4TRPL 5KSUA 1I8UA 2QQLL 2WTPA 5KANG 2R56H 1BIIA 5E8NB 4X99A 5D1ZD 3SKMA 5T1DL 1ZXKA 2HTKC 3KPOA 1AC6A 4X8CA 1JZ2A 3TIDB 4U6VH 2GJPA 4XTRC 3CSGA 4XOEA 5DK0B 4ZX4A 2R23A 1JZDC 5ICXA 3NEXA 4RMSA 2Y7MA 3AZUA 1BAGA 3VO0A 1T1YA 1PKQE 2WVVA 4OFIA 5SX4H 2NY6C 1G7MA 3VW3H 5LNDA 1LO5A 2NLJA 5BOJA 1J9CT 3PP3H 1C5CH 3S8FB 3C5SB 4L9LC 4DP4X 2OMVA 2DWSA 3ECQA 2ZOKA 1IM3A 5BV7L 4W9DC 3BGFC 5IJBC 1W0YT 2CHXA 4MAYD 4GBXB 3CZGA 4RDQF 5F96H 4DGYH 5D1ZI 4HDIB 4M7JH 2JF1A 1MSPA 1G5GA 1U8HB 2EIMB 4FJZA 2YFNA 3RVTD 4DKEH 5L0QB 3H6JA 2WSDA 3FU8A 1JV2A 1DSFH 3JSSA 5F6IB 2WTOA 1EEUA 3LZQA 5LUMA 2VC2B 4UT7H 1C12A 2X89D 5ADPH 1T5WA 5FHAH 4IJ3C 3GBNL 3NABL 1SYSB 2DQJL 3TJEL 4GO9A 3S88H 4ICXA 4ONFL 2NZ9D 4DEPB 3C5SA 1SEBA 3AROA 3E7JA 4P48A 1KGWA 4L5FL 2WLLA 2VN6A 3HZYB 3QEQE 4Y1AB 1M7UA 2ENJA 2UZYB 3N5AA 3LZFH 1NUDA 2Z31B 4EUPB 5L6YH 4L3EB 1HE7A 3MCLH 2TSAA 4NWTH 4Q6IC 1IV8A 5IQNA 1ETJA 4X4XB 3H3PH 2R2BA 4DP8X 5GZNA 1V10A 1W72B 2UZIH 3L4UA 2DF3A 1K3ZA 4ZMOA 3NSCA 1ET7A 3MLZL 3SZ6A 1EAPA 2NY2B 2CPCA 5G5DA 3QFJA 2BY2A 4KVNH 2NQ3A 4L3EA 5F8RC 5DHDA 5ABZA 5DJCA 5CJBA 4N2NA 1EWHA 4LSRL 3CFKB 3RX5A 1BVNT 1KCRH 4CADB 2PPFA 3UABA 5C7XH 3QDGE 4X2UA 2ZOWA 2WLLB 2LT9A 4M48L 3CFNA 1F97A 1R3KA 4NT6B 5JQHC 3RPKA 3QPXL 1NEZB 1I1AB 4GKZB 3QR0A 1DDHB 1NOFA 1HDMB 3I75A 5DFVC 2O5XL 4HH9B 1F3JB 2AXFA 1RUQL 3LHAA 1DJWA 4NQXA 3L3KB 3H54A 2F58H 4OIBA 2X2UA 4YHPA 1U91B 2B5IB 4ZAKA 4QXWA 4KUCD 2PPCA 4GP4B 4YHOL 1RUAH 3CN1A 4KTGA 2HUHA 3MV01 4RNRB 3WXWH 5CD3A 2R0KL 3PXLA 4BZ1A 2NNAB 1Q94A 2WQ8A 2R4RL 4OW6A 3OKMA 1IGJA 2IPUK 3S8WA 4JFED 4JY5H 3OMIB 1NDGB 4GBXA 1J18A 3SB3A 3T6ZA 2NY0B 3FOLB 1G9HA 4JO2H 3I3BA 4OM1L 4HMCA 2NPLX 3PAUA 1L4IA 1UJ3C 1PQZA 3BESR 4S1SH 2WZ5A 4NQSA 3L3OB 3ARFD 1OY3B 1DSYA 4QRFA 5PAZA 2H9GB 3BUPA 4PJ9C 5C07A 4JANB 4XVUC 4B95C 2HMID 3JYBA 4QJ4B 4I89A 1TTBA 3NG5A 5F7FA 2X89A 5DHMC 1B90A 2J4WH 4Y9GA 2EIEA 3KJ6H 4OGZA 5HGBB 2PW1B 2Z7YA 5BV7C 3UIYA 3QG6B 5IB3B 2YEZA 1WVZA 4PJIA 3OR6A 5KSUB 1CD8A 1HHHB 4WGWB 3H4FA 4R5TA 4L29B 3POCA 1R24B 5TE7H 4EDWL 4RISL 3HW7A 4J4PC 1F5WA 2FAUA 2F54A 5FWRA 4ZNEE 3OVUB 3CSYA 5E6IA 4LCWA 3ARGB 3Q2VA 1KPRB 3P3SA 2ZOLA 3EFFA 2VW6A 4ACPA 1MF2H 3EFDL 4RETB 5I1IL 5EU4B 3PXHA 4DCQA 1A7PL 1IAIL 3TNNB 2WYZA 2XCMC 5BZWB 2XG4A 3CC1A 1JNLH 1Z9SB 2ILLA 3A4FA 1ZHLB 3W81A 4MZ2A 1HX0A 4QHNA 3JZYA 4HIQA 4DT2A 4NO3A 2ARJQ 4W68A 1NCOA 4OVUA 3A6CH 3GKWL 3I9IA 1Z3GH 5FYLH 3S36X 4X7TB 5MEQB 4GG6F 1TTAA 2EEBA 4F2MB 4NENA 1ZA3A 4KY2A 3P73B 3L5WB 1X4XA 1EERB 5ABAA 2W9LA 2QZ5A 4NPYA 5JTWA 3IFNH 4YK4B 5F1OB 1W6WA 3KXFD 2CRMA 1IEHA 1A8JH 1DZBA 3N1PC 4PJGB 3QPKA 3M46A 1Z3RA 4DGIH 1S9YB 2H0FA 3PWPE 3QXDA 1MLBA 4YE0A 3W9DB 5TTRA 1XX9C 3P30H 2CKBA 1UGKA 2C9AA 4TTDD 1W80A 1F4HA 2VIRB 3L1GA 4XE5B 4PMFA 4XMTA 4QRQA 1E6JH 4FQJH 5T1KA 4Y5YC 4K23L 4G9FB 5GGVY 4AX3A 2A73B 2EO9A 1GXEA 3QT2A 3RWFA 4K5MA 5FV1L 3CLEH 4W9EC 4KGJA 2N56A 1KIQB 3SSGA 1F02I 1NGXB 2GEEA 3TCLB 1GJUA 3T0EA 4PQXA 2XTJB 2BVEA 4OJEH 2E56A 2Z8SA 2WBJB 2PWEA 5F1SA 4F15B 2OYLA 4P2OA 2A74B 3CSBA 4PRPE 4YQXH 1H0DB 3IS0X 4OLYL 4LCCA 5SWSA 1V5JA 3CIQA 3MNWA 4AMKL 5CJXA 4GQQA 4DP2X 5IFHH 4YHLL 3FUNA 1YYML 1M1XA 4KI5F 5LQBH 2B77A 5HHPB 1B4JL 2Y3NA 3UX9B 4WDIB 3TN0A 3ROLB 4MD5A 2QQKH 1S8DB 1A6TB 2AJXH 4P04A 2FYYA 1FDLL 4HJ1A 2ZKHL 1DVFD 3QCVH 4JM2B 1U0QA 1U41A 2WGNB 4KROC 2BINA 2OJZH 3MLVH 3CHXA 2NSMA 2IFGA 2EICA 3DIFA 4WAFA 4WSKA 5B7FA 3VXMD 3ZE0F 2O6CA 4JQXC 2DMKA 2JXMB 2AQTA 5ELIA 5FOBA 1MHPL 3OKOB 5DHXB 3T0BA 1BBJA 4AYFB 4NCC1 2ZF9A 1TQCB 2MJWA 5E6IC 1HT6A 2IFFH 3FN3A 1TU2B 3SGEI 3TBWB 3GMMB 2UWEA 5DQJA 4RWHA 1ZGLP 1E9OB 3K72A 2X1QA 1ZKAA 4TUOB 3SDXE 1TZGH 1T0NB 3SQRA 4R0LB 2D7OA 2WWMD 4EZJA 3UTPD 4ZDHA 4LEOB 4DP7X 1CZ8H 3ATFA 3OLIA 3H7LA 2IOOA 4O58H 5GGSA 3DV4B 5LGJB 2XWXA 1T2QL 2EDXA 2WCPA 4WJKB 2X4QA 4R7XA 4Y7MA 3BSZH 2VR7A 4DP5X 5KTEH 4HOZA 3BP4B 3S97C 3RHWF 1NBYB 3D30A 3HPLA 3D6GA 4K8RC 1J05B 4U6XA 1HH9A 2NR6A 1CDUA 3I85A 4RGOL 1V7MH 1CVSC 5BS0D 2P48B 1MHPH 1BFVL 4W70A 2AZUA 2DM2A 3PFUA 4YHIB 5AW1B 1OARL 1MREL 3L9BA 2CPUA 5GGTH 1PD1A 2L7QA 2P8LA 4MXQC 4OF3A 2ICEC 3R0MA 1R9FA 3MBED 1RH8A 4FG0A 2N1KA 3OWEA 2ZJSL 1XIWA 4EI6B 3DV6A 4GQRA 5KSBB 2HKFL 4M1CC 5TK4A 3DTUB 5AUMA 1A7BA 1XH3A 3SBRA 3T8XA 3D4GA 2EH8L 3TEUA 4YHNB 1INEL 4ZFOL 4IRJC 3F6LA 5DD0L 1I1FA 1YMHA 3SE8H 2BDNL 2PO6D 5LBSL 3NPZB 4ONGL 2ZG3A 1AGCB 2D2CC 4FYTA 1IM3D 1NCWL 4TVPD 4F80A 5I19H 2XKNA 1SJMA 1P4BL 2OW7A 4F8QA 3QDMD 4MB1A 4AGPA 4ESKA 4HXAH 3V6OC 1JE6A 2G3XA 2R69L 4IMLB 4WLCA 2C4XA 2YQGA 1RUPH 3CDYA 2B9AA 4TF4A 4LDCA 3O8XB 5T5FL 3KLAA 1AD9B 4GG8B 3H3KA 3NRFA 4N8UA 2C26A 1T6VN 2G3NA 3MJ8A 3V6FB 5IJDC 1KPUA 4P9HH 3QCUH 2OCJA 2J44A 5LCVA 2GJ6E 2IANE 2NUPB 2BOCB 2ZXAA 3FDWA 3IXAA 4OT1H 3UBGA 2BSSA 3UAEA 1UKSA 2GSIA 3SGKC 4BXSV 3VVVA 4NZ8A 3OKEB 4ZMYA 3WS3B 1E3ZA 2AKRB 2Z0BA 2Q8BH 4QOKA 5E6ID 4R90L 1CGWA 1VJSA 3TNMB 5JPMA 1S7VA 2ZUTA 4N20A 3PIQB 5DFTA 5L4JA 4U05A 3KHOA 3V0JA 4DQOL 3SJVE 2YSTA 2DQDH 1AMYA 1EGJH 1JYVA 3Q6FA 3EGDA 4JLRB 5AZEL 3O8XD 2VM4A 4Y2DC 1T04B 4MCZB 4N2AA 3AMLA 2IADB 3B2MA 3CH1A 1WAAE 1AH1A 3WIAA 2ERJB 3O4LD 3RY6A 1BD2E 3EH5B 4FD0A 3FQWB 1DVQA 2SODB 4LPCA 4TNWK 4QRRD 4H8HA 1F8TH 2OMZB 2OMUB 5F3BA 3TA3B 3TBSB 1CFSB 4I0PD 1FH5L 2DQCL 4NERA 4JFYA 4BBWA 3CZKA 1MWAL 1JGEA 3VI3E 2GABA 1JXDA 1KXTB 2ADYA 1SLWA 1T1ZA 1X5LA 3H55A 4PJFB 2VQ1A 3VFRA 2WO3B 4TUKL 3ZDXE 3DSFL 3OLGA 1R47A 4H4NA 3CFUA 3E6HA 1KLGA 1OCOB 2F68X 4PHZA 1PZ2A 1BLNA 3TWCH 1N6UA 3AY4C 3MOAH 5AUMB 3PP4L 5DVOA 1LMIA 1QSEE 1NH6A 1YG9A 4BRJA 5I2IA 3VD4A 5TDOA 1HH6B 3MYJA 3KYKL 5EIIB 4L9DA 2APWA 3CE1A 3O4LB 4C8XA 4UQEA 1JPSH 2OX5A 2P5WE 2YGVA 3BKYL 5AZ2H 5JA9A 3BRFA 1F4AA 4JFEE 1MCIA 3RJOA 5IIEA 1A8ZA 3L2LA 4Y9FA 2BS71 1A7QH 4XVJH 3IJHA 1UZGA 2VISA 4LP5A 3QIWB 3FT3A 3UAAA 3VD1A 3MJ6A 1L7IH 2EDOA 2JI1A 2VDML 4O5LH 2DMCA 5AOZA 1E4KC 4P23D 3VNZA 1FVCA 1NPNA 1TJIL 4HUXA 4U6HA 2JNZA 3VFMB 1HU8A 1HL4A 3LZFL 2WYHA 4BINA 1D2OA 5DMKA 3QUYB 2BFGA 1AOZA 2PTUA 4AQEA 4M6OH 1ZA6A 3NTCL 4PTTB 5GS0C 3SY0A 2IDTA 3HB3B 5MEOA 3ETBJ 3GJFA 4WNJA 4NHCL 1TQSA 5AVQB 4TULL 3HI6L 1BYNA 4W9FC 5FHBL 5FLVA 1ZVSA 1KGIA 1PY4A 3FBKA 1ZMYA 3MNVA 3PNWB 4FQCL 4M5YH 3W0WA 1OAUH 3BUYA 1DFBH 4OZFH 4XVTL 2UWEF 4NQDB 5AL0A 3HEIB 1Z7JA 4L4VB 4F91B 1QATA 4YE4L 1MCPL 1S78D 3BVUA 3RWGA 2VABA 2ITCB 1T7WA 4PRHD 2ESVB 5DRWA 3LQAL 3OPZH 1CFNB 1MVUA 3QPXH 3UC0L 1MJ7H 1ZHNB 3B34A 3CN4A 3TXAA 4U6YA 2IQAA 4TSAL 4YH6A 1NMAL 3FPYA 3GRGA 3L4YA 4LDOB 4NXSA 4NQVB 3P0VH 4K3JL 2VH5H 2R4SL 1U58A 2VLKE 1U3HC 3SGDI 3WEXA 4BFIB 5BOZG 3MFGB 1KJVA 4FZEH 4BV1A 2FQEA 4JPQA 1EVTC 3JZ7A 1BWMA 4AV5A 1S5IH 2H0PA 5DDHA 3CX2A 4MQXC 1HS6A 1QLRA 2BDNH 2EKSB 3CMOL 5H94B 5IWLA 3PS6A 3DHUA 1FH2A 1E4WH 4U3SA 3TBVB 2X6VA 4MDJB 1SOSA 2EAEA 3EYSH 3PPSA 1E4XH 3HHMA 5AW3B 3I6LD 3VH8A 3H42H 2PCYA 2YD1A 1KZQA 3EGSA 4LSTH 4AT6B 3RI5K 5J7CC 4KMTL 2R56L 3G9AB 3D12B 4RQQB 1QLEL 1WAPA 3SDCD 3UTSA 4ZUWA 4YX2H 2K7PA 2DKSA 3NJHA 4ODHH 2HTLD 2PXYD 4ZODA 2BHYA 4EXKA 5ITFA 1QFWH 3V6OA 3V4VL 4TUOA 3VQ2C 5JQIB 2MTPA 32C2A 1K8IA 3OKDA 4KJQD 5B22A 1NFIB 4FFZL 3QZWG 4G5AA 5GIRA 2F53D 5MEND 2BY3A 4RWYL 1X9QA 5ETUA 2D4FA 2KZ1B 1RSYA 1X5KA 3DK0A 3V4UH 4Z3GA 1VCAA 2ENPA 2OFQA 3DUUA 3Q1EA 4YSRA 2EE2A 4ZS6D 1IAKA 3ARDD 1QRNA 3FCBA 2BSTB 4GS7C 1WC7A 4OCXH 4ZMXA 4HF5H 4HBCL 1AJ7L 3GUFA 4M4PA 1KTCA 4W93A 5E0FA 1T0MA 1A3LL 3AQZA 4TUUA 1ZV2A 1FZKB 3IKCA 2K6WA 4JFPA 4LSTL 5DHYA 3S35L 2OTUA 1CIDA 1L6PA 3SE9H 1I8IB 1I7RA 4KDTA 5GS1C 3GWJA 4FADA 4NENB 1FWXA 2BVQB 3L17A 4I48A 3F64A 5F3FA 1KLFB 4WUUA 1YY8B 3RTQA 3VAEA 4ONHB 4XB3A 4AEHH 5KYYA 5KYYB 1V7NH 4MXVE 1TQTA 5E2UH 1S5IL 3K4DA 5CEZD 3I02B 1D3CA 2FUQA 4AKPA 2WOBA 3J27A 2OTWA 1QFWI 4Y5XC 3VD3A 2PWHA 4L1BA 4OFVA 2XXCB 1CDCA 2ED7A 3N1GC 3ZQXA 3BIAX 1TNMA 2CM6A 2WKOF 2BOBA 5CR8A 4AQ1A 1ZK5A 4GKLA 4HKZA 4LF3A 5D8JH 3U6RB 1UA6H 3NCFB 3ILQD 1H9DA 4HJ0D 3AY2A 3DUUB 1T1WA 2MCMA 2J8UE 1U95B 2A5UA 2QELA 3OR6B 1NLDL 2HT4D 3PWJB 1M71A 1WA0X 2VIRA 4AGNA 3VGGA 5C86A 1UZ6F 2GJJA 3BFOA 2X3CA 3JBG7 1AOHA 2WIIA 1JF1B 5K9KB 2XX0A 3G5ZB 1LE5B 1XGRB 4QTIH 2KZWA 4WK0B 2NR6D 4M6OL 3IMRA 3SPJA 4IBWA 4PW9A 4XO3A 2WM0A 3VUAA 2W0FB 3GI9L 5EMYA 4UT9A 1G7LB 1LHZA 1T03L 3U6RA 2DPKA 3BVVA 1TYJA 3IDGA 3O3DB 32C2B 2FR4B 4K2UH 4Q6IB 1LEKB 3NK4A 2X9WA 4XOCA 4UQ3B 3QJTB 4X6BB 3V95A 4NO3B 1T20B 3DOSA 1TOXA 4HZ1A 3BKJL 2MPAL 4LO9A 1O0VA 1QZNA 4H1LA 4ODUB 2HVJB 5IQ7H 1SJEB 3O3EB 4QRRE 3DVNB 5D2NB 4UB0L 3QUXD 1V3KA 3IPEA 1OCWL 4AJVA 3UBHA 3IWUA 3NJMA 4FXKA 4PVNA 2EDQA 2ZCHL 2QPEB 4YHPB 4ZAKB 4BYHA 1XH0A 1EV2E 1NAML 4I3GA 5ECGA 4XMXA 1OAXH 3NA9L 3DX7B 1IC5L 3PP3K 3QJZA 1Z3GL 9PCYA 3ZDZB 5EOQH 2B2XH 2UY7B 4Y89A 4FCAA 1QG3A 1QHOA 3LIUA 4PJDA 3H9SD 4D8PA 2WXFA 5IR1B 3VTAA 1AP2B 5T1JA 3P9WB 2Z7UA 5D7SL 1C16A 4G1EA 4PV8B 5GHWH 1UJ3A 3G08A 1XBRA 5L4IA 4XVSL 2X1WL 4UOJA 2YRZA 4JFVA 5IV2B 5EU6B 3ZDYF 4GB9A 1CFVH 4LVOC 2O6DA 3F7PC 4PJ8D 3GIVB 3H56A 5BUGA 5JXED 3ABGA 1CI5A 4BEIA 3SDYH 1IBGH 2F5BL 1VCBC 2Z7WA 2C9VA 5TE4L 3FF7A 4P2QB 1B88A 2WHVA 2DEYX 3FTYA 4QRSA 4UIKH 4WTXA 3BN3B 4A2DA 1A7NH 4MWFA 4N90D 3O0RH 4DAGL 1NGYA 3R19A 1ULVA 2O6PA 1MXGA 1MCCA 3Q3GA 4BFOA 1MKFA 3EOAA 2JB6A 2K8QA 3PJSA 4PTTA 1KJMA 3BVTA 2ITDB 3ARBA 2E59A 2OK0L 1A1OB 2Q6WA 3THML 5JW5A 1KPVB 4M4RB 1OD7A 1M2VB 4XN8A 4ZX5A 4FP8H 4WU7B 4IYKA 3CFBB 3L4VA 5EZOH 3MBXL 3VFNA 5CGYD 5J6SA 2EP6A 4BSWB 4CNIB 3KH3A 2RGSA 2AQRA 2ZXCA 4K7FA 4F27A 1YPZB 3ULAB 4MJHA 4PJ8B 4EE2A 2X4OA 5D1QD 5JXAH 3N85L 4FXGA 1WDAA 4UTAL 4MAZA 4YBQD 5D5MB 4CSTA 3QDMB 4BHUI 1K85A 3GIZL 4OLWH 5AVSB 4Y4KD 4DKEL 1BJ8A 4PM1A 2WZ6A 5GZOD 2WVVB 3DKHA 2AEOA 1SLVA 3OJVC 1NBQA 3B7YA 4FJYA 3BH9A 4S1RL 3LSOA 4IEFA 4FAAB 3QHZH 3OAUL 5FK9A 2IGFL 5IQLA 1NIBA 1A3RL 2CDEA 3UH8A 2R23B 2NXYC 2L3BA 4A6YH 3L4CA 4FKEA 4WV1B 5J13C 1AIFB 1OW0A 2WSKA 1A7RL 1COBA 4LGPB 3VFRB 1G84A 2BZ7A 4RSVA 3TZVB 4JKWA 3X12A 2OXHB 3CGTA 3EGXB 3FF8A 4WTZG 3CH1B 3MV7D 3BYYA 2VRAA 2PP7A 3D05A 5HSFA 4NWTL 3UBXG 4OFQA 1CLVA 2X70B 4XODA 4UYPA 4EI5A 5CNHA 2V33A 1L3WA 3KD4A 2YAFA 3HNVH 4URKA 1PGRB 5EO0A 3LXUX 2IG2H 4ZT1A 1UYWH 4BFGA 4AEHL 4LIQE 2ORBH 5A43C 3CAFA 4OLVL 3F83A 1KN4L 3VB9A 3I2CL 4GI9A 3KDPB 1YJDH 4JDTL 5TDOB 4N1HB 4DN3L 5AKSA 2Y1ZA 1HWHB 2VUKA 3BEVB 4HEME 4AEIL 1NEUA 3WO3B 2CBQA 4HJUA 5IWLC 3LEVH 5KYNA 5IK3B 1CYWA 3HUJA 1XAUA 3RAJH 5D7JC 4HX1B 2ENYA 3BQUD 3GBNH 3V4VH 4QOKB 1LO0H 5ANMB 2FX9L 3VWKD 1AS6A 1MJUL 2XIBA 3BC9A 3BPCB 4JZNA 1TJHL 3HZKA 4GG8A 4N5ED 1EZSA 4BKLB 1CGVA 4RWYH 4X0NA 5AKVA 4C4BA 4AM0B 3AUVA 4YMPA 1LTXA 3N9GH 2R29H 4CL7A 2E5EA 3B5TA 4ILDA 3CZJA 2X9ZA 2E7LA 5B7MA 4FYRA 3ULVE 4QRAA 4FXKC 1HTYA 2OXGA 1FL6A 5DJDB 3ZPDA 2J6WA 5BZZA 1R4XA 2X28A 4YDJA 5JZ7C 2PPAA 4IW4C 5K9OB 3AFLA 3IDNA 3RKDD 1RK1B 4YX2L 1I1FB 1YMHB 4JCMA 3K1DA 1XF1A 2IPKB 4ZFFA 5D7JA 5E9DA 3WY3A 5SWZD 4P46A 4Q97A 4FQHA 4UINH 4BWTA 1BVZA 3G04A 3QUZC 5DJYB 5F7NC 1RU9L 4U1KB 3VGAB 2BNUB 2OW6A 3KWUA 3FQ4A 1XGUB