3NSDA

Silver bound to the multicopper oxidase cueo (untagged)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
487
structure length
462
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 129
structure length 462
sequence length 487
ec nomenclature
pdb deposition date 2010-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nsdA03
2H47C 1J9QA 2IWEA 4DP1X 4E9VA 4AX3A 4Q8BA 3S3BB 4BXVA 3HB3B 1A65A 5I6OA 1AZRA 4ZK8A 7PAZA 4FA7B 1BQRA 4HCFA 1L9PA 1HAUA 2Q5BA 2VW4A 1JVOA 4G7RB 1ZPUA 5B1JC 1KCBA 1ASPA 2WSDA 4YSUA 3CVBA 5E9NA 1CUOA 5PAZA 1GSKA 1AOZA 1NDTA 1FWXA 5B7FA 1X9UA 4X4KA 3V9EA 4NERA 2FTAA 3WNJA 5D4JA 3FQ2A 2YXVA 3MBWB 3JT2A 3NSCA 1F56A 4Q89A 3WIAA 4AKQA 3S8GB 2W8CA 3NP3A 1ZIBA 4F2EA 2PLTA 1A4AA 3FSAA 3X1GA 1IKOP 1MG3C 4G72B 4HCIA 1NICA 3FT0A 3UACA 1CYWA 4KNTA 2Y1AA 3NJLA 2YAPA 1OF0A 1QLEB 2VN3A 4G7SB 1TKWA 3X1FA 4YSQA 4DP4X 5B3SB 4A68A 2PP9A 5AKRA 2AFNA 5I6PA 4DP0X 4YSAA 5B1KA 1AG0A 3QJSB 1NIAA 3CDZB 5A7EA 2CAKA 3ABMB 3GYRA 5I6MA 3DKHA 4KNUA 3ZBMA 3OM3B 2CUAA 1ASQA 2AZAA 4DP5X 1RCYA 2P80A 1GY1A 1NINA 5EHFA 1T5KA 4GP5B 1RZQA 1AZBA 1BAWA 4DP2X 1OE1A 2X87A 4NAJA 1PZCA 2BP0B 3DIVA 2XXFA 2DWTA 2BW4A 1CYXA 4UANA 3UAEA 1NIEA 1IBYA 1AG6A 5IY5B 2JKWA 2VW6A 2FJSA 2HZHA 3PLYA 4M3HA 5TK2A 4W9ZA 2YAQA 5I6KA 1AZNA 2UXVA 3NJMA 1ET7A 1ETJA 3FU7A 1ET5A 2EINB 2XU9A 2H5UA 3FS9A 2DYRB 2IDSA 4KOCA 1NPNA 2J55A 2BWDA 1WS8A 2TSAA 3QJRB 1AR1B 2CJ3A 3NYKA 2FT7A 3QJTB 3FSVA 2FNWA 1KDJA 1QNIA 5I6NA 4M4RB 2TSBA 1BEXA 3BVDB 3PPSA 1ILSA 1HFUA 1FA4A 4DPBX 4DPCX 1ZDSA 3SBQA 4EF3A 4HZ1A 1V55B 2DV6A 2XWZA 4HHGA 2HRGA 2IDFA 4JHUA 4KOBA 3NJGA 3TASA 3IN0A 3FU9A 3X2QB 7PCYA 1SJMA 4E9TA 2DY2A 2EIMB 1L9QA 1NTDA 2H3XC 4WTQA 4DP8X 4BDVB 4F2FA 4L0PB 4FAAB 1PLCA 2GB2A 4DP7X 2EILB 2EIJB 2P80D 8PAZA 1M56B 2BP8A 1R1CA 3JTBA 2GSMB 1TEFA 2UXGA 5LDUA 1OCOB 2EIKB 4CSZA 1PZAA 3CVCA 3ZIYA 2IAAC 3X1BA 3QQXA 2IDTA 4K9JA 2PP8A 1NPJA 3EHBB 1XMEB 5I28A 3UABA 4YSDA 5B1AB 5AFAA 4AZUA 1SHXA 2YAFA 2BZ7A 2MRYA 3FQYA 4KO7A 6PAZA 2IH8A 3BQVA 3CDZA 5AZUA 1PAZA 1IC0A 2VSMB 4KO6A 3S8FB 4TXVB 9PCYA 3ABLB 3FQ1A 2W88A 2XV3A 4YSCA 4N4YB 4E9SA 3SBPA 1PNDA 2RACA 1VLXA 4YVUA 2B3IA 1W8EA 3PCYA 3AZUA 1JERA 2XUWA 1EZLA 3U25A 2QDWA 3AG2B 3H4FA 1NIFA 2YAOA 4HHWA 1PLBA 2OV0A 2UXFA 3WNIA 1OOWA 2ZWNA 4GP8B 2GC4C 1N68A 1OE2A 3WKQA 1ADWA 1MG2C 3SQRA 1ZIAA 1NIBA 3NJJA 2VSKB 1ID2A 3T6VA 1WS7A 2CALA 2XV2A 3X1EA 2B08A 3QPKA 1JZEA 1AAJA 3PAZA 3FPYA 1PLAA 1BXVA 1DYZA 4HIPA 4KO9A 2PPEA 3KW7A 1AANA 1BYOA 3AG1B 4YSEA 1L9OA 3D12B 1ASOA 3AW5A 2FQFA 1JZJA 1BQ5A 3WG7B 1MZYA 2VMJA 3EH5B 4E9QA 5B7MA 1GS6X 2HRHA 2QPEB 5I5MA 2PPFA 4HALA 1J9RA 2YARA 5ANHA 3PXLA 4KNSA 2FQGA 2BP0A 1WA1X 3FU8A 5PCYA 1KV7A 2XYBA 1XB6A 3IBOA 3FSZA 2J5WA 4HCGA 2PCYA 1JVLA 1PY0A 4A2HA 4YSSA 3AG3B 2XLLA 1OE3A 3OQRA 2BHFA 2MTAA 1E30A 2I7OA 5TK4A 2PCFA 6PCYA 2BP8B 4ENZA 2A3TA 3EF4A 3KW8A 1M57B 4E9RA 1AZUA 3ASOB 1KCWA 2N0MA 3NSDA 2AVFA 5I5IA 1SHWA 3OD3A 1AACA 1SDDA 1HAWA 4DP6X 1CURA 1J5CA 1GYCA 1PZBA 1OCZB 1GR7A 2FQEA 4MFHA 4JKNA 1KBWA 2IDUA 5I26A 2HX9A 4A2DA 1E5YA 1CC3A 1I53A 1QHQA 2GHZA 1OCRB 1PF3A 2UX7A 3NJFA 4A2EA 4YSOA 3UADA 4F7KA 1AS7A 3UGEA 3PAUA 5D4IA 4CSPA 4NB7A 1MZZA 3MX0B 4AKOA 3NSFA 3GXUB 2QPDB 4G7QB 1UATA 4BDVA 1N70A 3G5WA 1JXGA 1J9SA 2PPDA 1KYAA 2DWSA 4YVNA 2R7EB 1AQ8A 1BQKA 2XX0A 3GDCA 1GY2A 1XB8A 2IWFA 2J56A 1WAEA 1BYPA 4N8UA 1ZV2A 2YAMA 1L9SA 1YLBB 1B3IA 2AZUA 1E65A 1JZHA 1SF3A 2HX8A 1URIA 3NP4A 4BXSV 3FYEB 3S3CB 2FWLB 2UXTA 4QKTA 4YL4A 1W6LA 2VW7A 4AI7A 2ZONA 2Y69B 4GXFA 1PMYA 3CZUB 4BWWA 2PPCA 2UX6A 2QDVA 2GIMA 1V10A 2OCCB 3OMAB 4BWTA 3ABKB 1SFHA 1L9TA 1X9RA 3SBRA 4A2GA 2ZOOA 2IWKA 1ZDQA 1M9WA 4WKXA 3DTUB 2E86A 1EHKB 3L45A 1A8ZA 3AY2A 1DZ0A 1L9RA 2DYSB 3T6WA 2XXGA 1JZFA 3IEAA 2XV0A 4YSPA 4KO5A 3V9CA 4BWUA 3CG8A 1NWPA 1SF5A 1SNRA 4E9XA 1E5ZA 3NJKA 2GC7C 2GI0A 1AZCA 2QT6A 3WKPA 2XVBA 3N55A 3TBBA 1JOIA 2WO2B 5B1BB 3ASNB 4JHVA 4E9YA 3IE9A 3T9WA 1KBVA 1KGYE 5B1JA 4A2FA 2ZXWB 4A66A 1GS8A 3AG4B 3FSWA 1BXAA 4A67A 4GY4A 2BWIA 2JFCA 3NJHA 3ZX1A 2VM4A 3FU7B 2Q9OA 2BW5A 3H4HA 1AIZA 3X1NA 4P5RA 2NRDA 3N2JA 3T71A 1TEGA 4G70B 4PAZA 2HXAA 3T6XA 2PP7A 2YQBA 2YXWA 1PCSA 5B7EA 1XB3A 5FC9A 1ET8A 1ILUA 1OV8A 2HLEB 1SFDA 1TU2A 1RKRA 2FT8A 2YAHA 3FYIB 4PCYA 3ABGA 3OMIB 2FT6A 4HAKA 3QJUB 4BK5C 1J5DA 2J57A 4QLWA 4AKPA 2AANA 3ZDWA 1AS6A 1GS7A 2HX7A 4DP9X 1NWOA 2WO3B 1FFTB 1JZGA 3NJNA 2BO0A 3S3DB 3H56A 2VM3A 1A4CA 2BZCA 1JXDA 1SDDB 5D4HA 1PNCA 3CVDA 3T6ZA 3WI9A 4DPAX 2I7SA 1WA0X 4UAHA 5I6LA 3TBCA 1KDIA 3EH3B 5F7AA 3PAVA 1A4BA 1IBZA 4GYBA 1NIDA 1JZIA 3QJVB 4GP4B 1RZPA 1WA2X 4G71B 1OCCB 3NSYA 2LLNA 3TU6A 4P5SA 3C75A 2FQDA 3ERXA 1BXUA 2OJ1A 2YAEA 5F7BA 1GW0A 2I85A 4RH4A 1MDAA 4UF7C 2PPAA 1A3ZA 2IDQA 3UAAA 4W1TA 1V54B 2IH9A 2CCWA 3RYMA 1W6WA 2GBAA 1AS8A 3HEIB 4YSRA 3NT0A 4YSTA 3EH4B 1J9TA 1NZRA 4E9WA 2JXMA 3FPXA 2R7EA 2XX1A 5I5JA 1IUZA 3TA4D 1JXFA 1E67A 3NJIA 3QJQB 3IN2A 2CBPA 3OMNB 2X88A
chains in the Genus database with same CATH superfamily
3HE6A 1GTNA 3MLVH 2KERA 3GUFA 3GSNB 3IU3A 4XNUL 4WVRA 4AX3A 3ULSB 1NFDA 1YEIH 3CLEL 3TJEH 4A7SA 5J6GA 3MU3A 4OT1H 3WLBB 2FZ3A 2XWTA 3EJJX 4Z8FH 3QQ3B 1PZ3A 3QYMA 1NFIA 1PFOA 1JVOA 2YZ8A 5E6YA 1D5MB 3KPPB 1LXMA 4OIAA 2V2WB 4H26B 2X44D 3LN4B 2XI9A 3C09B 1QR1B 1CUOA 4TVPE 1EO5A 4HDIA 1VJSA 3VYOA 5BJTA 4W9GC 1JPTH 1PD1A 1NDTA 1UWYA 1S9WB 2VNCA 4JZJA 3TBWB 3HI5H 5DQJA 3PRZA 4UOW1 3EBIA 2PWEA 4ZAKB 2VZUA 2DLFL 1H8NA 2PO6D 3LZLA 2WWNA 5ERWB 4ZUUB 1NC4D 1XHHA 2MPAL 4AYSA 2UVFA 3ULVH 4NRXB 1BDYA 1JWUA 1MFCH 4Z3TA 5LDSA 3MV11 2JJUA 4PV8A 4TL4A 4PTTB 3FZUD 1CT8A 1MHPL 3D5OF 3L5JA 5IKCA 1P4LA 4UB0L 4ZXBC 1GZQB 4G72B 3TVMC 3BSGA 5E6ID 3U4BH 4X8JB 4TQ8A 3QCTH 4N0FA 4PS3A 4XP9H 4HC1H 3RI5F 2ICWI 5DC9B 3X1FA 3NAAH 5DJAA 2EE6A 5E2WL 1YAZA 2R4SL 3SY6A 2EC9T 4BFGA 5DMIL 4XHJD 3GZKA 2JVUA 4TPRL 2J73A 4RRPG 5BMFL 2AEPH 3LS4L 3U9PL 4NIKB 3ATFA 3HNVL 3EOBA 3QCTL 3CXDH 1FYTE 4HWNA 1PCXA 1LILA 2ZNWA 3LKOB 4GUPA 3B83A 1QI4A 2CUAA 3ULUC 4CBZA 2VXSL 4QRRD 1EA9C 2P80A 3COOA 4NOBA 4DT2A 3UGXA 1N8ZB 1U8NB 4G9FA 2UWEB 4E2OA 1D5ZA 2X87A 1DJSA 4NAJA 3ROOA 2OMVA 3SGJA 3HNVH 3GSQA 3NH7H 4ZSOB 2WSKA 3N40F 4DN3H 2NZIA 4HKXA 2B20A 5I8KL 3LMJL 1I7ZB 5GRUL 3B2UC 3KM1A 4W9ZA 4F93B 3JV6A 4XMWA 1D5XB 3T3ME 1E2ZA 3LH8A 1CBJA 1T6BX 1F90L 2A99A 4N5EC 4ZUWB 4JX0A 4U49A 3PWNA 5KVGH 4L8SA 1MCPL 5KYUB 5KBDA 2QPFA 3GKZA 2BWDA 1SN2A 1EH9A 3MV7E 2DTML 1E8XA 3CQPA 3HKZA 3UMNA 4EIGB 4BFIA 4L3AA 2BDNH 4PRIA 1FBIL 4JPQA 3RTQC 4P2QE 3VO0A 1O7SA 1JN6B 2IH3A 4L8CA 4WNQA 1EWHA 1MRCH 2UZYB 3DYOA 4LU5H 5CGYD 2O93L 1F4YH 2JLPA 2RCSL 1IM3B 3DX2A 3FU9A 1QNZH 3TCLA 2KBGA 4D3CH 4MX7B 4JANB 3C6LC 2MKWA 3NPSB 3QB7C 5BUAA 1T7WA 5ESAB 1UM6L 2A4ZA 5DJ6A 3NZ8A 4K15A 4Y5XB 3MLWH 3MNZA 2BP8A 5IF0B 1DQKA 4XRCB 1LMIA 2XNAB 2MIZA 3GQFA 4H5SA 4UINL 3L1FA 1S7RA 3EYVA 4D3CL 1HT6A 1XTMA 4PGEA 5IVNA 4LCCB 2F5AH 3H54A 3RGBA 1T03L 4FQJH 4PV9A 2EAEA 3VMOA 4GUCA 1IAII 2V9TA 2ZOLA 5FYJH 4H8WC 2V37A 4U1SA 1EHLH 5B1AB 4AJ0A 4AQ1B 2C26A 2DJMA 1OLLA 2BZ7A 4IBQA 3LXCA 4OCLC 1KEML 4YE4L 4BZ2L 1VEMA 2FSEB 4KROD 2LTQB 4TXVB 1RZKH 4J1UA 4BKLB 4IKNA 1CN4A 3LQZB 1CLZL 5GRWA 3VX0A 1U8KB 2VZOA 3MRKB 4M9OA 2VXUH 3D4ZA 2QR0A 2ZCZA 1T6WA 3QO1A 4WUKL 4MS8D 3HC0A 4F9PA 3CFKB 1S9YA 1UXLA 3SDCD 2VJ0A 3FQNA 1PLBA 1U8MA 2ZWNA 4NKMA 3TO2B 4RSVA 3VGHA 4N28A 5CCJA 1ZANH 3UTPE 1ZIAA 4N1EA 4NFDA 2JE8A 3U82B 3WEXA 4MZ2A 3QCUH 2OMZB 1JI1A 2VAAA 4GXUM 5B8CB 4WO4D 2P48B 3FTYA 1TETL 4WAFA 2X1PA 3AQZA 1AAJA 2QJDA 5D1ZI 3W37A 1R3IH 1I9IH 1DQTA 4HFWB 5EF1A 1DYZA 1IB5A 3MUZ1 3BRFA 4HS6A 3HHRB 1JD7A 3GLAA 5ICXB 1JGDB 1HEHC 1SOQA 2WWKO 1KLFA 1RUKH 2E7MA 2WGXA 3C8KB 4EKJA 4S1QL 3EO0B 5ISZE 4ZFOL 3IGFA 3WNKA 1R3IL 1RVFH 1QRNA 5I5MA 3IAGC 3PP4L 2IVFC 4J4PD 4OF6A 4Q9BA 5CEZL 4JFQB 2QVTA 3DC0A 4NRYB 4CMHC 1U8HA 1EZVX 3DETD 3L4TA 4X4ZA 2X2UA 3DRTB 4P3DA 4DKEL 1RUKL 1OP9A 3ES6B 3VI3A 3U4AA 4XNUH 2NYKA 1AR1D 2PCXA 3Q01A 1MW2A 2C1OB 3K81A 4HHAB 4JG1H 1XCTB 4ABUA 1P1VA 1TQCC 1O6VA 1OHQA 2RBLA 2ZG3A 3GMRA 3P3TA 4HEMA 4MBRA 4RAHA 3FUIA 1XH0A 4Z7UE 5SV4A 4TN9A 2UY6B 2CHWA 4XNQA 2NQCA 4EI0A 2AHIA 1GGCL 3DOSA 1KCWA 5CMAA 2J8HA 3NSDA 4IRJD 3B2DC 3BT2H 3VWJD 3DVNB 3UJIH 4GFXA 3VGDA 3D2TA 2YA1A 4JG1L 1CK0H 3NEEA 4P5MB 3FKUS 4WFED 3D4CA 4AQAB 5C86A 4Y1TA 4ANVA 1QHOA 4DGYL 5J11C 3FQRA 4HV8B 1P84K 4ZODA 3UEQA 1TCMA 1FSKB 2HYMA 1QLEL 1E5YA 4B9KC 5LWYL 3BLBA 1L0YA 2AQNA 1E5UI 1P9MC 1XX9C 5GRVL 2JCWA 3MV9D 3QDJD 2DRUA 1U8PA 2X4PA 2FO1A 5IMOA 1CLOL 1SXNA 4LLDB 5IJCC 1UB6B 4HPOL 3KPRB 1AC0A 1YN7B 3ZZSA 1KJ2A 4JO2H 4EQ3A 2OSXA 4B95C 3RGVA 5H35A 4HBQA 1OEZW 2QGDA 1LO2L 1QEWB 4JY4A 4OVUA 5DI8B 4ICXA 2DIEA 3G5WA 4FKHA 1SLVA 4JQVA 3SCMD 4R0LA 1KYAA 2QQKL 2DWSA 3RA7L 4EIUA 2Q87A 2F58L 1T5WB 1TQCB 3HRPA 1ZGLP 3JQOB 3GIZL 2FJHB 2IWFA 3OG4B 4OZIE 2ZG1A 1FL3A 2ZX9A 4PJ9B 4Q6YA 1YLBB 4MHHG 1ZT7B 4P57A 3J07A 5FCSH 5AKVA 2GY7B 4AGOA 3JWDL 4YIQB 4ODTL 4YL4A 2JQMA 3T3PF 4LLQB 4P9MH 4WW2A 3SKOB 4ZDHA 2VN5A 3WE1A 2NOYA 5IQ9B 4FDWA 4PRHE 2PPCA 1XQ4A 4Z7UF 2UX6A 3G9VA 4PRHA 5KG9B 3ZSSA 1MJJB 2ESVD 3CIAA 4S1SH 3U0WH 2BSRA 1QW8A 3ABKB 5IJKC 3IFNH 3IFLL 4JPWL 4EOWH 1KIPA 5CFAA 2XQ0A 1JV5B 4WO4C 3S3PA 3P4OA 1VESA 4JM2A 2E86A 4HU8A 1IAOB 3OQ3B 1J18A 2TRYA 4LRNH 5EO0B 1WIUA 2F74B 2IWGA 4H2AA 1L9RA 3L95A 4XVJH 3NJVA 5KJRL 3P77A 4MNGB 1G6RL 4JKMA 1WO2A 4POUB 5LBSL 3AREB 1X3DA 4JRXD 4EBQL 2FZ3B 2FL5A 1L7IL 4Z7QB 1MAMH 3V9CA 1PIFA 2CO1A 4ZTPH 4MS8C 4F9LC 1R3JB 1SEQL 1KOAA 2YGQA 1ETA1 1SF5A 3UPCA 5DHMC 3TZVC 3BSZH 5F3HA 5J6HA 2R1YB 4UZSA 1FC2D 4IBZA 4MNQB 1D6VH 3TVMB 3T2PA 1DJIA 5E7BA 3MJ9L 5DYOB 4B60A 5KSAB 5B1BB 3WJLC 4JHVA 5AZ2L 3E6HA 3QUKB 3ZDYE 4F1SA 3U9UB 3PPEA 2MNJB 4KJWC 1FDLL 1OALA 2Q86A 4M48H 4ZAKA 4O2FB 2JLLA 2VJ8A 3MN8A 3MLUH 1VEPA 3OC8A 5SWSB 1BAFL 2HRPH 3O4OB 3FU7B 2XTJE 3H9HB 3MGTA 4OJCA 4PP2A 5EF0A 5CBEA 3UTOA 2Q7NA 3PWPA 1T7YA 4OM0H 4P5RA 4YDVB 1HNFA 2IFGA 4DQOL 5IMKA 5L0QB 4PAZA 1CFTB 3UPAA 1ICTA 4BELD 4JFOA 2I9TB 5KJ4A 3TBTA 1JMZA 4ZFZB 1K4DB 4MKMA 4A7TA 4NN7C 5HD8C 4HJUA 4JMNA 4PD4J 1VGEH 1LJMA 1G9EA 5TDNB 5BQ7A 1RKRA 1KIRB 2YAHA 3EGSB 4ONHB 2IIJA 2PABA 4ORZC 2J57A 5B3NA 4KKNA 4ODSH 3GO1H 1DFBL 5I18L 2R9HC 4LIQE 3ETSA 4LSRH 4X83A 3T0EA 4X4XA 2WZ6A 1NFDB 1CBVH 4HP5A 3EGXA 1KLUA 3H56A 5HYQA 1ZS8B 1OGAB 1SDDB 3PGCA 4UNUA 4YX2H 5I30L 3CVDA 1KYFA 5GGRA 3ZRFC 1J0ZA 2R59A 1CDIA 3R8BB 1CDUA 3ARBA 3FUJA 3EH3B 1NAMA 1TIUA 5AYUL 1VERA 5LUMA 5MEND 1I31A 1UENA 4UT9H 4AYFB 3NCMA 3TL5A 3CMOH 1HL9A 5DJZA 5L6YL 2E9GA 3FL7A 1S9WA 3GINA 2DQEH 3QC6X 1MFEL 2G9HA 1B0GA 4KVNH 3BP7B 1SOXA 1FG9C 5DLML 5I2IA 8FABB 4YXHH 4J8RA 4YR6A 4FI6A 1V54B 1CFSA 4GNKB 1XSIA 4K9EC 4M9PA 4N85A 5BXFA 5EF3A 3WNMA 4AYMC 1OY3B 2RHEA 3QJOA 3UYRL 4XCYA 3SOTA 3O6MH 3DDFA 4OQTA 4Y5XC 4OZGB 3LHPH 4YHYC 1E67A 3MA7B 3QJQB 4WW1B 2ROYA 2CNZA 3ESUF 2Q3AA 3V6BR 4J8QA 3ETBF 4F3FA 3D7PA 5DD5L 3MV9A 5JPNB 4OM1H 3TF4A 1ZTMA 3TN0C 5CP3H 3W9EA 2BIQA 4PJFA 1HZHH 3D25A 4OIIL 1G0XA 2C9PA 1MF2L 2WVVA 1MY5A 3FB7B 7PAZA 4LVOB 3U1SL 1E27A 4YFEA 1JPFB 2V8LA 4ETYA 3BIAX 5GS2D 1I9RL 1BA9A 2DI7A 2OMVB 2VLME 1HI6A 3D30A 4G7RB 4WJG3 2HFGL 3RB5A 1TSRA 4NC1E 1PKOA 3HNTL 4KK8D 4PWIA 3ZYOA 5DJYA 1KEGH 1YY9D 1E4XH 3UTTE 4X6CB 2J2ZA 4KY1H 3W1ZA 3X14B 4NERA 4Q4EA 2YJQA 4AQ1A 3ZYIA 3BH4A 1J8HA 1I1RA 2X89D 4JFDA 3NCYP 2EIZB 3MBWB 1AY1L 1CZ8L 4Z7OE 3LNIA 1F56A 2BNRE 4KFMA 3N43F 1IQWL 3D39E 3QWOB 1VACB 4LXFA 3TF7C 3LQZA 4HUVA 3OJVC 4K3JL 1GGBL 3JTSB 3NAAL 4BFIB 3K8LA 1LLAA 2VC2B 3QNXB 1QUNA 5DMIH 4A2MA 4FTVB 5F1KC 1AGFB 1L6PA 5E9DB 1JF1B 2VZ3A 4HXBH 1E40A 4KZ0A 4A68A 2A74B 4NO3B 4Z7VA 3U7WL 3II3A 2G3NA 2X1QA 1FP5A 4LSSH 4Y2LA 4TLSA 3SGDI 5DHVB 2X9XA 4JREC 4ZW7A 3P4NB 5DGRA 4GINA 4KVCH 2AGJH 4MX7A 5BCAA 3T2LA 3PQYD 5I1EH 1HHIB 2KLRA 3WNPA 1TJGH 4UTAL 1BAWA 2LVCA 2BP0B 2YRLA 3OXSA 1AHWB 2OJZH 3OXRA 3L9RB 5DJXA 1ZT1B 3GMLA 4ZAKD 4DZ8B 4H5SB 4UQ9A 3SKNB 2IEPA 4MZIA 1C1EH 5IY5B 1E6OL 5MEOA 3D48R 3FTUA 15C8H 3QYNA 4PJDE 5I75B 5E56A 2ICEC 4I9WE 1E9QA 3NEXA 3UP1A 3DX8B 3CLFH 3H3BC 3GMNB 1KB9J 1INQB 4IOSA 2IQ9H 4M7LH 4F91B 3PP3H 5MERA 4ZUSB 3EJZC 3M1OA 1IAIL 3QEGH 4LCYB 3MLSL 3BUPA 3MOAH 5I0VA 1RJCA 2D9QB 4PHXA 4P2RE 4DFHA 1IFRA 3BESR 3QJRB 4G1EA 1T66C 3MPCA 3FN9A 1KB5H 5KJRH 1CTOA 3QI9A 3SKMA 3V5KA 5DT1H 2VAJA 4ZOAA 1IEBB 1IBHA 2TSBA 4LQFH 4QHKJ 4R7DB 3T77B 5GRJH 5SWSD 4XN1A 1J1XL 4B9PA 2A9NL 4GRMB 3QDGE 4TKWA 1WRFA 4DPBX 3BSZL 1NGPH 3LY6A 4RLDA 3IDGB 3RL1A 4R0LC 1UT1A 3KR3H 3GM0A 2EECA 3WEXB 2GEEA 2J4WH 3N04A 4KTEL 2QL1A 3D33A 3DX9B 3TYGL 2VMEA 1PDKA 3FUEA 4PWGA 2H3XC 1JTTA 2J1XA 4HPYH 1J0JA 1ZKAA 1V3LA 1X6LA 1A6AA 3GRBA 5AW8B 1PG7L 2AS5M 5LN8A 3E1F1 1F4XL 4UT7L 4HISA 1R1CA 4PRPE 4JY5L 1LDSA 1E3XA 1T03H 3SSGA 1R5IA 3LN5B 3IJYB 4HWZA 4P3CH 3CE1A 5GRZA 2HCZX 3DXAA 4PJAA 2R0KL 5AVWB 3V4PL 2IAAC 4ZFFB 3GSRB 1QRNB 3I50L 3S37L 1K2DB 1Q1JH 2VDKB 1E28A 2UWEF 4BZ2H 1HHGB 5DJCA 3A6OA 1CG9B 2FHFA 2DD8H 4ODXB 3S5YA 1HXKA 3IF1A 2Z8VC 3VGEA 3ZE0E 4PP1D 4U6VL 3WFDH 1DLHB 4QRTB 1FFQA 4XCFH 1KXTA 5D7IA 4DERA 4I18C 3LKSA 4X5RA 4E9LA 1XEDA 1VLXA 2V5RA 2E5EA 3FFCB 1YYLL 5C7XL 1J1PL 1VADA 1XCTA 2AJXL 4K8RC 4WW2B 3SKOA 1JZ3A 5IQ9A 4UM9D 1NCOA 4EN3D 2K1MA 5I1GH 1U30A 2YAOA 2RMNA 2YD8A 2WXOA 1CR9H 1HE8A 3CXHK 4RWYH 1N68A 3QCUL 2CPCA 1UADC 1LE5B 3BYTA 3ALPA 3DVNA 2DZEA 4TSAL 3BGAA 3GZOA 1AO7E 1YYLH 4V1DD 4JQIA 2X4UA 2P8MA 3ZDXB 1ZGLA 3GRWL 2BCKB 4YUEL 4EZMA 2B0SL 1TNMA 2QFRA 2X4RB 4GW1B 2P5EA 1Q90A 5DD0L 4BFBD 4GQPH 4AH2B 1B4RA 3GMQB 1XGQA 3HUJE 2I5YH 4IEFB 1VF5C 1WE5A 1HEZB 1E3ZA 4P49A 2R23B 2H8PA 1OSYA 1UD2A 1AANA 1XF5B 2G3ZA 2PPEA 3GSXA 2XFXA 2QGBA 3HNSH 3N0AA 1Z3RA 2WLIA 4RA0C 1H3XA 5EO9B 4LSTL 2Q76B 1IGFL 4NN6B 4S2SB 2BVOA 1I85A 4NQXA 5CEZH 2BIMA 2WVSA 2J1YA 3PJSA 4L4TA 5H35B 1K6QH 2I5YL 5TDPA 4A7VA 5IIEA 5A3ID 5DYOA 2X9ZA 3E80A 4L9LC 5ANHA 2YBGA 2A4CA 3O8XB 5AVZB 4BUHA 4GBXB 1ZLWK 4KNSA 4QRPD 1S9VB 4K94L 1WA1X 3WUWA 4LHUD 5L8JB 2XTJD 1J1OL 1M4KA 3KPQB 4YHIA 4E41B 4EQ2A 3KVQA 4NJ9H 1YEJL 1JVLA 4M8QA 3WGUB 2CO7A 2DQUH 4P57B 4LKCB 3S5LG 4DOHE 2ENYA 1DSFH 4WI9A 4YZWA 5TK4A 3VQ2C 2P3YA 3L5IA 5L8LB 4JHWH 3TZVD 1E5CA 2DICA 2IANE 1SN0A 3IKKA 4ZS6D 5GGVY 3S8WA 1NBQA 4HF5L 7FABL 4PJBF 1CIUA 3QAZB 3MRRB 1MHPH 1ZSHA 4CU7A 3UP6A 3V10A 4WKZA 1J5CA 1G84A 1E4XL 1TENA 1GR7A 1A7QL 3OJ2C 5KBMA 1NL0L 2ZPKH 4PJIB 1IAOA 3ZE0B 1WC7B 2HX9A 3HE6B 1HX0A 1I9JL 3UIYA 3N40P 4WEMB 4AGNA 1U58B 2Y6TE 3HG4A 4OI9A 1NKRA 5LG6A 2BSBA 2PO6B 3ULSA 4Z7WF 3UGEA 5KZCD 5IB4A 3L3KB 1I85C 2GIXA 5AW1B 4KQ4H 1XEUA 4L3FA 4AZ8B 5C9JA 4CU8A 3AREC 3INUH 3CXHJ 4GSRA 5DTFB 3SY0B 2WZ5A 1BFSA 2DBLL 3F6IA 3ASWA 3F7VB 2MQ3A 2DTSA 1JUFB 4JGUA 1E6JL 1NLBL 2ADJB 3CDGA 3SDXA 3HZVB 3MROA 2BWQA 3QI9D 1AQ8A 5ALCL 5CLZA 4DVRH 4HDIB 5BJTB 1GMEA 5JPNC 1HWHB 2FEEL 4HK3J 1E42A 5SWSA 1ZLWH 4J8RB 1HXMA 3OZ9L 4G8GD 1T7XA 3BCDA 4CC0A 1F45A 1S3RA 5HGBB 4AI7A 4QHMA 4S1SL 5BV7C 2HTLC 4CGTA 2GHWB 4EI6B 1PG7W 1G1OA 4YBQD 4BWTA 3MUHL 1F8TL 2A6DB 1HCYA 4IS6A 1M7XA 2A9ML 4UT6H 4ADIA 1GOHA 3MV9B 5DJAB 1R5WB 2E0PA 5CEXA 3HZMB 3T8VA 4PJFB 3L45A 3D25B 4KXAA 2DYSB 5FKAB 1GYUA 3C9NB 5GS1C 1F8TH 2NUTB 1X5JA 5EUOE 4KUZL 4Y4HC 4NQSA 3Q13A 4QUOA 5DD1L 3X3FL 1PZ2A 4IRZH 1G43A 3NIGB 5ES4B 2EDJA 2VIRA 3OHXC 1KB5L 4HWEL 4XOAA 3V4VH 2AC0A 3N44B 2D0FA 5EUKA 2AJSL 2D7TL 2GJZA 2Z8SA 2OZ4H 5DZOA 3IYLW 2HJLB 3PWLB 1TTFA 3REVA 2EIBA 5KSVB 4X6CA 2J2ZB 1NCWL 4X7SL 4C4BA 1NGPL 2W07B 5B1JA 2G4GA 4JL1A 3PJLA 4MJID 3B8YA 5I76A 3FSWA 4AEHH 3GSOA 4PB9L 5CU9A 3BX7C 1HYSD 2O72A 4QT5A 1M7UA 1YEDA 4GH7B 1UWXH 4E42B 3EG9B 1PY4A 3GI9L 4XOBA 5F70A 1CFSB 2Z64C 1JZ8A 4X7SH 4BSVA 1OARL 4XP1L 3LKQA 5INCA 1XR8B 2JK5A 5C09D 3NFPB 3OAWA 2HLEB 2OXGB 4GKSB 4FTVE 1YQ2A 2FX7L 3SYOA 2RAMA 5E9DA 1RZFL 2FGWH 4HAKA 3GI9H 1SVZA 3O6FA 1T0NA 2FIRT 4PJGF 3HBQA 2W5PA 1SXBA 4OLUH 4DP9X 2R0ZH 3EBGA 3DJTA 4LSVH 4X6EA 4YHYB 3PWVB 2BO0A 1RZFH 1OXYA 4QHKI 1ZK9A 4JRXE 4TUJB 2WZ0A 4CJ0A 4F2ME 1JXDA 4FEIA 4F58H 3SDDD 2ZUQC 5HYSA 1ZT1A 2CPUA 2CWRA 2GJ6E 4UT9L 4AENA 5DJ8A 4DUWA 3D4GA 5JOPD 5IF0A 1YO4A 2XICA 1XIWC 2NNRA 3G3LA 3BO8B 3EYSH 3NN8B 1A9BB 2V9UA 4XRCA 5C1MB 5D1QD 2EXWC 4UTBA 2ZCLH 4IRJB 4XOCA 3C75A 2FQDA 3DUUA 1BXUA 3GPEA 4H8VA 4C83A 3RVXC 4ACTA 2V33A 3VD7A 4LEOA 3QJXA 4EAEA 3UPRB 1AGBA 4GO8A 1J05A 4P2OC 1R46A 3L7FA 3V5KB 2CHZA 3KYKH 4GBXD 5ABAA 3FF7A 4KV5F 2FSEA 4ZSOE 4IJ3C 4OKVA 4R7NA 3VXMD 3K4DA 1JGUH 1PS3A 5DRNB 3BEWA 4TUOA 5JOEA 2ARJA 2J1KA 1QATA 1EFXA 4JB9L 3K74B 5CJQL 3WJMA 3IAPA 5D8JL 3EDKA 1BVNP 4IM8A 2F54B 1FO0B 2IWEA 3A4EA 3CVHA 3HN5A 5JHDE 1JS4A 3GKWH 3FN0L 2APVA 3S3BB 1UG9A 2LW3A 4LLWB 3UTTD 5TTRA 1ZHNB 4ZMZA 5HJGA 2V9QA 3HC3L 3V6ZB 2F53D 5FW7A 1FIEA 5CBAA 1ZPUA 4KKAD 2VXVH 4FCAA 4DZ8A 2JI1A 4JR9H 1JFQL 1Y0LB 4JFFE 2L7JA 3HE6D 1WICA 5E6IA 1BMWA 4P46C 1AGCB 1RFDH 4OCWL 5SWQA 1C08B 4FJ6A 1Y07A 2F5BL 5C0ND 1U8OB 3WNJA 3JZYA 1UWGH 4N1CA 4AGLA 4JW3A 1W80A 4POZD 3ILQD 4RGMB 4ZUSA 1MNNA 3P0GB 3EYOB 1U8HB 1F41A 4U1JB 3QCVL 3SE8H 3F83A 3IRZA 3HOGA 4OZIF 2QQKH 1WEJL 1S5IL 4HLZG 3U2IA 5FYKU 4ZX6A 3BVNB 2LAAA 3EOAA 2VR7A 3WTTA 2WCSA 1G7LB 3QHZH 4HUKB 1BPVA 4GEJA 1YEHH 3AAZA 1LE5A 1QFOA 3CHXA 3QWRA 4PJCE 3A0OA 1VCBC 5EZLB 1NAKH 3ZBMA 4J4PC 2P9RA 5E4AA 3TWYA 3GMQA 1KV3A 4P5MA 4IEFA 4RA3A 3VXTB 4L0YA 3GK8H 4KPHH 1VDGA 4NC0B 2VDNB 3QNFA 3UG4A 3RFRA 4AOFA 2L7UA 3SKJL 3VXQA 1CYXA 4MJIA 3TS8A 5IWLA 2FX9H 5ICZB 5J4MA 4Z3EA 3K91A 4PLNC 3LRSB 3I2CL 3PJSB 4RGMC 2G60L 5F72S 4OTXH 4UOW0 1NFDE 4IBVA 4AM0B 3BLKA 3RWFB 2JJVA 3O8XA 4E68A 3FS9A 1N8OE 2DYRB 1LP9B 3U48A 1CG9A 1VFAB 12E8L 2F61A 2PTUA 4ODXA 3MRNB 1KC5L 5DC4B 1CFQA 3HG0A 3P3UA 4NQEA 4XPFH 1BJ1J 1ZHBB 5E9DD 2WLLA 1KXTB 1KPVB 3G5ZA 1IGCL 3CVHL 3KVDD 2MPVA 2Q7YB 1F1AA 1QFWM 4GSUA 4WCYH 3WXWH 1FQ9C 2FCBA 1UEYA 1RPQA 1SYVB 1K4CA 4UT9A 2XZAH 2OYLA 3FT4A 5DRWB 1N6VA 1BAFH 3PPSA 1OTTC 4GW5A 3UBGA 3N43B 4WF7A 3PGDA 1ZY9A 4AVIA 3G6AB 1EVTC 2HB0A 2HRGA 3PDDA 2ALWA 4HHGA 4OJYA 4WNJA 2X42A 3VFNB 5JTWA 5K9OB 2MSPA 1NDMB 4F7PB 4I3SH 4UQ2B 3PQYE 1IFHL 4JBSA 1RK0A 1HL4A 3RWJA 3GO1L 1DCLA 3DHMA 3JTBA 2DQIL 3P77B 4CC4C 1MFUA 4MCYB 4AL8C 5KYWB 4XZUB 1IMHC 1JRHL 2LFEA 1NEZA 1YJDL 3LPOA 4G9DA 3FTGA 1R3JA 4L4TB 4PUBH 4FG0A 5IIEB 1J0YA 1JUFA 4K71C 3FCGA 3H1ZA 3CDGB 4KMTH 5I28A 2FGWL 5F3HB 3V52H 4GBXA 4M7KL 4DUVA 2YAFA 5CZRA 3EOTH 5MEQB 1X4XA 6PAZA 2NSQA 4Q2ZB 1P5UA 1LD9B 1BREA 3KPQA 5EWIL 3QH3B 4HH9A 4WO4A 1D6EA 3ZDZE 3O8XC 3TT3L 1KTRL 4MJ6B 3T1FA 5KYNA 2B3IA 4JRYB 3DROB 1KTLA 1QHPA 3H7BB 4K9EL 3MJ8A 4X80H 4PP2B 1WIOA 4YBLC 3MODL 3PWPB 1J86A 4HHWA 5L7XH 4TVPD 2JB5H 3L5WB 2PW1B 4ODHL 3TBTB 3A4DA 4YE0A 3W11D 4AGMA 3ULVD 3RHWK 2IMNA 5BVPH 1S7XB 3CSBA 4WY7L 1KJ3H 2ATAA 3ZDYF 3TP4A 1M1XB 4N5ED 1CGWA 2WVTA 5I0YA 1I8MB 3X1EA 1DQML 2X38A 3QPKA 4BM7A 4U3XA 5JNYB 3AXLA 4HZAA 2PWDA 4ES8A 2W1NA 2AKRB 3TA3A 1O75A 1QTSA 2HSIA 3CFCH 2WP3O 1RMFL 4K71B 1L9OA 4GFTB 4ABQA 2VLRB 2V2XA 2JI3A 4YZFF 1BQ5A 4QRUA 3L3KA 4HQQH 1ZS8A 2IAMB 3BUIA 5GSRA 2F1EA 3QEHB 2Q6WB 1KXVC 5SWZB 4X0KB 1HYSC 1AP2B 1NMBH 5C0AA 2XWXA 5KVEL 1KBPA 1HCVA 2QPUA 4Y9EA 1O9ZA 4EIZC 3P02A 1U3HB 1KY6A 5DURB 4UV7H 4XN7A 3CQFA 2Q1EA 4M02A 2BSEA 2EDNA 4GI6A 2N59A 3RPIA 3G5XB 4NJ9L 2B1AH 2D2CC 2WBWB 4LSDA 3VI3E 4NZ8A 2L7EA 4KK5D 1DLFH 2ZJSL 4NLAA 3EG9A 3NZSA 4MCZA 3RWEA 1YMME 1KJMA 2BY3A 2PWGA 4FXTA 4I2XE 3WSQH 3ARDA 1YPZF 4ATTA 4JJHA 3HC3H 1UYWL 4N2HA 4Q6IA 3LKQB 3I3BA 5INCB 3LD8C 4ZXBD 4L29A 2A3TA 1M57B 2ZE0A 4UQAA 2KL6A 5MHSE 3D8MA 4Z9KB 5I8CA 5T8IA 4AJYV 5I5IA 4NQCE 2ITCB 1OB1B 1JPST 5HGAA 3PL6D 4MYWB 4ACPA 1NL0H 2ADGB 1OWRM 1A7RL 2MOQA 4Z18A 3CFJA 1Q9LB 2JKRM 3OZLA 5T5FH 4AUJA 1FLRH 4ONOA 2CBMA 3OLGA 1G7PB 2VL5B 4JFZH 1LWRA 2NUTA 1VFBA 2GHZA 1HINH 3O6LL 3MLXL 4Y0GA 1MCOL 2WXMA 3B43A 5IBTH 5D4IA 1L9MA 2GBTA 1X7TA 3OHXA 1A6PA 3MX0B 3FTSA 4OCSH 2N1TE 4DO5A 3BP4B 1F18A 4B6ZA 1IC4L 5MI0C 3V5HB 3A6BL 4XMLH 4Y4HB 4CUCA 2CJTA 2FYYA 3ARGB 3DPBB 1ES0B 2YWYA 4DGIL 2ICEA 1P7HL 3N50A 3I9PA 3KBEA 2W07A 3KPSE 4C83B 4M7ZB 4X7DC 4FLRA 3LD8B 5FXCH 3FO2A 1NLDL 3OZ9H 5IQLA 4ZMOA 4NZTL 3EJYD 4OZIA 2BOBB 1L9SA 2OR9H 4XN5A 2YQ2A 3CN1A 5BOJA 1XSKA 2E59A 1YYCA 3M07A 3S3CB 5KAQF 1A6UH 3ZKMD 4GIPD 2Z4QB 3TBSA 4N9OB 1B2WL 2HKFH 5TD4A 4OD3L 4NO0A 2YD4A 2IQ9L 3EDDA 4M7LL 3WN5A 5IROA 1XR8A 2JK5B 1MRFH 1A2YA 1QTYT 1V10A 2GIMA 3OMAB 5BRQA 5BRZE 1LWHA 4H8WL 2Z7UA 1LO0L 3BWUF 2E7CA 4PFEA 2ZOOA 2IWKA 4JFVA 2APSA 4LOUC 3U0WL 3WJMB 5M94B 1T1WB 3GHEH 4O02A 4MB1A 5GRYA 3DTUB 3PNWA 3RIAF 1A4KB 3JSSA 4JFHE 2ZX7A 4I85A 1MRFL 3TV3L 4LLWA 5T1MA 1MWAA 2V7HA 3FH5A 1IZKA 3RIFK 2PYEB 3T6WA 3O3EB 3L8QA 3PIQB 1CXKA 1RUMH 4H88H 3TEZA 3NCJH 3KAAA 3UROR 5JHMA 2BDNL 5T5NG 4OIFA 5AVYB 1G6RH 5EH1A 3NESA 3UTSB 4OB5L 2OZ4L 1M6UA 4HFUH 4DGWC 2I26N 4KXBA 2QSCL 3KXFB 1IO4C 5EA0H 1GHFH 1VCAA 2AITA 2ZF8A 4JE0A 4G8AC 4NAMA 1RHHA 2ZP9A 1RZJC 2WO2B 5EZOL 5D4QA 3Q06A 1S5HA 1AGCA 4JN1L 1EFQA 4KJPC 5DJXB 2EUZA 4GG8B 1HU8A 2H6UA 2BLFA 4G5ZL 4W6XB 2OFQA 4BA8A 4B9JA 1NCCH 4ZO7A 4OCNC 4OSUL 3EYQD 3RGVC 1NBYB 2EXYC 1TQTA 1W72L 3O3AA 4JAMA 2JCCE 1HSBB 2YD6A 3F85A 1AZVA 3CK0H 4PGCB 3T71A 2ZUYA 1GJWA 2F19H 2WLZA 4JM2F 2XTLA 2EKJA 2PCFB 3AB0B 3HFMH 3UAJD 3NZHH 4ENEC 4MLIA 2QBWA 1F3DH 3RL2A 4R90H 4J3OD 1JZ6A 5BZDB 3FQTB 1UC6A 3GSUA 1EFXB 2YUZA 4R7DA 3T77A 4A7GA 3LYRA 3TA3D 2CLRA 3EJYC 3QUZA 2F54A 4ODSL 5EZLA 5KVDE 2AV7B 3D85D 3DSNB 4G6FB 3F7YA 3VE0B 1I1AD 3MYZA 3L17A 3O3BB 2OX5A 2IQAB 4MMYB 4JJOA 1PDKB 1UVQB 1Q94B 3FN3A 5GSVA 4NPKA 1KN2H 4BYHA 3VXQB 4MJIB 1U8CB 1ROCA 3PWUA 5F7LB 2MCPL 4LMQE 3BW9A 2CIKA 1NIDA 4GP4B 5J11B 5CZVH 2ZWZA 1K5WA 2H2SC 4IRSC 4HW6A 1CJYA 5E08H 1FRGL 3L2LA 2VUKA 3CUPA 5T3ZD 4R97C 3MR9A 2PPAA 3RWCA 2IDQA 1ZHBA 2YMXL 3EFDL 3PL6C 3MBEA 4FGMA 3UGUA 3I75A 1UOLA 3MOQA 4YZFE 1IFGA 5F9AC 1WIPA 1U6AH 3L3GB 4Z0XA 4FQLH 2JKIS 5MP6L 3AU1A 1Z1WA 4B7LA 3LKSB 1WWAX 5AD0B 4XMKH 5E5MA 1JXFA 3MRLB 5TF1L 5DUBB 1NBZB 3HIZA 1XH2A 3IN2A 2C8NA 1AKPA 1MI5D 5CJOH 2XWCA 3JZ7A 5KW9L 3GEWB 4JO1H 4PJFE 3VH8B 1NDMA 4F7PA 1BIHA 2P26A 4XP5L 2WB1A 1AZRA 4ZK8A 3GNML 1XH1A 5D1XE 2NSMA 4WU5A 4QRPB 5F21B 4F33A 4KX9A 5KBKA 5KANI 3U7YL 1ULVA 5J6GB 2IGFH 4G6FD 4BBWA 1AYOA 3KPOA 2K0RA 4KZEH 3BKCL 1TFPA 3PDOB 1MSPA 2DEYX 4Z7WE 2H8PB 2R23A 4H0HB 2Z35A 4PS8A 3UAFA 3UTQA 1TO5A 2C7UA 1U42A 2G5UA 4Y2NA 4YDKH 3IXAB 4KY1L 4P2YA 5D1ZC 4PLKC 4F9LA 3F7RA 1NANH 2D3NA 3GXFA 4FCHA 3NP3A 4HMDA 4WGVB 5CIPA 4Y9BA 4FNTA 2WLLB 1OGSA 3X1GA 4DKDC 3IU4L 4Q58C 3SN6N 1AXTL 2Q7YA 3UACA 5D1QB 3LXAA 4PTTA 3SGDH 5KVDL 3IKCA 1CGTA 1D9KA 3O2DH 3Q8AA 2VLLA 1SY6H 1U93B 1WZMA 2AFNA 4AC2A 2F58H 2XETA 3MTXA 4ZOCA 1SMDA 1YEGL 4HXBL 4DHLA 4Z3IA 3TJHC 5I66A 1BHGA 2FWSA 3TOPA 4HULB 1H9VA 4P4KB 4LLYA 1SYSA 2H0FA 5K9QG 1QRKA 4JE4B 4FI7A 5IVOA 3NQKA 2MKLC 4D7BA 3RJQB 4ODTH 1FZJB 4DIXA 1A3LH 4NN7B 2VXQA 1MFMA 3I85A 2AEWA 3RWJB 4H7VA 3UZQB 4AL8L 1BVLA 3NRPA 1CE6B 2CBOA 4MCYA 3ULUL 4LVHC 3FQXB 4L5FL 3WLBA 3UYPB 5KVGL 3IFLH 1OP4A 1MLBA 2X4OA 5TDOA 2I69A 4NHCL 5AAMA 1FFRA 4PJBA 5DJ0A 5DTFA 4MDIA 2RQEA 4WI5A 4XPHL 1MWOA 2V9RA 3DHPA 5EBGA 5K93A 1MY7A 2WYIA 4Y2DC 5C08B 3WD5L 4PM1A 3SHSA 4IU2A 4XNZB 2ZYIA 4KOCA 3S5LA 1F4AA 2L7QA 5C07E 3CZNA 3QH3A 4WV1C 5D6DC 4XO3A 3LKNB 4KTDL 5KN5B 2IV9A 1JFHA 1TZOA 2GKIA 4HD5A 5KYUA 4EEEA 5INDA 3M1CA 3BD4A 4JPKL 2NY2B 2HJKB 2WIIA 4R96B 4ZJ9A 3HHMA 4DPCX 5HGBA 2CGRL 2ITCA 1WFUA 1NCGA 3FSOA 4EF3A 1CVSC 1V55B 4ELMF 5DCCA 2AJZA 3AADB 5BV7H 2N7BA 1Q9LA 2A6DA 5ITBH 2PYFB 2VB5A 1CD0A 4X99A 4JPKH 5FCUH 3GJEA 4WNQB 4AMWA 1NCCL 2UZYA 1BBJB 4X7CC 2FBOJ 5DD6A 2E74C 2OW7A 4HUWA 4Z23A 1J7VR 7TAAA 1N4XH 1OAYH 4OAWA 5AUMA 3RAJL 3Q8CA 3B2PA 1OAZL 1FCGA 2FDBP 1SMAA 5HHOD 3F58L 1HHKB 1NGQH 4I9XA 3D0AA 3MX0A 4NQSB 4Y1AE 3N06B 4AUUA 1Z0MA 5EU7C 3VXOB 5BS0E 3CH8A 3ET9F 5IR1A 1ES0A 3QXUA 3UCQA 4K0OA 5D5ME 3BAXA 5FO9A 1U3HA 4PJ8B 3OLDA 3C5ZD 5KSVA 3BQVA 1QZNA 5D72L 5J9PB 3KL0A 4JG9A 4XPAL 1OF2B 3RTQB 5D6DA 3CV5A 3ZY7A 4NZUH 3UZVA 2J8UA 3QEQD 2B1HH 2R2HA 1CD1B 5A2LH 3SDCC 4QPEA 1HQ4A 3DXAD 2IDCA 4NO0B 3WN5B 1TTRA 1Q38A 1AKJA 2CCLA 2QDWA 3ARYA 4JLRA 3L5XL 1M53A 5FWQA 4YBHA 1A2YB 2DQEL 3NABL 2GC4C 1I1CA 5CJXC 2WNGA 5BRZB 1MG2C 1A0QL 4U6YB 1OB1A 1H8LA 2GPZA 3PYCA 1NEPA 2PMZA 1RQ5A 4NKDA 4QIRA 4UIMB 1OTUC 2XG5A 4YUEH 1JZEA 3PV6A 1PYWB 5E08L 3PJNA 4MNGE 3TWCH 4LCCC 1UZ8B 4A7GF 1BF8A 3FONA 1IM3A 1JIBA 2Y7NA 2R29H 4HEPA 4ZTOL 3UTSA 5DWUH 1QBAA 2ORBL 4PSRA 4W9CC 5JLZB 3G5YA 1OT4A 4JZNA 4GAGL 1CBVL 3KXFA 4TUJA 1U6AL 3AACA 1R4XA 3EH5B 3WEMA 4ZUTB 3BP4A 1O0VA 3MNZB 4G6AD 3V5HA 5IHHA 1S5HB 2CHXA 2YARA 3T3MB 5BZWA 5KVEE 2P5ED 1K6QL 3RWHA 2W91A 4FKEA 3QJHB 3N1PC 3V0GA 2XY2A 5GS0L 5PCYA 2I32A 3DSFH 3ZZLA 4FZ8L 3ARFA 1U2CA 4HZLB 4PRPA 3I3EA 1YEEH 4NT6A 1V8HA 1OZTG 5SX4I 4FNUA 1HSBA 3V6FA 4KHTL 4H0LC 2F1AA 1BVZA 3UJIL 3MJ9A 1DVTA 3GNMH 2PCFA 2WQXA 2Q8BH 2XTSA 3DO7A 5FYJD 4R5XA 4L4VE 1KCVH 4HU2A 2ROXA 4GG6B 2DF3A 2MHAA 3DSFL 3WY2A 2XC8A 4MZ3A 5F9DC 5TE6H 5FM8A 4DKTA 1TPXB 2XQYA 1KELL 2N0MA 3MRJA 5IFHH 3QORC 2CA3A 3L3OB 4PLKD 2AEQL 3EZJB 3GMMB 1U8MB 1VHPA 3GXNA 4MMZC 1A4KA 1BV8A 1MCHA 2B14A 3F7YB 3QBTB 4QXWA 2ZICA 1CC3A 2UX7A 5GGUB 1YYMH 2IQAA 5LAPA 3CFQA 3NJFA 4U3CA 3BRDA 1Q94A 1XCQB 3POHA 1SXCA 4M1CC 3DBXB 3QPQD 5F7KC 4RDQF 2WANA 1U8CA 2H0EA 3AM8A 4G8GA 4WTZG 5BQDA 5E6UB 2XN0A 5LB1A 5E2JA 4PJXA 5K69A 4HS6B 1FAKT 2Z0BA 4YDLB 1A3RL 2DAVA 2OPCA 4GW4B 1UB6A 1WWCA 4M5SA 4X6CF 5EN2B 4TRPH 1INDL 3OKNA 1JXGA 3KJ6L 2PPDA 1B2YA 3HBPA 1VB9A 1B0RB 5F9WC 3V0DA 2CKBB 2XX0A 1G6RB 5IJKA 2Y7QA 1PY9A 2FX9L 4WFHE 5BS0A 4XN2A 2ZXBA 4PWKA 1DBJH 3EJCA 3CVIH 3FUNA 1A6UL 4JGMA 4K3GA 1Q0EA 2GVYA 1USQA 1AH1A 3VXNB 2CHNA 4Q9CA 3MLYL 4P9HC 2UXTA 4L23A 3PREA 4QKTA 3QORB 4ODVH 4W6WB 4H0GA 3ARPA 4Q0XH 1DE4B 1ZT7A 2NLJA 4PG9B 2AXFA 5ID0A 1UM4L 2DL9A 4FD0A 5FA4A 4ELKA 4XBMA 1KYUA 3GSUB 1J5HA 5IHZB 4FXGC 3HRZA 2HTKC 4AUYA 3KLKA 3ETTA 3WXWL 3VFTA 3FBKA 3S0PA 3UBXB 1JGVH 1EHKB 1PX8A 5IBLC 2Y1VA 5JIQA 5FUCE 2B4CL 1TTGA 2R56H 3VCLA 4WW2F 2K8QA 3VE0A 5TJWK 4J3XA 3AFLA 3EAKA 2XV0A 1ESOA 1OAUH 2WW8A 3KWVA 3RKPA 4Z78A 4I3RH 4RMUA 2O5YL 1XF3A 2XRAH 4D9RD 3QWQB 4KDVA 5FYKE 4RETB 4FI8A 1DUZB 4XT1C 5F7WC 5J3HD 4PRIE 1N7MH 1S6NA 2X9YA 5SWZE 4V33A 2F9BT 3RTLA 3AT8A 1Z5LB 5E70A 4JPIB 4R8WH 1I1AC 3FT1A 3BUTA 1KENL 2QMJA 1KLGB 4X6CE 4O5LH 1HEJC 4GT7A 4KK5C 4LESA 3RWGA 1YEWA 1TQSA 1CQKA 3MC0A 1JPEA 2FD6L 2ZXWB 4U2ZA 1WLHA 3LRSA 1S7QB 5HGGS 2BWIA 3MQIA 3E6HB 1JRHH 5AOIA 4AEHL 3D39B 3FHEA 1YZZA 4KKRA 1CGSH 1P7QA 3N2JA 4Q9RH 1UACH 4ZMQA 3UERA 3IWUA 4HAFA 3P9MB 2B7DT 3QDMB 1RZKC 4D9QD 4MASA 5AG8A 3CSTA 4OFPA 4OQTL 3WJJC 4AC4A 1OV8A 1YY8B 3AU1B 3IKCB 3B5HA 2FWOB 3FT2B 3QQNA 3S37H 3GUTA 3SE3A 5E9DE 2K4WA 1DVFA 4TSCL 5ID1A 1SYVA 4ONFH 3M7FB 5DRWA 1T3FA 4IDJL 5E1AB 4K94C 4PJIF 1GS7A 3KWWA 2VH5H 3SQBB 2AMGA 1IT9H 1AMYA 4OLUL 3RKDD 3CZJA 5KYYB 3CGTA 2XIBA 3CIQA 4JFWA 1KIPB 5I1CH 5AB2A 1XBDA 2VZTA 3M17A 1RU9L 1X9QA 4F2MA 5D7EA 2GJRA 4NUGL 1BVLB 4ZMAT 2P1YA 4JPSA 1AYRA 1Q9KA 3QEUA 3BGFB 2A0LD 3PAVA 5C07B 1JZIA 3PDOA 1MLBB 2D73A 5G4NA 1EX0A 5F7FA 4ZNCD 43C9A 4HJGA 5CUSL 5L88H 1NAMB 4JJ5A 2YAEA 1BEYL 3QARA 4LOUD 1B4LA 3UJTL 1MUJA 1WGVA 4TOYL 4J3VA 5DJZB 5E2UH 5IQOA 2O6PA 2WIMA 4KBPA 4ZW6A 3U1QA 1OD7A 2HG0A 2HT3D 3BP5B 3U9UA 4KZDH 1E8ZA 3TWCL 1P5UB 3LKNA 4GKZA 4YSTA 1FV1A 4MXQD 5IMMB 5D1QA 4FFVD 1NCJA 4MJ6A 3IPBA 5I74C 3T1FB 2DL2A 1DLFL 2ZJSH 3TPUA 4Z5RB 4M5ZL 1H5BA 2CR0A 3K1DA 4IKKA 4PJ9C 5JHDA 3I6LD 3MA7A 6TAAA 5T3XD 1JK9B 5EU7E 1TZAA 3D0LA 4C57C 1X7SA 5I6OA 5DD6B 5AVSB 5FGCB 3U7YH 3BDXA 3S2CA 4Z77B 1QFUH 2JF1A 3QUHA 4LCWA 4OAWB 3KH3A 4UQIM 3QRFM 4P4KC 1RL1A 3AXLB 4GKNA 1GGIL 2DQTL 3RJDA 4BSJA 5HYQB 4UDUA 1KCVL 3WEOA 1IGML 4LFHD 4NQCD 3UTPD 3ZHKA 5JPMB 2AABL 4MMXA 5GGRB 4BQ6A 2X4OB 4P2RB 3W5MA 3Q05A 1GGBH 4TQEL 2YKKA 2Y0SA 3VXPA 5IHUH 5FO9B 2ED8A 1FNFA 5SWZA 5T1JA 4HJ1A 5C08A 2F53A 1TVHA 2J20A 3ARDC 3V5DB 5DK2B 2OL3L 3G6JA 3UZVB 2J8UB 3O4LD 3UO1H 1MG3C 3G5XA 4PMFA 3QK0A 3RPBA 1LYQA 4K3EL 3BUQA 5KN5A 2EZ0D 1AE6H 2WWMD 2O6DA 4UBDD 5C8JA 1VFUA 1L9NA 4FMVA 4C56B 4OD2B 4LE8A 1I7TB 1RD6A 3KWUA 2PP9A 2IBBA 2EC8A 5ANME 1JXKA 5FYLE 4DVRL 5L2KB 1B6DA 2W0FB 3TYFB 4Y16C 1F58L 3IDIB 4NKDB 2HP4A 5MHSD 4WW1A 2VOTA 5GGQH 2QGEA 3BDYH 1C1EL 4LHJB 4BFEA 3GJEB 1PYWA 2ENPA 2ZUTA 1T1ZB 2QVIA 3P2BA 4RQQB 3F12A 2YA0A 2D9CA 2HG5A 2X40A 4XNAA 5TH2A 4HUWB 3W9EB 5SX5K 2YPVH 5B39A 2BW4A 1NBVL 2R29A 1SJEB 4PTUB 5E6RB 1NIEA 3BQUA 3FB7A 3QEGL 1AG6A 4HKZA 2X2YA 3NPSC 3I6GA 2FJSA 3I6KB 1E8WA 4OZFB 3TNMB 3DMMC 2K45A 3WOVA 5TK2A 2N56A 4LARL 1CGUA 2WXQA 3L9RA 2OQJA 3T0WA 3P1VA 5EU4A 2MCAA 5HVFB 1ET5A 3N42F 1ZJBA 2WQSA 4IDLA 3P11L 5DJYB 3R1GL 5BZXA 5F0MB 3W11C 3K2UH 2DQGH 1OF2A 3RLSA 1ADQH 1AR1B 1JHTA 5MERB 2B4CH 3IDNA 1YPZA 2EIZA 3ULUF 2Y1YA 1KCSL 2ZG2A 4KRPB 1IGCH 2Y25A 1UA7A 3BSZA 3O8XD 1A1OA 4HT1H 1ILSA 1H3TA 3OJDB 1AXSA 4FLOA 4Z7VF 5FOBA 4K3HA 4UU9B 2IF7A 4HIXH 1NOAA 1V7MH 1ADQA 1B0WA 1NDGB 3TASA 4UT7H 2APTA 5T3ZE 2HWZL 2YA2A 2DY2A 3MFFA 4J3OG 1BG1A 4UIMA 1Z3GL 4NI3A 4BDVB 1SOKA 1ZHLA 3QR0A 3V4UL 5D55A 2OMTA 5KSBA 2OJEB 4FQQA 2X6MA 2AI0H 5CHNA 4LIQH 2AK1H 2TAAA 1RUPL 3Q7JA 2CQVA 3DBXA 4N86A 3HE7D 4OZFH 5C0GB 3M1BB 4PVMA 3A6CL 3EHBD 2LU4A 4RIRA 2YZ1A 1DJWA 3H9SA 4NM4H 4CVZB 4N2AA 3C2AL 4JRFA 3QQXA 4YQXH 2JQZA 4ZUTA 3LZQA 4TL5A 1R5IB 1GC1H 3DJZA 3MXVH 2F08A 3KCPB 3THMH 3VFUA 2F7IA 1Q0XL 4KJWD 5IQ7H 4L9LA 3QJHA 3O0RH 3S36X 4KO7A 4ONFL 4NWUL 3VAEA 3BD3A 4CN4A 2DWYA 5EEWA 3ZYJA 1WGOA 3MCLH 5JW5B 5KZCB 2RQ8A 2H3NB 1EVUA 4OUUA 4R7LA 4E9SA 3TNNA 4P5TD 3WJJA 3WTVA 1NCIA 1ITCA 3QQ4A 3S3JA 5GZND 1DEEA 3DGGB 4FG2A 5ECGA 4K9EH 4PY7B 3ARSA 3HS9A 2YRBA 1PVHA 4GP8B 4YDNA 3U7AA 4AMXA 5EBLB 4EI5A 4R2GD 4A2LA 3MRJB 2PN5A 1AQMA 5BMFH 1A7PH 1NIBA 3HRZB 3IXTB 4UQDA 4W4NA 4H1LH 5JXEA 5J1TC 5MP6H 1IGFH 1BFOA 3T6VA 3KYMB 5FK9B 2B08A 3KEDA 5EZIH 3O45A 2CDFB 3MV01 3VWKC 1CGVA 2FJUB 4OLZH 1HNGA 4LO9A 3BZFA 3VFSA 4HGWA 5GGUA 4M6AA 4LSUH 4F5CA 5ICYB 4WK4B 4E36A 4OD1L 3MACL 1I3GL 3GXMA 3LIUA 5HHQA 2ZP8A 5AL8A 5G2NA 2YC1B 1BBDL 1X5HA 5DZLA 1L3WA 5HGHA 2COVD 5LXGH 6FABL 4PJXB 3P30L 3T0BA 3N6YA 2WLIB 2ZD0A 4N3TA 1LP9F 2EACA 4MNHB 4YDJA 3LN5A 2OZ4A 3BT0A 3FN0H 3MFGB 3FU8A 2EH8L 1KV7A 5CP3A 3RFZA 2DJ4A 4M5ZH 4ZFFA 3PL6A 5EOCL 3GSRA 3CHQA 5LXGL 5A16A 1P7KA 2I24N 5T1KD 2LV4A 3AG3B 2DI8A 2XLLA 3A67H 3MVSA 1A14H 1E30A 2V3FA 4PJEF 4CVUA 1NOLA 1F1GA 1H6UA 5D6CB 3KW8A 1UJ3B 2MPAH 2NLJB 3GUTB 3F5WA 2K9FB 4MA8L 4X9YA 3VWKB 1ZGLM 1J88A 5FA4B 1VADB 3HPJA 4YHOL 1A14L 4G9FD 4FFTA 3REWA 1AC6A 1I8UA 2VDRH 1EXGA 2MFNA 1J0IA 1FF5A 4HSAC 3ZUCA 5BV7B 5C0NC 3N44F 2VDOB 1OGPA 3VG0L 3FFOA 2P7TA 5HHMD 4A2DA 4QGYA 5E7FA 1TJXA 2Y23A 3NIDE 4TYUA 3C5ZB 1QSED 4W9JC 4F2MB 4YHOH 3K7UA 2HN7A 4EO5A 3U9PH 2NX5D 2QQLL 1IGIL 3CXDL 4PGJA 1U36A 2EKSB 3V0EA 3WXVL 3MBEC 4TRPL 1YEHL 3NUKA 3EO1A 2QPDB 4I0CC 3OKLA 2MNWA 5I82A 2OMYA 1H8OA 2X09A 2ZXGA 4LBEA 3FFDB 5FYJL 32C2A 2BS71 43C9B 5J56B 5DURD 2Q76A 5HGDB 1EHLL 4A04A 3VQLA 4BFJA 4K7PH 2VDLH 4L5FH 4UTBH 5HDWA 1QSFD 3FQWB 4FQCH 3SD5A 3TJHD 5JW4N 3BP5A 4IJTA 2R0WH 3FB8A 1ZV5A 2IPTL 4GKZB 5BZZA 1PFCA 4ETQA 2VW7A 4XPHH 4IMLB 2C7FA 3KVPA 3P40A 4M8QB 4OJFH 4NRZA 1B2WH 2HKFL 4KUCF 1Z9OA 1KFAH 2AXGB 4WQOA 2H6PB 2NY7L 4U4IA 4K5NA 4YHML 4LKCA 3HS0A 3ZRSA 1X9RA 3US1A 3T65B 1GGUA 5DD1H 5I73C 4OLXH 4U1MA 4KTDH 3IJSB 1IAIM 4WKXA 4RMSA 1SXSA 2R56L 4B9IA 3RX9A 3KWWB 4XXDB 1TETH 4FG4A 1R24B 3TO4B 3CVHH 5K1JA 4YBLB 3RVXD 1URLA 4WGWB 4TSBH 5AW3B 5IROD 2VQ1B 1YMMB 4I2XB 3WO3B 1N5YH 4QOKB 1NWPA 4O2EB 5FKAA 1WC7A 5HDLA 2VT0A 3K2KA 4FXKC 4QEGA 2JIXB 1KBGH 4WV1A 2KZBA 2GI0A 4QHLB 1ETZA 3KM2A 4S1QH 3S97C 4GAYA 4YXKL 4N0YL 5IREA 2C9UA 4MMXB 2VRAA 1PG7X 4N2BA 3KLLA 4CDGC 4YO0B 3EDFA 4G7VH 3QDAA 4RRPM 4JFEE 4HJGB 1D5RA 4EN3B 3GFUA 4UM9B 1JZ2A 4HIXL 3REVB 4P4RB 3KBHE 4A67A 4KI5C 1ZTXL 2LU5A 1L4IA 1CL7I 1UKSA 1XIWB 3F04A 3ZX1A 1IAKB 5I19H 1MCNA 2EVJA 2BC4B 1JNJA 4M93C 3ZE1F 1AIZA 4G6JL 2WUBL 1V3KA 3TTSA 4OJEH 3P0YL 1E4WL 3V4UH 3II1A 4B3VA 3LHAA 3MTRA 3EUUA 5D7KE 5D1XD 3I9AA 3U6RA 3MRDA 4C56A 1V7NL 3Q0HA 1I7TA 2IBZY 1U3HC 3ARQA 3MJ7B 5JA8B 5H8DA 2V2TA 1I1FB 3EBHA 3QEQE 4GRLD 1P53A 2WBKA 3BT2L 3LV3A 5INDB 1X5LA 3IFOB 2AANA 3FCSB 4LDLB 4QWWD 3QA3A 2WC7A 4X8XA 2QQQA 3VM5A 4Y7MA 4PJIE 1NC2A 3V0AC 5AKSA 4ZOBA 1CDGA 3L5XH 5KBLA 4XP9L 1XCWA 4MLSA 1QI3A 2DWEB 3U9WA 5HDBB 3I74A 4MMXC 3X12B 3RVVD 2ZCLL 3PWVA 5DQDL 1UH2A 2X0UA 2EDHA 4EN3C 3ARVA 1WA0X 3MBED 2DLEA 4GPVA 4UAHA 2WD0A 1U9KA 4ADGA 2OM5A 1K5NB 2Y07L 4KTYA 4BCZA 1JGIA 1L5GA 3I9IA 4G80A 3PG2A 4OLWL 4N20A 4QAWA 5AUMB 3MCYA 4CDHA 5T1KA 4PRNB 3UDWC 3SGKC 4P2RA 1R47A 2YPLD 3JWOC 4TOYH 1KG0B 1KJVA 1OGTA 4O4YH 1BVOA 4JKPL 4GQ9L 5B22A 3FO0L 2ITDA 3BH9A 3T8XB 5EBMA 2IO5A 4XHQA 4A6YH 1RMFH 3BH8B 5F96L 5B4MD 3QJFA 2AV1A 2WXRA 5I76B 1W6WA 3G6JB 2FB4L 4YHNB 5J9PA 1J9TA 1NGXB 5D2LF 4DKEH 4ENED 4JKPH 3V8OA 4NKIH 2O5XL 5KTEL 4GUQA 3NFNA 3UC2A 1WYJA 1ZA3B 1KYOK 4KHTH 4NS0A 4UU9A 3TEYA 5B3JE 1HH6A 1ODUA 4BSWB 1DQQA 5E1IA 4HS8L 1R3HA 3D39D 5D5MF 1KPUB 4LLUA 3FQUA 3QPXH 2Y2YA 3GHPA 1AQHA 1FPTH 4FHKA 4QMEA 2BSTA 1WZKA 1RJZA 3O6FB 3DTXA 2HLFD 1MFBL 5I71B 2OMTB 3DETC 4FFYH 4QNPF 1I8LA 1L9PA 5I9QB 5E00B 5TH2B 1NGWB 2F5BH 2PW2B 3RPKA 4KDWA 5C0GA 4BUQA 1EEUA 1FHNA 2I27N 1UCTA 1SJEA 3BQUB 3WEBA 1XH3A 1XSOA 2Z3FA 4BRVA 1BZDA 1MFBH 2Y24A 5DD3H 1VAHA 4L8DA 4EJ1C 4C55A 1LE9A 4RMTA 3AJ7A 1Y1DA 2B1OA 1J5OL 1OIOA 2PTTA 3E6FB 4IJ3B 1D7DA 3NSCA 3VGBA 5DEZA 3WIIL 4KH2A 4XR8C 3S8GB 4PJCF 4UINH 3RWHB 2L3BA 4J3WA 3LRMA 1MHHA 4DQOH 1JHTB 3B2MA 2C1PA 1CLVA 5EEXA 2IC2A 3LPWA 2ZSVB 2EDLA 2VITB 4PJ7B 4N2CA 4HCIA 3CX5J 1X5FA 1CYWA 4KNTA 4DK6A 4NGHH 2R51A 3BP6B 1TKWA 2WLKA 2XVKA 3F8UB 4HIJA 4JDZA 3L7FB 1F42A 1A1OB 4G6KL 1BWMA 3VDAA 2WINB 3LEXB 4HX1B 2IADB 4LVNB 3KGTA 3AM8C 3PUUA 3T8MA 4AE1A 5DVLA 5I71C 3CWGA 2HJFB 4I4WA 3SDXE 2NZ9D 3NRQA 2KI6A 5H4YA 4NGHL 1T89C 4E5XG 3SO5A 1OCWH 2YKLL 5IUSA 1TXKA 3GBLA 3L3OA 1NINA 4NFCA 2YPVL 5CSZB 4ORGA 4P46B 4HKBB 5E94B 1RZQA 1AZBA 1TZIB 3CX5K 1BD2D 1GPOH 2V4LA 4RFOL 2VDPB 4DKAA 5KS9B 2VERA 1M2VA 1KWGA 1HZKA 3AXHA 4ZW3A 1BSIA 3C2SA 1ZHNA 3QZWG 12E8H 4GRWF 1OB0A 1MCEA 3CC1A 4PIRF 1MPAH 4OZGE 1MJ7H 1I75A 1I8LC 4N8VA 5I6KA 5L4MA 2DQMA 2FUTA 2XG4B 1I9IL 1SEQH 1FFOB 5F7EH 1Y0LA 1GKOA 4AQEB 3HHSB 1YNLL 4LAQH 3NEOA 2BMKB 5DWPA 1GYWA 3OKNB 5K33A 5SV3A 5IG7A 4XTRD 4L4VA 4G8IB 1NCHA 4L5FE 1G6RA 4KX8A 2DQJL 1NJ9B 4GRLA 4B7IA 2HFFB 2Z1KA 1XD1A 3GXTA 4IRSD 1G7IB 1YQVL 4H44C 4JM4L 1EO8L 3MHZA 4XP6H 1KDJA 1KN4H 1BF5A 3M88A 3WHE0 4MQ7A 2A6JA 2VE6A 4HS3B 3DK0A 1FA4A 3VWKA 4HSCX 3VXME 1G0DA 4P9HH 2X5PA 4RNRA 4FN0A 4OM1L 4OSUH 1KIUA 1UACL 2ENQA 3OPZL 4OF5A 3K2MC 4JFPA 4XC3L 5A2AA 3REWB 3ZJAA 4GW5B 2A4EA 2AXFB 5ID0B 3JV4A 2NZ1A 2QKIC 1Z5YD 3QZWB 4WI0B 5IEHA 5IGXH 2ZF9A 3KYMA 3FRPA 1ZVYA 5IHZA 3G6AA 5HY9A 2NXZD 4FAAB 1RZIA 4PUBL 2CZNA 2EO7A 5I8OL 3TA3C 5E4EB 4DJMA 3VCLB 2UXGA 4NM4L 2C9SA 5IGXL 3MXWL 2Y36H 1XF3B 4XMTA 1Q72H 1NSNL 4U3SB 1AJ7L 2WXGA 1QD0A 2EYRB 4N6RA 5CWSA 2VDQH 2CXKA 3TIDB 1M05B 3RNKA 3H42L 2J88H 1FN4A 1GZPB 4S10A 2EDQA 1C5CH 5DVOA 2VM9A 3FXIC 4I77L 4R4NC 1RK7A 4QYOA 1F3DJ 4AM0A 2QSQA 1JCKA 1FH5H 4Y4KC 2GTWA 1G7QA 3FU3A 4ELMA 2YSSB 5BNXD 1VFAA 2Z0UA 4YVUA 3BWUC 4JFDE 1KBBA 3MRNA 4JZJB 4Z7NB 2DLHA 2MMXA 2VR9A 2YQ3A 4Y2DA 4YDZA 3D39A 1IM3D 3U25A 4A7UA 3ARGD 5IB2B 4TNWK 3H4FA 4CC1A 4ZO6A 2XOTA 2BERA 4PRAB 2H6PA 4D0CA 1SBBA 3HS0B 3P9MA 3QDMA 2Y07H 4KKQA 4UNIA 3W9DB 4EDXB 4B0MM 4K07A 1D5BA 2YD7A 1A9EA 4OLWH 5CD5D 4U1MB 3T0EC 2FWOA 1WD8A 1OVZA 3BUDA 2N3JA 1N6QL 4EXKA 3VRJB 3BD5A 3BHBB 4H25A 2OBGA 4MA3A 4PBWD 4G42B 3EJZD 3EXLA 3FPYA 5I24A 3ZKXC 4GMTL 4X7FC 1TT6A 2ZOTA 4QYAA 1SLXA 4KO9A 3BJ91 4EUPH 1F2XK 3AW5A 3CSYA 3MRCB 3APCA 3NIFB 3QUGA 2VISA 5D1XC 1P4IL 2EKSA 3BZEB 1G9NH 5GS2H 1ETZB 1BZ9A 3H53A 3IU3B 4APQB 4XE5B 3EO1B 3GHBL 2VLRA 3OKLB 3J8F7 1S4IA 5AVQB 1F4WH 3MV9E 1PJWA 4M6NL 4X6DE 2BIHA 1HHHA 4ZG1A 5HGDA 5M7QA 1UKQA 3IDUA 3WY3A 1AP2A 5C0AB 1N6UA 2XKNA 4I1NB 3FB5B 1RIHL 3D07A 1BJMA 4G3YH 1FHGA 1T5XB 1FJ1B 3HS0C 2NY6B 2NZ9C 4HUCA 3O6KH 1I4FA 2A9DA 3HG1D 1AGDB 4DK5A 2LVEA 2BVEA 4DF9A 5AAMC 5DQJB 5F7HA 1KTCA 1JNLH 1RXLA 4NWTL 3SE4A 3WKMH 1FDLH 4M48L 3PE9A 2A9NH 1QA9A 4MXQC 3LZFL 2FHCA 1TR7A 3LRHA 4JFZL 4S0TD 3NTCH 3UO8B 5D9SB 3RDTD 2WP3T 3L1GA 2QELA 4HEPG 4OM0L 5E8EB 3GBMH 1XT5A 2YD1A 4MBOA 4ALAC 2P5PA 3RWIA 2D7PA 1ECYA 3IU4H 1K8IB 1IC4H 2WCPA 4PREA 3TO4A 4YC2B 4I1RA 2CUMA 3GTNA 1OGAE 4KK8C 1JK9A 4LSSL 4ANXA 5CLYA 4O2EA 2WXLA 1YY9C 3W82A 2Q8AL 3EOBB 4JNXA 1NLDH 2BVYA 5KVMC 1K3IA 3AITA 2DS4A 3W2DH 2NTSP 2H2PD 1WBZA 3SBWA 3MRIB 4ZNEE 2K70A 4QRUB 1HQRA 3GBDA 5DJ6B 3C6LB 3GJFB 4Y5XA 4IBSA 3AMKA 2HFEB 1S7TA 5JPMA 4HJJL 3I3DA 3O9WD 5A6MA 4ZSOA 1QASA 3O3UN 2QSTA 4M1DH 4EMZA 1EHNA 2E9BA 1XIWA 4G6AC 3BH8A 2YKLH 3QJFB 4HKXB 1JZHA 1IGJA 4BCYA 2EDMA 4G9FE 4YHNA 5BO1L 4UOQA 1QYGL 3G04B 3NIFE 2NY7H 4YHMH 4K5OA 4MCZB 4ZPVB 4NQDE 5EOCJ 1AHKA 4M1DL 4YDMA 2A2QT 1NGZA 1ZA3A 4TLKA 3MDJA 5EIQA 1BLNB 3LS5L 3E2HB 3FAXA 2IG2H 4ZPTB 2Z34A 4BSWA 1AXIB 3BQUC 4AVHA 4PSPA 3H3KA 2FR4A 1GW6A 1IGYA 5C3TA 4YN3A 1OT2A 3N1GC 2A1WL 4N2OA 2F8OA 5LG1A 3SPHA 4OFYA 2WQWA 1LK3H 2ADGA 1CXIA 1T1WA 4PEEA 1ZE3C 5EZOH 5A2BA 3IMRA 3QT2A 5DEFB 5LKNA 3O41B 4QO1A 3SGKA 3QRBA 1RP8A 3FNKA 1A6WL 3X12A 2PYEA 2WGNB 2DQJH 3EDJA 4LLMB 4KKAC 2A7BA 4MCNA 3WKPA 1VFBB 5I15H 4GG6E 4HPYL 1QACA 4L0ZA 3FTXA 1CMOA 4Z3FA 1I7RA 4FABH 1JRHI 2Y4SA 1MF2H 4L3EE 3IE9A 3G6DH 4HFWA 4B50A 3BIBX 4KJYB 2ATKB 2Y22A 3U1SH 4WZ9A 3OF6D 3I6KA 2XFGB 5KVFL 4TMPA 1VKXB 1DJZA 1QRND 5IK3A 3DUHA 1NAMH 3TESA 3ARGA 3DPBA 5E2VH 2VM4A 1RUQH 5HHOB 4PGEB 2GQHA 2XXMB 2YK1H 2XBTA 4OCYH 3D3VA 3K5SA 3DTDA 3KPSB 1NBYA 4G70B 2Z91B 4JKLA 3P2TA 4WWNA 4L2LA 5CLXA 4XBEH 4OZIB 3DGDA 3ZE2F 2KDYA 3L4CA 3FYIB 3GSNL 4KKCC 3VI3B 1NKOA 1JPTL 4WIQA 4MAUL 2WOBA 1IQWH 3QNYB 2ENJA 2VLKE 4GT0A 5GS0C 1R3HB 4NZRH 5D72H 3WL9B 3D69B 2XPGA 1AOHA 4KI5F 2NW3A 1FFTB 4X42A 4LOEA 1GMIA 2J88L 3A22A 5IJBC 3ULVL 5D93C 5DVNA 2XWJB 1KCUL 1E4HA 3GSNH 4KI5D 4LPVA 1WZAA 4XNQB 4PS4H 1A4CA 1BYNA 4ODUA 4RAUB 3LQMA 1H15A 1WCQA 5E94A 1CO1A 3PNWB 1OT1A 3TFKC 5CINH 3B6SA 4YGVB 5C0DA 3VXRA 5AAPA 3ZT6A 2UUDH 4JPVL 3SE9H 2OMZA 3HB3C 4HD9A 3TBCA 5B8CA 3B2VH 3POCA 2XN1A 3L3OC 2Q2EB 4UMSA 2ITFA 1QR4A 3EFDH 1UJTA 2ARJQ 4JQIL 4L3CB 3P3RA 4Z95L 4P5KA 5E8PA 3HTLX 4LSUL 2PR4L 2XG4A 3BW9B 1MCDA 3M6DA 3ERXA 4HUUA 2PR9A 2OMUB 4WWKD 4MNQE 1MDAA 3ZK0A 3AGWA 3OAUL 3NA9H 4G8IA 4ZTOH 3VFUB 5C0CE 2F1BA 1AI1L 1OANA 3H3PL 3Q8EA 4NYLB 1MHHB 3O81A 1IBDA 1KJ2H 3QDGD 1G7IA 3LPGA 2B2XH 5CN1A 4JFQA 3BZ4B 5F7DA 4LCWD 1F1DA 2VSDA 3MRCA 5HYJA 5LQBH 2X6CA 1F86A 1MEXL 2W9EH 4MXVF 2WINA 3LEXA 4Z0XB 1O7DC 3GI8L 5C3LD 4KXZH 5JQ6H 3KJ4C 4XXCA 4C8XA 1H9DA 2HJFA 4I4WB 3S9DB 1J9QA 3RL2B 4NDMA 4ZMNA 2E47A 4UZUA 2A9AA 2J25A 3EO9L 3FT3A 3QIWB 5DUBA 1SZNA 5AVTB 1H3PH 3MBXH 1AD0A 5I1JL 5KG9A 1A3QA 4PRHB 1NMAH 2HVJB 3L3HB 3OV6A 4RDBA 3FRUB 2K6YA 3PFQA 4ICWA 1RIHH 1RZIB 1ND0A 2OSWA 3B9EA 2Q7AA 3DOSB 5CMAB 2UZIH 5KS9A 4H8UA 3SYPA 2CDFA 5D7LD 4Y4KB 1GCFA 2VWEE 4JKWA 3B7SA 4YFLF 1JNLL 2J7LA 3GS4A 3NG5A 3MNMA 4N8VB 1EHXA 2V6HA 2ITEA 4JO4L 4G8EB 2FBRA 1CDYA 1OAQL 4JFED 2CIKB 3PABB 5IMOB 2YXVA 3OAZH 4RWHA 2BMKA 5DHEA 4GSXA 3HZ3A 4Q89A 2Z92A 1KJ2B 4FQIH 1QSEE 2H1XA 4HJTA 2DBLH 5ELIA 2ZUVA 4ELMB 1LMKA 3EW3B 1TO4A 1U2YA 1QEWA 2Y6SC 5L8KB 4JY4B 5EN3A 4KRNA 3D6GA 1XO8A 2Y1AA 5IB2A 2QHLA 1H6EA 4BINA 4I48B 4LSPL 1UZGA 4Q97A 4ELDA 3FCTB 4HYTB 3AVEA 3I75B 4FQIL 5FM4A 5B3SB 5JDJA 4UAOB 1I8IA 2DM4A 4YSAA 2IOOA 1SLWA 4HJSA 4RBPK 5IMKB 4HUXB 1D9KB 4NZDA 4JFPB 1ONQA 2BY0A 5T33H 3UJJL 4LLQA 1KY7A 2V17H 4Y4FC 3BHBA 4H25B 5I1AB 3AUWB 1GY1A 3BDYL 4JDVA 5DFVC 2J3SA 1OE1A 3W57A 2BS9A 5DMKB 4TLUA 3BPOC 5D7KD 3ECBB 2YMOA 2VXUL 2QKIB 2W65B 1GIGH 3WKNA 3BIKA 2ZNXA 4XBGA 3UAEA 3OF6A 1FZJA 4U6XB 5I16A 5T1LB 4N0UB 4DAGL 1A25A 3PLYA 5I8EB 2HPTA 4MA7L 4XB3A 4CU6A 5F7EL 1CE6A 2OKMA 1G0YR 3UEZA 1HHHB 4P07A 4YNYA 4ECNA 3IE4A 2CNYA 3V4VL 1MFDH 1FN4B 4QY8B 2AK4E 3CN3A 2CH8A 2AK4A 3P11H 3KGRA 32C2B 5GGTH 3KH4A 1CL7H 5EULV 4MGXA 2EADA 3KE0A 2QHRH 1USZA 3NYKA 3MKGA 3K6SB 3QJTB 1DBAL 4L48A 3MA9L 3S5LB 1OGAD 5E8DH 3F7KA 5BOPA 3QG6B 5DJ2B 3TH2T 4OLEA 1AO7D 4V1DE 1MH5B 1VSCA 3HE7A 1DBBL 3HMWH 4XMVA 4PRAA 4N24A 1RVFL 3ZVVA 4D0CB 3L3IB 4ETQB 2E9JA 4IMLA 3S6CA 3F7PC 4HZ1A 5BXFB 5CBEB 5D8JH 4MQTB 3TJPA 3E9TA 1A9EB 2PUQT 3B34A 3NJGA 3PGFL 5MI0B 1ZMYA 1XF2B 4E9TA 4QF1B 3ZQ9A 4P0DA 2QZQA 4DP8X 2X6UA 2IJ0C 5KVFH 3HMWL 2AJZB 3A4AA 1SXZA 2DPKA 3D4YA 3DX3A 2ED7A 2XZCL 1EEYA 1XD0A 1J48A 4BQCA 5F7UA 3HE7C 3KMDA 4OCYL 5ANMA 4ZI8A 2Y36L 4U1GC 4LEXH 4H20L 3Q2LA 2W60B 3C6SB 3CFBB 2WCGA 4O00A 4C56E 5IEKB 5H37G 3B3IB 4XNZC 4X4XB 4URTB 2ZUWA 4R3SA 2PP8A 2C9AA 1C5CL 4WV1B 3UABA 4QHLA 3IDJA 4I77H 1WAAE 2ZTBA 4AZUA 4DGYH 3VXOA 1MAJA 4DOHB 4EI5D 3ARFD 1PKQE 4PRPD 3QHFH 5AZUA 4A39A 3BMWA 3OKEB 2Z31C 4PJBB 2GEQA 4F7TB 2VL4A 4PJ8A 1PZSA 2G2RA 1IGJB 1CLOH 4RGOL 5C08E 3X14A 5ACLA 1CDJA 2IGTA 1HH9B 4WWKB 1B0GB 3ZT5A 4F8TA 1J8HB 5CZKA 4J5VA 1JWMA 1T2JA 1U3JA 3MBWA 1OOWA 4JHAL 1LO2H 3BKJL 4BEIA 1C9SA 2FSDA