3NT0A

C500s (t1d) mutant of cueo soaked in and bound to cu(i)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
468
Chain Sequence
b'ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase cueO
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 129
structure length 468
sequence length 492
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A03
2AVFA 3T6XA 2JFCA 1HFUA 1E30A 4YSPA 2VM4A 3QQXA 2DWTA 3HB3B 1PLAA 1SFDA 1CYXA 6PAZA 1L9QA 2YARA 1GYCA 4K9JA 1IKOP 2YAQA 4E9TA 1B3IA 2CBPA 2TSBA 2IDSA 4MFHA 1W8EA 3NT0A 2YAEA 3IN0A 3T6WA 3TASA 1ZDQA 5AFAA 3X1FA 4DP4X 1JZHA 2J5WA 1FWXA 1A3ZA 2BP8B 2IWKA 3C75A 3FYIB 5B1BB 4HALA 1ET8A 4E9XA 4A2DA 4A66A 1PCSA 1YLBB 2WO3B 4YSAA 3FSAA 1AIZA 3NSDA 1ASQA 1M9WA 3KW8A 2PPEA 4YSOA 3TA4D 2BP0A 5D4HA 1OCZB 1AS7A 1OCRB 1PY0A 1XB3A 4HCFA 7PAZA 5I6KA 4P5SA 1J9QA 3NJMA 2PPDA 2BP8A 3SBPA 2GC4C 3X1EA 2VM3A 5B1AB 2J57A 2UXVA 1OE2A 1EZLA 2W8CA 3IE9A 3S3CB 3FT0A 1AG6A 2N0MA 1AACA 4Q89A 3ZBMA 3NJKA 4HHGA 1FFTB 1BXVA 1ZIAA 2XWZA 1BQRA 2YAHA 3ZX1A 5I6LA 2JKWA 4YVUA 1N68A 4KNUA 3UABA 3T9WA 1WA1X 2ZWNA 5F7AA 1JZJA 3NJJA 2EINB 3ABLB 7PCYA 1V54B 3S8FB 2OV0A 1W6LA 2BO0A 1RZPA 2AANA 2ZXWB 5E9NA 3X1GA 2VSKB 1BAWA 1JZFA 4YSTA 1BXAA 1AG0A 2CUAA 1J9SA 1OF0A 3ERXA 4CSPA 2I7OA 1BXUA 3ZDWA 2XV0A 4KO7A 1XB6A 3NJHA 4UF7C 3FU7B 4KO5A 3CVBA 1AZBA 3FQ2A 2H3XC 1PMYA 2RACA 1AANA 1SFHA 5D4JA 4KNSA 2AFNA 4A2GA 2FQEA 2CALA 4JHVA 2LLNA 2Q5BA 1TKWA 1KYAA 1SNRA 1X9UA 3EH3B 2BWIA 2NRDA 4BDVB 3DTUB 2A3TA 2XXFA 2DY2A 3FU7A 1KBWA 1A8ZA 1J9TA 3EH5B 3FQ1A 1JOIA 3H56A 4HCIA 4JHUA 5FC9A 2IDQA 2TSAA 3NSYA 3T71A 1GR7A 1OV8A 1PZCA 3RYMA 2HXAA 5TK2A 2B3IA 2FT8A 1BQKA 1ET7A 5B1JC 3FQYA 4KOCA 3MX0B 4YVNA 4BDVA 4F7KA 4ENZA 1ZIBA 1AZRA 4GP4B 1IC0A 2YXVA 4AZUA 1VLXA 2OJ1A 2P80D 4E9QA 9PCYA 3NJNA 1PNCA 2FJSA 4ZK8A 3L45A 3CVDA 3PAUA 4YSUA 3AG4B 1ZPUA 2B08A 2QDVA 4UAHA 1AS6A 1JVOA 2OCCB 2FQFA 1OCOB 3D12B 4HIPA 2GIMA 3BQVA 1GS7A 4FA7B 3PAVA 3TBBA 4L0PB 3FYEB 3UACA 4QKTA 2VMJA 2GBAA 3FPXA 4KOBA 1A4BA 4A2HA 4BK5C 2HRGA 4DP6X 2XLLA 1ETJA 3TU6A 1JXDA 3U25A 2I7SA 1NPJA 2CCWA 4DP8X 3MBWB 4DPAX 5I6PA 1IBZA 5I26A 1ILUA 4G7QB 1W6WA 2Y1AA 1KDJA 2FWLB 4JKNA 1AR1B 2BW5A 4GY4A 1CC3A 4G70B 4NERA 2VSMB 2PLTA 3WKPA 4KO6A 1WS8A 1FA4A 4DP1X 3HEIB 2IH9A 3NP4A 1NIEA 2I85A 3FU9A 1NIBA 3CVCA 1AQ8A 5IY5B 4A2EA 2IDUA 2UX6A 4FAAB 3NYKA 1R1CA 2HRHA 5ANHA 2PP8A 1OOWA 2DYRB 2AZUA 1XMEB 3IBOA 4DPBX 2XU9A 1KCWA 3BVDB 1PZBA 4AKOA 1J5DA 3N2JA 2MRYA 1WS7A 1NDTA 1JERA 2GHZA 3QJRB 4E9SA 1ID2A 2VW6A 2WSDA 2W88A 1URIA 4AX3A 4P5RA 3WIAA 1ZV2A 4M3HA 3CZUB 3X2QB 1NINA 2IDFA 4BXSV 4PCYA 1RKRA 2VW7A 2PPAA 2EILB 3S3DB 3ZIYA 1I53A 1WAEA 2GC7C 2JXMA 2BHFA 2VW4A 1SJMA 2IWFA 1JXGA 4RH4A 2YXWA 1QHQA 4A68A 2XV3A 1KCBA 2EIKB 3UGEA 4YSRA 1HAWA 4N8UA 1PNDA 5AZUA 2HX7A 3H4HA 2XVBA 3QPKA 1DZ0A 2PP9A 4G7SB 4KNTA 3AG1B 2QPDB 4Q8BA 1AS8A 1M56B 1OE1A 2X88A 5A7EA 1MDAA 3PCYA 3KW7A 1J9RA 3H4FA 4AKPA 2FQDA 5AKRA 1X9RA 3GYRA 1JVLA 1SHXA 3N55A 1BQ5A 1NIAA 5B1KA 1JZIA 3QJSB 2FTAA 2PPCA 3FU8A 3T6VA 1XB8A 2IH8A 4YSEA 1HAUA 2XXGA 2Y69B 4BXVA 4YL4A 4A2FA 5I28A 2BW4A 1L9RA 1JZEA 3ABKB 6PCYA 2GSMB 2CAKA 4YSCA 1E5ZA 2EIJB 1F56A 4KO9A 1BYOA 3V9EA 1SF5A 4E9VA 5B7FA 4DP7X 1V55B 4M4RB 2QPEB 4DPCX 3AZUA 3T6ZA 4HHWA 2XX1A 1ADWA 3GXUB 3NSFA 1ZDSA 1MZYA 4GP8B 4E9RA 3AW5A 1TEFA 5B1JA 4EF3A 1L9SA 1QNIA 3FSZA 3FPYA 3AG2B 2H5UA 2PPFA 3EHBB 4DP0X 2FNWA 2Q9OA 4X4KA 1KDIA 3G5WA 4QLWA 3OQRA 1SHWA 4G71B 3UADA 3X1BA 1NICA 2XX0A 3QJVB 3JTBA 3QJQB 5B3SB 3NJLA 1SF3A 3WNJA 2YAOA 1GS6X 2CJ3A 4HCGA 2E86A 2IWEA 2HX9A 4BWUA 1DYZA 3AY2A 1EHKB 1E5YA 1KGYE 2UXTA 1PZAA 1A4AA 3DIVA 4GYBA 1ASOA 3PAZA 1T5KA 1AZNA 2XYBA 4AI7A 4F2EA 4UANA 3QJTB 3X1NA 1KV7A 4WKXA 1GY1A 4TXVB 1CUOA 1A65A 1NIFA 2BP0B 1PF3A 1QLEB 2UX7A 1JZGA 1M57B 2DYSB 3S3BB 3FS9A 1GSKA 1MG3C 5F7BA 2QT6A 4NB7A 4F2FA 2EIMB 2HX8A 1WA0X 5I6NA 2YQBA 5PCYA 1CYWA 1TEGA 3ABGA 3QJUB 5I6MA 1WA2X 4DP5X 5B7MA 4BWWA 2BWDA 2FT7A 1TU2A 4WTQA 2R7EB 4GXFA 1A4CA 2IAAC 1CURA 2PCFA 2HLEB 4E9YA 4YSDA 4N4YB 3CG8A 5EHFA 4YSQA 2XV2A 3PPSA 3WG7B 1V10A 2H47C 1RCYA 1KBVA 2MTAA 1PAZA 2YAMA 3NJIA 1AAJA 3NJFA 1OE3A 4G7RB 1AZUA 2J56A 5D4IA 2R7EA 3FSWA 1JXFA 2PCYA 3OM3B 1NIDA 4BWTA 2BZ7A 8PAZA 4G72B 1NTDA 2BZCA 2VN3A 2X87A 3EH4B 4E9WA 1PLBA 2GB2A 3OMIB 3V9CA 3NJGA 1GW0A 3CDZB 1UATA 1E65A 1BYPA 3WKQA 3IN2A 3NSCA 1AZCA 1NWPA 4AKQA 3OD3A 3FSVA 1SDDB 1ILSA 2UXFA 5PAZA 2YAFA 3UAAA 1MG2C 1L9OA 4W1TA 2PP7A 2AZAA 3CDZA 1GS8A 2XUWA 1J5CA 3WI9A 3TBCA 1NZRA 3SBQA 1NPNA 4YSSA 1NWOA 2DV6A 4HZ1A 3PLYA 2QDWA 1SDDA 3SQRA 1PLCA 3GDCA 5I6OA 2UXGA 4DP2X 3OMAB 4HAKA 1AOZA 4CSZA 1MZZA 2HZHA 4NAJA 1IUZA 2WO2B 1ET5A 3SBRA 2ZOOA 2ZONA 2GI0A 3IEAA 3NP3A 1GY2A 3PXLA 5B7EA 5I5IA 4W9ZA 4GP5B 1L9TA 3ABMB 5LDUA 1BEXA 1IBYA 1OCCB 3DKHA 3AG3B 2IDTA 1ASPA 2P80A 2YAPA 2DWSA 3JT2A 4DP9X 3ASOB 3S8GB 2FT6A 5I5MA 1RZQA 1L9PA 2J55A 3ASNB 3EF4A 4PAZA 2FQGA 4A67A 3UAEA 5TK4A 3WNIA 1E67A 1N70A 3OMNB 5I5JA
chains in the Genus database with same CATH superfamily
5F6IB 5E8EB 4NRZB 1QI4A 4XCFL 4OFPA 4NCC2 3VXMA 1T4WA 4ZTOH 4GRMB 1I31A 2P9RA 3IPEA 2Q6WB 3KYMB 4JRYD 4URKA 1TJIH 5E2VL 4WLCA 1CXEA 3CZJA 3O3BA 1ML0A 2BCMA 2TAAA 2ZJSH 4O58L 4DZBB 5CIPH 3KAAA 2BFVL 4JFTA 3T6WA 2X2YA 4OKVA 1EFQA 4U1MB 3QORC 3K1KC 4NQQA 2X4QA 1TZOA 1OGTA 5T5NF 1NMAH 5DDHB 3EZJB 4YEFA 3WN5C 1AR1C 4HOXA 1FH5H 1UD4A 5E6YA 4BE6A 1K6QH 4ODHH 5T3ZL 4N2LA 4UU9B 3TO4B 1ASQA 5EIVA 4EDWL 4XWGH 3QA3B 3TA4D 1NBYB 1AGBA 3U9PH 2NY2B 5C0AE 3TZVC 1T83C 2D8KA 5C08E 4ALAC 2B1HH 3W9EB 3OXRB 4QAWA 5DQDH 2O30A 3NJMA 1U8MB 3JQOB 3D07A 1AY1H 4Z8FL 2EH7H 3O3UN 2Q8AL 1YEEL 1PY4A 1AG6A 1JZ5A 3OWRA 3WLWD 4B7LA 3UIZA 2CKBH 3NJKA 5I1IL 1COBA 2YAHA 5JPNA 4OFQA 5E6ID 4I2XB 1ZVSA 1XGTB 3FOLB 1UWEL 1A6TB 5D1ZB 2ENJA 1I85A 1MJ8L 2WB7A 1IU1A 3RIFF 2HVKB 5LJYH 4I89A 4XHJC 4GRLC 4H0IA 3ARXA 5SWZA 3D2UB 5I16A 5F93C 1OAJA 2E56A 5I5RA 1P6FA 4EVNB 5KG9A 3L4YA 1T21B 3JWOL 4MMXC 4MAUL 4PJGE 4AEIH 1UM4H 4PJ8A 1C8PA 4X4XA 4PRIA 4AJ0A 4NZTH 4POZD 3EUUA 4BFBD 2FO4B 5AKVA 1B2WH 4NO0D 4ORGA 1CDJA 1XSKA 4ZUVA 1WAAA 4HMDA 1HDMB 3DSNB 4MDIB 1TVHB 3AU0A 5K5YA 1U93B 5K9OA 3N91A 5DJCB 3EJQA 3GSWB 3M46A 1KUMA 3L3KA 4PYHA 4YWGH 1BFVL 3MV7E 3LXBA 2OMUA 5D7LE 4CL7A 3PU7A 3COOA 2R0KL 4ZJ9A 1JZ2A 3VFPB 1BZ9B 3GSQA 1JOIA 4M8QA 2AI0H 2C5DC 4E5XA 1I1FA 2I25N 5DRXA 2CWRA 4P2RB 2O4EA 4I0CC 1FL3B 3VB9A 4B9KC 4JRYE 1BF5A 4JMXA 4N2AA 4ZSOE 3SB3A 4ZUTB 5LXVA 2YQGA 2X9XA 4J3OD 1UWFA 3H42L 4HWEL 4YVNA 3IJEB 3GIZH 4OR1A 2EIBA 3V10A 4L1HA 3NCJH 5LHDA 4XCFH 4PJ5B 2PYEA 4I88A 4YSUA 3L9RA 4GS7B 4ZX6A 3DV6A 4LO9A 1JPGA 5BW7A 3FOMB 4JDVB 2OP4H 1CGSH 3BQVA 3QUGA 5E2VH 3N41B 3TBBA 3G08B 3FONB 5LGYA 2WLMA 1LGVA 3FQTB 4O58H 3N1QC 4UV4H 3K81A 4A2HA 2BFVH 3ARGA 3B34A 1C12A 2CHWA 3BVUA 1HKLH 1X4YA 3U25A 5A2KH 3O2DH 4PJCA 1HL9A 1MJJA 2W9LA 1W6WA 3TBSB 3OAYH 3U6XS 5T3ZH 3A0OA 4HUXB 3ARQA 2ATKA 4P2QB 4RMQA 5D1QA 1ZLWK 1R5VA 4EDWH 2W38A 1EBPA 4CW1A 4AH2B 2NTFA 4IHBA 3FRPA 1VGKA 4KGJA 1JGDA 1VSCA 4P3CL 3SPGA 4MSWA 1WFNA 1DQDL 4JG5A 1IC4L 4WV1C 5I17B 3TOPA 1KCWA 1VENA 1UWEH 3MLRH 2ZKMX 2H1XA 5E99L 1N67A 1NFDE 3QJRB 3MREA 4WNQA 1WK0A 1ZLEA 2CO1A 4OAWB 1GYVA 3N04A 3CBJB 1KBBA 2W88A 5F9WB 3FL7A 1JXJA 4P9MH 4Q4EA 2IMMA 4FD0A 4P5RA 5HGAA 4JPIA 4AOFA 5MEND 4X6BB 5BRQA 5C0FA 1NMCC 4MAUH 5EF0A 4L1SA 4UUJB 2ZKXA 3ZIYA 4PEEA 4NZ8A 1FL5B 2BHFA 4AMKH 3MCKB 4MA8H 3RJQB 1E4XI 3NA4A 4C4UA 2R27A 4DN4H 1BFSA 4OZGA 2JIXD 4ZAKD 2V2WA 1FO0L 4IHOA 2HTLC 1NCBL 3UGEA 3DURB 2KS0A 3RNQB 3H4HA 1T2QL 1KB9K 2Q86B 3NK3A 1HQRA 1ITBB 1PLGL 3FB5B 4HZAA 4NYLB 4PW4A 3RJOA 4RA0C 1VFBA 4I1RA 2WXIA 2R4SL 4OFYA 2FYYB 1N8ZB 2R0KH 2ZKWA 2YD7A 2P48B 1I8IB 3GK8L 3KPPB 5F9OL 1GHFL 3WIHH 4NHUB 3S4SB 1MCOL 3F6LA 1E9OA 3B7RL 2YD4A 4PR5A 3QNYB 4BUQA 1ZEAH 5JR1L 5AOKA 1FVEA 4HIQA 2ZXEB 4Z7WE 5HI4C 5E08H 4M3JA 5FYKD 3ZDZF 3PP4H 4F57L 4HWEH 4HW6A 1QSFE 2CM6A 3KPSB 5DJXA 2GSMB 1P9MA 1TETL 3BZFA 2W60B 1Q90A 3ILQD 4LQFH 2F5BL 3P9MA 5J89A 4U1NA 3A67L 3EO0B 3FU5A 1NCOA 1TQWA 3HS8A 1DUYA 3BC9A 4ELMF 1CTOA 2ROYA 4PGCA 43CAA 1DBKH 2J4WL 5G5DA 5ACZA 3TBYA 4UB0H 3BEWA 1M6OA 4TNGA 3VI3A 1FFOA 3HVDA 2VH5L 5AVTB 3EGDA 4G71B 5IQ9B 3NRPA 5DUBB 2AEOA 4JZOA 1SHMA 2NY3D 2JQZA 4QHUA 4AV5A 1MY5A 1BQHA 2X6UA 2NXYC 3HG0A 2ZF9A 4L37A 3UPCA 5FOBA 1E5CA 2NR6D 4HG4K 1SM3H 2Q3ZA 1WCBA 5DHXB 4HIHA 2ITDB 3VX1A 5IOKA 1BBDH 1YY9C 4IYKA 1HYSD 2DI9A 4WTZG 3CSGA 2KI6A 2XBDA 3KWWB 1QFWI 3CQPA 2HT2D 1HI6A 1B9ZA 3EHBD 3IDNB 3UTSD 3QWNA 1A1MB 1MVFA 1B9KA 1CU4L 1UFUA 1IX2A 3QJTB 2IH1B 1IQWL 1TU2B 4Q14A 4OBSA 1A65A 1HZKA 3DPBB 2CUHA 2DWEA 3CFBB 4UT9A 1DDTA 2OI9C 2X7LB 4BE5A 1T1WB 4NZUL 5IJKA 5TE7L 2YD5A 3UTTB 1GGBL 1HEZB 3LCYA 4LGRB 5CP3H 3U0PA 2V9TA 5TDPB 2YQ2A 3V7MA 4XMKH 1A4KA 1A1OA 3NJVA 1SUJA 1JV2A 1PIFA 1CXLA 1L7TH 4UI2A 4MA7L 5MEPB 4OM0H 1A5FH 2G0LA 1N3NB 4HJIA 4IRJA 4EZKA 1SHSA 2H8PB 1FHGA 5AAMA 3S96A 5AAPA 1IBHA 3R1GH 4YC2C 2HVJB 1CURA 1H3PH 2Z31B 2F53A 3WEXA 5JPNC 3BIBX 1I85C 5GS1A 1JYWA 3MV8D 1HN1A 2KMWA 1Q9OA 1FO0H 2GFBB 1LK3H 3NZUA 4GKZB 2P5WE 1FE8L 3E1ZA 2B14A 1INDH 5AWNL 2I07A 4QUOA 5T33L 4PWHA 4L29A 2NDGA 3N5AA 4BWTA 1PLGH 1J05A 4YQXH 4J8RB 2E7DA 2OMTB 4FQ2L 4PJ8C 2BVEA 4BFIA 2AK4A 2GB2A 2D7MA 3P3TA 4IBZA 4JB9L 4X6CE 3K6NA 3JWNH 4Z5RA 2APVA 2ATPB 1RJCA 2OKMA 4QRSB 2XWJA 3GK8H 1XAKA 1BYPA 3GJFH 4XCYA 1YEHL 4DGVH 3MRRA 5DQ9B 5F9OH 1GHFH 2H32B 4A6YA 4DKAA 1WFTA 5C0BD 4N8CH 1D9KC 1U8IA 5T5NG 5JR1H 5DJ2A 3NDYE 4N0UB 1E28B 3RILA 1T03L 3LNIA 5BOPA 1ADQA 3ISYA 2UXFA 2W81C 4F57H 2IGLA 2YAFA 4ICWA 3M45A 1L9OA 3UAAA 4GRWE 2P24A 3G5ZA 3KDMB 4U49A 1GS8A 1TETH 2Y7QA 1N59B 3D39B 1F4XL 2HN7A 1CPUA 3GI8H 4X80L 3VM5A 5T1MA 2DOCA 3A67H 2ZWYA 3GDCA 1BW8A 5KEZA 3CVIL 3UMTA 1M7IB 4JE4B 3PWVB 2QEJA 2A6JA 4PGEB 2IOIA 4NQDD 5FHAH 1XGRB 4AENA 4FLSA 1KCVL 1MZZA 3O8XA 3SBRA 4HX1A 1PFOA 4TNWK 1YQVH 3REVB 5C97A 5KZCB 3IS0X 4OCSH 2C1PB 5BW7C 5C0JA 2VDPB 5E56A 4YO0B 1R3KB 2BSRA 2OMVA 1SVBA 3PRZA 1G4RA 1CZ8L 2WAQA 4J3SA 4AYSA 3A6BL 5GS0D 4N2OA 4XH2B 5JNYB 1G0YR 2VLKA 2ZWKA 4JM2A 3UJIL 4BZ2L 4YXHH 4PAZA 3ARGC 4FNSA 1FV1A 3ES6A 4F7PB 4NNXB 4ODXB 1JHTA 1ZGLB 5F2FA 3WIIL 1E67A 1AH1A 5FYJD 3HUJE 3OKKA 5I5JA 4YHYB 2WCSA 3IJSB 3NZSA 4M93C 2HJFA 3CFJB 1E30A 2YIHA 3FHEA 5KYYB 3NZ8A 5IGXH 4ZFFA 1T89C 4MJJA 2UWEA 2V2TA 1N18A 1HHGB 2AV1B 1CYXA 3M8OH 4P2AA 5D1QC 3RX8A 3AJ7A 1Y1DA 4KQ3L 2F1BA 1IM9D 3QJFA 5CGBA 1OK0A 4LAJH 1SY6L 4NZUH 2XTSA 1GPOL 1UJ3A 4JE0A 4P5KB 4L8BA 1LEGA 4URTB 4AE1A 4DOHE 1ZDQA 4YLBA 1KGCD 3OF6D 4QNPF 4QHLA 1OZUA 2CDEB 2A6IB 4QF1A 1MHHB 3HZKB 1BQLL 3TV3L 5EC1A 3W2DH 1G7PA 4JDZB 3FUDA 4IU3B 2LLLA 1LLAA 4PJBE 1EEZA 3IDXH 4PS8A 1I8UA 1R5IB 3L4UA 4QRPA 3GXTA 3EYVA 3FW6A 3PWPA 4YLQT 1AS7A 3GEWB 3IDYB 2W9DL 5GHWL 1NGXA 4U0RB 3ARFA 1QBML 3E6FA 1AMYA 3TIEA 3RKPA 4QIRA 3T0XA 5IUCA 4AJYV 4CN1A 1JN6A 2MH4A 2BMKA 4WUKH 5CJ5A 1Z32X 2VC2L 1KB5L 2IALB 4FQ2H 5IIEB 4FG0A 4JB9H 3KGTA 1ZIAA 1BD2D 1BQRA 3U46B 1N68A 4F1ZA 3T9WA 4FCHA 2X0UA 3QUHA 5IHHA 3QAZB 1I9RL 1YEHH 3KGRA 5DEFB 1XR8B 1JGLL 5LCVL 3V0HA 5JW5A 3KXFB 1PS3A 3TEWA 1J86A 2J3SA 1A6WH 1OSZB 4OZFA 3HS0C 5DHVA 1QVOB 1VIWA 3KPRB 4C56D 2KDYA 1WQVT 2XN9B 3A4AA 1T03H 1NBQA 3DIDA 5D6CB 2SEBA 4JFED 2DBLL 5IMKA 3ZKMD 4NQDE 3FQXA 4CVXB 2WSPA 4LNRA 4O9HL 5ICUA 5FDWB 5ABAA 1J87A 4PGBA 1NBCA 3IDIA 1QRNB 1KXTA 1T5XB 4FYTA 2E7HA 4Q52A 5F7DB 3C2SA 3CIQA 4MZ2A 5KYXB 4U1KA 4X80H 2R0WL 1FZJB 1AANA 4JFDD 2J71A 3V95A 1WDAA 2R23B 4AGNA 4GSQA 5GGVL 1KIRA 4GW1B 4Z7IA 2EDHA 3SYAA 5HYEA 4AUUA 2F0CA 2J8UA 3BPCA 3CVIH 1E4XL 4MNQA 4H2CA 5CLYA 1KCVH 4KZEL 4NPJA 3ZUNC 5ISZB 1P9MC 2V33A 2DY2A 4G6AD 3BOVA 3OC5A 1FUNA 3SKNA 2NY6D 1KTBA 3PWUA 1A8ZA 1KBWA 2JH2A 2WNWA 3EH5B 3ILPB 5FYJE 2HMIC 1KGUA 3MV01 4K9EC 5F21B 4BSWA 3DO7B 3K6SA 1HJCA 3BQUA 3LZQA 2DQUL 4TSCL 1PZCA 2GTQA 3RWJB 1RIUL 2JWYA 3LSOA 1CZ8H 3IXAB 1MCKA 1E27B 3RGHA 4CGUB 2QHRL 1XGUA 3AABA 4JCWA 4MHHG 2BSDA 3Q3GA 3B43A 1U8HB 1YUHA 3MRLB 3UJIH 3VDAA 3ZDZB 4BZ2H 1V05A 4ENZA 1LE5A 2EDKA 4HJ0D 3VXUB 4EUPB 3I6SA 4EN3A 4F20A 2X4SA 3ZRFC 1BM3H 3HG3A 1TMQA 2FJSA 4NO3A 1LQSR 4TUKH 2AXHA 4NO5A 4Z95H 3VXPB 3R19A 3FNKA 2WQUA 2QV4A 3WY4A 5EC2B 4U6VH 2HP4A 3Q2NA 2VUYA 2Y1ZA 5DD0H 2Z3FA 3MX0A 4ZXBD 4R7DA 4I18B 5FGBA 1IZJA 2WY3B 3IU3B 4ELMB 1V3LA 3DK2A 1T66D 4UDUA 5AW0B 5F7NC 2VERN 4B96A 2PR9A 2RIKA 3MBEB 3MJ8A 2VAJA 3MV11 3DYMA 4DPAX 3TF7C 3IGAB 4YEEA 5D7KD 3NCYS 4JG1L 1UD2A 3I6GB 3SPCA 2FWOA 3CDYA 4J3UA 3BFQG 3ISRA 2K7QA 2V8LA 3KLKA 1H3GA 5IJKC 3TJPA 4HZLA 3BSZA 4XNQB 3ESMA 4DEPC 2J6EL 2Q10A 3FU9A 3AQYA 3KYKL 5JDSB 1TEYA 4I13B 3DX9A 1S3RA 4RISL 4P23A 1OOAA 1R1CA 1NC2A 1R3HB 3KR3H 4UNUA 4OZ4B 3WS3A 1KJMA 2WVVA 3BAEL 3HAEH 3KZ8A 3GNML 1MCSA 4C56E 5F0LB 5D96B 5GZNA 1HSBB 1TJGL 1QFWL 3O6FD 5AVUB 4N8VB 3LXUX 4AMWA 5FAAA 2ZKHH 3AB0C 5GS1C 4X7SH 1GGYA 1R3LA 2ZXBA 3VU1A 3V0EA 4XNAA 1I9RH 5BS0A 5CF3A 5JHDA 4FLHA 5CU5A 2ODHA 4WWPA 5DEGB 1BX2B 3W39A 5C2BH 1O5DT 2RH0A 4LSRL 3CZUB 3F6JA 3KL0A 2ICWA 2Q87A 3MOBL 5DD1L 5IT2L 2QTVA 3EJSA 2YUWA 5DRWB 2DBLH 3S3DB 4H5SB 1DQJA 3GXPA 5TGBB 3VRLE 1RK0B 3SDXF 2FGWL 3BWUC 5IKCA 2I27N 4ZMOA 2NY7L 3APCA 2VZUA 4N8UA 4PBXA 5F88B 2Q76B 2CLVB 2VQ1A 2PP9A 5KVEL 2QMKA 1G1CA 2VJXA 3LN4A 3SD5A 1RMFH 1DO6A 4KNTA 5GRJH 3EFFB 1AS8A 5DK0B 5E9DD 4C4BA 4N8VG 4Y2DD 1DJYA 2FGZA 3FTSA 4N22A 4C83A 2BP3A 1F6AA 3V52L 4HUCA 5D5MF 1ZD6A 2WXJA 4LBEB 4MKMA 1U8JB 5IMMB 1XF2B 4HS8H 1NIAA 4L3EE 3ILQC 2UZXB 2ZUQC 5ADPL 2DQUH 2HPOA 2PPCA 4LOVA 5DT1L 4H13C 2QHRH 3J8F7 3ZU8A 3RWIA 3SHSA 3MUHL 1SGKA 3F2LA 4HBQA 4KK6D 3PJSB 4YL4A 4X9IA 3O8XC 2NNFA 4K71C 4LEXL 4KX8A 3E8VA 4QOKB 3TA3B 1E5UI 3U0TB 1H3UA 1LDSA 3UZVA 3NESA 5EN2B 1ZCRA 4R2GB 1V55B 1SBBA 2FE0A 5D7KE 4XNUH 3RZCA 1SOQA 3QEHA 3DRTA 2NY3C 2Q7AA 1IGIL 4WQOA 3OQ3B 1EAPA 4Q9BA 1XF5B 5D2NB 4JM2C 2QSCL 3BN9D 4ZODA 1BYNA 2CO6A 4WY7L 2V7HB 2DL9A 4A7QA 1ZK9A 3BUDA 5I1EH 2OMWA 3JZYA 1EEYB 3BVVA 3H9SA 4M1CC 4LHUG 3VI4E 2XZQL 4Q0XL 4H0LC 1FLRL 3UADA 3EHBC 3KHQA 4Z7QE 1KTDB 1ND0A 2ERJB 3DHUA 4CDGC 4JG1H 5I1GL 2XQYA 2ADFL 3DX3A 4F37F 4PGDB 3P30H 2CJ3A 4HCGA 4GKNA 1M7XA 5B8CA 4GAAA 2FH8A 3L16A 1UJ3C 2DTML 5IVXF 1NCDL 4U4BA 4OQTA 5DZOA 1CICB 1JRHH 4P57B 3KPLA 1F4WL 3EYQC 2VL5B 4RWYL 3OG4B 3PAZA 3B9DA 4NKMB 3GJEA 3TN0A 4MBOA 5CWSA 1SYSB 4IDLA 2DWXA 3ETBF 1DVTA 3BAEH 1KV7A 2CRZA 1CFSA 1PF3A 1TJGH 1JZGA 2XFXA 5F72S 5KAQF 3ZMRA 1T1YA 3MRNA 3HRZA 1P4LA 1I9JL 1PZ5A 5F7BA 5JW3H 3DRQA 3U7YH 2DQIH 4PTUA 4FX5A 4KVNL 2WGXA 1ETZA 1PG7W 4WGWB 3E6HA 5DJ8B 4U1LB 3F7PC 2E9IA 3H53A 2BWDA 4L1TA 4MJIB 5CD3B 2R7EB 5DK2B 3IETA 2WKOF 4LSRH 4NNYB 5DMJB 3OTTA 4JG0H 3CFUA 4G1EA 1Q9WA 5IT2H 5ADOL 3LKQA 4WWNA 4G2AA 4HIJB 4YNYA 2CIIA 1DCLA 5E9DE 4JY5L 3BCFA 3E3QE 3LQZA 2FGWH 4FG6C 4K2UH 1Z7JA 4UM9B 4U1IB 4UOW1 3O9WB 1UEMA 4P06A 3TPKA 4G7RB 3GI9L 4F7CA 3HHMA 5CS7A 2PN5A 3C5JA 2Z34A 3A4EA 3VGEA 4JN2B 3TC9A 5KVEH 4PHXA 3I9IA 2EDRA 4ZO7A 2UZYA 3QYNA 4NI6A 1IO4C 1UT9A 2VN3A 3LQMA 5K9KA 5FKAA 1PKQE 3SJVD 5IWLA 3RE0A 1A9EB 2DLTA 3X12A 4BK4A 2EC9T 5GGRB 1CFQA 1S7WA 1UATA 3HR5B 3V52H 2VLLB 2GJZB 5ILTL 4E41E 3U36A 1KIQB 2YPLA 2WQRA 5AZEH 5ADPH 1O7VA 1AZCA 3S3JA 1F4YL 4P4KD 4ALAL 4RFOH 3C6SA 4YIQB 1J0YA 1RLWA 3FSVA 1ZHLA 2NCMA 3EF7A 3LNHA 4N90D 4LEXH 4IIQB 3N1MC 1UGKA 3TCLB 4GAYA 4OCXL 4WFFE 4A7VA 3Q8BA 1PEWA 4XOAA 2R1XA 4G9DA 4XPBL 2EDOA 1H15B 3BQUC 5GS2D 2R29A 2ZOWA 3OZ9L 2C7FA 2DW5A 2R51A 5FF6B 3ZKND 1KY6A 4NT6B 4APXB 3MGTB 3BI9X 2E7CA 5CFHA 5I6OA 2QSCH 5KW9L 4WY7H 4XVSH 4MS6A 4O02L 4TMPA 2IV8A 3BPLC 1QAWA 3HLAB 4D0BA 5C6TL 4MQXC 2DD8L 3V9FA 3U6RA 4XMXA 2GI0A 3IEAA 5J9PB 3GUFA 1FLRH 3TBVB 2PUQT 4H1LA 3GSNA 1L6XA 5IB5B 5JORB 5AOIA 3BW9A 3GZOA 3LTVA 4JRXE 5KVGE 1JYXA 5HYSA 4I3GA 1A6UH 3QC6X 1CT8A 4MQ7B 2ZPKL 1ASPA 2H26B 1E8XA 4RMVA 5DYOA 5I76A 3UYRL 5FGBC 3QULB 2Y06H 3PS6A 3ASNB 5CJ8A 1MRCH 5H4YA 4BFOA 1SZNA 3DXAD 3RWFA 1MIML 4CAGA 2NSMA 1TVBA 4Z6AT 1DVUA 1W8OA 1YN7A 2CSPA 3Q8AA 3B2VH 3IKKA 1WZ1H 3OLEA 1UWXK 2J1ZA 2JCCF 2Z65C 4N26A 1D2PA 2KQNA 1DQML 1YEJL 2NY0D 3DX1A 1F3JB 4K55A 4N24A 3FUNA 4WW2A 2P26A 5CHNA 3SDDB 2GIYA 2CIKB 4WO4C 5EBMB 1A7OH 3BUYB 1YN6A 2JB6B 2HLFC 1ROWA 4AK1A 5HHPA 4ZFOB 4GBXD 4KRMB 1EDHA 1OD7A 3UDWA 4LCUA 4HIXL 1E3ZA 4KVNH 4KROC 2G5RA 5KSBE 2EXTA 3JWDL 4P46A 3OC8A 4F7TB 5I0WA 1AO7E 1MLBA 1NDMA 1FZMB 5JIIA 3VUAA 4WWID 3LRGA 5ICZA 4A2DA 4KZDH 2ED6A 1U8KB 5GZNC 5ADOH 3DX4A 3GO1H 4K8RH 4WWKD 5E0QA 3MLTA 3W82A 2PPEA 1DZBA 1ECYA 5G4OA 2EEBA 3Q5TA 4OIAA 5DFVC 1G7MA 1KCRL 1QO3B 2J88L 4JY5H 3LPWA 4HCFA 4CMMA 5JW4R 1FYTB 4R4BA 1Q1JH 5I6KA 3GXDA 4KKAD 4ELDA 1KBGH 5A2BA 5E70A 2VWEC 5ITBH 3U7WH 5E8DL 1ZHNB 3SBPA 1KGIA 3GI9H 4BSJA 3C5ZA 1JNJA 4G7VH 3GF8A 5EO9A 2BNQB 3DOIA 1T80A 1MDTA 3CXFA 3T0ED 4AZ8B 4X7TB 1A64A 2RAMA 1UEYA 1D5ZA 1RZKL 1CN4A 3QDGD 2AEIT 3D0VA 4RQQB 1CF8L 3RWEA 4Z7NF 2JKWA 1IKNA 4RAUB 4N90E 3BP4A 5CBEA 4PJAE 3NACH 1Z6JT 4IGBA 2BS71 4DF9A 1QFUH 3CH8A 4JAMA 3FB6A 4KUZH 4ALAH 2YRPA 4LE8A 5FA3A 5C07D 2G9KA 3FU6A 5A40E 1WTLA 3DA0A 4KMTH 2CLRB 3M1BB 1Q0XL 4LDLB 2O5YL 1BXUA 4B0MM 1HX0A 3V0AC 5KN5A 3T3PF 4WHTA 3BT2L 5EO0B 1AJ7L 2ENYA 3FQRA 1DUZB 1JFHA 3UYPA 1U8LA 1NUNB 4OCXH 5GGUB 3SDXB 4G6AC 3UAFA 1EJOL 5IQ7L 4N2HA 3P02A 2WZ5A 4XPBH 2RACA 1KN4L 1MI5A 3WJJA 3OZ9H 1EZUA 4OFKA 4PBDA 4R8WL 4EN2A 4L0YA 4KK8D 5MERB 1LEKA 1U3HB 2PYFB 4U1GC 4CADB 2FHBA 4UQDA 1NCTA 4GW5B 2GEEA 4O02H 1IM3D 4FQIL 4WUUA 5C6TH 1HZLA 3ARDA 5CUSH 2W0FB 3B3IB 2G2RB 4LOEA 2BCKA 5FX3A 3FQ1A 1J9TA 3CH1B 2LOEA 3RZCC 4IOSA 1CF1A 1FGVH 5EOCL 4RSYA 3EGSA 1T3FB 4AW4A 5IFHL 4LHUA 3GSVB 4N2MA 1WYJA 4PJHA 4NHCL 1MWAL 1UZ6F 3UYRH 3VGAB 4FFYH 2J7LA 5KVMC 1RH8A 4TS6A 1FG2B 2KBGA 1NFAA 3SPJA 2W0PA 2C1OB 3G6AB 4Y9EA 2H2PD 2BXYA 1RZJL 3DBXB 3K7UA 1U8PB 3GSXA 3MJ6A 4A63A 4FJYA 5HPMA 5LKNA 4JUSA 2ARJQ 4DVBB 4ADIA 3SE3C 4K5LA 4ZNCD 4OZIE 3UG4A 1GW6A 4GAJL 1YY8A 4KKQA 2AKRB 3MJ7A 3POHA 1WCQA 3QNXB 5EU5A 3ZE0F 5B8CC 2VMEA 3QYMA 5F70A 2A4EA 2QGDA 3P9LB 3FT3B 2YMXL 3K6FA 4IBLT 1KPVB 1HQ4A 1VADA 3TN0C 4PBVC 4CMHC 1KLGA 1EEQA 4N2CA 4MYPA 3QWQB 2OFQA 4JCLA 3K4DA 4WI8A 3OXSA 5AOMA 1DVZA 3VVWA 4PJEF 2V0AA 3WFZA 5CR8A 2D9CA 3T0EE 4GB9A 1DQQA 3WKPA 3HRZC 2NW2B 2V8MA 3O6FC 1KCRH 2IXQA 3MLXH 3QDGE 4KKRA 5T3XD 5IVXB 3VO0A 3Q48A 5EA0H 1KPUA 4P2YA 3CVCA 1MF2L 5TTRA 1BFOB 2OW7A 4G8GA 3HR6A 5DJZA 5EZJA 5M94B 3OKDB 2IDCA 2VLJA 5D8JH 3QUML 4AK2A 2O5XL 3B2PA 1R24A 5DO8A 3FT2A 3FQNB 1QFWM 3LQAC 1TYJA 2AW2A 2ICEB 3DC0A 4Y7OC 2N56A 1YHPA 5EORH 1NM4A 3EYOA 4FTVB 2XTJB 3ARTA 3BD5A 3NVQA 4G9FB 3L7FB 1F41A 3QCUL 4LL1A 4G59C 4PJXB 4OD1H 2WSDA 4Y4FB 4AGLA 1XL4A 1MW2A 1GIGH 2XZAH 4JPKH 5EDXA 1AQHA 2G4EA 3L3DB 2A9CA 1J8KA 3UTPD 3MTRA 2CHZA 5KJ4A 1Q0XH 3X2QB 4AJWA 3O3EB 4J6IA 1TG8A 1KJVB 2R2CA 3EJZC 2P52A 1U21A 2QFRA 3DJZA 5IWLC 3VFMB 2F6AA 5CO1A 3BT2H 1AJ7H 2IADB 3JYBA 4H40A 1YMMA 4Y2DC 1DVFB 1TQUA 2XV3A 5ERWB 5L9DL 1KN4H 4CC1A 3DV4B 3BDXA 4HS6A 3D3VD 3F7KA 4ATWA 1HWHB 1PNDA 2EUXA 3TBWA 1T7WA 4OJFL 1OGAA 4K7FA 2IQAA 4HJJH 4J5VA 2H2SD 4F9PA 3ZTDC 1M3JA 4Q8BA 2BRQA 1I8LA 3H3KA 3LPFA 4FQIH 2CA4A 3AQZA 5KAQG 1JMZA 2IPKB 4RGMB 1HL4A 3VFGL 4IDJL 1S7QA 4PRHB 3FFCA 1I8KA 2LTQB 4JZNA 5FUZL 1VESA 5IFHH 1F11A 2NY1C 4RGNC 4NIKB 1J8HD 3L1GA 4N0CD 2VDKB 1WUNT 2MHAB 4QHKI 2OR9L 3VXME 1VRSA 3BN3B 2CAKA 2YPKB 2WO4A 15C8L 2COVD 1SJHA 5F7LB 4J27A 3V0IA 4P04A 1XQ4A 2ADGA 3CPLB 3VNZA 4C57C 1ZPLA 4M4RB 4Y1AB 4PLKC 5EEWA 2VUOA 4FXGC 4JUTA 3TT1L 3GXUB 2BIQA 4GAJH 4R3SB 2ZP9A 3LD8B 3QEQB 2M8XA 5GSVA 1TEFA 4K15A 1CDBA 4EF3A 1LMIA 1JDDA 1GC1C 3OR6A 4ZMNA 5T3XE 2E27L 5BZWB 2BNRD 2VQTA 1FN4B 5JPMB 2MQ3A 4LEOB 2N59A 5HHNB 3N44F 3UP1A 4MBRA 4WW2C 5AG9A 1SF3A 4JKKA 4U3SB 3K2UL 5F9JA 1GS6X 1BJ1H 1WT5C 1KZQA 1HILA 1U8QA 4JQIA 4E42B 1KF9B 3UDWC 2EE2A 2XSKA 5DWPA 3FFOA 3IFPB 3V0FA 2D31A 5GRXG 4P46C 1T5KA 5ENWB 4PRAA 4F2EA 4J6RL 3TYGL 2M1KA 4F7EA 3QUMH 4KRPD 1QR1B 2YFNA 3T1FB 3CDCA 3RIFK 1GY1A 2B4CH 2ZUUA 3W0WB 5J13B 1GVIA 1TCRA 4LRIA 5T1LD 5AB2A 2J20A 2FD6H 3LNGA 2NX5B 2BSCA 3GIVB 4W93A 5SWZE 3ZSTA 1KB3A 3D25B 2ZNXA 5CD5C 2G4GA 1OGSA 2QZQA 4ERSL 1MJUH 1QRKA 5JQHC 4XCCH 3PL6B 5FHBH 4NQCA 2ZAHA 3C5ZC 2F9BT 2HJLA 4OCLC 1UOLA 5J0BA 2EYRA 4M56A 3SDAB 4L5FH 4NGHL 1ZT7B 3U9UA 1UACL 1RIHL 5AW8B 2PCFA 4LDOB 2PXYB 4HC1A 3I74A 4I3SL 1B4TA 3CZGA 1WAAE 4PLOB 3BRDA 3VFOB 4PJ9A 4YGVA 1IKNC 1RV6X 1I8MA 3BFOA 3STZB 4F3FA 3L5IA 3M7OA 3D0LA 2H3NB 1GGIL 1KTJA 1ZLVH 1JPFA 1FCGA 2MQ0A 1QHOA 4ODTH 3V4UL 2YGQA 2XWTB 5DURD 3R8BB 1WBYA 1WFUA 1ZHBB 2JKSA 2XZCL 2YD2A 3MA7A 3DJSA 2EDTA 3QIUB 4P4KC 4U31A 3ZQWA 8PAZA 3LVEA 3GMQA 3P0YL 4L4TA 1A14L 1OHZA 3ZK0A 4DZ8A 3RTQA 4M5SA 4H26A 2XWCA 1F90L 1J8HE 2AF2A 5EUOF 5LBVA 1BJ1J 1NCNA 4JN1L 1S9XB 5HHMB 5SWQA 4Z7NB 4M00A 3AROA 1A22B 1OQOA 2LAGB 3G6JE 2J8OA 4IDJH 5JO5B 3CE1A 3O45A 1FNAA 3WFHB 3WJJC 4RETB 1XGQB 1IQDB 3G9VA 3RI5F 4ANWA 1AGFB 1VFOA 4OIIL 4NSKB 5DHEA 2RFXA 5PAZA 4H8WH 3HI1B 4MQTB 2PYEE 4AEEA 5ITFB 2ALAA 2OR9H 3N1GC 3MROA 3T3PB 3ARDC 1UOWA 3OKNB 2C9QA 2GYSA 15C8H 3TPUB 1MWOA 1QBBA 2P5EB 5IJVA 3L17A 3BPOC 1NWOA 3CSBA 1Q0YL 1Y0LA 4M8RA 4QEGA 1S7VA 1XZ0B 5IB3A 1BOYA 3CFCL 3GUTA 3BWAA 1JE6A 2FBJH 4P4RB 1UURA 2VO8A 4JKPH 2HRPL 2JJSC 1IBBA 3P2DA 2OTPA 2ZP8A 3EOBB 4IU2B 4PJCE 1E7UA 1MVUB 3C60A 3IT8D 1NFIA 4O5LL 1XF4B 2G9HA 2VUKA 2MOGA 5IOPA 2O93L 1GY2A 5D1QE 5KSUA 4WGVB 3MOQA 1U8OA 2J6WA 3CN2A 2F7PA 5BCAA 1AP2B 5H94A 2BSSA 2NY0C 4V1DB 4H7VA 4GJTB 2R8SL 1J12A 4DSYA 3QFDB 1S7RA 4FNLH 4XODA 3W9DB 5BV7H 4WEBL 4GBXC 4NBXB 3VVVA 4X9BA 3LMJH 4B3VA 5IFJB 1P84K 2EXSA 4IKNA 4XBGA 4I48A 4JANA 5HD8D 3JV6A 2HT3D 5E8OA 3NFNB 3UX9B 1K5NA 1PLAA 2F08A 2OW6A 5H35B 4KKCC 2X4UA 1S9WB 3ZE0B 4K9EL 4GAFB 4HUUB 3BH8B 2IDSA 3L3OB 5ALCL 6FABL 1AZVA 2R69A 1EX0A 3ESPA 1G6RH 1OF2A 1QUNA 4UBDC 3BRGC 5E1IA 4I9XA 1UB6B 2ZTBA 3X1FA 1S2EA 3FYIB 1DLHB 3X11A 1KJ2A 4LKCB 1T2JA 2JTDA 1EMTH 2MJWA 3H55A 1A6ZB 4NGHH 4RAVA 3DGCR 1RIHH 4LPCA 2HJKA 1NUDA 2WBWB 4OF0A 4PJEB 2QSTA 3WD5L 4OZGE 4XGZA 5H2BA 1F1AA 3V4PB 1KELL 5D1XA 1ZLSL 2HG5B 4PCTA 1NCJA 4KXBA 5DMYA 1WBXB 2ZYHA 4FQ1L 1S78C 5F1SA 2NMSA 1M1XB 3F84A 2F53D 5E6SB 4WCYH 2LGNA 3V4UH 4NC0B 1BEYL 1IE4A 2J57A 5F9AC 5EF1A 1NFDF 4HGWA 4WSKA 3VFUB 1EGJA 4Y2OA 4EZLA 2ESVA 3RDTA 2Z35B 3V0DA 4PJ7F 2DQDH 4N0FB 4PJDF 3TO4D 5F7EH 1UQSB 2JJUA 1JSYA 2GK0B 1DHKA 2DLIA 2YSTA 2MEJB 1YECL 3QQ4B 3CFEB 4JN1H 4TQEH 4UT9L 5MEOA 1GKEA 1WA1X 5E5LA 3UO1L 2YOAA 1QBLL 4BIKA 1TZIA 5IF0A 4NJAH 4PWKA 4BA0A 3ET9F 3VXTA 2XWBB 1D7CA 1BIIB 2ICWI 3I02A 5ANMA 3T5WA 5TH2B 4ZS7H 5E2WL 2BNUA 2FDBP 2VSKB 5IJBC 5EH1A 2E9GA 4KK8C 1QUPA 2LVEA 3IGFA 4KFMA 2EUWA 4CSPA 4D9RD 1I8LC 2HKFL 5I1HL 4YBHA 1G1OA 4LCYB 3ZUCA 2YGVA 3SGDH 1QFOA 1JIBA 4XXDA 2FO8A 1FFNB 2EDFA 3GMNB 2CJUL 5D1ZD 5C0DA 3B4NA 2BVPA 1XGZA 2WXPA 3JUYA 4XN9A 1Q0YH 5E4IA 4CSSA 4KNSA 1V7NH 3SE6A 3CFCH 5AYQA 1UUNA 4LSSH 2FQEA 4TL5A 2HFGL 3T0VA 3LZOA 1S4IA 1C7SA 2HRPH 3IKCB 5J11C 4MMZA 2WGNB 4MWFB 4F15C 4BDVB 3NGBB 3DTUB 3RHWK 4BA8A 1UC6A 4O5LH 2A3TA 5HYFA 4WGKA 1A1NB 1FC2D 5DTFB 1IE5A 5HJ3B 2E7BA 1A0QH 5FC9A 2BHZA 2Q7YA 3GPSA 3FZUC 1IGJB 3VJ6B 4A6YL 2R8SH 4PRPA 4YN3A 1PD1A 4Q97A 2B3IA 1VDGA 1Z66A 1WV7T 1RUAL 3HCVB 4P2OD 4WEBH 1RIVH 2VDLB 3I6LD 2IPTL 1ADQL 3W5MA 2BVOA 3A4FA 1U3YA 9PCYA 3TYFA 1MW0A 4H44C 4KV5E 3S5LA 3SOBH 1AKPA 2AJ3A 3T3MB 5IW1B 4P2RD 1RP8A 1P7BA 2ICCA 2VXTL 5I71B 5IJDC 4KTEL 1VJSA 4NQSA 5DJ0A 5BRZB 2NZ9C 1CFVL 4PLJC 2ED7A 1CLCA 3FPXA 6FABH 5IM7A 1NKRA 1OAZL 3QDHA 4MJ5A 3V6OA 3PV7A 5DQJB 4GSRA 1ETJA 1USQA 1F2XK 3AXIA 3TU6A 4IBWA 4JGJA 4WHDA 3D48R 4OM1L 3N44B 1LXMA 2F53E 4PJ5D 4V2CB 3T04D 2E74C 2V4LA 3MOAH 3IF1B 4KJWC 4X7EC 4PTTA 1M42A 4KH9A 4LRIC 2WNXA 1H8NA 3WD5H 5MEQB 2Q7NA 1YEFL 1K4DB 1MHPL 1XAUA 3ZYIA 1ZLSH 1P7QA 4JGUA 3D85B 5DF0A 3VYOA 4XVJL 1PJWA 5JQ6H 2AERT 3B8SA 4JO3L 1G7QA 5L0QC 1CJYA 3DYOA 2GUYA 3LZFL 3QXAA 4QRPD 2O5ZL 5JOPD 1BEYH 1NOAA 2CDFB 4QRUB 43C9B 3LV3B 4PI2A 1JWSA 5DDHA 5FIEA 3KLHD 3IBOA 2L8AA 1J5IA 4P2QD 2XU9A 3IGKA 1KPRB 5FV2A 1RUQL 4UT9H 1Z3GL 1YECH 3GBML 3HTLX 1G7LB 4AKOA 1IC1A 1NGQL 1I1YA 3HI6H 3N85H 4KVCL 2VERA 3KM2A 1FPTH 1I9IL 5E0FA 1NBYA 2OMNA 1ROCA 4GAGL 4HXAL 5IG7B 3RWGA 4QXVA 3KYOB 1U2YA 3NFPB 3BYYA 5C0AB 3W9EA 1YPZF 3NCXA 3WIAA 5C08B 3ILDA 4KQ4L 3EYUL 4XTRC 4GW4A 4Z0XA 5FK9B 1F42A 1J0KA 5IP4A 1TITA 2IDFA 4GMSH 2HKFH 2A1WH 4Y5XB 2XPYA 3E9UA 4DTGH 2OL3B 3H3PL 2DQEH 1IAOA 4GXUM 4OH2A 1GKOA 5I18L 3WTSA 1QHQA 4W9FC 4A68A 3X17A 4JY4B 5B39B 3SCMA 2DQHL 1VF5C 2EIKB 3LX9A 4NIYE 4AIZB 1S3KH 4X6CF 4BCYA 2YGPA 2GKIA 2HX7A 4BKTC 1DVXA 4JVPA 5JW4Q 1HCFX 2HFGH 4KKPA 4Y88A 3GS4A 5F3BA 3WLBB 3AGVA 1GAFL 3HE6A 3D2UA 1MRDL 3EADA 4LXFA 5I66A 1G7IB 3I50L 4ZPTB 4NN5C 3U9WA 3ELQA 5EUOB 3GC3A 2KH2B 2I32A 4M61B 4JFXB 5L8LB 1RSYA 3I6LE 4Y19A 5K69A 3QE5A 1RU9L 3UPAA 4BQ9A 4PJGB 1JPTL 4YDNA 4GRWF 4ZO6A 5KUKA 4YBQD 3TNMB 2BDNH 5I0VA 3I2CL 4LESA 4ZUUB 1CGXA 2QSVA 4ODVH 4MDIA 1ZT1A 3SGEI 1II4E 2F68X 5BVJB 3C60C 3D33A 2CRYA 4A2MA 4PMFA 4MXVE 2IPTH 3DVFA 3HHSA 5JHAA 1JS4A 4PN6A 5HDQL 2EQDA 2UWEE 1Q4NX 2ENPA 1CL7H 5FYKH 1QLFB 4J4PD 2AEQH 4ZQKB 4AIXA 3G6DH 4GFXA 1DQVA 5D7LB 4FLOA 3ESVF 4L8CA 2QPEB 3LKNB 4EN3D 5ACLA 4PJ5E 4UQ3A 1HK6A 2F7QA 4KTEH 4WU5B 2HFEA 2COQA 5B1JA 1CFVH 3L1OH 4XT1C 2BIMA 4X0NA 5EZIL 1JF1A 1F97A 2QVTA 5H4ZA 2EIZB 2H9GB 3KPSD 1XEUA 5GRYA 4M1DH 1S9VB 4IMKA 5GZOD 4QRPE 5JOPE 5JUEL 4O2FB 4FADA 3NJLA 5C0IA 3HUJF 1TZHB 3KJ4B 4JL1A 1YEFH 3FOMA 3O6KL 5HHXL 1DYZA 4FFZA 2G3ZA 4P2QE 1JDAA 3W37A 4NUJA 1HHHB 2QLVB 1PZAA 1RQ5A 2PCPA 3LZFH 4OI7A 5K39B 5INCB 4RBPH 4JKMA 4KVPA 2O5ZH 2PO6A 5JXAL 5D7HA 4UANA 2X4TA 3VDCA 3MV9A 1L0YA 1DDHA 4EUPG 4P49A 3HG1A 1NIFA 1GCFA 4G8EB 1NDGA 5JYMA 3B2UC 3WYRA 3ZKXB 4B9FA 1LO2L 4UWQB 3TBSA 5DCCA 1HH6A 3EGXA 3UIYA 1FNGB 5D1XC 1RUQH 1KENL 1MG3C 5EBWA 3PHQB 2N3JA 3EJTA 2Y25A 1KIUB 4KVCH 1FAIL 3WE6A 4TN9A 1I9IH 2X6MA 1I3UA 5D4QA 3IVKA 1WGOA 4G8IA 4HXAH 5TF0A 3GRGA 5EUKB 1KOAA 2C9SA 4DP5X 4KQ4H 3EYUH 5AD0B 3KPQB 2FUQA 3LB6D 2JB5H 4XAWH 3WFEH 1Z2KA 4NRYA 5I8OL 3FB8A 4NQUA 4PCKA 2X4RB 3P69A 3J07A 5L4FA 1EHAA 3NIGF 4R83A 2OJEA 2XVLA 1KEGL 4NM8L 4RMWA 3I9GL 1KCLA 3UTTD 1QFHA 1ONQA 1MCNA 5I18H 3BSZL 1S7XA 1GXEA 4NKIH 2J8UE 2DQHH 4OJYA 4NN7B 5CINL 4YHNA 5KSAA 2CUIA 5CMAB 1BLNA 1QX1A 5D4IA 4HHAB 2MQCA 2IGFL 3CLEH 1NFDB 1NCWL 2E7MA 1HH9B 1IVTA 3MLVL 1IT9H 4PJ7B 4Q6KA 1NTDA 3MLYL 4FL4C 4PJDB 2QHLA 1JZDC 2Z31D 2K8MA 3BJ91 1GJWA 5AVRB 4EOWH 1ZLUH 3EBIA 1ITCA 2WYIA 1MCEA 4S1DC 1BBJA 1U6AH 2FL5A 2LU7A 1BGXL 3WNLA 1YEDB 5SWSA 2YMOA 3CXHJ 2FHFA 1VB9A 4NXKA 4B6ZA 2XJKA 4N9GB 3MUZ1 2ZT9C 4OZFH 4XP1H 3WFDL 1P7KB 1U92B 2X1OA 4MMZC 5DHVH 4OD3L 4TVSa 4P9HC 3QUXB 1AIFB 1DTUA 5IBUB 1AHWB 5IHZB 2PP7A 3N6YA 2GJ6B 5HDQH 4XNBA 1ZSHA 2GT9A 2KLTA 2VSCA 1DL7L 3KPSE 3QPQD 5EIQA 4JPQA 3QIBB 1B90A 5BMFL 4LVNB 4KI5F 1FVDA 2PW2A 3SDYH 4PM1A 2L3BA 2LVCA 3C08L 1FH2A 4Y16A 2YD6A 3QXDB 1CGVA 4A7SA 5JIPA 5KBDA 5EZIH 2HZHA 4AY0A 2ADJB 4HDIB 3EO9L 4UAOB 4LGPB 4Z7WB 4PS4L 4JFFA 4UTAA 4Z78B 1EHLH 4ZW8A 3D39D 4MS8D 1QSFB 3HVNA 4LFHG 5CGYD 2A74A 4ZFGH 4Z76B 2HT3C 1BWWA 3GXFA 4G7YL 5D2LA 3OHXB 3HZVB 1XL6A 1CD1A 4RIRB 5IEKA 1AD0B 3RWDB 5K1NA 1ZA3B 5HHOA 1MCWW 4MAYB 3V6OC 3LZNA 5HGBA 3UL4A 3MHZA 4YFLI 3U4BH 2FB4L 2ZOUA 2WWMD 3E0GA 2VDQB 4TKWA 3OJDA 4WEMB 5CIPA 1W16A 4M6OL 4KWUA 2IBGA 4ZZFA 5M95B 2WUBL 3VG0H 4EJ1C 2KZ1B 3HIZA 3I9PA 4PJFA 3SE4A 3BP7B 5HY9B 3CHOA 2YARA 1JL8A 5BS0E 4RZCB 4X4YB 4LASL 4N1HB 3ALWA 5JHDE 3WTVA 2TSBA 4R4FL 4PLNC 3VFTA 1LD9B 1OEZW 1FAIH 1W8EA 4AM0A 1TJHH 5IVZA 5J6GB 4MZIA 4ZMAT 2R83A 3ATEA 3C5SB 4B5EA 4BFFA 2J5WA 4M7JH 4C55A 4XX1G 4L9LA 5ID0A 4QHPA 1UXWB 1VEPA 3IDNA 3PG2A 4DGUA 3NSXA 1QEWA 1W0VB 4YHPA 4YHML 5DZJA 3PGDA 3UERA 3H9HB 3L3IB 3QEUA 3WNKA 4OUUB 1KEGH 5K1JA 1PY0A 2NUPA 3V5DB 5D7JB 3WXWH 2R2EA 4LLMA 3BAKA 5TF1H 2Q1EA 2NY2C 5CINH 2CKBA 3EOAA 4OQTL 2XG5B 1W72A 3RY6A 2GC4C 4J2QA 2VM3A 3V5KA 5TDPA 1EFXD 4NQEA 3MYJB 2IGFH 1ECZA 4FMVA 4KDTA 4OLVL 3HZMA 4X83A 4AE0A 4L18A 1URZA 2G3MA 1G4MA 3GLZA 3MLVH 5MEPA 3MLYH 5ICYA 4QI3A 4P59H 1OT2A 2E47A 4IQHA 1BXVA 3DO4A 3GZQA 4QHMB 1MW3A 4K3EL 5C0CA 1MNNA 1OO2A 3EFOA 3AT8A 3CHQA 3EJJX 1BGXH 1V54B 3SPVA 2VQUA 3UTQB 1CE1L 5FWRA 5EU6A 1G7JA 4OUOA 1YPZB 3VRLF 3VWKA 3HE6C 3AUVA 2WLNA 4OD3H 3QIWB 1TFPA 1TKWB 2P5WB 2PTTA 3DVNB 4N0UE 2OR8A 2QGEA 2ORBH 3CUPB 4KO7A 4PY7B 3G5VA 1J0ZA 2OULB 3JWNG 3LQAL 4BUHA 5I1CL 2OMTA 5DWUL 2BFGA 3CVBA 2YXMA 1D5MA 3H9YA 4QRRD 4ZS6D 3ZHNA 4PD4J 3KLAA 4ONFL 4KITB 4LF3B 4IKJA 2BHUA 3DX6B 3D39E 4X6CB 3KXFD 2AFNA 1UD5A 3QRGL 3P4MA 2H32A 3RVXD 1X6LA 5HXMA 1NC4A 3KPRD 3H9SE 3CSYB 2ATAA 1C5BL 2XN9D 2WXRA 1KYAA 1SNRA 4XO5A 5IB2B 4F37K 1J1PL 2FSEB 2Y2TA 4Y0GA 3EO9H 5D55A 4BEIA 3AS2A 4XCEB 5TFSH 3GRWH 5EIIB 2JLLA 4HLZG 3TFBA 1H6UA 1NJ9B 2EDWA 1QRND 2RCSL 5IK3A 1RK1A 4X50A 3P0VH 3EOTL 4GRWB 4XMWA 1BP3B 1LDPL 4IEFB 4G7YH 4NP4L 2VIRB 4M7ZC 4Y4KB 3WTUA 1KYUA 2DQ6A 2PWGA 3NBNA 1OAXL 1D6VL 3U30B 1L9MA 1BQKA 4GIPD 4S1RL 5B1JC 1FIEA 1MY7A 4OGAC 3VD3A 3KPNA 3IRZA 4X8JB 5D93C 1Y1UA 4BGLA 4GP4B 3D7PA 3NJNA 2P28B 4IMKC 2VO5A 4UIKL 4B9GA 2BHYA 2FX7L 3REVA 5L2JB 2G0KA 2D3VA 1ZHKB 4XWOC 4MZRA 1FZKB 3W57A 1Z0NA 3QNFA 3VI4F 2BRRL 3O2DA 3EFDL 4KX7A 4Z7QF 5A3ID 2AQ3A 2R29L 3H54A 2N4IA 1KTLB 4LASH 5I8KL 3TLRA 2E6PA 4X5QA 2H6PA 4R4FH 3UACA 4GLRH 4P8QA 3MRBA 4LOFA 3WMSA 3CMOL 3L5XH 3ULVC 3VXUD 5IROD 3K74B 1NPUA 3L9EA 3MRKB 2H4EA 2Y0SA 1URLA 2CCWA 2PO6C 3T0WA 4JDEA 5I26A 1Q9LB 1OSYA 2ZXCA 4KUCF 3MRIA 3VD5A 3GSNL 3L5HA 4JFHD 3HUJB 2GSIB 4ES8A 3CHRA 1RULH 5CU9A 1SVCP 2QSQA 4BSVA 2PLTA 1C08B 4OF6A 1QA9B 1CWVA 2GCYB 1FA4A 1G7HA 3MRHA 2HKHH 2MCMA 5FO8A 3HFFA 2R0ZH 4XAKE 4LVHC 3G5YA 4PY8I 2EVGA 4OQTH 4R7NB 4P5KA 3MBED 3LNEA 1GC1L 2WBKA 3ZMNA 4FDWA 5J1AA 4OLVH 2VJ0A 4DOHB 1OP9A 2CDEA 3A24A 1MHHA 3HZKA 5F44A 3GMPA 2ZX7A 4O2CB 4JDZA 4I0KA 1IFRA 2KC0A 3FO0L 1PZBA 4OD2B 5CKAA 2DRUA 4AL8C 1A4JB 1LO0L 3FU3A 2Y1VA 3FO1B 3MTXA 3I9AA 5F8QC 1X5GA 3DX2A 5FYLD 3S97C 2ZCHH 4S1SL 2Z0UA 3QWRD 2DQTH 4UTCA 3R18A 3F7LA 2A99A 3M1CA 4QRRE 1CE1H 5KSAC 4AGQA 3QR2A 1QNZL 4Y9BA 3S35L 4LZKA 4ZW5A 2WINB 1DJGA 1DE4A 3KXFE 1YJDC 1IIKA 1X5LA 3LKPB 1R3JB 4K3GA 2EILB 4I0PB 4XBEL 4A7GA 3NIGB 4LSPH 2DJ4A 3V4VA 3MYZA 5I1CH 4TLSA 3F05A 4XNZB 5DWUH 4OV6F 4RH4A 1CBJA 2P7TB 3F7YA 5EPMA 4Z7AA 3LRLA 2CGRL 2FIRT 4RGNE 4G43B 3IFOA 3LEXB 2H1PL 3QRGH 1DZ0A 2VXUL 5IQLA 3Q1EA 1C5BH 3UYOD 3WIHA 1AZZC 1HSAB 3DETC 1WFOA 3GHEL 1J1PH 2CDGA 4CGTA 5EF2A 5DJAB 1SOXA 4L3FA 3T8XA 2AABL 3T1WA 4TF4A 4DUWA 3H4FA 1PIGA 1CR9L 2K4AA 1GZQB 3CPUA 4QY8A 1RZGB 1HKFA 5F7WC 3SE8L 5I1AA 3VSVA 3FTGA 4NQDB 4TTGA 2X6CA 3GFUA 3IRPX 1H9DA 2YR3A 3BIKB 1VERA 1D6VH 4EI5A 4Y16C 2W07A 1YMHB 3FFDB 2Y69B 5CZKA 4GT7A 1F8TH 3L2NA 1FDLH 3TEUA 4Q2ZA 5B22A 4FYRA 1YG9A 4S2SB 5IEHA 4ISVA 3ZDZE 3QWOB 2DWDB 1UASA 2WZPA 1K85A 5ISZA 3NIDE 2FX7H 4O4YL 1F00I 5KVFE 3OJVC 2A74C 4JFZL 3IDMA 1GOGA 2FZ3B 1S8DB 3PWJA 1F6FB 2AHIA 1LNUB 3KWVA 4NUQA 1LYQA 3LKSB 4GEIA 3C6LA 3EFDH 2R29H 1ODAA 3JTSA 4JFHE 4TLKA 1EUUA 2IFGA 4NLAA 1NCHA 3MBXH 4AQ1B 4AYMC 3CMOH 1U91A 4HH8A 3QHTC 2DQFB 3BZDA 3G3LA 3TA3D 4BH8B 2E5EA 3QQDA 4XVTL 1HXYA 5FO7A 1OTUC 2VC2B 1KB5B 3QJVB 1OD9A 5ACMA 4H1LH 3IJHA 3OAZK 4R2GD 3LEVH 1I9EA 3SE4C 2YAOA 3GS0A 2E86A 4JQVC 3VXPA 3QI9A 3VFNA 1AQKL 2EACA 1E5YA 1HC1A 3VYPA 1CXKA 2J12B 3HNVL 4KHTH 3PREA 2J2ZA 1NEZB 3D05A 5FYLE 2G3XA 1IL1B 3AS0A 2N1TE 3PWLA 4L9LC 4B27A 2YEZB 3OX8A 3TJEL 5I1DB 3X1NA 3MNWA 2OCFD 4W81A 1A3RL 5CP3A 1KC5H 5KSBF 1PG7X 2F19L 3V2AR 2GITB 1P1ZB 3V6FA 3MLSL 1TZGH 2UX7A 5GGTH 1U2HA 3CC1A 4KKBC 4W9EC 1YNTA 3LN5B 3AXHA 1BVNP 4FA8A 5JDJA 3L13A 5IHBA 2H7WA 3BVNB 4WFGE 1CICD 5BXFA 1K4CA 2HX8A 1A6VH 4S1SH 1WA0X 1K2DA 2CD0A 3H7BA 5F3HA 1JYNA 3RY6C 4HWUA 5TE6L 2A0LD 4A7TA 1E8ZA 1QNZH 3IAQA 1EV2E 1BOGA 1WA2X 3W11C 1KMGA 2EYTB 4KDTC 2FRGP 4LLDA 4LKXB 1UADC 4OI9A 4WTQA 2OPCA 3QAQA 5CN1A 3QJXA 4ATTA 2O61A 4MJ6B 3ZT5A 1MFAH 4I5BA 4YSDA 2V2XB 3GBLA 3CZFA 4XBEH 5ICXA 1MI5E 3WG7B 1YEIH 1X5IA 2C3XA 1L3WA 2FEDC 2Z31C 1AVAA 5C9JB 5AVQB 4C56B 3MJGX 4HCRA 3QYCA 4MX7B 2CGRH 1N2RB 3OGCB 5FXCH 3MO1B 4JPVH 1IAKB 4ZMTA 1KIPB 1OE3A 1QASA 1UVQA 3P4LA 4DETA 4L2YA 4HULB 2YJQA 1AI1H 4XZUA 2VXUH 4ZPVA 1JXFA 4WUUE 3QFJA 4MJID 3NQKA 4PJAF 4PUBH 2AJVL 3K72B 5I0ZA 3ZYOA 1BX2A 3SKJL 1J8SA 4ZX5A 1RJYA 3EH4B 4MVBD 4F2MA 2FJGA 1RVFL 1IBGL 5C3LD 3CDZB 3WY2A 1K8IB 4K3DH 1RD6A 5BNXD 3QPQC 4WKZB 4XBPA 2WXQA 2OX5A 3OKLB 3O9WD 4WTXA 1NMBH 4HK3N 2D2OA 1BG1A 3QC5X 5JXED 2V7NA 5AUMA 1MFEH 3SPHA 1NANH 4G6MH 4Z0BL 2VKXA 1NCAH 3X14B 1GGUA 1SEBB 2JI2A 4YHIB 4X99B 5HYJB 3RVUC 3PDOA 3EFFA 1NZRA 2FJHB 3WIFA 1IGMH 1NPNA 2EDQA 3FCTA 4O4YH 4JFZH 3GMMA 1OP3K 4M1GH 4Q9QL 3MODH 4JHWL 3L4XA 4MS8C 5F1NA 4AGPA 4N0RA 1IC7L 3CFQA 1XF2A 1CIDA 1FGNL 2QQLL 4ABVA 5LXGH 4HAKA 4L3EB 5GS2H 1IC5L 3RKDD 3IAGC 3AQDA 2ZOOA 1G87A 1QR4A 2VISB 3SE9L 3O4OB 2BOBB 1HYRC 2WBJA 2XCMC 4QOKA 1E8YA 5CJOL 3U0TA 1REIA 3D9AL 1KG0A 4EO5A 3AMKA 1X6NA 4RSVA 2DWSA 4DKTA 1P5UA 1X7TA 2EECA 5B38B 1RZIB 2DMHA 3HNVH 4XNXH 1QSEA 5DS1A 3Q6GL 5CP7A 3RNKB 4IOFC 4M03A 4OZIF 1M7DA 2IG2L 3VXQB 5DRNB 4U6TA 3WO4B 1M2OA 5SV3A 3C8DA 1BFTA 4K7PH 3T6XA 3ZO0A 5ESVA 5IW6A 4TTDD 4C58B 1A3RH 3UAJA 4FHKA 3O81A 4OGXL 2CLZA 3VI4B 3ARBA 3ECBA 1M7UA 5C3TA 3GBNL 4OF5A 4Z7QB 3MR9B 4GINA 3RWHA 4PGDA 1CK0H 4OU3A 1KGXA 4O51A 2BOCB 3IN0A 5GGQL 1JK9B 3ZGIA 4HUVA 3VWJD 2V5YA 1XTLA 2PTUA 1G9ML 1RUKL 2X0WA 4UQAA 4LCIL 4NENA 2OMZA 3ETTA 1X5KA 5J12C 2LFGA 3VTMA 4OJAA 1PCSA 1YLBB 2GIXA 4NKMA 1FJ1A 4JS7A 5CLTA 3SDDD 1YMME 2DMBA 4ZFQA 1UKTA 3B7UX 4ZMWA 4ZFZA 2AC0A 3CFDA 2LW3A 3LIUA 3QCVL 5D4HA 3BAJA 5B38G 4JQIL 2YBGA 2VN5A 3OKOB 4OLYL 1OGAE 1J9QA 4P5SA 4ZYKA 2F54A 5F96H 4F91B 5AYTA 5E5UB 3A5VA 4XPFL 4POYA 3ETSA 5DO2D 2VMFA 4PJIA 1R3IH 3A6OA 2X2IA 1KNOB 3LIZH 2AJVH 1JZ8A 1K72A 2N0MA 1OLLA 1CIUA 3QCTL 3L4CA 1J8RA 5I9QB 1ZGLM 1TPXC 3D34A 2D3JA 4DCQA 5KSVB 4CUCA 1RVFH 3B7SA 3DOSB 5JOFA 2RALA 1MREH 3ATDA 1U0QA 3BE1H 1AYOA 1XF3A 3S37X 4OV5B 1FYTD 5KWYC 4RX4D 1U9KA 2A9DA 4N2IA 5JMOC 3PHAA 2CBMA 4UM9A 1A9VA 5AW7B 5FO9A 2DYPA 3FCUB 2BNQD 2CKNA 3EYFA 3ERXA 3L3GA 3LS4L 3E8UL 1PU0A 2ARWA 2MCPL 1JNNL 5E2UL 3FUMA 3QP3A 1P1VA 2IAMA 1P4BH 2VAAA 3VD4A 4HC1L 5DS8A 4YHLL 4EXPX 4GQ9L 4TLTA 3WHE1 3SPIA 3SQOL 1HHKA 4F58L 4JHWH 5L6YL 2E4FA 3QUZA 2VLLA 1MAMH 2CK0H 2GJZA 1IC7H 3DMMA 5FKPB 3ZZQA 2MSPA 2XJLA 1NGZB 1FGNH 2QQLH 1S9YB 4IRSB 4JHZA 3NEOA 4E41B 5HVWA 3F12A 1NOLA 4O2EB 3EH3B 4PWGA 2BH0A 1IC5H 5T1DL 1BVLA 1MH5A 3CFKB 2C3WA 1MIEL 3GMLA 3VYNA 3MAWA 4ORZC 3H7LA 4DW2L 3BPNC 1CLZH 1SEQL 5DLML 3SE9H 5DD6B 2C9XA 4JHUA 5CJOH 4YZFE 1TJMA 3ROOB 1J88A 1QLRA 2DBJA 3D9AH 3BVTA 1OV8A 1PSKH 1FNEB 1P5VB 3Q6FA 3O3DA 3FT4A 1P6AB 1U58A 1ET7A 5KBPA 3CK0H 1T1XA 4HJGB 1U3HD 1YEKL 4KK5D 3DUUB 5FF6A 4FTDA 4NT6A 4YK4B 5AZ2H 1ZIBA 1D6EA 4KJPC 4AZUA 5IHWA 3EJYD 5BO1L 2B0SL 4LPVA 4D9LL 5IROC 5L8KB 1PNCA 4XCNA 1Z9LA 2NQCA 1X9LA 2UVFA 1F3RB 3PAUA 4KK9D 1YNKH 5BQ7A 1T7YA 2GBTA 1FL6A 1EEUA 4YDKH 5C92A 2GIMA 4NZRL 2IH3A 4OGXH 1G0DA 5DFAA 1ZTXL 2G60L 1WWCA 4G3YL 1D5IL 2Z92A 1MN4A 3QI9C 4PI0A 1DJHA 3FUKA 3U83A 4NQCE 4YFEA 3P3SA 4JRXB 4Z3JA 1BAGA 4YDVA 3TL5A 5GGQH 3SDCA 3P4OB 4I18C 4DK3A 3QULA 3KG5A 1JXDA 2B1AL 4ZZKA 5EFIB 4DP8X 2RJMA 3QQ3A 1XIWA 3QORB 1ILUA 4JFQA 4YAQB 3MBEC 3RX7A 4X8GA 2FWLB 1UFGA 2IIJA 1AR1B 1XVSA 1OALA 3DECA 4GY4A 1BZ7B 1TQSA 3DOHA 4KAQL 2VSMB 3REWB 2UVEA 5AL8A 4YHKH 2CIKA 2PWEA 4X5XB 1R17A 3HAEA 1KYOK 3BUYA 4JQIH 3UTZB 1DN0B 3RPIB 4FQPA 2Z64C 2NYZA 2CRMA 3MBWA 4HUWB 2EZ0D 1FYTE 4L4TE 2VGLM 5E1GA 1YCSA 4A39A 1AKJA 4Y4HA 1G9HA 4QT5A 5ANHA 4G80B 5DVMA 1T4KA 4HPHA 5KSBB 3P0GB 2F5AH 4Q58C 1G43A 1WHOA 1OCWL 2JE8A 2NUTB 3GLDA 1Q94B 1RZ8B 3QCTH 4OSUL 1AO7B 2BNQE 4LSVL 4X6DA 4ZUSB 3ZL2A 2FATH 4HS3B 2X1XR 3H3BC 3K6DA 4J3TA 3RI5K 3ZHKA 4ZI8A 4I4WB 2XV6B 4ABWA 3QO0B 5GGSA 5LGHL 1R47A 2E0PA 2VZ3A 5GGRY 2R69L 1ID2A 1WAAF 1NM9A 3HC2A 5DJYB 4R7VA 5GPRA 4O02B 1KJ2L 3KH3A 4RGOH 3RB5A 4BXSV 2VLRA 3E8UH 5E2UH 3O4LA 4KDVA 4LLWB 5DYFA 1ZTXE 2BSTA 4UINL 4AQEB 1QEXA 3C9NB 4HC1H 3HBGA 3RURA 3TO2B 2DKMA 1WIUA 1LEIA 3I6KA 4FTVD 2VZSA 4NWTH 4PIBA 4HT1L 4ZMPA 2XTJD 8FABB 2B16A 4G9FD 1QLEL 3DVGA 5FPIA 4IOIB 5DI8B 5L6YH 3TT3L 2X41A 5F89A 1LILA 3UPRA 4PJAB 1MUJB 4G7SB 1I7UB 5AAWA 5I75C 1EGJL 1R0AL 4UIMA 3QEGL 2TRHA 1MIEH 4PV9A 4W70A 3BZ4A 1W0WB 4KXCA 3P4NA 4YBLB 4C59B 4DW2H 1SEQH 5DLMH 2C4FT 2XC8A 1DVFD 1XGPB 1DUZA 5GGUA 1Z1WA 5D5ME 5HYQB 3ZYZA 5T1KB 1XB8A 4JDTL 2EDMA 3QZLA 3RVWC 3VH8B 3LKRB 4N0YL 4JFSA 4F80A 3S88H 4FG4A 1AXSB 2Z8RA 4EMZA 1J0IA 1N4XL 5F8RC 3TEXA 2X4PB 1JZEA 2XQ0A 5BO1H 2VKWA 4YSCA 4D9LH 4GW5A 2WZAA 4WJ5B 4IRZH 2XZZA 1BYOA 5ALBL 5E9AA 3V9EA 3RVTC 2WBJC 3T0BA 3TA3C 3QUYA 4PRHD 1RK7A 5K33A 2DQJL 3SKOA 2R15A 3RL1B 4WNJA 2WLIA 2G60H 4N28A 4B97A 4UOJA 3AM8A 3N0PB 4G8FB 3MFFB 3RUGA 1OY3B 4CJ0A 2J1WA 3FC8A 3FSZA 1ES0B 2I26N 4JR9L 4EDXB 1RSFA 3FUJA 4UV7H 2OYLA 5E6ZA 1QW8A 1HE7A 1OW0A 2XKNA 1MVYA 5A6LA 4FYSA 1MCHA 3X3FL 2VDMH 3UAJC 2X2HA 5D1XE 5FA4B 5IR1B 4GEJA 2VRQA 5IFAL 1C16B 3ARBC 4NKOB 3RFRA 4WHCA 3QEQD 1MCRA 4NLHA 2ZCKL 1JK8A 1KLFB 3IK2A 1JGEA 3DIVA 4OZIB 1IGTB 4HKJB 1ASOA 2VOTA 5CLXA 3T65B 5J06A 2ILLA 3O2WL 3N9GL 2A0LC 2CHNA 5F7HA 3S3SA 4LLYA 4ONHB 4OLWL 4PP2B 1ZS2A 2OXGA 4F9LA 2Z8SA 4OSUH 2MPVA 1M57B 4WV1B 4EZMA 4GXVH 4MXQD 1WFJA 5KOVC 1EXUB 1ED3A 1I3RB 5ANME 2PF6A 1TF4A 3R7RA 4MDRA 3ECQA 5DJ6A 4GUQA 3BUTA 2W94A 5FUCE 2YQBA 4OZGF 1IGYB 1IEBA 5FCSH 3QJUB 4FTVE 1JAEA 3RTLA 1WLHA 2R56L 3ULUC 3I75A 5IMOA 3LZPA 4BELD 3CCHA 2WZ0A 1NMCB 3WXVH 4MNGB 1W2KT 4GQRA 4Y5VA 2ICEA 2YPVA 2AK1H 4JFOB 5DVOA 3UZQA 2IBBA 2QQNL 4ZMQA 2O6FA 2Y2WA 1U8CA 1KCSL 3IJYB 2B2XH 3LHPL 1QLEH 4HT1H 6CGTA 1OL0A 1LTXA 3L9BA 3TT3H 3LPOA 5FV1L 1DFXA 3TBTB 1MWAB 3FSWA 3L7FA 3NFSL 1UWYA 3APFA 1IFHL 2WN3A 4PJXA 4PRBA 3SDAD 1NIDA 4Y4FA 2L7UA 4F27A 4F8TA 1EGJH 4LDEB 1R0AH 4KZ0A 5GIRB 2CJSA 3QEGH 2PXYD 5D9SA 3PXJA 3CFTA 2IAMC 1HIML 2JELL 4UT7H 2NCEA 3VXSB 1QQDB 4ZOAA 1XF1A 5AOZA 1N0LB 4PRPE 3BO8B 2AQPA 4G5AA 4WDIB 3QUZC 2WJ7A 1J7VR 3DMMC 1T7XA 4JDTH 35C8L 1VKXA 4JG9A 1ETA1 1M71A 4U3HA 3DV4A 3QIUD 4N0YH 4JEGB 5C7XH 5JMRA 1FZOA 2YEQA 5EO1B 3BP6B 3MMEB 2VRAA 5A16A 3WN6A 5I0XA 5HHMD 3WI9A 2BY1A 3VI3F 3D2TA 1CXHA 2VMCA 2VDNH 4FF9A 2DQJH 2IPKA 4O00A 1UZGA 5LVEA 1X7QA 1O7SA 5CEZL 5LLIC 1XO8A 5FCUL 5F7FA 2VR4A 3VAEA 2EXYD 5J6HA 1TUPA 5C09D 1I1AB 4XPTH 4U6HB 4IMLB 3UBXG 5GXBB 4PJ6A 4PVMA 4FYQA 1VFAB 1ZA6B 2E9JA 4P9HH 1LO5A 2I5YH 3GJFK 4N3UA 3F7VA 5CZXD 5B7EA 2X89A 3CN0A 4GP5B 5KS9A 1SN0A 4XC3H 3VXMB 1MNUL 5IFAH 3NA9L 2PCXA 4QYOA 3OPUA 3THML 2CNYA 2VLME 5DA4A 3WUWG 2NXYB 3GGWA 4N20A 4KV5F 1IKFH 4HUMB 1WZKA 2ZCKH 3O3BB 4N9OB 3RA7H 5I1JL 3SDCC 4XC1L 1DBAL 4HEMA 2ED9A 1JV5A 4OKVB 2AAAA 4ONGL 1N6QL 2X4QB 1LO3L 2Y7OA 3O2WH 5BZWA 5GSRA 4RFEA 1C1EH 1ZVYA 4OLWH 4M7LL 2JCCE 4LEOA 1SN5A 4V1DD 1L9QA 1GYCA 4OLXH 1IKOP 2OK0L 5E2TH 4NFBA 1ZANL 2QPUA 4WO0A 2J43A 4TVPL 3EBHA 5ECJE 4AVHA 1GL4B 2NZIA 2JSFA 2CO4A 4ZMZA 3WDHA 1OARH 5C8JB 3O2VL 5EOQH 2R56H 1ET8A 4AEHL 4RMUA 1JCKA 4S0SD 2CBTA 2WK2A 4IK6A 1F58H 1AIZA 1ZVHA 4WFHD 1QR1A 3OAUL 2EO7A 1HT6A 1M9WA 4A7UA 3RX5A 1M2VA 3W0WA 4LVEA 5JPNB 1EWHA 3TVMA 3BH9A 3GKWL 3K5SA 5I2IA 2XN2A 1DQLL 4FFZL 5FR3A 3WN5A 3BWUF 4AG4L 2PPDA 4LCCA 3QNZA 5SWZB 3ULVL 5I16B 1EAQA 1OWRM 1IFHH 4AQAA 3DJ9A 3PL6A 4Q56A 2NW3A 1I8AA 4FQXA 4YE4H 5HGDA 3WY1A 5KG9B 3PQYA 4Y19E 1FNSL 3TZVA 3ZBMA 4AWJC 1T83A 2JELH 1HIMH 4X4XB 5I6LA 4OT1L 4OTXL 4OB5H 3FO9A 1E2WA 1ZKAA 2W5PA 3K3QA 3NJJA 4Z7NE 1WFIA 5DFTA 7PCYA 4ORGB 3S8FB 2OM5A 3MRMA 2XFGB 1OPGL 2H3NA 4OGYL 5I82A 3S3PA 1JI1A 2GBVA 5K9OB 1GYUA 3RGVD 2YKLL 3OLIA 3FB7A 3BVWA 4BZYA 5AAWC 3BD3A 3CN1A 3EZ8A 1XR9A 2I7OA 1CGTA 5C09E 4K5MA 4EQ2A 2OMUB 1DFBH 4ZW7A 2P4AB 1JNHB 3LN9A 4GRLA 4G11A 1JYVA 3ZE1F 3IE4A 3GSQB 4M8QB 1J8HB 3RJDA 1I1FB 5DRXB 4E5XB 5CEZH 1OIOA 4MMXA 3G6JB 2CALA 4RDQF 5BRPA 3FRUA 4UM8A 3U0WL 2ZSWA 1IQDA 4JM2F 3HMXH 3RLSA 1YJDL 2W9EH 3A47A 3ME0A 1MOEA 3RFZA 1A21A 1E4HA 4FFYA 3QUYC 4HCIA 2PYEB 2Y07L 3L9RB 1MNUH 4KXDA 4FRWA 3DV6B 1JPGB 1TCMA 3GT6A 1RJLA 2P5EA 4FLRA 3RYMA 2AEWA 2GABA 3AM8C 1CB4A 2G30A 4L4VA 2ZOKA 5C0ND 4NI3A 1WF5A 3U6XA 4LU5L 2BPBA 2EH8L 5EEXA 3POCA 4XC1H 3S34H 2X2UA 2YXVA 3UZEA 3MV9E 3ARGB 5F7KC 4G1MA 1I7TA 4IU2A 1UD3A 4GI9A 1OW0C 2GY7B 1KXQA 3CVDA 4PJCB 2P46B 1R5WA 5BVPL 1MJJB 3HE7A 2HUHA 1W91A 4LB8A 1GS7A 4X0KA 4E5XG 1OTSC 1EK3A 5D1QB 1ACYH 1R5VB 1XCXA 2OMBA 4WFHE 1JHLH 1S5HA 4QKTA 3WJMA 3B9KA 2WIIA 4PBWD 1B6UA 4TVPH 3WKML 4K3JH 4CW1B 2HRGA 2NNRA 1AFVL 2Z91A 4FNPA 4NN6C 2NTFB 3H0TA 1VA9A 1B0IA 4BRJA 1VGKB 3E1F1 3O2VH 2EKSA 2X38A 3GTTA 5I6PA 4X4MA 1JGDB 2W0LA 4AEHH 4MSWB 4UTAL 1OPOA 2CMRH 3C8KA 1CXFA 4Z7UA 2ZXQA 2B59A 3RPBA 1EANA 3ML8A 4NERA 4OVVA 5FM8A 5L7XH 2V3FA 4KGLA 4PJEE 1CQYA 1JNLL 2Z7UA 1VGEL 3GKWH 3HB3D 3NP4A 1CO1A 3LEYH 1NIEA 2I85A 3KBPA 4NXSA 1DQLH 3V6ZA 3NABH 4HUUA 1AQ8A 5DC2A 4ZTOL 1Z5LA 4XVUD 3MREB 4WNQB 5IY5B 2K1MA 1A7QL 3ULVH 3FCSA 4C4KT 1O7DC 5HYIA 1HINL 5HGAB 3WU1A 2DYRB 1DCEA 1B0RA 4JPIB 5FDYA 5KJRL 4LOUC 4DPBX 5C0FB 4PHZA 2Y7SA 1UKQA 2Y7NA 2ICEC 4OT1H 4Y5VC 4Y89A 5SWSE 4F8NA 3D85D 2J5LB 1CMOA