3NT0A

C500s (t1d) mutant of cueo soaked in and bound to cu(i)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
468
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 129
structure length 468
sequence length 492
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A03
4WTQA 2XWZA 1BXUA 1B3IA 2PCYA 2PP7A 3DKHA 3QJRB 4DP2X 1A4AA 1KCBA 3FSAA 3AG4B 1MZZA 3WG7B 4QLWA 1TKWA 1PCSA 3OMAB 4F2EA 2WO2B 3X1NA 3ASNB 1WA1X 5LDUA 4HHGA 1IBYA 2WSDA 1MG2C 3FQYA 3SBPA 5I6OA 4BDVB 2BW5A 1JZEA 2DYRB 2JFCA 2JXMA 2Y69B 2VW4A 3FQ2A 3T9WA 1RKRA 1QNIA 4YSOA 1KGYE 3CDZB 4A67A 5A7EA 4YSUA 5I5MA 3N55A 3JT2A 3QQXA 3BQVA 2DY2A 2CALA 1J9QA 1HAUA 2IH8A 3CG8A 1FA4A 1NDTA 3OMIB 7PCYA 1WS8A 4GYBA 4A68A 4FA7B 1IKOP 3FQ1A 1PY0A 1V54B 2CUAA 1FFTB 3L45A 1KCWA 1ET8A 1OCRB 2GB2A 3QJQB 1AOZA 4KNSA 4JKNA 4KO9A 3NJFA 1BYOA 4AI7A 1E5ZA 2J55A 4DP7X 2HX9A 4E9YA 2VN3A 3FSVA 4L0PB 1KBWA 2IDUA 1N68A 1PMYA 2IDFA 1X9RA 1AG6A 3ABLB 5AKRA 3WKPA 5I6LA 3HB3B 2PP9A 2CAKA 4JHVA 4YSSA 1OCOB 2CJ3A 4M4RB 4KNTA 1ET5A 1KV7A 3NJMA 3PPSA 4BXSV 5ANHA 2YXWA 3AG2B 5FC9A 1NICA 1JVLA 3QPKA 2PPAA 2VSMB 5B7MA 1OF0A 2B3IA 2GC7C 4YSEA 2FT8A 2OV0A 3AW5A 3OD3A 2QDWA 1JERA 4EF3A 4KO7A 4UF7C 1PLBA 1RZPA 3TASA 5PCYA 4AX3A 2OCCB 3IN0A 5B1JA 6PCYA 3ABGA 1RCYA 5F7BA 4PCYA 3UADA 2AVFA 3H4HA 1M56B 2AANA 4YVNA 1JXGA 1W6LA 3FU8A 1MG3C 2EIJB 3S8FB 3S8GB 5B1KA 1ZIAA 4BDVA 2I7OA 4HZ1A 1L9RA 2BWIA 1TU2A 1PZBA 4X4KA 1KDJA 3UAEA 3CDZA 3ABMB 3RYMA 1KBVA 1OE1A 4E9VA 1ID2A 1MDAA 1A8ZA 3FT0A 4ZK8A 1ASQA 2W88A 2EIKB 2GIMA 4YSPA 3PAUA 4A2GA 4N4YB 1L9PA 5B7FA 2XLLA 1SFDA 4P5SA 1JOIA 1GR7A 3DIVA 2PPFA 2UXTA 1GS8A 1DZ0A 4BK5C 1AZNA 2JKWA 1BYPA 4E9XA 1NIDA 2BZ7A 2ZXWB 3SQRA 2UXGA 1M9WA 3AG1B 1QHQA 2Q5BA 4HIPA 4TXVB 3ZDWA 9PCYA 4N8UA 5B3SB 1XB8A 3BVDB 1NIFA 1BXVA 1NPNA 2QT6A 3T6XA 5PAZA 4AKOA 2BP0B 3X2QB 1AR1B 3UGEA 4DPAX 3T6WA 4G7SB 1A4BA 3SBRA 3MX0B 1EZLA 3NJHA 4W1TA 3WKQA 4E9RA 1DYZA 2XXGA 4MFHA 2XV0A 2IWEA 5AZUA 4A2EA 2DWTA 2IWFA 3T6VA 2IDQA 1AZCA 1GW0A 1QLEB 4DP0X 1BQKA 1JXFA 2TSAA 1SJMA 1IUZA 1PZCA 2UX7A 4NAJA 2FQDA 4WKXA 1TEFA 3FU9A 1CYWA 1ZIBA 2XYBA 2J57A 3QJVB 4AZUA 1E30A 4P5RA 4YSAA 2NRDA 3NJIA 1CC3A 2YARA 1SHWA 1F56A 4GP5B 4NERA 2B08A 3NJLA 4GP4B 4DP8X 3ZIYA 4BXVA 1SF5A 1L9OA 2E86A 3SBQA 5I28A 1JZIA 1OE3A 2GBAA 2FQGA 2FT7A 4UANA 2AZAA 2CBPA 1BEXA 2VW7A 3DTUB 1IC0A 4K9JA 1NIEA 1OCCB 2J56A 5I5IA 4A2FA 1ILSA 1M57B 4YVUA 2YAFA 3X1GA 1URIA 2CCWA 1HFUA 2UXVA 3X1FA 3TU6A 1NZRA 2AFNA 3EF4A 5I6MA 1CURA 2HRHA 1JXDA 3PAVA 4A66A 4Q89A 2BHFA 1CUOA 1E67A 3WNIA 2BWDA 4GY4A 1SFHA 1NPJA 1JZGA 1CYXA 1ASOA 1BAWA 4UAHA 1PNCA 4HCIA 3IEAA 1SDDB 3CZUB 5B1BB 2YAMA 1ZDQA 4W9ZA 5D4IA 1JZJA 1SHXA 2XV2A 3PCYA 2EILB 2BP0A 5I26A 4YSQA 3IE9A 5I5JA 2YAQA 2MTAA 2IAAC 1KYAA 1AACA 3JTBA 1ILUA 3D12B 3UABA 2IWKA 3V9CA 1AG0A 3FS9A 4G7QB 3ERXA 2YXVA 3EHBB 4HHWA 3V9EA 2YAEA 1AZUA 4DP5X 2IH9A 3X1EA 5B1AB 2FNWA 1RZQA 5TK4A 4BWTA 2PP8A 1FWXA 3AG3B 2P80D 2YAPA 1GY2A 1E65A 3HEIB 1KDIA 3KW8A 1AANA 2XUWA 3NP3A 4DP9X 1EHKB 3NSCA 5AFAA 2VMJA 1E5YA 1WA0X 1HAWA 7PAZA 4BWUA 1BQRA 2YQBA 4HCFA 5E9NA 3OM3B 4KO6A 5TK2A 2ZONA 2PPEA 1GYCA 1WA2X 3QJUB 3ABKB 4GXFA 2UXFA 1PLAA 1TEGA 1A65A 1GS7A 3NJNA 1OV8A 4A2HA 1AS7A 2DYSB 2XU9A 1WS7A 3ZX1A 2XX0A 4G71B 3OQRA 3NJJA 1PF3A 2I7SA 2ZWNA 5I6PA 4BWWA 1NINA 1OE2A 5D4JA 1XB6A 2OJ1A 1T5KA 2XX1A 2YAOA 4G72B 1AS6A 3S3DB 5F7AA 2R7EB 3NT0A 1NTDA 3NJKA 1SNRA 1VLXA 2GHZA 2IDSA 1JZHA 4AKQA 5IY5B 2FWLB 1AZRA 3KW7A 4KO5A 3EH5B 4DP1X 2DWSA 1SDDA 3AZUA 4PAZA 2BP8B 4DP6X 1XMEB 3IBOA 1UATA 5I6NA 2GI0A 3TBBA 1W6WA 3NSYA 4AKPA 2PPCA 2VM3A 5B7EA 3S3BB 2YAHA 2WO3B 3H4FA 3FPXA 1IBZA 4NB7A 2ZOOA 3IN2A 5B1JC 4E9SA 3QJSB 8PAZA 4E9TA 2BW4A 4G7RB 1WAEA 3WI9A 2GC4C 3X1BA 1AS8A 3EH3B 3FSZA 3N2JA 4KOBA 1J5DA 2VM4A 2FT6A 2XV3A 5EHFA 4RH4A 2LLNA 3FYIB 2I85A 4KNUA 1OOWA 1X9UA 2IDTA 2EIMB 3GXUB 2J5WA 2FQEA 2H47C 2EINB 3EH4B 3NYKA 3FU7B 1MZYA 2DV6A 2QPDB 2X87A 1GSKA 3GDCA 4YSRA 2AZUA 1I53A 2Q9OA 2PLTA 5I6KA 2UX6A 4A2DA 1L9QA 1OCZB 4KOCA 3ASOB 1JZFA 4E9QA 1AAJA 1NWPA 3WNJA 4DP4X 3NJGA 2QPEB 2TSBA 3QJTB 1PAZA 1NIBA 2A3TA 1J5CA 1N70A 2PPDA 3S3CB 3UACA 1BQ5A 1J9SA 3H56A 1L9TA 3PXLA 3CVDA 3OMNB 1AIZA 4Q8BA 3TA4D 4F7KA 1A3ZA 1YLBB 1A4CA 1ET7A 2RACA 3ZBMA 2R7EA 4DPCX 1V55B 1R1CA 1NWOA 2N0MA 2BZCA 1ETJA 4JHUA 3FSWA 2HZHA 3T6ZA 2PCFA 2VW6A 4G70B 1ZPUA 3UAAA 2BP8A 1BXAA 1ADWA 4HAKA 2HX8A 1ASPA 2XXFA 1XB3A 1SF3A 2FTAA 3FPYA 3C75A 4F2FA 1PZAA 2H5UA 4FAAB 3PAZA 3NSFA 1AZBA 4YSDA 3T71A 4YSCA 1JVOA 1ZDSA 2XVBA 2HLEB 4M3HA 1PNDA 3G5WA 3CVCA 2H3XC 3NP4A 4CSZA 1GY1A 3GYRA 1NIAA 1J9RA 2FJSA 3AY2A 4CSPA 1W8EA 2MRYA 1PLCA 2X88A 4HALA 4DPBX 4E9WA 3WIAA 4QKTA 2GSMB 2HX7A 2HXAA 2VSKB 2HRGA 2FQFA 2Y1AA 4HCGA 3PLYA 2QDVA 4GP8B 4YL4A 1GS6X 3FU7A 3U25A 3NSDA 5D4HA 2W8CA 4ENZA 2BO0A 1J9TA 3MBWB 1L9SA 1AQ8A 6PAZA 3CVBA 3FYEB 2P80A 4YSTA 1ZV2A 1V10A 3TBCA
chains in the Genus database with same CATH superfamily
2VQ4A 1TJHL 4P2QA 2IFGA 1HH9B 2PP7A 2YEZB 1AYOA 3PWPD 4DFHA 5D93B 4ZW6A 5FYKL 5EO1B 4YR6A 3V10A 1Q72H 5JPMC 3GO1H 3WXVL 3TXAA 3ASNB 4JHWL 3DUSB 5F9WB 2Z93B 4FXLA 5GGRB 3O8XD 1GGIL 4G3YH 4HJJL 1FYTA 4J8RB 2GJ6E 1M71B 2D3JA 3UG3A 1XGPA 5E9DD 4ADGA 1JZEA 3S4SA 2K6ZA 4KK6D 2OK0L 4GRLC 5FUOH 1ZAGA 4FNTA 5EOCJ 3U7YL 1EEZB 1KGYE 3SO5A 1JV5B 1SYVB 1U3YA 3FAXA 3ZTEA 3N55A 5I5RA 1RFDH 2BS71 2YO3A 5F89A 1HHHB 1TFHA 4OJCA 4CADA 4N90D 2ETWA 4PBXA 3CG8A 3FULA 1G9NL 3V6ZB 4NO3B 3S2CA 5C0DB 1KTLA 1TVHA 4ZMZA 4FA7B 5CAYB 3Q6FA 3QG6B 5SWZB 3BE1H 4JFYA 3GMRA 4MCYA 2VKXA 3OTTA 3CFCH 4OGXL 4RDQF 4AM0B 3BJ91 3AC0A 3S5LB 1TZGL 3LNIA 3W9EB 1NDGA 2FYVA 4TTDD 1A6TA 4X4YB 4Q9BA 4KQ0A 1NBQA 3EO9L 1MJ8H 3FRPA 3G5VA 4YNYB 5GGSY 5KSVA 4HS3A 2CR3A 4ABUA 5KAQG 5HGBB 1RJLA 3ABLB 2WLIA 1HOEA 1CGYA 3AT9A 1G9EA 1OGTA 1KTKE 1QKZL 5CEXA 3GB7B 1ZTXE 1SN2A 1UKSA 1Q9LB 4QTHA 1UB5A 1EXGA 1NGQL 2YRBA 1FZKB 3ISWA 3UJIL 3GQFA 1INQA 3L4VA 3QPKA 3MRCB 1JZ3A 2B3IA 3VACA 1E5BA 4DGIH 1BCIA 4JB9H 2HB0A 1EEUA 2OV0A 3O3UN 2R69A 5JA9A 3MOBH 4UTBH 3CDGA 1KB9J 4LVHC 4AX3A 3EBHA 3JT0A 3IN0A 1HHKA 2R1YA 1X5XA 4K23H 4ONFL 4HUUB 1X4XA 3EO0A 4PWIA 1MI5A 3BZDA 4M5SA 4MQXD 2B39A 1GMIA 1KYOK 1I7UB 4P9HL 4BSVB 1PSKH 4WUKH 3TVMD 3HPLB 3MKGA 3IKCB 3EJCA 2NY3B 3F58L 3GBDA 5AUMB 1ZS8A 4WU7A 1RU9L 4WK4B 4XVSL 1PZBA 3KH4A 4J3OF 5K39B 2H1PH 3ABMB 3ALXA 3B83A 1CD8A 2PTTA 3L3KB 4FMFA 1BFOB 1A7QH 4E5XB 4YPJA 3QCVH 2VDMH 2PNDA 2F5AL 3L9BA 1HEJC 3C09B 1YY8B 1DQVA 1UZ8A 1YNLH 4NQDD 4FCAA 1A5FL 2XRAH 3FUFA 1PEWA 4IIQC 4X0KB 5I71C 2VDRB 5D5ME 1GS8A 3FU0A 1PJWA 3WEAA 2P5EA 5ESAA 3VD1A 4RMWA 1I75A 3EF7A 1J5HA 1R9FA 2O6PA 3DURB 3T3PF 3TS8A 1QHQA 1VGKB 5E6UB 4K73A 5JXAH 1T1XA 5DEZA 4HQQH 4NGHL 3TPUB 3N43F 1ZMYA 4N0FB 4XXWC 5AKTA 4LDLB 3B6SB 4N8VB 1NUGA 3VNYA 5E00B 2UWEA 2EXYD 4IK7A 1Y6MR 1NCCH 4G8IB 4MRCA 1I85A 3RPIA 3WFDH 4GI9A 2NY1B 1L6XA 4AK2A 3VUAA 2AK1L 2E8YA 1TQTA 5DR5H 1M4KA 4X6BB 4HJSA 2V7HB 4GFTB 2YLHA 3B43A 3BZFB 1KYUA 4N0UA 3BUPA 2VLLA 1E8XA 3IDJB 4BHUI 3RUGB 1KMGA 4MMYB 4W9DC 3TO4D 4A2EA 1SUHA 1IFGA 4XCNA 2IPUG 4CVZB 1QLEB 4LLYA 3CLFH 3FTVA 3QDGE 1I7TB 2V0AA 4ZMWA 4JZJB 2KKQA 5EF3A 4ZG1A 3I50H 5INDA 3C2SA 3SE9H 2NY5C 3ZTNL 3KS0H 3QP3A 4XO3A 5G55A 4I0PB 4ACTA 2XTLA 5GQBA 3AWEA 4HUNB 5H35A 1WZAA 4LEBA 2ZOWA 3GLDA 5HPOA 1H5BA 2XYBA 4YDNA 4BD4A 3DROB 5FM4A 4K3EH 3QS3A 1SXSA 4FQCH 4HWUA 4XZUB 1VFBB 1FCGA 3GJFA 3VXSA 2BLFA 2VUKA 4LCIH 5TDOA 4QR7A 5L9DH 1GZPB 1V8HA 2VR4A 4XRCA 3K6SA 4JR9L 3VRLF 1TZHA 2Q7AA 3QZBA 4A04A 3N06B 4F8TA 5IV2B 2ZCHL 1XCWA 3MLYH 4WRLA 2QPSA 1SF5A 4WWID 5MEQB 1A66A 4KAQH 3SBQA 4NKQB 3CFIC 2ADGA 3ZIMA 4N68A 1JYWA 4IIQA 2FT7A 2YBRB 4RX4A 3L3OC 1QUNA 2XZCH 4AMKH 1KJ2A 3ESOA 3S37X 4PJ9D 3QIWD 5T1LA 3ZYJA 3VDBA 3DHMA 4G8FB 4PRIE 5I6XB 2IAMB 3U46A 5DJXB 3VJ6B 2ZSVB 4AQAB 4WFFE 5CLYA 1XIWC 2XQBL 2O26U 5CBEB 3D48R 3IMVA 3BLKA 1NEZA 2RCSH 4LARH 4AYDC 3SSGA 3C8KA 3QZPA 2A74A 4GY4A 4HPOL 4JFDD 3U6RA 3BRFA 3HG4A 1YYLH 4IKIA 1L0XA 1WH0A 3WLWC 2XWJB 4A7UA 1JZ6A 2B3RA 5L8JB 4H2CA 3BP6B 5IBUB 2WXRA 4XN4A 4OLVL 1YEFH 4BFGA 4FG6C 5IG7B 4HC1A 2HN7B 4TVUA 1C08B 4RGNB 1B6UA 3UG4A 3R7RA 3QEQD 2MKWA 3KLLA 4HKXB 2IFFH 5DC0A 3JTBA 1KLFB 1R5IA 3GUTA 3NABH 4PJ8B 4CU8A 2WVVB 2XKSA 3NCYP 1ML0A 1J8HB 2WO4A 5D2LB 4HHWA 1IFHL 5IJKC 5F1SA 8FABB 4N6RA 2UZIL 4MTMA 1R6VA 4JY6B 4TLUA 3COOA 1L3WA 3D85B 3ISRA 1JAEA 5ANMB 3L5XH 1D5IH 4DW2L 2YMXL 3G6DH 4JFFA 3F12A 2Y36H 3DA0A 2O61A 3B7UX 1MCNA 1P9MC 1ES0A 1U3JA 1AANA 1U2HA 2V2TA 4RFEB 3MFFB 1JF1B 1NC2B 1I1YA 4G42A 4PWHA 3S37H 5IW1A 2JI1A 5D7SL 2PMZA 1BD2D 4X9HA 4W9JC 2HKHH 2ICWI 3KYNA 2IF7A 4G43B 1EJFA 1ZT7B 1E6JH 3HZVA 4DTGH 3L3OA 4HJ0C 3TA3C 1DSFH 1HH6A 3T2NL 2Y7SA 2VLRA 3FHAA 4HD5A 4MLSA 1CZ8L 2OA9A 2Y6TE 2CCVA 4Q6YA 2PYED 3MLWH 4MJIB 3IFNH 2N7SA 3H3PH 3L3GA 2GPZA 1F5WA 3MODH 1QSEE 5D1ZI 1XIWA 2Z4QA 5GS3A 3ZSTA 5DJ0B 5ILTL 3RLSA 5J7CC 1UKQA 2YPKB 1A0QH 1OF2A 1ZHNA 3SE8H 2Z7UA 4UV4L 5ESQB 3B3IB 2R51A 4LXFA 4Y9CA 5C08D 3I6KA 4FC3E 4PB9L 5EN3A 4PJDB 1N5YL 2LQRA 3CC5A 1UYWH 2CLZB 4GW4A 4Z7VB 3RILA 3AABA 3P4NA 3TO2B 2E6PA 3QUZC 1WO2A 2XJKA 2MSPA 5BV7H 1U2YA 4UUJA 3AXHA 4PGCA 3MRHA 1WTGT 1Z9LA 4PRNA 4D9QE 4F2FA 3RE0A 1J18A 2BP8B 3DRTB 4O2EB 4FFWC 4L48A 2HFGH 3LQAL 5IJKA 3L9RB 1NMCB 2QVFB 3BP5B 1QABA 2CWRA 4M1DL 4E2OA 3VD5A 4N0YL 4IGBA 2MOGA 4HIIA 4GBXB 5EU4A 1FF5A 2CRMA 4P2OD 1XL4A 5HGDA 5HPMB 4WU5B 2KLSA 3PGCA 1OQOA 1P9MA 4MA1B 1LP9F 1IC4L 5DFTA 5GS0D 1AKJA 4G7RB 4OR1A 1CI3M 1FO0H 3PIQB 4PS4L 4DGYH 4JFTA 4L4VD 1ORQA 3CE1A 3BJLA 4HWNA 2J88L 1A3LL 3IMTA 4NAQA 1JNHB 3Q2VA 2Q7YA 4ODSH 1Q94B 3X11A 3DHUA 3JYCA 4HBQA 3S35H 1C12B 2V7NB 1K4CA 4UMSA 5JORB 3ZGIA 1A8JH 3UX9B 5GISH 4KTDL 4EMZA 5IB1B 5JOFB 4PCTA 2CCLA 1AR1D 2Q8BL 3M6DA 4PGBB 5J6SA 3TBTB 3CK0L 4RGOL 1LE9A 1MWAB 3QEHB 3KWTA 1KGIA 4CBZA 5L4FA 4OCWH 5IWLA 2HWZL 2LLLA 2JKIS 4ZTOL 1BMGA 1EBPA 3C08L 4R7NA 3CVHL 5D7JB 3B2PA 1VF5C 2CJSA 5I16A 4LSPH 3PABA 2JTDA 1JHKL 3BZ4A 2A3TA 1U93A 4Z95L 5EU7C 1T04B 4FG0A 4K3HA 5IQ9A 3K2KA 1CICC 4PV9B 1WWAX 3QUZA 3WENA 1SDYA 1SM3H 1XF3A 3OGCB 3PXLA 5IB4A 3L9EA 1AGEB 3DK0A 4ZMPA 2HMIC 3GSQA 1Y07A 4KQ4L 4TNWF 1HXMA 3UOAB 4G1MA 3FF8A 4HGWA 2BJMH 4MYWB 3UTQB 2IXQB 5C9KA 2P3YA 5D1XB 5KOMC 2VRKA 1OP5H 1A6WL 5HP5A 3VD9A 2QKIC 3SKJL 3MNVB 1HHGB 1KPVB 2DWEB 4X7TB 4EUPB 3PWJB 3MRQA 4JO4L 4C56A 2V6HA 3K6OA 1I9RL 4LHUD 4S1RH 3MRGB 1NCHA 1R17A 3KPPA 1KG0B 1SXCA 4H8VA 4XMLL 4D3CH 3KE0A 4AUYA 3ULUF 1A7NL 1MAJA 3ARVA 1FFQA 4K7PX 1DJGA 5TE4L 2R23B 1RH8A 4HCRH 2NZIA 4KXAA 3FUMA 4AQ1C 3AWFA 1G6RL 3UZQA 1IM3B 5T5NG 2JKTM 5D7EA 1DVSA 3K0YA 2X88A 2R1WB 3C87A 3LZFL 4HALA 2GK0A 4QKTA 4L8CA 3KPSA 1YJDL 2APBA 3SDCA 4HCGA 4AH2B 1GS6X 4RESB 3BO8B 1B9KA 1UD5A 5D4HA 1OT4A 3PP4L 4TSCL 1DJHA 4IDLA 5CXPA 4BE6A 1W0WA 3WTSA 5HJ3B 2Z9TA 1ZV2A 5C0JB 4QRTA 2G5RA 2DQUH 4HPYL 3TBCA 1JPTL 1BZ7B 1BXUA 4Z5RB 1CICA 4LP8A 2BIMA 1QAWA 1YEGH 3ARBC 3C5ZB 3N44B 3FSAA 3RY4A 5KSAB 4ODUB 3MUGB 5KANI 5C0BB 3CSBA 3HE7B 3EKCA 4LGSB 3H7BA 2C9RA 2WWOA 1PYWA 3PNWB 4JRXE 4WW2B 5D6DC 3W82A 5HHXL 4UTAL 3DJTA 2WSDA 2VDQL 4N20A 2KI6A 1I8MA 4NQXB 1AMXA 5EWIH 4V2BA 2DI9A 4K7PH 4Y16C 4W9GC 4QTIL 3ZHFA 4XMUA 3VI3E 3DPBA 3IAQA 5D7LA 1TU2B 5E8OA 5BQ7B 5KVFE 1NBZB 3DSFL 4UILH 2E9IA 3HKFA 1SN0A 5A7EA 5DO8A 1O6SB 4OFIA 4BFRA 2PW2B 3QQXA 4Y2DD 1B3JA 2H32A 5F8QC 4U1NB 1J9QA 1XR9A 2EE0A 2IH8A 2NY7H 4JQVC 4AGQA 1FA4A 1ZVYA 3GGWB 1ZTMA 1IKOP 1S3KH 2W60B 4U6VL 4AQ1A 1JDDA 1D5RA 4ZDHA 1BSIA 4LDOB 3BGFB 1A1MB 1ZWIA 2X0VA 4MA8H 4GRLD 2H1LM 1GC1C 4AGPA 5ECGA 3TZVB 1NGYB 2ICCA 4UT7L 2PCPB 4UT6H 3U7WH 4Y4HB 5D1QB 1DQIA 2J12B 3FO0L 1MNUH 5AL0A 3GC3A 4JFZH 3PWVB 2MCPL 5KG9B 2I9TB 4AEIL 1HYSC 5AG9A 2AQSA 5L2JB 3HB3B 1J5OH 2KPNA 4FEMA 4GLRH 3K72A 4F7EB 5K59E 1ET5A 3GMQB 4DAGH 3RA7H 5M94B 2DB8A 3IT8D 4Z78A 2GUOA 2YZ1A 3I84A 3AG2B 3QJZA 4LPYA 1ZLSH 3DGGA 2VSMB 3MRRA 4F57L 2GC7C 2ITDA 3QZMA 3WMSA 3B7RL 4KX9A 5CZXC 3VYPA 2V3DA 1OLZA 4GH7B 4AEHH 5D6DA 3U1SH 4KO7A 4FOMA 4F7PB 3G5YB 4TQEL 1KBKA 4PG9A 2OCCB 2BOCB 5F7YC 6PCYA 5AAPA 1JRHL 3QG7H 5EEWA 2GYSA 2PW1B 3PUUA 3VXNA 3K71B 1VJSA 3FFCA 3O9WA 1AH1A 2VDKH 3MV8A 3OF6A 1RI8A 3PP3K 3HPJB 4RGNE 5FGCB 3CN3A 2ZCKH 2HT3D 3IXAA 3V2AR 3RNQB 3EGDA 4QHUB 3OXRA 1GJWA 2VZ3A 2X4NA 1F3JA 1AHWA 2EDYA 3RVWD 2VDLB 3CDZA 1J8HE 5D2LE 2HH0H 3RYMA 1OD7A 3FQUA 3NZHL 4YHKH 3FN0H 1N59B 3BVWA 5AYUL 3FT0A 3S36X 2VR8A 1N0LA 3AY4A 2ESVA 5ANME 3SPVB 4YC2C 4U6YB 1JN6B 4UV7H 1X3DA 2X4OA 3VD2A 2A6DB 3HZYA 2VLKD 3T4AA 4PWEA 1PKQA 3Q6GL 4LLUA 3A67H 3QDJB 2AK4B 1DZ0A 4I3GA 4BK5C 2EUVA 5A2LH 2Y72A 1IVLA 5MEOA 5DJCB 3BRDA 3QUMH 3LZLA 1CK0L 1C5CL 3N1FC 1A1NB 3FQ4A 4M56A 5GSRB 3NK3A 1XZ0A 3KYMB 4PLKD 1ZLDA 3KGRA 3GSRB 4NRXA 3QIBC 2AV7A 3FT3A 5HVGB 4LPCA 1SBBA 5B3SB 1NEUA 2DTMH 1A7OH 3B1TA 3E2HC 2CK2A 4MJIE 4RZCB 3BQUC 1S7TA 3HJ0A 4ZFFB 4WJ5B 3ARYA 4I5BB 1FZMB 3DYOA 2DD8H 1KJMA 2R4SH 3NQKA 4FLOA 2VQTA 2AEWA 3IXTB 5DTFA 2JKRM 3MKKA 1N6UA 4M62H 4NNXA 1QX1A 4NZRL 3CU7A 2AGJL 3MJ9H 2AJYH 5DYOB 2XV0A 1OPGH 3GDBA 1SMAA 3DXAD 4PJEE 4NN6C 4QCIB 4PJDE 1UOVA 1RZJC 1PD0A 4KRMB 5D71L 2EH8H 1JXFA 4FERA 4Z7VE 2ZKHH 4FXGB 1IGCL 4N2EA 5IFAL 2VIRA 1A1OB 3RGVD 4IJ3B 4HLEA 5JO5A 1T0NA 1MOEA 4IBLT 5IZ7A 2FQDA 4TNEA 4WI0A 1BOGA 2Y3NA 4FQXD 2VR9A 4KGJA 3V0VB 1BQHB 2WXMA 1JWSB 4OZIA 2EDJA 2VRAA 3FCGA 2OXGB 1MHPH 2P42B 1MN4A 5IBTH 4EQ2A 1G7IB 4X7EC 3NZ8A 1F4WL 4ZTPL 4YSAA 1Y7VA 3IM1A 1KELL 5CR8A 3ETBF 3HNVL 3IDXL 2WNGA 4DP8X 3MRFA 1I1RA 5LWYL 3UZVB 4TLSA 3RWJB 4J4PD 2OJEA 2OR8A 2ZWYA 2BOBA 2Q3AA 3OKDB 4UANA 3DTUB 4TRPH 2IMMA 3GHEL 5H94A 3RWGB 4WEUD 4YVUA 1A3QA 1FH5L 3JZ7A 1RZKH 3FRUB 3ALPA 4Z7NF 4HS8H 4N0RA 1KEGL 4E41A 3TYGL 2WLMA 3UYPA 4L3FA 3MRMA 3QIBA 4YHIA 5IUCA 3TYFA 1LO5A 3ATEA 4YDLC 3S7GA 5HI3D 2GJZB 4OCYH 2DKUA 2FLMA 2EXSA 3KH3A 4X5WB 1E67A 2OMXB 1P2CA 5DVLA 1A7RH 2OKMA 3HZMA 3KPMA 4XNYH 4Z76A 2CHDA 5HVHC 1TTFA 5F9OH 5JYLA 1MFBL 3B9KD 4FZEH 5ACLA 4CRPA 4MD5A 3NDZE 2I24N 4AL8L 4AV0A 2VDMB 5ALCH 5C07A 1BM3L 5CJXC 4PGEA 2NR6D 3GK8H 1JHLH 4DKDC 2VABA 3PPEA 3SPGA 3MV7D 2JKXA 3UABA 4PMFA 4F24A 5AVSB 3ME0B 3IVKA 1LO4L 4P59H 3E8UL 5SWZD 4D0BB 4XCEB 1ZVHA 3II3A 4HG4J 3G5XB 3BFWA 1INEH 5E1AA 3APNA 3VGBA 5DO2C 1LEGB 2XA3A 5J06A 1S7QB 5FWQA 1ND0B 5HI5C 1MPAL 3KW8A 2OP4L 2XUWA 4U0RB 1Z3GL 1HC1A 5D1XE 3CFEB 3MROB 4MS8C 1ZVSB 4CW1A 4PJGB 1HDMB 5KYUA 1C5BL 1H0DA 3G08B 4IRZL 1QHOA 5D2NB 1LWHA 3CVHA 4FJ6A 1KTDB 3BP7B 1BQLH 1J0JA 3ECVA 2D0HA 5T5NF 3GSVB 2PPEA 4U6HA 2J4WL 3KNBB 1GA2A 3KJ6L 3C9NA 2WXNA 1KGUA 3SO3B 2R59A 4D8OA 2CLRB 3MV9A 4W9EC 5C0EA 1MIEH 2XWBA 2FJGB 3SE4A 3ZX1A 4OZGF 3GF8A 4B9KC 4YDIL 3RGHA 3GRWH 3HC4L 4NNPH 1IEHA 4YWGL 3QZWG 1OSZA 1ZGLP 3P9MB 3V79C 2AJVL 4HJ0D 4EIBA 4G72B 1G7PA 3QJXA 4L5FL 5FOBA 4AOFA 2WYTA 2ZPKL 4ZNEA 2X5PA 2QPFA 5GGQL 3O6FB 3LZQA 3KPRA 2DI7A 2YQGA 1AGFA 3D6GA 3UDWC 5IY5B 1YNKH 4MJHA 3KW7A 5CJXA 1DZBA 2PCFB 5J56B 2ZOLA 4WO4B 3JWDL 1ZEAH 4GT0A 1MIML 3A21A 5GS0L 5IVXA 2RH0A 1PPIA 2CDEB 2R2HB 3LH8A 4R5VA 2EYTA 2PXYC 2QHRL 4JPVL 3SCMB 4U1SA 2NX5B 4Q6IA 5A2IH 5C2BL 1U8IA 4AKPA 2PPCA 4PLJD 4ZZFA 5C0BE 5CFHA 2MQGA 3II2A 1G6RA 4NB7A 4IRJB 3EJPA 4JY5L 4JZOB 3CH1B 4XP9H 1G1YA 3ZT7A 4EN2A 5JIIA 3IPBA 4K94H 4L37A 1B4JH 1WBZB 2VQ1A 4NZTH 5AVWB 4OF7A 2OZ4L 3VCLB 4EIZC 3WI9A 5KEZA 4XH2B 2G30A 4L1TA 2FYYA 4J3OC 4Q7DA 1J5DA 4W68A 2E8ZA 2FT6A 2NLJA 1QA9B 3WU1A 1BX2A 1LDPL 5LNDA 5BVJB 1OAXH 1WPCA 2WANA 1X5MA 3H42H 3NYKA 4HF5L 2OMWB 3Q43A 5E9DA 4NUJA 3K5SA 1MY7A 3GMNA 1KB3A 1S7UB 2NOYA 4HUWA 3ZK0A 5IHUL 1XD0A 1TYRA 1THAA 2FJFB 2PLTA 3DDGA 3V0WH 5DMJB 4NHCH 2UX6A 3NPSB 5FW7A 4FADA 1D6EB 1QFWM 1FNHA 4U2YA 4LRIC 3HBPA 4OZ4A 4NKOA 4P06A 4I18C 1WBYA 4UTAA 4EN3B 2FGZA 5BZZA 5D1QE 2N59A 1IT9H 2W65B 3Q44A 1N70A 4QD2E 3ZR6A 4CVXA 3M17A 3UDWA 4TL5A 4I0PD 3SOBL 4UNUA 3LZRA 5HD8D 2E7HA 1W9XA 4PUBL 1LO2H 3WTTA 5ERWA 1DJXA 3CBRA 2YMOA 5DXWA 1WZ1H 4DPCX 2V2WB 2FX7L 2XVKA 4I3SH 4ALAL 4F58H 2G9HB 3HG5A 3LNGA 3QB7C 2VERN 3F7PC 3VI3F 4L8BB 1I3VA 4PBVC 3LKQA 4CA4A 3O0RH 4HD9A 5IR1B 4F20A 4TV3A 4NO5A 3C2AH 1UJ3C 1YEEL 1G94A 2L7JA 3P3UA 4R3SB 3VFOB 4RIRB 2VC2H 1U8QA 5LGJB 1MREH 3PYCA 4FNUA 3TBYB 1BMWA 1F3DH 5C70A 5I74B 1ZT1B 3O3AA 3QORC 4G9FD 1KXVC 2GTQA 4X99B 5FFOA 2IAMD 1JGLH 1ZDSA 3ZE1E 1YMMB 2VUOA 4XNXH 3N1MC 3FONA 3UPCA 2CGRH 3EJUA 2AQ2A 1O5PA 5FGCE 1RUPH 3PHQA 1S7RB 3WFEL 2NNRA 4JREB 3GYRA 1K4DB 3K4AA 1P4BL 3QARA 4Q9RL 3WL9A 4GKZA 2CRYA 4Q56A 4CSPA 4YHZL 1U92A 4L3CA 4M61B 3U36A 2Y23A 2NYKA 3T0EC 1G4RA 2J6EH 4G82A 1DQQA 3UP1A 5MHSE 4Q74A 1LE5B 4JPKH 2CO3A 1H8SA 2XY1A 4IOIA 4PVLA 4S1DD 2G75B 1L0YA 3NSDA 2OTWA 2Y24A 4PI2A 3VXQB 3ML9A 5JQ6H 1GZQA 4N2HA 1UD8A 2WOYA 1M53A 3L5WB 3LRGA 1G87A 3VXOA 4CMMA 5C3IA 5K59F 5TDNA 2XNAB 4PJ8D 2EE9A 2NYYC 2AK4E 3QDJE 3BKML 3O2DL 3FCBA 4M5ZH 1AY1L 3FO2A 4NYLB 4J2QA 1UHVA 4WTQA 3QUKB 3J07A 3GHPA 4HGMA 3TLRA 2FECI 1PJ9A 2PO6A 3WG7B 4ZMOA 5JZ7C 4NQDA 4KTEH 2DLIA 1NFDE 1GGTA 3GMLA 5KOVC 5CM1A 5FB8A 4M93C 5IEHA 2ERJC 3CV5A 4BZ2H 3K80A 5D6CA 3X1NA 1LO3H 4PGDA 1NC2D 4OD1H 2Y25A 4JQIH 3Q1SH 4F9PC 4XVJL 2QQNL 5KS9E 1S5HA 2WLKA 1QR1A 1MH5A 3FQYA 2VDNL 1UJ3A 2NXZB 1ODUA 1OB0A 1EGJL 2VTFA 2X4TB 4NUMA 4OLWL 3SHSA 3U7AA 3UROR 3IS1X 4BDVB 3OMZA 1RKRA 3GS0A 7FABL 1KXQE 1QNIA 2Y7NA 4KDTC 2CBTA 2FB4H 2APWA 4JNXA 4KKLD 5DJAB 2NXYB 3O6MH 5D2LF 5C7ZA 3CXFA 5C0IA 4GG6B 3FQTB 3IDMB 3NVQA 2GSIA 4GSDL 5I0WA 2BPBA 3MRPA 3VXUB 4ZW3A 1L6ZA 2ALWA 3CFDA 4PEEA 4U1KB 1EHNA 1YEJL 1FFNB 4GYBA 3UO1H 3RRQA 3KXFE 5DD6B 5J11B 3L7EA 1JGUH 5GSVA 3L1GA 1FFTB 4Y16D 4HEPA 4ZTEA 3BXNB 3O2WL 3TO4A 4DIXA 4UBDD 5F9JB 1G7HA 1BJ1J 5I82A 4Q52A 4JO1L 5E5MA 4F3FA 4ZUVB 4QLRA 3VXPB 3T0EA 4JM2F 5KVGE 4CSTA 2BY3A 3V5HB 1IKFH 4NLAA 3LZPA 4N2MA 1QI5A 5E70A 4JN1H 5F1NA 5IOPA 3TNNA 1RZ7H 3US0A 2C3GA 3GRGA 1X9RA 3WKPA 3QO0A 1X5AA 3RTLA 3ZMNA 4G5ZH 2X12A 2A77H 3DX8A 3HRZA 4YSSA 1S6NA 4PRDB 3BN3B 2Z31C 2X7LA 3D08A 3QUYB 4GW5B 5IROC 3WOVA 2ZXAA 4J3UA 2CU9A 4XNQB 4I4WA 1U8OA 3MUY1 5ANHA 3RWHB 1N64H 3EFDH 4GBXD 1GZHC 4O2FB 4QXWA 3UP6A 4PJEF 1NMBL 4PJDF 2IGFL 3OXSB 2AV1A 1MRDL 2ZXQA 4MAUH 4TUKH 1GJIA 2X44D 5JW4M 1B0GA 3CFKA 2FX9L 3LTVA 4F9PA 5GRVK 2GW5A 4NKIH 1HE7A 1VZGA 1RIUL 1EANA 3EBGA 4M6OH 5IHLB 5B39A 3KLHC 1AE6H 4LQFH 2DS4A 1JZ8A 1V3JA 3BWZA 4L4JA 2KQMA 5JOPE 4XX1G 5E08L 1QLRA 3TWCH 5KZCB 2UVFA 2DEWX 2EYSA 2CO6B 3LS5H 1KBPA 5B1KA 2XPYA 3LRKA 4ODXB 1T5WB 1J0YA 3K1DA 1N2RA 4KRLB 4BJLA 4R0LC 3UAEA 1K6QL 1T2QL 4UINH 5FYJU 2NY2B 5BXFA 3AADB 3EHBC 1MDAA 3DX0A 3O41A 2QQKL 4XCYA 2J1KA 1H3WM 2WN3A 3IU4H 4DVRH 3AUWB 3OZ9L 1MEXL 5D7JD 3QVAA 2GIMA 2VISB 4NKDA 3WMPA 3D18B 3OLDA 4JFSA 4ZSOB 4ODTH 5KW9L 3GRBA 3TF4A 2JLLA 5DEFB 4UI2A 1FLRH 2CHWA 3EG9A 2I60H 4YGVB 5DMKA 3LB6D 4WFHD 4AIOA 3IMUA 5A2AA 4AZ8B 5DUPL 2O4EA 1DVZA 3T0DA 3WUWA 1I3RA 5D2NE 3V4UH 1SMOA 3QXAA 3BVNA 2BSEA 1BOYA 4ZMQA 1XB8A 4ENEC 4PWGA 5IIEA 3VSTA 2YXFA 2EUZA 1NIFA 1UXLA 3LRLA 3UXFA 3OAYH 3D9AL 1E2VA 5T8IA 4JDVA 4P2RA 4XHJC 4XO8A 2K4WA 5AVZB 4RCAA 4L2YA 4BV1A 3BAYA 4FGMA 5E94A 1VPOL 3RDTA 4EDXB 1H8NA 5C0AB 1ETB1 3WEOA 5ID0A 5AALA 1HN1A 3R06A 5INCB 3VE0A 1K8IB 2F74A 4K8RC 4U1GB 4KU1A 4Z7OB 1OGAB 2YUXA 4U1JB 3VWJC 1M7DB 1TNMA 1CGSL 3ATFA 1IM3D 3T08A 4DGVL 1Z9OA 3IK2A 4GIAA 2FBJL 2A6IB 3NRFA 3LN9A 2C7FA 1IGMH 4JO5A 4WAFA 2NX5E 5I18H 4JG9A 4QAWA 1E30A 2YPLD 1AXIB 1Z9MA 3L3JA 3ULUC 2IG2L 2WB1A 2Z1KA 1LNUB 4NERA 5DD3L 4KI5E 2GTWA 3H9SB 3MLSL 3P0YL 3IB4A 1ZA3A 2R39A 4KJQC 4OCRL 4WY7L 2NT0A 1IC0A 2NQDA 1HWWA 4K9JA 1WFIA 4PS8A 4NQEB 3CNKA 4JVWA 4DJMA 3NCEB 1FGVL 3C5ZD 3IFPB 4FYTA 5KSAD 3KPOB 3ZR5A 3VQ1C 5C0BD 5FO2A 2XWRA 3VRJB 3PWNB 1P1VA 4LVOB 4N2CA 3TU6A 1QBML 4B3EA 2VDKB 2NY0C 3EF4A 3HHSB 2Q10A 3RX5A 3L4YA 1E6OL 5IFJB 5EEUA 1FG9C 5K9KB 3O81A 3BN9C 4ZO7A 4AK1A 1T03H 4J7RA 4R7DB 4HLZG 1OAZL 2XFXB 2WQAA 5HGAB 5J3HD 1DP0A 2YGPA 1UOWA 3TTYA 1P7QD 1VGEL 2DZEA 4DCQA 1SHXA 3JSSA 1MCDA 4QF1B 5I26A 3IE9A 2YAQA 2OZ4A 4MAZA 1YEHL 2Y06L 1RP9A 4ZMYA 2EACA 1CT8A 2Z1PA 3VGHA 4K3JH 2OW7A 3NFPB 4OLXH 3SE3A 4DP5X 1H3GA 2IH9A 3QUMB 3IGFA 4LF3A 1T1ZA 1GL4B 3GSWB 5D70L 4X80L 4EDWH 5I8OL 5DWUH 1QFPA 5I9QB 5GRWA 1MWOA 1K72A 1WTLA 2LT9A 2VL4A 3L2MA 3NCJH 3KJ4B 2MIZA 2GJPA 2DIBA 4YXLH 4TF4A 2W92A 2XTJC 5B38G 4J6RH 1I1CA 3OM3B 4X7CC 2CDGA 4Z18A 4BZ1H 3C6SA 3EJRA 1TTCA 1KYOJ 1IBFA 1R47A 2WKOF 1R5VB 3I9PA 3GLZA 3BWAA 5HI5D 1PLAA 5EC1B 1OV8A 4OIFA 4OI8A 4FTVD 1H3UA 5EOQL 4UIKH 3QI9C 3MA9L 3IWVA 3BMVA 4D9RD 2RB8A 4P46B 3RAJH 3SKNA 3CMOH 1IM9D 2E47A 1P4IH 2ED7A 3HJEA 4XVOA 5I19H 4HSAC 3QCTH 3BAKA 5CJQL 1NJ9A 3GWJA 2D03H 1H15A 5ID1B 1F2QA 3QCUL 4WNQA 3MAWA 2XG5A 2C9SA 4KO5A 2VDRL 5DT1H 4EIGB 3FZUD 2ZJSL 1CE6B 4MMZA 3EGSB 1WVZA 2CA3A 3RB5A 1E8ZA 4GRMA 4QHLA 4R4FL 4H8QA 4BK8A 1S7XA 5BVPL 5IGXH 5MHSD 4WSJA 4FABL 2YAHA 5LVEA 1MRCH 4LCYA 4NZUH 5EU6B 3RL2B 2EDXA 2P48B 2EEAA 4AXWA 4MXQD 3DVGA 4WFEE 2EXWC 2DJMA 4XBPA 4KROC 4I3RL 1DL7L 4R96A 5EG6C 3ZE1F 3QUXC 2BW4A 4WWNA 1ZLWH 5IM7A 1WEJL 5EBMA 3X1BA 4UQ3A 3UYRL 5GJSL 3KCPB 3VM5A 4D9LL 4NSKB 4P4KC 2G0KA 2VXQL 2MQCA 3M45A 4DESA 3BYTA 5EUOB 4KZ0A 2BVEA 3Q3GB 5D5MA 1MCWW 5I1JH 4RAVB 1CI5A 3VFPA 1QLEL 3O2DA 3ULVH 3LQZA 4LCWB 5E5UB 2OZNA 1NDMA 3IGAB 4ODHH 1IAIH 3VFMB 3VXUE 4GMSL 4LAJH 4U7MA 1HXYA 1A14H 4NM4H 3LKOA 4MQ7A 3E6HB 1FIGH 3AUVA 4FZ8H 4N0CD 1UWEL 3GLAA 4Y2DA 1WWBX 3ASOB 2FWUA 1JZFA 3FTZA 2O5YL 2F19H 5LCVL 2XVGA 3ARED 2WQ8A 3UCQA 2YC1A 3P77A 3H1ZA 4D2NA 1WLHA 3IJEA 5C9JB 1NFDF 3DV4B 1QLFB 4Y5YC 1A25A 1IE4A 2XZAL 4CKQA 5I23A 3O6LL 1EZUA 3PHOA 4Q6KA 4DZBB 2R9HC 1Q9WA 2J8UE 4Q8BA 5KS9F 3MBEB 1W91A 4U3SA 3QDGA 3T0AA 1QBLH 4KKAC 1BFVL 2BINA 4H0LC 4JG1H 4GINA 3OAUH 1YY9D 4M03A 1I8LC 5L6YL 1G1KA 1TYJA 4G8EB 3FB8B 1JIBA 3FO1A 4OQTL 3QUXA 4MAYC 3WIHL 2O5NA 3GI8L 4XGZA 4XVTL 1YYML 2Z64C 1U8CA 4JM4L 3JWNE 1XGUA 1GW6A 4HIJB 1CD1B 1T0MA 4DFIA 3ZDYB 1AZBA 2K9UA 1MCKA 1ROCA 1YN7A 1CDBA 1WIPA 2OR7A 4P4KA 1OXYA 3C8DA 4IBWA 2XACC 3MOAL 3MXVL 5E9AA 3WSQH 4IK6A 2APXA 3SQBB 4PGZA 1CBVH 1OANA 3I74A 5EF0A 1J9RA 1FN4B 4Y0GA 2DIAA 3AY2A 5AWNL 3RG1C 5LGHH 4OV5A 1NAKH 3AJ7A 4PRIA 3LHAA 3VM7A 4G9DA 1AQDA 5F7HA 2WXFA 4KVPA 2OMVA 3QORD 1CIUA 4LEOB 5JOPD 1G9ML 2AI0H 5LNEA 1J9TA 4ZSOE 4ZAKC 1M3JA 1T7WA 2NDGA 32C2B 5AW5B 3W9DA 5HHQA 1P69B 3SBWC 3AXLA 2BHUA 5L7XH 3Q8FA 4Y8DC 5D9SA 4XP1H 1T6WA 4YDMA 3KWWB 2WXKA 4EQ3A 2C9AA 2CPUA 3NG5A 4HWEL 3AG4B 3TGXA 2K78A 5SX4H 4LLQB 3VGGA 3BPOC 3HMXA 2ZX7A 4HLZH 4ABVA 4HZLA 1OTSD 4F2EA 3REVB 1FL5B 1F6LL 1IC5L 3GMOB 2ZICA 1R3LA 5LDUA 2WWKT 1CLYH 5BZXA 1UM4H 1OARL 4RMQA 2GBVA 2NYYD 3ECWA 5F21B 1XGTB 3SKMB 3WN5B 2WP3O 4U1LA 3T9WA 5DQ9B 5D8JH 2B9BA 5F9WC 4X7DC 1RPKA 2PETA 4MA7H 1R5WA 4HX1B 2WTRB 3QPQD 4YLQT 3P4MA 4CMHB 3MCKA 3NA9H 4K5NA 2EIEA 4P2YA 4XXDA 3NESA 4Z7OE 3RFRA 5EO9B 5DMYA 1X5ZA 4WVRA 1Z0MA 2BM3A 1S9VB 1MFEL 3BIKB 1UA7A 1MSPA 3KVDD 1DN2A 3QQ4B 1AD9B 4RGMC 3PG2A 4Q9CA 1AQKH 1THCA 1OSPH 3UBXB 1AOZA 3P3RA 4HUVA 4RRPM 4NC1E 1P7KB 1QSEA 3LSOA 2NNCA 3QJFB 3VFWB 1G7LB 1VSCA 5LJYH 1E5ZA 1ANUA 4OF3A 3RGVA 1TZIB 3CFBA 3SB3A 3VFRB 4IMKA 3H9SE 4L0PB 3T65B 2X1WL 4EXKA 4FQXA 4ZAKA 3P4OB 3L16A 4JAMA 1MFCH 4TSAH 1D5MA 1ESOA 2VC2B 2BHYA 5GRYA 2NUTA 5E03A 3SBWA 3SCMD 2NX5D 4WJKB 3ZJAA 5BUGA 5DFVC 4GKOA 2W0PA 2FBOJ 2HLAA 1I3GH 5HDQL 3L3DB 1XBDA 1IEBB 4IRJD 1FV1A 1T1WA 4J4PA 4HXAL 3P11H 4R5XA 1M2OA 1UACL 3K4DA 2FH8A 3I3DA 1MHEB 3KMDA 4NQQA 5KYWB 3FT4B 1HH9A 1KOAA 2YEZA 4RLDA 3TF7C 1S9YB 1PLBA 2O5XL 4HIEB 2DMCA 1MFAH 4FQLL 5KJRL 5EO1A 5GS1B 4PRBB 1W80A 3BT2L 4WSKA 4X7FC 2L0DA 4YAQB 2KL6A 4Z7WE 4QO1B 3L3HB 2Z93A 4NLHA 4YH6A 5IB2B 5IROD 5GGRA 3D51A 4JCMA 1VRSA 1MG3C 4J8RA 3ARFC 1M71A 1XF1A 3FOLB 1XTLA 1KACB 1F42A 5C09B 2FHCA 2XQYK 4X4KA 4RWYL 1EEZA 4KI5F 1JV5A 1S7WB 1SYVA 3HMWH 3WV0A 1OAYL 1ID2A 2YQ3A 4O9HH 1CFTB 4HOWA 3MUHL 1X9LA 4EN3D 4NO3A 3REWB 2Z3FA 5C0DA 2M8XA 4JJHA 1NL0H 5HYSB 3QG6A 2D7TH 3DIVA 2PPFA 5SWZA 5GZNC 1HI6B 3KPTA 1UADC 4F8QA 1W0YT 5HYJB 1IGJB 2UXGA 1M9WA 3C09C 4AM0A 2XKUA 2VMDA 3S5LA 2NPLX 1ADQL 4RVBA 5JMRA 3O3EB 5EF2A 1OCWH 3W9EA 3VXRB 3EHBD 3I9AA 4PTTB 4X4YA 5DFAA 5J1AB 2C4FU 4YNYA 4FQ2L 4NO0B 4BINA 2XWXA 1U91B 1F45A 4X8CA 1YNTB 2BP0B 3HVDA 4OT1L 3GB7A 3X2QB 4B53A 4FXKC 2BSBA 1MW1A 4K71B 2IC2A 2WIIB 3MX0B 2QR0B 2X6VA 1FZKA 2J1XA 2Q76B 3Q7JA 2LHAA 4QRSB 1FPTL 3GTVA 1TEYA 2X1QA 1MVFA 4LSRL 4RNRB 2FATH 3CZGA 5E7FA 5E1IA 2J71A 2QADB 1WT5A 1TJIL 2EAEA 1SOXA 1BGXH 1YMMD 2NY1C 4ODVL 3P2BA 4KJYB 1K2DB 1FFRA 4I88A 5E6SB 4ZD3L 2ARWA 3KGTA 4K94C 4F8PA 4KVNH 5AW0B 2CM5A 1TEFA 3EYSH 4HUUA 1HHJA 5E1GA 3UZEA 3GEFA 4X8JA 1MW0A 1YC8A 5CGBA 5C92A 3OJDB 3ROLB 4BSVA 4JG0H 2BX5A 3QQ3B 2JH2A 5DD5L 1PCXA 5EU6E 4HFUL 4NO2B 1IE5A 1JWUB 1O6TA 1CC3A 2A9AA 1CU4H 2FEJA 3NJIA 3US1A 4PRPE 5E8EB 3VWJD 4MLIA 4YXHL 5K39A 3L3KA 1CLCA 4WKZA 3VQLA 3VQMA 1BFOA 5E2UL 4JZNB 4UIMB 1MVYA 4E5XA 2R8SL 3EOTH 1JK9A 4LSTH 3TBVB 4A2FA 1UM5H 3GTTA 4EZJA 5JA8B 3UYOD 1YY8A 2CSPA 3D0VB 4NUPA 4CN1A 4M8QB 2UXVA 4X0KA 5EUOE 1CWVA 5IMLB 2AFNA 2LAAA 2E4FA 3HR5B 1IBGL 2EICA 4LCWE 4WI7A 1DFBL 4PV1C 3VW3H 1M6OB 1WFUA 3DURA 3O4LE 2BHFA 1VGKA 4NI3A 2NXZD 4Q89A 3AB0C 4RMTA 4A66A 5KJ7E 4KJQD 1RZ8A 3CN0A 4ZX6A 1BECA 3TPUA 4FXKA 4N0FA 3A22A 3B6SA 4N8VA 3W5MA 5E00A 4WUUB 2FSDA 1GH7A 4G8IA 3U0TB 2Y0SA 5G4MA 4AJ0A 3QPXH 3I02A 1BQUA 4GT7A 2VSCA 5F7EH 3VXUD 2EDKA 1YMHB 4X6BA 2V7HA 5IHWA 3ECUA 5GGVH 4ZYKB 3BZFA 3QO1B 1CFQB 3IDJA 4BE5A 2QSVA 3RUGA 4RBPK 2UZYB 4MMYA 5HHMB 3EJJX 3WDIA 4RGNC 3QIUC 1TQCB 5GRUH 1KCVH 3V0FA 4CVZA 5I17B 4G11A 1I7TA 2B4CL 3OB0H 4JZJA 4PP1D 5IT2L 1E65A 4HUXB 5ELIA 1D5XB 5E6ZA 4I0PA 1EHKB 3AU1B 3NSCA 4X7SL 2L7QA 4L3EE 1TQBC 3C6LD 4PRHE 3W81A 3P0VL 1G9MC 1HAWA 3DROA 4GAYA 4XZUA 4PJAB 1VFBA 2VLJD 3N41B 1GZPA 1RIVH 3QUYD 3ZDYE 5MEQA 3ABKB 1BDYA 2FO4B 3CHOA 5I1AB 1U2CA 3T77B 1WG3A 2W0FB 2CO7B 1XF5B 2P5PA 1GS7A 4RAHA 3NJNA 1Q9KB 4JM2C 1ZANH 2N7AA 2AEQH 4X6EB 2XU9A 3WLBB 1N6QL 1KB5H 5JIDA 3FXIC 1HKLL 3T0VA 1RUMH 3GBNH 2BERA 2VDLL 3OQRA 1KJVB 2ZP8A 1HOCB 4G8FA 2IAMA 1D3CA 5DJXA 2XTJD 3IE4A 3VJ6A 2ZSVA 4QT5B 4LRNH 4G5AA 4ODWB 2V8LA 3V7AE 5MENB 1TJMA 2J8UF 4P9MH 2IO5A 4N2BA 5CBEA 4CGTA 4NP4L 4QRRB 2EDQA 1XGQB 3ZL4H 5KZCD 3OHMB 4N9GB 4U1IB 5CUSL 4OQTA 1Q72L 3WIHA 1ACZA 4J27A 4WI6A 4GJTB 4Y5XB 3T3MB 3LRHA 4DP1X 4LFHG 2XWJA 3TEUA 4G3YL 2NY2D 3VTMA 3GSNH 3BP6A 2HT2D 4NOFA 5CGMA 5IG7A 2HN7A 1C08A 1HZHH 1KGXA 2DBLH 3VD0A 1L7TH 4JDZB 5IOKA 1X5GA 5IJBC 4PJ8A 1RFDL 3ZUNC 2WVVA 2NY4B 1Q1PA 4NM8H 1E4KA 1J8HA 5FKPB 5D2LA 4TQHA 1KUMA 1NMCC 8FABA 1KIQB 2IH3B 3AM8A 4NPJA 4Y19D 4WTZA 1DHKA 1IAMA 4JY6A 2XN9E 5I1KL 2ODIA 1TXKA 3D85A 4TLKA 4NC0B 5ANMA 4DOHE 3SDDB 2VM4A 5TDPB 4XAKE 1MQKL 1QEXA 1SDAB 4RFEA 3MFFA 1JF1A 1NC2A 1OOWA 3SGJC 4R2GB 1BP3B 3V6OA 3D4CA 3QUHA 4N8PA 4I13B 1I9IH 3HW7A 4A55A 3U9PH 1FG2A 1JV2B 5HHPB 4ATTA 3KPNB 5IBLD 2KERA 2G2NA 1MJ8L 4G43A 2EC9U 2JIXD 4JM2A 3HOGA 5FGBC 3SGDI 1ZT7A 4EI5B 4OGAD 4HMDA 4LEEA 4B27A 4MJ2A 5I30H 4P57B 4UDTB 5C0AD 4HIXH 3C12A 4MJIA 3PDDA 1JNLH 3LNDA 4TS6A 4FNQA 5CF3A 4ELME 1QW8A 4Z0BH 1AC0A 1QOKA 4LCCC 4E36A 1OGAD 4IBQA 2QPEB 1QRND 4X83A 1TKWB 5DJ0A 1E3XA 1QEWB 1HCFX 2NQCA 1RUAL 3PU7A 4KKPA 3PJLA 2GT9B 1UH2A 4DGIL 5EEVA 4JB9L 3LQMA 5ESQA 2D9QB 3B3IA 3BEVB 4WGVB 4PJEA 4XOCA 4PJDA 3TA4D 1A3ZA 4EPSA 4AV5A 3B2VH 3OKLB 1JYNA 3DYPA 4NQCB 2CLZA 1R1CA 2ARJB 4Z7VA 4Y1SA 2DWDB 3TO2A 1IAIM 2C5DC 5KUMA 3FSWA 1YC7A 4FA8A 3FC8A 2DMGA 3EO1B 4PSPA 1PSKL 5GGVY 3UAAA 2BP8A 5CN2A 3WXWH 1G7QB 3CSGA 4HU2A 3DRTA 4O2EA 4Z7OF 2WXJA 4JPQA 3L9RA 4NQED 2R9HD 1U58B 1TJGH 3H9ZA 4A6YB 1H9VA 3H6AA 2WMPB 4NNYB 5D1XC 2H1PL 2ADIB 2CKNA 2JE8A 4GBXA 5HPMA 1A7QL 4WU5A 1RULH 3X3FH 2XVBA 3QCVL 2VDML 2EVGA 1TO5A 5I0ZA 2G3XA 3ZMEA 3PIQA 2XIIA 4BCYA 5MEPB 1YNLL 5DYFA 4OFQA 3SJVB 1OQXA 2CK0H 2XRAL 1BF8A 1JNHA 4PREB 2B0SH 4RFNB 1Q94A 4H25A 3BPNB 4MAYD 1C12A 2V7NA 4GG8B 5JORA 3NQIA 1TTAA 3LKRB 3WO4B 3PWUB 4HQQL 4LZKA 4NJ9L 2BHZA 1Q9OB 3BFOA 3EJYC 3FQNB 2QSCH 4GS7C 4W4NA 5JOFA 4PGBA 1IQDB 3TBTA 1BG1A 1Z1WA 3B7TA 1MWAA 3QEHA 3BUQA 3ZSSA 3BSHA 2JJTA 3FYEB 3CLWA 1BVZA 4OIIH 5HYJE 4S1SH 3RZCB 3WFDL 2NNAB 1IILE 2OMBA 5TGBB 5K9QI 4DP2X 1I1AB 1H3VA 3VXRE 2MHAB 5ABZA 3IDUA 1SY6H 1PCSA 4QRQB 1W2KT 3OMAB 4HIQA 3ZKXB 2EDOA 3NSXA 1LWRA 1T04A 4X2UA 5CIPH 5SV4A 1H6FA 4PV9A 4Z7WF 2Q3ZA 2X53A 3H9HB 1UWXH 2DJUA 4R9HA 3OGCA 5AZEL 3ULSB 1AGEA 4W9CC 3HE7C 4QIRA 3ILQD 3SE9L 4HWBH 2F18A 2VW4A 1FL3B 4FG4A 2X38A 3KVQA 1QWHA 4A67A 3UTQA 2IXQA 2DKMA 4CNIB 2WBJD 4R8WH 5D1XA 4ADJA 1DQLL 1HWHB 4OU3A 3UTPD 5KBNC 2FSEB 5LXGL 3MNVA 5KANG 4LCIL 5L9DL 1HHGA 1KPVA 5GRJH 2DWEA 2YD2A 4X7TA 5C0NC 3HCVB 3TH3T 2YBGA 1PY0A 3MRGA 4KAQL 5AENA 4YPGB 4MJ6B 3E0GA 3A4EA 4P46D 2PWEA 4UU9B 4YN3A 3T8XB 3OR6B 5KBDA 1A6ZB 2ALAA 1BAFH 4JPIB 2LU7A 2XZCL 4OF5A 5DEJA 5CCHE 1P5UB 2R23A 3TN0C 1BYOA 4AITA 5I8CB 2Z8RA 2RALA 4I77H 3HG0A 2H8PB 1IM3A 2D0FA 4WHYG 3L17A 4OJYA 6TAAA 4ZMAT 2FE0A 2R1WA 5T3XE 1DANU 5JR1H 4WI2A 2DOCA 2HKAA 1U8HB 2RCSL 3QA3B 4KRPC 4Y4HC 5D1QC 1MVUA 2O5ZH 5FO7B 4AH2A 3BO8A 3JWOC 4DT2A 3EYQC 5EU6D 3ZRFC 3DC0A 3PAYA 3CHSA 3W1ZA 2OSLB 3FTYA 3HB3C 2D4DA 4KPHH 5HJ3A 1MCCA 1YEFL 5C0JA 2FT8A 3CCHB 1BZ7A 1TMCB 4R7VA 4Z5RA 1EBAA 2B4CC 4NN7C 2QDWA 3NFSH 4PWFA 5T1JA 4APXB 2WUBH 3NABL 4S11A 5CLZA 3C5ZA 1PS3A 4OBRA 4UQ2A 4G6JL 5AAWC 5KSAA 4ODUA 5B1JA 5C0BA 3HE7A 2AQNA 3PQYB 2AJ3B 2N1KA 2BSTB 1CPUA 2AVFA 1MAML 3PNWA 2YSTA 3I3BA 4WUUE 4WW2A 3ZDZB 3JVFC 5C6TL 1JMXA 4YVNA 4FQHB 4I8DA 4WGWB 3L5XL 5MP6H 4NQXA 1TSHA 3LXAA 1WC7B 2DMBA 1JWMB 2Y36L 1P84K 3HG1D 4A7GF 2EZ0D 4ZXBC 4A38A 2JNZA 2N3JA 3S37L 1M3IA 5BQ7A 1TU2A 1NBZA 5FCUH 1OVZA 2ZYHA 3T8VA 1XEDA 1G7MB 4ZJ9A 2JKSA 1O6SA 3OAWA 3X3GH 3NRPA 2PW2A 2HKHL 2C1OB 1KFAH 3EJZC 1A8ZA 4U1NA 4KHTH 2VAJA 3UAJC 1E6JL 4DTGL 2W88A 3DX1A 3KEDA 1C5DB 1DSFL 5KVEH 1A4JB 1NGWB 1ZHBB 4B50A 2WWNA 4Y4FB 2SEBB 5EUKB 1NKOA 2XLLA 3GGWA 2W60A 3ARFD 3H3PL 5KVDE 2WKOA 1YO4A 4Z6AT 4J1UB 3MODL 1A1MA 1WZLA 4QWWC 5JHDD 5F44A 4TUUA 1U6AH 5DA4A 2ROXA 4PIBA 4HJTA 5TQ0H 4GEIA 4FS0A 3TZVA 3MBED 1NGYA 4OLZH 6FABL 2PCPA 2ZUVA 2HFFB 1SVBA 1A0QL 3CVIL 4Y4HA 5D1QA 3AT8A 3SE8L 4JFWA 1JPSH 2JKLA 3C60D 2ILLA 1U95B 3ILPB 2DM3A 2ZX9A 2VH5H 3BKCH 3PWVA 2JJVA 2I9TA 5KG9A 5L2JA 2J8HA 4J39A 1KPRB 3JTTB 4N5EC 5MI0C 1KENH 3SGKC 2FX8L 4G7SB 3LPOA 4F7EA 5BV7L 3BD5A 4QHNB 1CGUA 1KTBA 1RIHH 4M7KH 2HFGL 2ITEA 1NMAH 2NNFA 3VB9A 5LB1A 3DO7B 1WHOA 3CZEA 2IV9A 4P2AA 1ETZB 5ESVA 2E75C 4XC3L 4HBCL 3U2IA 4DHLA 1BVNT 3ZKND 3WS3B 2GJRA 4F7PA 1UM6H 3G5YA 4HOMA 3UBHA 1EUUA 4F93B 1H3PH 2BOCA 4OTXL 3LN5B 2BY2A 5FK9B 1OLLA 4M7LH 2OYLA 3S4SG 1BIIB 2PW1A 4P5KB 3K71A 2Q20A 2R29A 3LKPB 3K5RA 3P30H 3MV01 4FXGC 3CZSA 3HPJA 1MI5E 4Y2OB 3BWSA 4XNBA 3HG3A 4ODSL 3RNQA 3C5XA 1EJOH 4QHUA 5CHNB 1N3NB 4N6QA 3HAEH 3ZIYA 2NW2B 2F8VA 1L9OA 3DMMC 4XODA 3SPHA 2ZKMX 4A7SA 4AMXA 4HIHB 3VVVA 5GISL 5FYJH 4PR5B 3MYZA 1N59A 4GIOA 1BEXA 1V3LA 1ONQB 2EABA 5BS0B 3VFNB 3ARDB 3SPVA 5J0BA 4U6YA 1M57B 3H8NA 4P0DA 2R0ZH 4OCWL 5F6IB 1SN5A 3KVPA 2A6DA 2CRIA 3TJPA 2CCWA 4MKTA 2H0JA 3FRPG 3QDJA 2AK4A 2OXHB 2DBJA 4URKA 1KCRH 5I66B 1YEKH 3GXNA 2XI9A 3MBXH 4LSPL 1MAKA 5DJCA 1JXDA 4GKSB 2D31B 2RQEA 1A1NA 2IQ9H 3CU1A 3ISYA 5GSRA 4BBWA 2XBTA 3KYMA 3MJ8B 4YDZA 2HYMA 2XKNA 3KBPA 3GSRA 1MUJA 4XN5A 4R84A 3MLVH 4LLVA 1LEIB 4F33B 1SM3L 4LVNC 1XX9C 4RZCA 5B1BB 1E5AA 2W1NA 2FGWH 3QFGA 4ZFFA 1JZJA 4AQOA 4TVPE 4WJ5A 5KS9A 3OKEA 5F70A 5T1KB 4I5BA 1FZMA 2HUEA 2BJML 3OBAA 4Q58C 4HW6A 3STZB 1AG0A 3IXTA 1KXQA 5CGYD 4YBLB 1QWNA 5K9JH 4L9LC 4U7SA 1KF9B 4XMVA 3LH9A 5DYOA 5FV1L 3FU3A 1JGVH 3MTXA 5GPRA 4OSUH 4QCIA 5AW7B 1JPFB 3QSKB 5TK4A 5F7WC 5E2WL 4LOFA 5L0QB 4FXGA 4N2LA 4S1RL 3HEIB 1A1OA 3X14B 4KKBD 3KXFA 1D7FA 5AFAA 4XCFH 2FEEL 4W6XB 2QSTA 4V1DD 3R4RA 1BQHA 1JWSA 4HCRL 4DETA 1WBXB 5IREA 4YE4L 3ILDA 1HZKA 1GTNA 2D8KA 4BWUA 4F7CB 3AT0A 4L29B 4J28A 2VXVH 2DQDH 3GHBH 4UAOB 2QQQA 1KXTB 4S0SD 1ORSB 3SPJA 3BH8B 2FRGP 3EDEA 3BT0A 1S5IL 1NEPA 3UZVA 1KWGA 4P3DA 1HL4A 5AVYB 2GBTA 3RWJA 3MZTA 3MLTA 3OKDA 1UUSA 4OVUA 2V9QA 4ELMF 3SJVE 2I07B 5DU7A 5FO8B 1QTSA 3WNOA 4TN9A 3RWGA 1KGJA 4QRPB 4KX8A 3L5HA 3VFVB 4WHYH 3MACL 2DQUL 5KUKA 1E8YA 3L1FA 5ICXB 1PEZA 1QNZH 2VYRE 2G3ZA 2ZSWB 1OT1A 2CXGA 2XWDA 1YEGL 3BAJA 5KTEH 1E9QB 2G9KA 2GJZA 2LE9A 2ADFH 4YIQB 4X5WA 2OMXA 3LIUA 2WXHA 1AI1H 2OCJA 3W57A 5KSBB 3HN8A 5C09D 3UJJH 3ZZ1A 4BFNA 2QV2A 5CMAB 3FU5A 3MNDA 4XNUH 4HV8B 2ENJA 2B5IC 1XXFC 1X7TA 3ZKQD 5EWIL 2GI0A 4L9LA 1PLGL 3QNFA 4K7PL 2J72A 1CDHA 1OTTD 1XR8B 4RAUB 1JD7A 4LPUA 3V5KB 1CTOA 4WO4C 5EOCH 2VN5A 3M8OH 3QAZC 5KBMA 2E9BA 2HLFD 4PLOB 2GCYB 3ME0A 3V6BR 2A38A 3HE6D 1WFMA 3HZKB 3LD8C 4JJOA 4D0BA 4GMTH 4N3TA 2BIQA 2AW2A 4M8UA 1JG9A 4LLAA 1S9WB 3G5XA 2R4RL 1R3HB 1FCCA 5ADOH 1AS8A 4JRYD 1NOAA 1LEGA 3EH3B 2DLFH 3OR7B 5BUPA 4KI5C 1S7QA 4YX2L 1ND0A 1IBDA 1YEWA 3G9AB 3H55A 4MA8L 2LLNA 4PS7A 3C5JA 4KNUA 4FFYH 4NO0D 3CFEA 3CLEL 3APFA 1QBAA 3S8WA 2H47C 2Z34A 1JPGB 1USZA 1MELA 2Z7YA 3MROA 4G6ML 4UT6L 3DOIA 3U7WL 1HDMA 2EDWA 2ENPA 4FG2A 3G08A 1L9NA 1MNUL 3PNRB 2DLTA 2XN0A 4Z7UF 1KTDA 3BP7A 5D2NA 2X1OA 5CEYB 4JFZL 5JIHA 2ZF8A 2Z92B 4DUVA 4JFXB 5EZLB 2NCEA 2QBWA 5DJZB 1FFOB 1FHGA 3JV0A 1HNYA 1N8OE 2QADD 3PGDB 4Y7MA 4HISA 2CLRA 1GRWA 3B2MA 4JO3H 2Y7OA 4NWTL 4AGLA 3RA7L 4DP4X 1JZDC 2BNRD 4Z7AA 4UNVA 3U48A 1ZLSL 1NEZG 5I0VA 3Q2WA 4UMGA 4L0ZA 3UACA 3P9MA 4UWQB 4AEHL 4LIQE 1YNTF 3U1SL 4XWGL 4PJHB 4JFHE 4B9JA 2OBGA 1CDUA 2JCCB 3WYRA 4ECNA 2E74C 3O6FA 4CDHA 5A40E 5C71A 4JHUA 4EBQL 1M6UA 3F00A 2VDKL 2PCFA 2ZG1A 3L4ZA 1I7ZB 2OSYA 4WO4A 4KXDA 4FNSA 4MBOA 2CDEA 3R1GH 2R2HA 5LN8A 2ZCKL 1CLZH 3SCMA 2NX5A 2P5WB 2HX8A 5DUBA 1UXWB 5EC2B 2P8PB 1FQ9C 3AAZB 2AJSH 2APFA 3BZ5A 3D3VD 2HH0L 3V4VB 1SQ2N 3MRLB 4IRJA 4YHKL 3ZQXA 4FAAB 3OAZK 4UQCA 4JZOA 3ZDZE 2F53D 3CH1A 1JVOA 2R2EB 2CIIB 3JZYA 3LYRA 3D2TA 5FKAB 1WBZA 2DH2A 3OL2A 4B95C 3VCLA 4X42A 2DQTH 4WTXA 1IIIA 3O2VL 2KBGA 1UURA 2X09A 3A67L 3L4TA 4YK4C 1I7RB 1BZQK 4PJIF 1LM8V 1QA9A 4GSXA 3V0AC 2HTKC 4QEGA 3K8LA 3GSNB 3QUML 4NPKA 2D9CA 3U4BH 4JREC 3ATDA 5BVJA 2VZOA 1ZE3C 2Q2EB 2ZXCA 2OMWA 4APQC 3MGAA 5EU5B 2A6JA 5LBGA 3F7RA 1AQ8A 1S7UA 2DTML 1A7OL 1UTDA 2BVOB 3ZN6A 1RK7A 1CGTA 4LB8A 1IBBA 1JCKA 3UTSD 4AIXA 3S88L 1D6EA 5HHMD 5DGQA 4U4IA 5FYKE 4MD0B 1B9ZA 3HVNA 1X5KA 4JRFA 3B5GA 2DD8L 4BQBA 1H9DA 1PFOA 4B9ZA 4LKCB 4EN3A 2VCOA 1OP3K 2HAZA 4QLWA 1MCBA 4V33A 1BJMA 4FQIH 4JUTA 4M6AA 3MJ9L 2W65A 3B8SA 5IVOA 1OPGL 1X6NA 3HS0B 5TE7H 4IMLB 1FFPB 2WBKA 2KYIA 3HC3H 2BRRH 2EH8L 5C0FB 2K70A 4BFFA 2ZZUT 1IEAA 4W6WB 1UVQA 3S36L 2OMTB 2V2WA 3ESVF 1JNJA 5HJDA 4L8BA 2XG4B 4JUSA 2ZNXA 4NEHB 5IR1A 5HDOA 1OAJA 4M1CD 5F3BB 4JHAH 1DVFB 4R3SA 1Y18B 3VFOA 4RIRA 3VO0A 1EFQA 2EDRA 4N8CH 3VB8A 5LGJA 4HJUA 5J6GA 2C3WA 3O3BB 1AO7B 4G6AC 3TBYA 3F7VB 1DFXA 3OMIB 4IJTA 3M88A 3CFQA 1ZT1A 1Z6JT 3DVNB 1QSFB 4LK4A 4X99A 3V0GA 5DUMH 1YMMA 1ET8A 5JIQA 2H1XA 5F7DB 5B8CC 5MEND 2X2YA 3TJHC 2EDMA 4JKNA 4AI7A 3IAGC 1F2XK 3HFMH 5J11C 3N41F 3WEXB 1RZKL 4QRRD 4HS8L 5J13B 1K4DA 2IDUA 2D7PA 1MCPH 5CEZE 4M61A 4O4YH 5ISZB 1AGDB 3VSUA 1DBKH 1KN2H 4OCYL 4QXUH 4BEIA 1SLXA 1LE5A 3T2QA 5BS0E 1DBMH 1J7VR 1A7RL 4XNYL 2C7UB 2G75A 4RMRA 1B4LA 1Z32X 5E6YA 3CXDL 1ZT4A 4JFEB 4AVHA 3L5WA 5E99H 4PB0H 5F9OL 1NCAL 2XNAA 4NN5B 3VH8B 2YJLA 3RPKA 3UTTB 2PPAA 3GNMH 3QULB 4LQ1A 2NY4D 2ZUQB 4HS6B 5ALCL 4NYLA 3STLB 3GK8L 1JHLL 3QUKA 1QFUH 3KWVA 1G6VK 1K5NA 1O7DC 3T6QC 1NBVH 3KG5A 4F80A 2LTQB 3SDDD 2YPVL 4P59L 3SD2A 2V5SA 1PDKB 2ZG2A 3GKWL 2NW3A 2FR4B 1INEL 3MRBB 2O6CA 1JXGA 3P9WB 3ZHKA 2X4TA 4OM1H 1TIUA 1H8OA 4JPWL 4BDVA 2ADJB 5FDYA 2IBZX 3POCA 4PG2A 4X6FB 2BFGA 3PWPB 43C9A 4KXBA 5DJAA 1RVFH 3BHBB 4GG6A 1D9KC 5G5DB 3FQTA 2QEJA 3IDMA 3D39B 4MKMA 3WEBA 2HRPH 1ASQA 5F3FA 1BQLL 3VXUA 4B7LA 5JUEH 1J87A 3VU2A 3O8XB 2FUTA 4QAMB 4L9DA 2P9RA 3PHSA 4FMKA 4U1KA 3TEWA 1FFNA 3T09A 3WFCH 5FIEA 3RVTD 3NCWA 1DQMH 5DD6A 5IESH 3CJJA 2N7BA 3GJFH 2VXSH 5ABAA 3BXNA 1AZNA 4JE0A 2WGXA 1MIEL 35C8H 2F61A 2X0WA 1GOFA 3GRWL 4PJXB 4ZUVA 3OZLA 3CZJA 3TWYA 3VXPA 4NQCD 4CU7A 3V5HA 3WE6B 3ZDWA 3B56A 1KJ2H 4KC3B 1OK0A 5TH2B 2H0EA 1NPNA 4HJIA 1QD0A 2CUHA 3P54A 3ZTJH 3KM1A 1T80A 4XOEA 2J8UA 4PI0A 4IU3B 2X4QB 1WF5A 4C59B 4PRDA 1WUNT 3GT6A 4J6IA 4BFOA 5JIPA 4ZFZA 1M1XB 4BQ8A 3FMGL 1ZEAL 3QUYA 4W1TA 3NJHA 4GW5A 3WKQA 3QJHB 2ZTBA 5GRZA 2CKBH 4PS3A 3RWHA 5I1HH 5T1DH 4HMEA 4O2FA 4EO5A 4XMKH 1ACYH 1S9XB 1T7ZA 1C16B 2IDQA 3OXSA 3DVIA 5EIVA 2DICA 4YHOL 4HCRA 4U3CA 2VDPH 3B37A 2D0GA 3DHJA 1JDCA 3RY6C 2ZCLL 4HC1H 4AMWA 5CJ5A 1QR4A 5FF6B 2X41A 1ZK9A 4U1GC 3TEYA 4NZTL 1HU8A 4I0CC 3IDIB 2MCG1 2JSFA 3QHTC 4FP8H 4QYOB 1JHTB 3QJVB 2C9UA 4WDIA 1DQDH 3ZUCA 2XPGA 2NY5H 1ROWA 2CO6A 4KGLA 1WHPA 3LMJH 4ODXA 1T5WA 1BWWA 2XQYA 3FH8A 4GP4B 3FCTB 1OAXL 3H42L 1SEQH 4NC1C 4W9KC 4K9EC 5T3ZH 1ZCRA 1V7MH 4LSQL 2AJZB 1U3HD 1XBRA 4XMWA 1T7XA 5JHMA 2VISA 1I1AD 4ORZC 3L1OH 3TVMB 4F9LC 3L48A 3G6JE 2F6AA 4ZSOA 4XB3A 2ESVE 3UJTH 4NHCL 1VFAB 5DEFA 4YGVA 4G2AA 5GGTL 4P23C 2WOBA 3BGMB 2DLEA 3D09A 1PKQE 2DQMA 2D4FA 2LLGA 2MPVA 4LO9A 4AZ8A 3ULVD 1T7YA 1CUOA 3JV4B 5FGSA 4YLBA 4LVOC 1B0IA 1CYXA 1ETA1 3G04B 5F7FA 1W8OA 3FQWB 5IQ7H 1XTMA 2IPKB 5HI4C 3FB6A 4KQ3L 4U1HB 1LO2L 5IFHH 1IARB 4W9ZA 1I8KB 3BEWB 2ZWKA 2GFBA 3ETTA 5ITFA 4I3SL 4MRBA 2EILB 4F58L 2XFGB 3QXUA 4LP4A 2IWKA 4EDXA 5C0AA 2OJZH 3VQ2C 3OJVC 4LLWB 3RWCB 4WWOA 2VC2L 3MLRH 1MREL 1UD6A 5DA0B 4ISVB 5INCA 1K8IA 2P52A 5JLZB 3K6IA 3KPLB 4U33A 4W9IC 3RL1B 2VO5A 4UT6A 4Q2ZB 2JCCE 2YA1A 4U1JA 1M7DA 4LOUD 5IK3B 3ILEA 1QYGH 4QXVA 2F7OA 1PX3A 4X6CE 4XNXL 1FNAA 4JGMA 4XP5H 2A6IA 3ESUF 1RUPL 2P5WE 4HKJB 4ZMTA 5LLIC 1NGXB 5TJWK 3U2JA 5I9QC 1X6LA 3N0AA 3RWIB 5ICZB 1UZ6E 4PJ5E 5TK2A 5JPNB 2V5TA 1LNUA 3LN4B 1P1ZB 1MW3A 4XXCC 2WUCL 1OTUC 1WA2X 5KYYA 3H9SA 4F9LA 2J6EL 3VFGH 3ZKMD 4JPKL 3TL5A 1HHIB 4AIZB 4N86A 1D7BA 5JQ6L 1XMWA 1WUZA 4OD3H 3O0LA 1KIRB 2WN2A 1LTXA 1YUHB 3IFPA 5C2UB 3LPFA 3KPOA 4M5ZL 2DQHL 4X8XA 3VRJA 3PQYD 3GS4A 5IEKB 5JXEC 2YD4A 1P6AB 1XF2B 4JKPH 5DZPA 3ARGC 1HX0A 3S97C 4GKNB 1AOHA 5EV7A 3DGCR 3NT0A 4CC4A 5IFJA 1YYCA 3R4DA 4KTEL 5K9KA 2GVYA 4ELDA 3BCFA 4FQPA 2CMRH 1MDTA 1WWWX 4JVUA 5E6IC 4R7DA 3BW9B 2XFXA 1LO3L 5HGAA 3HAEB 1BQSA 5GS2H 5GIRB 1OW0A 2KS0A 1GGIH 2MMXA 3Q1SL 4JQIL 1ZGLM 1HZLA 3UPRB 4OUUB 2A9MH 3UBGA 4XCCL 2R0WH 4QF1A 3U7YH 2WO3B 1KBBA 2FB4L 1GCYA 4GNKB 2XOTA 3P69A 2AAVA 1XF4B 4KZCA 1K5WA 3P2TA 4JFDB 4LOEA 3F7YB 1RZIB 3NFPA 3LHPH 3W11D 2QL1A 1YSOA 1YPZB 1EX0A 5LGYA 3QUMA 5K1JA 4ZW7A 3WE1A 3GSWA 3D52A 3N2JA 1OP4A 3EUUA 5A2BA 4BFJA 3SYQA 3FYIB 3QEQB 1NAMH 2X9ZA 2DQIH 2HT4C 4NENB 2IH1B 4YDVB 2N0KA 5LHDA 1TZGH 2YGOA 4WWKC 4XXCA 2QJDA 5F1OB 1A6AB 1MZYA 4OJAA 2G2RB 5AAMC 2ENQA 5F88A 3EO9H 3V0DA 4A7QA 1IKFL 4XT1C 4HDIB 1AO7E 4UCFA 2K6YA 5DUJA 3ESNA 1AQHA 4OV6F 1EAJA 5T33H 1QSFE 1PY4A 2X89A 3WDHA 4U3HA 1R5VA 3ZDXE 3TFKC 4U6XB 5DCCA 4F7MB 3SD5A 4G5ZL 5DK3A 5EC1A 5IP4A 3ROOB 4NQSB 5JXEA 3UJIH 2J6WA 2AJUH 1C1EH 4JO2H 2TSBA 5I1LB 5FO9B 1H6UA 2ZAGA 2MKLC 1N64L 3EFDL 1GKEA 3N1PC 4F8LA 4P46A 2ZUXA 2WLLB 5DZ9A 4TUKL 1T5XB 3CVDA 3L5IA 1JZ4A 5LGKA 5F1IB 2PYEB 4NKIL 5ID1A 1HQ4B 2ZX8A 4PJCB 4Y9EA 1ZGLB 4OY9A 3S96B 1AE6L 2QGEA 4LQFL 5D1ZC 1JPEA 3BCDA 2W07B 5HDBE 3FOMB 1A3RH 3KPRE 1CE6A 2EEBA 4N2OA 3EGSA 4HGKC 3HNSH 4G70B 4OBSA 5AW3B 4W70A 3TBSB 3EDKA 3LS5L 4TOYH 2AKRB 1UEYA 1XZWA 4TVSa 4XVSH 5C08B 3IMSA 4C4KO 5C97A 3M07A 4FQ1H 1XB3A 3ARDD 3GMPB 3WJLC 1JUFB 4OI9A 3NIDB 4A7GA 5EU6A 3RL2A 4UINL 2Q8AH 1TCRB 2TRYA 2DQCL 4OFKA 4RZKA 1VZIA 1C9SA 1X9QA 4PRPA 4ETQB 4OD2B 5E51A 4M3HA 1SYSB 4DVRL 4NZJA 4A1RA 4FTDA 4LPXA 1B88A 4WWKA 5KBLA 3NIGE 1PD1A 1PQZB 2MWCA 1A5FH 4ODTL 3KCPA 4OZFB 1NIAA 2FZ3A 3BPLB 1EO5A 4ONHB 5DMGC 3N9GH 3PWPE 1L0QA 2FJSA 5EH1A 4NSKA 1UFUA 4KK9D 4AQ8C 2ZOUA 5JIMA 4KDWA 1EAQA 2GITB 5JHAA 5EUOA 4HULB 5FOJA 1DQKA 3FTXA 3Q3GA 2HXAA 3SDAB 2VSKB 4RAVA 4P2OB 43CAB 4LLDB 4NGHH 2YRLA 4FFVC 4I9WD 4H13C 4LCWA 3V4UL 4DSYA 1LL1A 2AXWA 3IGAA 3VFMA 4BA8A 4HZAA 2DRUA 2VNCA 1YVLA 5E9DE 2DI8A 3E6HA 4XI5C 1WFOA 2YPVA 2FL5B 5F7LB 1NH6A 1V10A 2AK1H 2ZQKA 5G2NA 4PJXE 4H1LG 2JQAA 1FSKB 3LEVL 4N90E 3VWKC 4UT9L 3CBKB 4ELKB 1QLFA 4HEME 4WLCA 2OLDA 2EEXA 2H2SC 4DZBA 1PU0A 1MHHB 5CJ8A 3MBEA 4CVWA 4I9XA 5E95B 1RL1A 3ZTNH 2EO9A 2OR9L 5C0RH 1F97A 3WUZA 3L4WA 3SODB 3FH7A 3LXUX 4NKMB 1NCWL 4ZS6D 1BVLA 5I5MA 1IGML 3IJHB 4WQOA 1R4XA 4AYID 1RMFL 1XH3B 4L3EA 3F6JA 3FKUS 2EO1A 4G8EA 3FB8A 4JR9H 2BY1A 4ZOBA 1F13A 2ZCHH 1MFVA 2X6UA 4N87A 4QRPD 4XNAA 1AQMA 5FYLH 4HIJA 1CD1A 5CSZB 2ITFA 3EXLA 2RHEA 4ANXA 4AQ8A 1S9KC 3L1EA 5CS7A 2BSRB 1UUNA 4WV1B 4TMPA 4WI3A 3SQBA 4Y1AD 3QC5X 3S2AA 4ZW8A 1WQVT 3FSVA 4QMEA 1FN4A 2X70B 4GSQA 3T4YB 4FKEA 1S3RA 2XDHA 2I5YL 1XEUA 4LHUB 5K9OB 4IRSC 5F3HB 1T03L 1Q0EA 3RKPA 4NZDA 3PY9A 5L4IA 3QQ9D 4KWUA 4A37A 1RK1B 1J1OL 1L3NA 3QRGL 4BXSV 3TJHD 32C2A 4OLVH 5E1QA 1CD9B 1KYFA 4TNVK 3VX0A 4D7PA 3KWWA 1JERA 4A63A 4AY0A 1UWGL 4JVPA 4OFVA 1HKFA 4XPFH 3IS0X 4LLQA 2J1YA 3TCLB 1ED3B 1OB1B 4LCUB 4OLXL 3REVA 1FL5A 4NQDE 4GAJL 4QXTA 3GMOA 3F62A 2FH6A 1KTLB 4G6KL 2AANA 3Q6FB 2DL9A 4EDWL 4OLEA 1XGTA 2F54D 2XN9A 4XN7A 5DWUL