3NT0A

C500s (t1d) mutant of cueo soaked in and bound to cu(i)
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
492
structure length
468
Chain Sequence
ERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHSHLLEHEDTGMMLGFTVLQGDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of multicopper oxidase CueO bound to copper(I) and silver(I): functional role of a methionine-rich sequence.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Blue copper oxidase cueO
total genus 129
structure length 468
sequence length 492
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3nt0A03
1AAJA 5TK4A 2VM3A 2QPDB 2AZAA 1V10A 1BXUA 1KGYE 2VW7A 1JXDA 2GIMA 4A66A 1JZEA 2YAEA 4GYBA 3NJMA 1CUOA 1SDDA 3DTUB 4A2DA 3SBQA 3T71A 2CBPA 1J5CA 1OCRB 4A2GA 1MG3C 3ABMB 4YSQA 4YSSA 2JKWA 5AFAA 1ASOA 1TEGA 3WI9A 4P5RA 4Q8BA 5FC9A 3ZX1A 1PZBA 3IEAA 3FSVA 5E9NA 3IBOA 3NSYA 1MZYA 1CYXA 2VSMB 1E30A 2YXVA 5TK2A 2PPDA 3X1EA 4E9WA 1FFTB 1B3IA 4YSEA 2A3TA 1AS6A 2XV2A 1TEFA 3WG7B 4DP6X 2UXFA 3PCYA 2FQGA 1EZLA 4YSOA 4YSRA 2XXGA 2DWTA 4RH4A 1AQ8A 4DPBX 5IY5B 1URIA 4YSTA 4DPAX 1ID2A 3TBBA 2YAPA 2XX1A 1KV7A 4YVNA 3CDZB 3CVBA 1IC0A 3AG1B 3AW5A 3X1NA 3MBWB 3EHBB 2GBAA 4NB7A 2PPEA 4GP5B 4BXSV 1KDJA 4JKNA 1NZRA 4KNTA 2QPEB 3OM3B 2IAAC 2AFNA 3FU7A 2J5WA 4KO7A 1OCCB 1X9UA 1ADWA 2DYRB 1A4CA 2XV3A 4CSZA 3TA4D 2BW4A 5LDUA 5I28A 2DYSB 5B7FA 3N55A 2AVFA 4GXFA 3AY2A 1JOIA 2WO3B 2FQFA 1KBVA 1QNIA 4L0PB 4JHVA 2XWZA 2IH8A 3DKHA 2YAFA 1PLCA 1WA2X 1UATA 2JXMA 4AI7A 1PLBA 3PXLA 4E9XA 1J9TA 4KO9A 3OMAB 4M4RB 1J9QA 3CVDA 2OJ1A 5EHFA 2RACA 6PCYA 3MX0B 3EH5B 4YSPA 3ZIYA 1W8EA 2YARA 1ASQA 2OV0A 2YAQA 1BQKA 2IWKA 2BP8A 1BQRA 4GP8B 4Q89A 4X4KA 2PPFA 4N4YB 4M3HA 2VM4A 4KNSA 3EH4B 1R1CA 3FU7B 2J56A 3T6XA 4NAJA 1J9SA 1AIZA 1AS7A 2ZWNA 1L9RA 1MZZA 3N2JA 1GY1A 2IDUA 2ZOOA 2PP7A 4HCFA 4E9TA 3GDCA 1M57B 2PLTA 2J55A 2X87A 3FSZA 4DP8X 3UADA 3T6WA 3NSDA 2BO0A 1L9QA 3FQ1A 4FA7B 1CYWA 1BEXA 1SHXA 2UX6A 4WKXA 1NWPA 3FYEB 2IH9A 3QJSB 1E67A 4CSPA 1IUZA 1I53A 2N0MA 4DP1X 2R7EA 3AG4B 1AZRA 3QJTB 3OMIB 1ZDSA 3ERXA 3FSAA 1E65A 2J57A 3ZDWA 1WAEA 3ASOB 3QQXA 3PLYA 2IDTA 5D4HA 4WTQA 5I6MA 2EIKB 1JVOA 4E9SA 3G5WA 2XUWA 3L45A 3H4HA 2FT7A 2YXWA 2BP0B 5I6LA 1J5DA 4BWTA 1E5YA 2EIMB 1PCSA 2Q5BA 3H56A 3NJLA 2IWFA 3ABLB 4PAZA 4UAHA 1HFUA 1L9OA 1KCWA 4W1TA 3ABGA 3V9EA 1A8ZA 1RKRA 2TSAA 2BZCA 1ZV2A 2FQDA 2Y69B 1AANA 4KO5A 2CJ3A 1AOZA 1NIDA 2H5UA 2DWSA 3TU6A 2H47C 2PCFA 4DP0X 2P80A 4HZ1A 4BK5C 1N68A 4UF7C 1A4BA 4G71B 1FWXA 9PCYA 4UANA 1WA1X 3GXUB 5D4JA 4GY4A 2PPAA 1L9SA 3DIVA 1E5ZA 3GYRA 5B3SB 2I85A 2ZONA 4AZUA 2B08A 2CUAA 1ET5A 2GC4C 1PZCA 3BVDB 3FSWA 1WS8A 1M56B 3NJJA 2I7OA 3OQRA 3ZBMA 1NPJA 1XB3A 5B1AB 4DP5X 1L9PA 3NJHA 2XYBA 5I6OA 1GYCA 2BP0A 3NT0A 3KW8A 3EF4A 4K9JA 1W6LA 2CCWA 1GSKA 2P80D 3RYMA 5I26A 3EH3B 2FWLB 3PPSA 4HALA 5I5JA 3S8GB 1ETJA 5ANHA 1TKWA 2IWEA 3OD3A 1JZHA 3BQVA 4HAKA 1N70A 3FQYA 3S8FB 2HX9A 2BWIA 4AKOA 4G7RB 1SFDA 1OE2A 1ZDQA 2GI0A 3TASA 4KOCA 3FU8A 1BAWA 2GC7C 2NRDA 1PMYA 1CURA 3CDZA 1PNDA 2BWDA 4NERA 5F7AA 1ET8A 1RCYA 2YQBA 4HHGA 3UAEA 1VLXA 1BXAA 3WKQA 3IN0A 1GY2A 1OE1A 2GHZA 1SHWA 4A2FA 1SJMA 3CG8A 2XXFA 3AZUA 4MFHA 3UACA 5F7BA 1A3ZA 3T6ZA 1JZFA 5D4IA 1OCZB 1KYAA 4F2FA 4YSCA 2OCCB 5AKRA 2MRYA 1JZIA 1TU2A 1ZPUA 2JFCA 2EILB 3CVCA 3FYIB 3NJGA 1BQ5A 1JZGA 4KNUA 2BHFA 1BXVA 2BP8B 2IDFA 2XU9A 2PPCA 3C75A 2TSBA 1BYPA 3HEIB 2FQEA 2FNWA 3PAVA 1NIEA 3WIAA 4E9QA 4KOBA 1CC3A 4HCIA 4TXVB 4DP2X 5B7EA 3UABA 2XX0A 5PCYA 2W88A 2UXVA 1L9TA 2EINB 2VMJA 4E9VA 1QHQA 1NDTA 4DP7X 1PNCA 2WO2B 2GB2A 1PAZA 3ASNB 1YLBB 2HX8A 1FA4A 1XB6A 1AZUA 3QJQB 1J9RA 3JTBA 1OCOB 2FTAA 4AKQA 4G72B 1JXGA 3IE9A 1GS7A 2IDSA 4F2EA 4ENZA 4P5SA 1NINA 3X1GA 1AACA 1PLAA 4BWWA 2Q9OA 4E9YA 3X1BA 1NICA 1OOWA 2QT6A 1KCBA 1NIFA 3OMNB 2PP8A 3HB3B 3PAZA 1OF0A 1GS6X 1WA0X 4W9ZA 4YSDA 7PCYA 1A4AA 1X9RA 1OV8A 1SF3A 3U25A 3NJFA 3TBCA 1ZIAA 1ASPA 4QLWA 2CALA 3S3DB 2VSKB 7PAZA 4DP9X 1M9WA 2E86A 2FJSA 2AANA 5I6KA 4YVUA 1MG2C 3UAAA 3WNJA 5I5IA 1ZIBA 4BXVA 1XMEB 1IBYA 3NSCA 1NIBA 2HZHA 3QJVB 4HHWA 1NIAA 3SBRA 4DP4X 2IDQA 4G7QB 5PAZA 1JZJA 4EF3A 2HXAA 1IKOP 5B1JC 2EIJB 5B7MA 1ILUA 2W8CA 2UXGA 1JVLA 1XB8A 1AZCA 1V54B 4A2EA 1AZBA 3CZUB 3NP4A 3PAUA 4YL4A 3T9WA 4BWUA 2DV6A 2PP9A 2B3IA 2YAMA 4A2HA 1V55B 3FU9A 1SFHA 2I7SA 1EHKB 5I6PA 2HX7A 1AG6A 2Y1AA 2DY2A 3QJUB 2BW5A 2QDWA 2X88A 4BDVB 2XLLA 2UX7A 2VW6A 3NJKA 3T6VA 1SF5A 4JHUA 5I6NA 3H4FA 6PAZA 4HCGA 2HRHA 1AS8A 2UXTA 5B1KA 3WKPA 3WNIA 1AR1B 4YSAA 5A7EA 1GS8A 8PAZA 2FT8A 2MTAA 1NPNA 1ET7A 2WSDA 3V9CA 4A68A 1T5KA 3NYKA 1PF3A 3S3BB 3JT2A 1NTDA 5B1JA 5B1BB 3AG3B 4F7KA 2PCYA 4ZK8A 4GP4B 3FPYA 1QLEB 2CAKA 3ABKB 1A65A 2VN3A 3UGEA 1SNRA 1W6WA 4AX3A 1KDIA 2HRGA 4A67A 1GW0A 2YAHA 4HIPA 1F56A 2R7EB 2GSMB 3FPXA 4N8UA 2XVBA 2LLNA 1AG0A 1OE3A 3IN2A 4FAAB 4G7SB 5I5MA 4QKTA 1HAUA 3SQRA 1PZAA 1PY0A 1ILSA 3KW7A 1IBZA 2YAOA 5AZUA 1DZ0A 1NWOA 1JERA 3NJNA 4DPCX 1JXFA 1KBWA 2AZUA 2ZXWB 3NJIA 4BDVA 1RZQA 4KO6A 1WS7A 3NSFA 1BYOA 3X1FA 3D12B 2QDVA 3QJRB 2FT6A 1AZNA 4AKPA 1MDAA 4G70B 2XV0A 1GR7A 3FQ2A 3FS9A 3S3CB 3AG2B 4PCYA 2H3XC 2HLEB 2VW4A 1HAWA 1SDDB 3FT0A 4E9RA 4YSUA 3NP3A 1DYZA 3QPKA 3X2QB 1RZPA 3SBPA 2BZ7A
chains in the Genus database with same CATH superfamily
4X2UA 2A83B 3OJMB 1ADQL 4J3OC 2J6EA 1I9RH 4K3HA 3LH2H 4XMWA 3NTCH 5LBVA 4HEMA 4LCWB 3B2XA 3SE3C 3IFNH 1FFQA 1YO4A 3D3VB 4HKZA 4EZLA 1LEIA 5TPWH 1OF2A 2P26A 3RY5A 4BQBA 1AXTL 2NQCA 1KGCE 3JT0A 1FSKB 5CZXC 3IJYA 1S2EA 1SGKA 3HN5A 1H6TA 3B1TA 3Q01A 1OTSC 5C0CB 4W9HC 1ZD6A 3NEXA 4KI5C 1CG9B 5HYQA 2H7WA 3A6BL 1LWRA 4JFUA 4R2GC 1I9IH 1MEXH 1C1EH 1XT5A 3BZFB 1EZLA 1J18A 3T08A 3IVKA 4AVIA 4NZRH 1A6AA 3TZVA 1HDMB 1IBDA 2R29H 1WD8A 2ZSVA 4HUUA 4R9HA 1VEPA 2NXYD 1ID2A 1H8OA 1KV7A 5F3BB 4L9LA 1HU8A 1Z3GH 3JZ7A 1BD2D 5AB2A 4P9ML 4ZMPA 4JDEA 2LW3A 4U1MA 4N2CA 2GBAA 4ONOA 4AM0Q 2OJEB 1ZS8A 2Y22A 2X0VA 5AWNL 1WCBA 1KDJA 3P3TA 2IJ0C 3ATEA 4TSBH 1MJJB 2EVHA 2OTPA 2QPEB 4QIRA 4UTBH 5LO7A 3VA2C 1DLFL 1BBJA 1HXYA 5TFSH 1ZLDA 1I1YB 3O6LH 1AGEB 2YK1L 4HPHA 5ID0B 4OI7A 1HYRC 3EBHA 5FYLD 5ECJE 2ZIDA 1QSFD 3A3YB 4KKPA 3IPFA 3T0XA 4DK6A 5JO5A 4GUOA 4EDWL 5AW6B 3ES6A 3WL9B 4UQAA 1JOIA 3N40F 4LP8A 4YIQA 1U8CA 1N9PA 3L9BA 4RBPK 2FX7L 5FS5A 1T20A 1IKFL 3FMGH 3GIZL 1INQB 4X0KB 4Z3EA 4ETQB 4OCXL 3ULVL 1YHPA 4R7NA 4BA0A 4IMLB 3QFDA 1YJDH 4OLZL 4Z7VB 3AU1A 3BD3A 3VCLA 4AQ1C 1XAUA 2K7PA 4PCTA 3D09A 2GJZB 2J6WA 3T1WA 3UGXA 3HNSH 3IDYC 3WTUA 2R0LH 1AKJD 1F41A 3C60A 4JQIA 1CICC 3SYOA 5F9OH 2EYRA 4DCQA 4Y4KA 4KNSA 2E3VA 2O6EA 5F97E 5DJDA 4AQ8C 3FU7B 4CILA 3KPRD 3L6FB 4WY7H 3KLSA 3FJTA 4QMEA 2J6EH 1D9KD 3ARGA 2JF1A 4OLEA 3GZKA 1GYAA 1PKQB 3WD5L 4N8PA 2FNBA 1N7ML 1E4WH 3VXTB 5DJCA 4Q14A 3NZ8B 3GSQB 2W0KA 4CVWA 1KEMH 3VFTB 3UADA 4DP8X 4CU7A 4EOWL 1I3RA 4F37F 3EYUL 1H3TA 4L9LC 1S7VA 1I1CA 4DEWA 4MKMA 5CINL 2OR7A 4Q2ZB 1GHFH 1KGWA 1NGXB 1W72H 3APDA 4AVHA 3MGTA 4X4YA 3MA9L 1Z32X 2BSSB 5TE4L 4HBCH 1ZWIB 3KLHD 3WJMB 5DHXB 2ICWB 3WIHH 4P57A 1IB5A 4XC3H 1EANA 2VUOA 3FAWA 1NGWA 3X3GL 3LZPA 4GO6B 1U21A 1NMBH 2CSPA 2I24N 4E42B 4HA1A 2YPLB 3DXAD 5E2TH 5DUBB 4DESA 4FS0A 2N7SA 4PJBE 5T1KB 4DGVL 3QUMH 1NMBL 4PEEA 5AYTA 2X6AA 1KCWA 2I9LA 3H42L 1QBMH 4X5XB 4LLUB 3GSWB 2GAZA 1TZOA 4LLDB 1XSJA 3ZKSD 3G6AA 2GHWB 2OL3H 2OXHA 1OAKH 5HYJB 1N4XL 2K45A 1O7DC 3IRPX 5EC1A 5IF0A 2H47C 3BWZA 4I9WD 2DLGA 4FJYA 4YQXL 5AVZB 2C4XA 2L8AA 1LD9A 3V4PB 3WIFB 3WY4A 4ZMOA 2BVOB 3TO2B 4KDVA 2KQNA 2WVTA 2VQ4A 1HILB 2TRHA 3MDJA 1S7UA 2EYTA 2PPAA 3DXAA 3QA3B 3IF1B 4JO2L 1G7HA 2ADGB 1I8KA 3MLTA 3TVMC 2B08A 1FZMA 4Y9EA 4PY8J 4XXDB 2CM5A 1EH9A 1T89C 3F04A 1L6ZA 4ZO9A 4DVBB 3MFGB 2P5WD 3ARBD 1UXSB 1TZHB 4FXKA 2KDYA 3H6AA 4YXHL 2YPVA 4KMQA 2A9DA 3KH4A 1MQKH 3NMEA 3V4PL 4ONFH 2D8KA 4K9JA 1YEJH 3FXIC 3O6FD 4GI9A 4W9EC 3QXWA 1N6UA 3RU8H 1MCLA 3L9YA 2R29L 5L6YL 2YQ3A 4YHOL 1HE8A 4WWID 5GRXG 2DL2A 1WZKA 3P2TA 4DGUA 3DSFL 4WJ5A 4YNYB 1QHPA 4ZX4A 4M5YH 1N6QH 2ZNXA 1SM3L 5GISH 3WN5B 2WVSA 2FWOB 1SXNA 3QORB 3L3IA 1VFOA 4PRPB 5EBLA 3PQYA 4OIFA 4NSKB 4UQEA 3PPEA 1LE9B 3RUGE 3JWNC 4MYPA 2R39A 4ZSOA 2CMRL 3WFBH 4JS7A 3S8FB 2VUKA 1BVZA 2MIZA 4WJG3 5BZDA 3SKMB 2CO2A 3OWRA 1BFSA 2IDCA 5FYKD 3QIBC 4MQXD 1R4XA 1R34A 3KVPA 4OD1L 5BRZE 2ORBL 1PNDA 1I7UA 2YQBA 5MERB 1JUFB 1IC5L 2FYYA 1PX8A 3D08A 1GY2A 5EA0L 4CU6A 3BIBX 5CGYD 4HUWA 2XXFA 3K8LA 3VFMA 3G5YB 2ZG2A 1YNTB 3VSVA 5JZ7D 4JHWL 4KV5F 3VFTA 2LFEA 1OCZB 3GWJA 2E27L 1RJYB 4W9LC 1J5OH 2AQ2A 4H8WC 3ECBB 5IREA 5D7JB 4EN3C 3WUZA 1A9BB 4GKSB 4M6NH 5EO9A 3TJHC 1WISA 3AXLA 2QQNL 5EORH 3NJGA 2CLVA 5FECB 1A1NB 2JQAA 3FQXA 3FFDB 4X9GA 5F9JB 1TCRB 5ICZB 2DJUA 3LTVA 2ZZUT 2P49B 5DK2B 1ECZA 1NCBL 2FNWA 1OANA 4IBUA 5CMAB 1AJ7H 4RIRA 4ZW8A 4QXGL 1XH2A 4KGLA 2XX0A 5BUAA 1BX2A 1JV2B 1ZT1A 4Z7NE 4LHJB 2F6AA 1BCIA 5KG9B 2WO2B 2JKSA 4K4KA 4UQDA 4XNYH 2CA3A 2KPWA 3GDBA 4JL1A 4GG6A 1JGEA 3LS5H 5HHOA 1SVCP 5L2KB 1UT1A 4B7LA 1J9RA 4AGQA 4AKQA 5J06A 4QCIA 3UTTD 3JWDC 4FFZH 1YEDA 2P48B 4FQPA 1AXSB 4G5ZH 1H3UA 2OMZA 3Q5OA 2RH0A 1EA9C 3P4NA 4CNIB 1CFSB 2ZOLB 1NIFA 5DLMH 4UYPA 3F3HA 1XHHA 4XNQA 1G6RA 3CZEA 3KJ6L 5F88A 1BIHA 3S34L 4Y4HB 3FCSA 1EXHA 2NSQA 4TUUA 4R6UA 2R59A 1R0AH 3TBCA 1FVEA 4XCFH 2JE8A 4P05A 2DQJH 3O2DA 5TDNB 4LVNC 2WTRB 3MLVH 4NZJA 3GUTA 3PWUB 1P1ZB 2DM3A 1T7YA 4F3FA 4YUEH 1DLHB 1UXSA 3UYPB 4H2CA 2VZ3A 1G4RA 4QHUA 5DQJA 4R4BA 4GKZB 4DGYH 5FO8A 5IQMA 4R8WL 3MRLA 2PMZA 1LK3L 5GSVB 1N67A 3QNZA 5CN3A 3S35L 4HFWA 1R3HA 1LEKB 5IF0B 1P53A 4HHWA 5MEPB 4L29A 5I0XA 1RUQL 4XWGL 1BFOB 1ZOXA 2BVOA 3TO2A 4N1CA 1V54B 4PJFA 1G6RL 2HP4A 5IHHA 1X5AA 1KYDA 1NCCL 4IRZH 2LU5A 4HPOL 1WGOA 2WBJB 4MQSB 3WFZA 4CUCA 2VIRA 5BVPL 2XN9E 2K3TA 5IW1B 3BLPX 3VXOB 1CCZA 1YEWA 3M7OA 1R6VA 3ZTNH 1GZQB 2D2OA 1CIUA 3FU9A 4NZTL 5FUOH 3AGVA 1U8LA 2PUQT 2AEPL 1UA6L 1NM4A 2BVPA 2FLMA 4PLOB 3V4LA 3WN5C 2WXRA 2QDWA 3MROA 4JJOA 4ZMXA 3CSBA 1CZ8H 5HPMA 2DQCH 3FO2A 4DPRA 5IQNA 3D3VA 5CJXA 5J8OA 3EOAB 1RJYA 4BUHA 5HHMB 4TVUA 2OMNA 4YE4L 4YLCA 2HPOA 4Z7UF 8PAZA 43C9B 4TTDD 4U2YA 1S78D 1T5KA 4JRXB 2E76C 1FQ9C 4JFEB 3MJGX 4HWBL 3EOYG 5B1BB 4F7KA 4JN2B 4LCCC 3KWWA 4HIQA 5E9DA 1CN4A 3GMNA 1FYHB 3ABKB 3HBGA 1TUPA 2ZYHA 4FKEA 4WFGE 1HCVA 2W9EL 4FXLA 2WN2A 4OCWH 3RFZC 1V7ML 1DVFB 2X0WA 3ISYA 3K74B 5J9PB 2EYSA 4AG4H 1JS4A 5AB0A 4M6OL 4S2SB 2DKMA 4OI9A 4J3VA 1DHKA 1U2HA 1XIWA 1OE3A 2OL3B 4NUJA 1DJXA 4M7LL 3VNZA 2CHWA 1BZ7A 2PW2A 2WIIB 4K2UH 4RZCB 2H3NA 3RKDC 4MRCA 3UJTL 4FFVC 1TLKA 4M3JA 1CXKA 4NYLA 3UJIL 4AGNA 1TVBA 3TEYA 4XE5B 5KYUB 2Q8BH 4KO6A 1OGAB 2WANA 4BZ1A 4ZO6A 3CFBA 4UILH 5C08D 2CUIA 5C6TH 4X83A 1UADC 2VDMB 1C08B 4DZ8A 2OR8A 1LO0H 1UM5L 3I6GB 4PFEA 4U1SA 3OHXC 5F7DB 3ZGHA 4J5VA 1BBDH 3GJFB 4XCEA 4EZJA 2EIZB 5I73B 1F2XK 5I0VA 4L8SB 5CBAB 1A6AB 2DI9A 2N0KA 5JO5B 4WHYG 2WTRA 5I74B 3B9AA 1GJUA 3PF2A 3P11H 1EPFA 1OZUA 1KUMA 4LCIL 3MREA 4DOHB 2ITDB 2V2TB 1S9KC 1BXUA 4HHAA 2Q3AA 1KGYE 3PHQA 3NIDE 5IK3A 3HS0A 1PZ2A 4ZYKB 1XD0A 3IK2A 2FHCA 5KS9E 1CXFA 5FEBA 1QFOA 3S3SA 5BW7A 1A4KB 3FB6A 3VFWB 1T1YB 4YSSA 2PABA 1LMIA 2WXPA 3VWJD 3GM0A 4KXCA 4K5NA 1H19A 3WELA 3DX2A 4ZMTA 4AYFA 2WLLA 1MAMH 4QRRD 1VJSA 1QWUA 4Z0XA 4UU9B 1XFPA 2YC1B 1MZYA 3T1FB 3N0PB 4PGCB 4OZFG 1KEML 4RFNC 4NT6B 4AYID 4UTBA 3LDBB 2DH2A 3V6ZB 3KPOB 1U8CB 2WM0A 3JV6A 1ICTA 1IEBA 3OSKA 4Z7WF 3MRNB 5C8JB 2XN1A 5DD0H 5C0ND 3E7JA 1KTCA 2MCAA 2DWTA 3ULVC 4GPVA 4DPBX 2X1PA 5LNDA 2KUTA 4B95C 5IY5B 4M7JL 5ECGA 1D5BA 4MJ2A 4APQB 4MTMA 4KWUA 1A3RH 3AW5A 2HA1A 3MBWB 1HZHH 4G9DB 4TM9A 3X1NA 5E08L 2R2HB 2BS8A 4L1HA 5JIDA 4DO4A 3TA3A 5G2NA 3T04D 1XH1A 3O2WH 2HN7A 3KLDA 4Y2DA 2E6PA 2HLFC 2Z92B 3T3MF 3WTXA 4I77H 3PL6B 3Q5YA 3UP1A 4FGMA 1R46A 3FU7A 3BOVA 5C09A 1V5JA 3F64A 4LP5A 4UOW0 4WTWA 2UZPA 1HWWA 4JG1L 4JKWA 4FXTA 4MX7A 2ARJA 3DA0A 5JYLA 2ADIB 1WFIA 4UIKH 5CFAA 3NIGB 3ALXA 2WLYA 4GXFA 4ELMF 2QR0B 3VX0A 4OZHF 3AU0A 4M56A 5I8OH 4ELME 2RTTA 3QRGL 3NABH 4UM8B 4X9IA 5EULV 3DECA 2NY4D 5CZRA 5HGDB 4EIGB 1WA2X 3H55A 1P4BH 1S7RA 1XGQA 2IQAB 4FMKA 3G6AB 4TUKL 4PWEA 3NQIA 1OGTB 5DA0B 1HWGB 3O3EA 1M53A 3PGCA 4HV8B 1WEJH 3VG9B 3WJJA 3OMAB 3ZKXB 3HS0C 4IBQA 5B21A 3HUJA 3SKOA 2FATL 1T1WB 3FB8B 3TJEH 4HIXL 4LASH 3EH5B 2D0FA 2YARA 1J05B 1CQKA 2FZ3A 1QW8A 3FTVA 3NCYP 4PJ9B 1U8PB 2OPCA 4C83A 2KT6A 2JCCF 4TQIA 2FECI 3TT3L 1NCWH 5IMKA 2VM4A 5GS1B 5I1EL 2BY2A 2GT9B 3C09C 4ZOEA 4JM2D 1ZHKA 2G3ZA 3VFRB 4NRXB 3G04B 4JCMA 4MCMA 2NTFA 3Q6GL 1FO0L 4BZ2A 2Q20A 2IDUA 5IWLA 4HCRH 1NLDL 4HWEH 1LO3H 1MAJA 5EC2A 3RA7L 1FL6B 4K5PA 1U8IA 3QJSB 3QORA 1IJ9A 3ILEA 4PRPA 3ZDXF 3L81A 3T0AA 1Q72H 5E6RB 4WO0A 2ZXGA 5J13B 4YDJB 1H3GA 3TN0D 2YFNA 4NN5C 3T0WA 4BE6A 2IVFC 1FL5A 2A74B 2E27H 1Y7VA 3ASOB 1QWNA 3UIYA 4B7IA 5JQ6L 5IHLB 1J10A 2GUYA 1JK9A 3BUQA 2ARJQ 2UYLB 4ISVB 1F58L 4H4NA 3H4HA 4HUXA 5EB9A 1IEBB 3WOVA 4AZ8B 5C8JA 1CVSC 4OKVA 5I8KH 4R97B 1BAFH 1ZHLA 2FO8A 2VISA 4FULA 2OJZL 1MF2L 2DBJA 1GGBL 1MJ7H 2IWFA 4M5ZH 3KWUA 1IRAY 2CR3A 4JFYB 1IAII 4Y5VB 1JPTL 3H7BA 4LBEA 3BVXA 1CGUA 1D5IH 4FFZL 3S4SG 1CF8H 3BCFA 2W81C 4WDIA 1G87A 3BP4A 3TOPA 3TN0A 4KO5A 3I9AA 4JPSA 5IBTL 3F12B 3V7AE 4W4OA 5BV7C 1BLNA 3K81A 5KSVA 2DYPD 4FQHB 4LVEA 2BHUA 5LWYH 5J0BA 3PABA 5TE7H 4JO5A 2F7RA 3QEQD 1NBVL 3P69A 5D4JA 3VE0A 4JO4L 3QIWC 3V4UH 1TSHA 3DRTA 3D25B 4NWTH 3HG1B 4IBVA 4QLRA 4P99A 4HLEA 1BJMA 3VXPB 1JL8A 5DJ0B 2Q3XA 2YRZA 3OC5A 4ABVA 2HKAA 2WJ7A 3GLDA 3ABZA 1H15B 1KIRB 2IFFL 1KIPA 4XNBA 5L88H 3HUJF 3OQRA 2EIBA 1JNHB 1RQ5A 1BECA 2QGBA 5FPIA 1U93B 1DFXA 1AZVA 1XCXA 1MREL 1Q9WA 4LHUB 5E6ID 3T2QA 5JW3L 3FUNA 1MWOA 3PGCB 1LDPL 3UTQB 3MNDA 2Y7QB 4FKKA 5GGQH 1J0ZA 1KJ3H 5LCVA 2XN0A 3S5LG 5I1GL 1M7IB 1W8OA 5I5JA 3MUY1 3L9EA 2EXYD 3AAZA 5D6CA 4P2YA 1TZIB 3N85H 2JKXA 2BNUA 4UOQA 3HLAA 5F3HB 2XG5B 2QZ5A 1I75A 3SZKC 4WW2A 2WXOA 2ED6A 3JWOC 4QRFA 1JI2A 2ITEA 2DQGH 1BAWA 1OP5K 4NERA 1KB5B 1U8HA 4AEHH 4BZ2H 1E9QA 2J72A 5CP3A 3S36X 2BIIA 4J28A 3FCBA 4IIZA 3OXSB 2OMZB 2VMEA 4HWBA 4LVNB 2YSSB 4HEPG 4MLSA 2YBRA 2XT1B 1G7PB 4P49A 4YHPA 2YS4A 3SDYL 3HC4H 2F8VA 5IVXF 1UD3A 1TU2A 1ZPUA 4YE4H 4NLHA 4Z7VE 1LQBC 2X4SA 5ELIA 1NDMA 4L8SC 1CXLA 2VXTH 3LNEA 1MCCA 2ZXDA 5ADOL 3TEXA 2L4OA 1BXVA 1EEYA 3N44B 3K80A 3BYTA 4ONGL 3VTTA 5A2FA 3GRGA 1SEQH 1TVHA 1IT9L 1T0PB 3P2DA 2VDQB 3HRPA 2MSPA 4Q0XH 1NIEA 1T4KB 4URKA 3DJSA 4HCIA 2ATKB 3ASWA 3R8QA 2JVUA 4KZEH 3RVVD 2F54E 5E8PB 1FPTL 1TDQA 3CLWA 2GK2A 3ASNB 3IDJB 2ROXA 4HUKB 2UUDK 4W9JC 2HX8A 1F97A 1QRNA 4MZ2A 3PWPB 4CC0A 3D9AL 3TCLB 2NDFA 3ZR6A 4MSWA 5ID0A 2XIDA 3R7RA 5I1LA 5CLTA 2B7DT 3OX8A 3T0EB 5FGSA 1AQDB 1AQMA 5F9WC 4PRAB 2A38A 3ZUCA 4P5SA 3UBFA 5LAPA 2Y36H 3STZA 3BQUD 2XZAH 4WTXA 4WEUD 2G5BA 1A7OH 3G7TA 1C5CL 3MOAH 4HWEL 4JN2A 4ZUVA 1GOFA 3QHFH 5BOPA 1VKXA 5HI4C 1PYWA 3T4AB 4QRPD 1A02N 4DGWC 2EIEA 3B1UA 3CDGB 4P2RE 5A3ID 3WMSA 4AJWA 1DO5A 4QRRB 1KYUA 3DX6A 3TS8A 1QTPA 4XN9A 5GGVH 1BDYA 2C26A 2J3SA 3S3DB 5JDSB 3DO7A 2X89D 3MYJB 2FJSA 2IANE 4X6BA 3LS4H 5C0RL 3GMLB 2WLJA 2IH3B 2EICA 3APCA 3HC3H 1JGUL 3CGTA 5F7EL 3CLEH 1MCKA 4BQ6A 2EYRB 3QJVB 2YLHA 4RCAA 4UB0H 1A1OA 3P9LA 3D7PA 4ZFZA 5DJAA 3F05A 3U2SA 1DLFH 3HS9A 1R19A 1XL4A 4GBXA 4ZPVB 3ARGB 5DRNA 1E4WL 2O5ZH 4PBXA 2BNUB 3ALWA 4K3EH 3L95A 1AZBA 4WW1B 2CKBH 2CUMA 3IE4A 1JV5B 4L8SA 3C6LC 4OVUA 4AC2A 3LRSA 2DV6A 4S11A 2WZPD 3EYFA 3QR1A 1GHFL 1KCLA 1IGTB 1B0RA 4N9GB 8CGTA 3OKOA 2CIKB 2KERA 3TPKA 3HJ0A 3T2NL 2ODIA 3KEHA 5I5RA 5HHVL 4M8QA 5FYJD 4XNZB 2Y1AA 1RIUH 4PG9B 1G6RH 2IC2A 2OXHB 4XP6L 1S9VA 2XLLA 3Q8CA 1G7PA 4QXTB 1EHLH 3MRIB 3SDCA 2KHAA 3RGVC 3CC5A 3Q6FA 4J2QA 2DWYA 4HCGA 5E0QA 3IDXH 1Q1PA 4R3SB 3FB6B 3VFWA 3FB7A 4H1LH 1AS8A 3MUUA 3EJYC 5ESVA 2AEPH 3V9CA 5J57B 4P2OC 4D9LH 5I1HL 1JNLL 4PJ8B 2N59A 5IB5B 3A67L 4GIPD 2F53B 4JFDA 4I1PA 3KYKL 4B9KC 2UVEA 3KBPA 5IOPB 2F54D 1VFBA 1LK2A 1JCKA 3DGGB 5E51A 5T1LB 1A9EB 2MKWA 3LXCA 1GZPA 2ZF8A 3WFDL 4MNHB 1PJ9A 2QV2A 1B0WA 4RSVA 5C0GB 3PWLA 5C09E 2DPKA 4AL8C 2EKSA 4QRTB 4AT6B 3O2WL 4YK4B 1P84K 4QYOA 2IBZX 2QGDA 1MCWW 5FM4A 1AR1D 1IC7H 3IJSB 1I8MB 1TJHL 3GGWA 3KW7A 5I1KH 2G3NA 5DD3H 2J8UF 4HJ0C 4PJBA 1UG9A 3MRDA 5C0BD 1FRGH 1PVHA 3VQMA 3AUWB 5HVWA 1DQMH 3P2BA 3MZGB 4R4ND 3BE1L 3ZO9A 1HZKA 1SVZA 1ZVHA 2F54A 3HZYB 4H8QA 5D2LA 5B3JE 1FYTB 4P59L 1IQWL 4NLAA 4AKPA 3MV9E 1G7IA 5CU9A 1UH4A 4G70B 3B3BA 1WDAA 1BVNP 3HI6L 3HI5H 4MJIE 4O02B 5GJSL 4BSWB 3D2TA 5FGCE 4PR5B 3QIUD 1S7QA 2AVGA 1RULH 4QXWA 1VF5C 4OFDA 1TO4A 2E9BA 2X4RB 2WLIB 1IT9H 1HJCA 1PZSA 5HGGS 1MFMA 3D07A 4F37K 1A9BA 4YHKL 1VB9A 2AZAA 2YN5A 3OKDA 2BNQD 5A2IH 1DANT 3COOA 4J3OH 3QS3A 4GSDL 3M17A 1X5ZA 2AXHA 2A9NH 1I8LC 1ZSDB 3T71A 1RY7B 1CLVA 3AQZA 5FUCE 3BN9D 3QDMA 2P8LB 1GPOL 1JWUA 2MQCA 3FCTA 4GAJL 3KGRA 2FYYB 3DK0A 1DVTA 2ADIA 3K8MA 3L95B 4WW1A 5LAXB 3SPHA 3RWGA 2Y36L 4HJGA 4XMKH 4KROD 4TNGA 4XN5A 1E4XH 1C5CH 3V6BR 2R4RH 3UJJH 2H3KA 1R5IB 3WUWA 1AS6A 4GMSH 4HLZG 4YHIA 4BFRA 2F58H 4KZDH 5C0BB 3NCYS 5AAMA 5ENWB 4FHJA 4R0LC 1I9JL 4X42A 1NUFA 1UWEH 1KYFA 1O6SA 1VGEL 4XBPA 4XGZB 4NBZB 1RLBA 1NFAA 2Q3ZA 1TCRA 3OZLA 4LLQB 1VENA 4YZFF 3HFML 1CDUA 2HJLA 3DSFH 3BO8B 4PJDB 2YAPA 5K9QI 3ISRA 2QFPA 4KY2A 4PJFE 1G6RB 5E8DL 1IC0A 3AG1B 1BEYH 1VEMA 2MKLC 3VXSA 1RMFH 2ODHA 5JORB 4ZTPH 2NY4B 4X8GA 4MJ6A 5F0MB 5IROD 2Y25A 3NA4A 4L18A 3QUMA 1EQWA 3DI3B 4KROB 4KXZI 3I84A 1IGML 2F53D 4PRBA 5CGMA 2B9AA 3L4CA 1OD7A 4P3WA 3FTGB 5I17A 1CTOA 1U6AH 4QHPA 1RIVH 5AZEL 3H9SD 2WUCH 5CGTA 5AW3B 5KVGH 1MIML 3BPLC 5K69A 1A4CA 4CSZA 3NIGE 1EDHA 3HE7D 2ZUXA 2J4WH 4OCSH 5I76B 1KJ2L 4Y2NA 3T65A 1GMIA 4JMNA 3NIFE 1ZHLB 2XETA 3NCCB 3KGSA 4X7SH 4FI7A 3KPQA 4P2QD 3VXSE 3CFDA 4GUCA 2FGWH 5HGHB 1MKFA 1JN6A 3IJ9A 2AQTA 4WFHE 5DD6A 5GS1C 3EUUA 2FE0A 1KBVA 2XWZA 4F1ZA 3ZE0F 1RAMA 5FLVA 1N4XH 1M7DA 4ZUTA 3AJ7A 5DZLA 1OP9A 4JN1L 4FNSA 4BK5A 4DCQB 3ZL2A 4WUUA 1RK0A 2NX5D 4OJEH 3LKOB 3DYMA 3GXFA 1JAEA 1W8EA 4FFWD 4M4PA 3OAYH 2GEQA 3JV4B 5HY9A 3UBXB 1G0YR 3VFNB 3AQXA 4NC0B 5EU5B 1BQKA 4JX0A 4R26L 1NCGA 1J12A 2MWCA 2VISB 4MA3A 3ZHNA 3VWKB 4GP8B 5J1TC 3O45A 4WNJA 3SE8H 2ATPA 4XODA 5LXGH 4PJ5B 1QYGH 1KIPB 3DURB 1XF5B 2CR6A 4K5OA 4ONFL 5BQDA 2XN2A 3RNKB 4EI5D 2VQ1A 1ADQH 3QYCA 5AVUB 4PVLA 4R0LA 4LLVA 1TITA 2QMJA 2E6QA 4JFVA 4P8QA 1M57B 4EKXA 2JI1A 5FAAA 3NRFA 2FRGP 4YXLH 1OTTD 3T6WA 2X28A 2H1PH 4UV4H 3WJLA 4NKMB 3SIKA 1M6OA 3KWTA 1EO8L 4EUPB 3QH3B 1OQXA 2OMTB 3IDMA 4CSPA 3OKEA 4LSSH 1YC7A 2ZOKB 4Z0BH 5LLIC 1B2WL 3C2AH 1IILE 1I1FB 3GJEB 4YEFA 3AG4B 4J8RB 4HKJB 3RUGA 5IWLC 4Y16A 3BGAA 2DQJL 5DUBA 1FFOB 3H3PL 3WIIH 1PEWA 5KOVC 3S4SB 1DEEB 4K3DH 5F1NB 15C8H 1WT5A 2RCSH 1BQHA 4X50A 2X9ZA 5JHLL 1Z9NA 3B9KB 5D4HA 1Q90A 4WTQA 3F85A 1G7JA 4OTXH 5I6MA 3SEPA 5C86A 5L2JA 2O26U 1ZVYA 4XO8A 5IEHB 1EEQA 1N8OE 1G7LB 3C60C 3R19A 1DJZA 4ZUUA 2NNXA 2JKTM 1ETA1 3AT0A 4HIXH 3DX0A 3FH7A 4IJ3C 4LASL 4N2MA 3RDTC 4QRQA 4PGDB 1FNHA 3HZKB 1OGAA 3U46A 3VDAA 4YGAB 5ICXA 3L3KA 3EH1A 3N40P 1TG8A 3OKLB 3DYPA 4RWYL 3EYOB 3U0TA 4POZD 4QT5A 2FQDA 1Z5YD 4DKEL 1F5WA 4YZFE 3A47A 1M05B 5D7LB 5F7UA 5E0FA 1UOKA 5IP4A 1OEZW 2DWSA 3TU6A 5J3HD 4TLSA 3UG4A 3CDCA 2FO4A 2GUOA 4BK5C 4M7ZB 5BS0A 2BVYA 1RZ7H 2A6JA 3FW6A 4YPJA 2ZX7A 3S37L 5FFOA 3VI3A 3AY4A 1MCFA 3GXUB 1JF6A 4GY4A 2ED7A 2HFTA 3IJ7A 3GYRA 1DVFC 1QHOA 3ZKNC 3FRPG 1JMXA 3CFBB 2PXYB 5ILTH 3PUCA 4PB0H 4X8JB 3BH9A 5KS9B 2OCJA 2ZQKA 3AT8A 4Z8FH 2DLHA 2BP0A 2P7TB 5J4MA 2DMCA 2ZT9C 2FX8L 3TWCH 5IHUL 2UZYA 1COBA 1QUNB 2CCWA 3BKJH 5DD1H 3RYMA 3GLZA 2IO5A 4FLOA 1T2QL 2C3VA 2HRLA 4G8FA 3TWCL 2A6DB 2K6ZA 4ZFOA 2R51A 1U3HD 3MREB 3IPEA 3W9EB 2OX5B 3L3HB 3TPUA 2YOCA 2XHNA 2E9IA 4PRHE 2D73A 3WKMH 1ZVNA 2QVTA 3G5XB 1ZDQA 4S1DC 3TASA 2D7MA 3BWUF 3X3FH 2G75B 1WWCA 1F4WH 1Z0MA 2AAVA 3LB6C 3PJNA 4K7PH 1OW0A 3UAEA 3VXRA 4HHGA 4WHCA 5J6GA 5HHVH 4HMEA 2AQ1A 1NKOA 4HS8L 1VCBC 2EKJA 1X7SA 4XP5L 1G1YA 3RWIA 4ECNA 4DETA 2AJVL 2R2BA 3RVTD 4PGZA 4UQ2A 1UUNA 4CBPA 2X05A 5AVTB 4F2FA 3B4NA 2OCCB 5FGBC 2BNRE 3EHBC 5ISZA 1XGTA 2H26A 1QA9A 3I74A 2DQMA 2RR3A 4RA0C 3RQ3A 3QWNA 3RIFK 1SJXA 2H8PA 4MNGB 4NQCE 4PJ9A 4HMDA 2DQUH 3IVKB 2IADA 1A6UL 3RZCA 4GRWH 4YWGH 3WO4C 4HOZA 3ZZSA 1N12A 4BFIA 3SY6A 2ADYA 2YA0A 2YRLA 5F89B 5HI3D 1DBKH 2BOBA 2VQ1B 5GQBA 1CC3A 3GSUA 1WWAX 1FC2D 3LN9A 4NN5B 1CD1A 2VMJA 1XGRA 4JO1H 4MAUH 3W9DA 3QIBA 2HWZL 5ETUB 1E28B 4L8CB 3EZ8A 3EDEA 3DIFB 4JKMA 4OF3A 4F8LA 1E7UA 1NGPL 5MEOA 2A9AA 1CQYA 3M86A 4APQC 3CU1A 4IOSD 4UOW1 3GBDA 3QWQB 4XXWC 3VFGL 4PJBF 4LCWA 4ENZA 4KK6C 4AEHL 1AACA 4M48L 4CN4A 2G5UA 4NENB 3ZSSA 3QEHB 1OSYA 5J6HB 4TL4A 1JF5A 1TYEB 4QJ3B 1X4XA 5CP7A 3CFNA 1SF3A 3G04A 4IKLA 4ODUA 5E2UH 2YD6A 3GB7B 4BKLB 2ZX9A 2V33A 1DQDL 1S6NA 3J8F7 2WXFA 5D8JL 3ZDYE 5CD3A 3BDXA 1UD8A 1ZIAA 1ASPA 2QBWA 3NFPB 3IGAB 3IYLW 2CALA 4NQCB 2VSKB 5E6IB 4DP9X 2OL3L 5B4MD 2YLKA 4EZKA 2X1OA 2WWMD 2W0LA 2JJTA 5KVEH 4G80B 5IHBA 4D8PB 4NKOA 4HJSA 3F62A 4M7LT 2BSED 4Q9CA 4HF5H 3KLAB 1E5BA 5D7HA 4HYTB 2QGCA 1YZZA 4Y2OB 4OIIL 3U6RA 4G7QB 3UBGA 3TF4A 1EEUA 3W2DH 4K71B 2XBDA 2IGFL 3FO1A 4OLZH 5F70A 4BSJA 4U6HB 1R5WA 1O9ZA 4I3RL 2V0AA 5DQJB 2A73A 2CHZA 1QFUH 3C5JB 1V7MH 3FZUC 3DETD 4AMKH 5BJTA 2Y2TA 4ETQA 2YZ1A 2Y2YA 4HFWB 5I30L 1DUZB 4JPIA 4ANXA 3R06A 1S46A 3HCVA 3KPMA 3GRWL 2YAMA 3R4DA 5J1AA 4P2AA 4A7UA 2R4SL 5I6PA 2RFXB 2PTVA 3VGHA 2APTA 3WXVH 2BW5A 2D7TL 2GCYA 4HW6A 3PV7A 2ZAGA 4NAMA 4P3DB 1D5MB 2ADFH 3OAZK 3JYBA 4GKNB 4I9XA 4PB0L 3P0VH 4JHUA 5AW2B 2C3VB 3K5SA 1G6VK 4NIYE 1XGPB 4OCWL 2KZ1B 1UM4H 4K8RC 4X6DB 1Q94A 1JYXA 3CX5J 4WI9A 1SUHA 4IW4C 4G7VH 5J9PA 1AGCA 2FWSA 1PF3A 1ZS2A 4ABUA 5T33H 3EJZC 3VXME 1QACA 4PGEA 2PCYA 4MMYA 2ICES 1GZHC 2CLRB 4KXBA 1N10A 2Z4QA 3QJXA 1I3RB 2CAKA 2JI2A 1CBVH 4L1TA 4QRSB 5DMYA 4HJTA 1W6WA 4GJTB 3OKDB 4GG6F 2GW5A 4EN2A 3RWIB 1BM7A 4LIQE 5A16A 4L2YA 3FPXA 3ARED 4M1DH 4PJFF 1NGZA 1VACB 3IN2A 2YA1A 4YGVA 4U7SA 4L3EE 3BISA 4ODWB 4N6QA 4WFFE 1C5DA 4FI6A 4Q97A 1SLWA 4U0QB 5CSBA 3Q1SH 4YHLH 5AZUA 5E95B 4HAGA 1JXFA 3OTTA 1WBZA 3ZE1F 2AJ3A 1S9WA 4LK4A 4HJGB 3UC2A 3MRFB 1MCIA 1UA3A 5EOTA 1MAKA 4ZPTB 3HHMA 5JA8B 1NUGA 2M8XA 4WI8A 5D72H 4D9RD 2ITDA 3RY6C 3S34H 2UWEA 4L3EA 4Z3JA 1E50A 3AREA 3RIAK 5J7CC 2AK4E 4LCCA 3WYRA 1I1RA 4LCWE 1RZGA 1E28A 1YMHB 2CJUL 3NK4A 2JH2A 3VI4E 4UIMA 4G43A 3HVNA 1AFVL 4V33A 3HPLB 5MI0C 4IHBA 3SD5A 2BINA 1GTFA 4MAYC 2AABL 4DGYL 4Y1SA 4J6RL 3EGSA 3DUSA 5T8IA 2J43A 4ZSOB 4ZDHA 5EF2A 4MVBD 4RFOH 3OC8A 2W92A 4QJ5B 5C0EB 1R0AL 1RK0B 3S36H 2AJSH 3FTZA 3LIZA 3HS8A 2COQA 3FTSA 4XCFL 3VFUB 1U8OA 3VU2A 3P3UA 5JTWA 4GEJA 4HHAB 3W0WB 4APXB 4UM9B 1KIUA 3TBWB 2ATKA 1MFCH 3QPXL 1N2RA 4ZT1A 4NNYA 1S3KL 4C56D 4EXKA 5C0AB 1E9OA 3V52H 1JVKA 4Z77A 3U2JA 3IU3A 5FHBH 2WGNB 3CNKA 1J8HE 2Q76A 3MCKA 3UOAB 3WFHB 4AIZA 2A3TA 2X4UA 2XV2A 5D5MA 5F1IB 3MLZL 3KBEA 4OV6F 3QNYB 1X5GA 3PCYA 2JIXD 4TUKH 5AVQB 2G9KA 4Y2OA 4PGCA 2VZUA 1NBYB 1RZJH 3GXTA 4XC1H 3BD4A 5K59E 3UAFA 1L0YA 2XFGB 3U1SL 1MCHA 3OGCA 5ACMA 2Q7YB 2E7DA 2DLEA 1I4FA 4BJLA 1B0GB 5D7JC 1K3IA 5FO9B 4Z5RB 1BREA 2CNZA 2B59A 4XPFL 3RTLA 2NY1C 1WBXA 2WQSA 4L3FA 3TT1L 1HINL 3NK3A 1D5ZB 2H6PA 2CMRH 2Z35A 4KU1A 3WFBL 4JFZH 4Y9FA 1QZ1A 1R5VA 3MRRB 4OR1A 3GO1H 1FDLH 3SGDH 1AXSA 3H8NA 2DBLL 4I3SH 3QJFA 2VITA 3SE9H 4RESB 1U8KA 4KHXL 1AI1H 4OT1H 2AVFA 3DTXB 4UNUA 2OW7A 3AY2A 4YLBA 1I7UB 4J3WA 1MI5B 1GGYA 2EXWC 3BHBA 3N5AA 4PVBA 4POUB 2ED9A 3S5ZA 1FGVH 3PXLA 2ESVD 4PLJD 1EEZA 4PVMA 1JV5A 4N68A 3S4SA 4KX7A 1D7FA 5FKAB 1E43A 1RVFH 1N18A 4B27A 4CVUA 2VABA 6PCYA 3ULUD 2XKSA 4N9GA 3WO3B 3TV8A 1NFDE 3CN0A 3P0GB 3TA3C 1ASQA 3HRZA 2XBTA 2WTPA 2CLVB 2DJ4A 4G1EB 4JDVA 1F3DJ 4GAJH 5EU4A 3SDXF 2WKOA 4P23B 4KKCC 4WI7A 2X4PB 4OAWA 2YD4A 2WXIA 2ZOLA 3ZDZF 2ZUQC 1R1CA 3PWJB 4QTHA 3ZHLA 3HG2A 4FXKC 1OZTG 3V6FB 2A5UA 4AYBA 2QFRA 2YQ2A 4R5TA 5E2WL 2DF3A 4PSPA 5D1XD 4O02H 1UD5A 2P42B 4PJXA 3CCHA 1MZZA 4WENB 4UT6L 2VLKD 3KPPB 2ADFL 2JK5B 4HCFA 4E9TA 2ZSVB 5BVJB 3BVNA 1THCA 4HZAA 4NRYB 5D1XB 4AQ1B 2YUVA 5FCUH 3VI4A 1BZOA 3KYNB 3FQ1A 1N7MH 1T66C 2CIKA 3RUGF 1C16A 3CHPA 4JY4B 1YQVL 4MJIA 4L3EB 2QADD 3DX8B 3H0TA 3Q5TA 3MAWA 4QI3A 4Y8AA 2B0SL 5ISZE 3QJTB 2G0LA 1P5UA 1RJCA 3O4OC 5DMIH 1S9YA 2GTZB 5K1JA 1S5HB 4JFED 5ANME 5DYOA 5DMKB 1CDJA 3O4LB 4QAWA 1RH8A 5B38B 4LOUC 2B0SH 1QSFE 1W72L 1Y18B 2EO1A 2G9HB 1I1YA 3F8UB 3MCLL 3MO1B 3QXDB 3R18A 2VDPB 4KKZA 1A2YA 5IB5A 4ZS7H 3CZGA 3HG4A 1E5YA 5DVKA 1PCSA 3BP5A 3QEUA 4EVNB 1P4LB 1IVLA 3MMEA 4YDNA 4TPRL 4FQJL 2DQEH 1T2JA 4HEPA 2VXTL 2R69H 3EDFA 1GGIH 1B4LA 1NGPH 3LRKA 2RBLA 2L3BA 2WVUA 3OGCB 5D7LE 1NGQH 2APXA 3PNWA 1LILA 1P4UA 1LYQA 4MCYB 5TE4H 4L23A 5DVOA 5K59F 2WBJD 5HHME 4XHJD 3B56A 4UDTB 2WXJA 3WIHA 1IBHA 1MFBH 1MNUH 5CGYC 2OM5A 1WA1X 3APFA 3BT2L 4JFDE 4K23L 1ZT7A 5C3TA 2QZQA 4KRPD 5CINH 4ZMQA 4YDVB 3LSOA 3W38A 1MREH 5HYFA 1BG1A 1W72A 4Q2ZA 5HPOA 3CQFA 1I31A 3RIAF 3HRZC 3MKGA 1IC4H 3ZZQA 4M48H 3TL5A 4X6FB 4F7TB 2QLVB 1ET5A 1YY8B 3IGKA 3NJJA 2X1WL 1ND0A 5LGHL 2WO4A 5C6WH 1NPJA 4ZJ9A 3VE0B 4XAWH 5A6LA 1TT6A 4U6VL 3EDKA 2WXNA 3NJHA 3LKQA 1CLOL 1UJTA 5DDHB 3VH8G 5KBDA 1RK1A 1W6LA 1KCRH 3T8MA 4WEEA 3BSZL 2EDRA 4FP8L 4N0CD 3QEHA 1A3QA 5BO1H 1R47A 4XP1L 3MNWB 4Y4HD 3QRFM 5HDLA 1Q9LA 1SPDA 2NY6D 2P24A 3HE6B 3WEOA 4LSTH 1I8IB 5HDBB 4WI3A 3QUKB 2C3WA 2WSPA 4PREB 1MSPA 3WGVB 5FHBL 1ZWIA 4JRWA 4NQUA 5AOZA 1FF5A 1CPUA 1E9PA 1C08A 2EUZA 3CDZA 2O61A 1JGUH 1RCYA 2X4OB 2OCFD 2QSCH 1RUAL 3B2VL 3DBSA 5D7SH 3UX9B 4EDXA 4K3JL 3P9MB 1MVUA 3MA7A 2P5EA 4GO8A 4OF8A 3CG8A 2VDKL 4KRMB 4LAQH 3SJVA 2MFNA 1S7SB 3WHXB 2XTJD 5H37A 3T6ZA 3CMOH 3L3OB 2WIIA 3PP3H 1V8HA 5A40E 3SPVB 3U4EA 4RX4D 4J23A 3SE4C 1T4WA 4R7DA 5GGRB 2P46B 3D05A 3GB7A 4AW4A 1ETZB 1MXGA 4ZMWA 1CMOA 5J56B 1JI1A 2O6PA 4J2XA 2ZXAA 1WZ1L 1HINH 3C75A 5C70A 4F9LA 3DUHA 5D5ME 1KNOB 5DXWA 2FH6A 2H6UA 4PJ5A 4HCRL 4ZXBD 4E9QA 5KSBB 5CWSB 2WVVB 4DIXA 1F58H 3B2UC 3UABA 1E2VA 2V9TA 3CCHB 1OPGL 4HJIA 4J1UB 1WD9A 5KN5A 4JUTA 4RA3A 1VEOA 2O5XH 1WFUA 2ZJSH 4S0SD 4XNMB 4L3AA 4KZ0A 4NT6A 4Z7UE 2G3XA 4HUMB 4TSAL 1VKXB 1BSIA 2O6DA 2R27A 5T5NF 1B2YA 1EV2E 2A73B 3ZMEA 2ZJSL 1LNUA 3T0ED 5H8DA 5EA0H 3HIZA 5EZIL 3WS3A 3KPSA 1NC4D 1SLXA 1MHEB 1Z9LA 2IPUG 4LQ1A 3A0OA 2JIXB 3S88H 2ZWKA 2R4RL 2OYLA 5JHMA 1EXUA 2UZIH 1VGKB 5EBGA 1BG9A 1T3FA 3LS4L 1MHCA 1BFVH 2I27N 2YOAA 5D4QA 2OAAA 1B4JL 4MZIA 3WNPA 3NZHH 5FXCH 5BRQA 4D0BA 5I1DB 4L4VE 2AJYL 4OCNC 2CDGA 3ZYZA 5BNXD 5AALA 2CDFA 4IRSA 2CK2A 2B5IB 3CFJB 4MX7B 4EMZA 4RISH 2BVEA 4WQOA 3BAJA 1I1FA 3GJEA 1C12B 3UEQA 3EJRA 3W3BA 1XMEB 3JUZA 1PLGL 2A1WH 6TAAA 1FZKA 5D1ZI 3HC0B 2EDFA 3MLWL 2JCCB 4RGNC 4HLJA 2N3JA 4DO5A 3MNWA 3HI5L 1AZCA 5HI5D 1II4E 4HWNA 1T5WB 3E1ZA 3AUVA 2Z7WA 4A2EA 5BO0D 2B15A 1INEL 3SE4A 1RIUL 1KXTA 4ZQTA 1RHHA 2HRPH 4HFUH 4JQIL 5DHYA 1D6EA 5E56A 4XT1C 3ZR5A 2DAVA 2K8MA 3VXUB 4PGJA 2AI0H 1X5HA 4FFVD 1NCWL 5ICXB 1B2WH 3BKCH 3C2AL 2AJUL 5GZOD 2DI7A 3V9FA 2K9FB 1SXCA 3E3QC 4J3UA 2IXQA 1TTFA 2DY2A 3NN8A 4NUGH 4L4JA 3UTSA 5L88L 4XMZA 3TEUA 4OD1H 5BUGA 1PG7H 1QLEH 2C9UA 3BI9X 3S2AA 2ZUVA 5FYJH 3TO4C 2FSEB 2Z64C 4TPRH 3L4YA 5I6NA 4NM4H 4TLTA 5FA4A 4Q7DA 4FTVA 1R3KB 3QAQA 4GOSA 1Z5LB 3WKPA 4WO4C 1CFTB 4H44C 2FX9L 4EXPX 4AQOA 1GAFH 3AREB 4A68A 4DN4L 4JO2H 2Y3NA 3QUKA 4M5TA 1KB5H 2APVA 3JT2A 1KPRA 1NTDA 2EKSB 4QRTA 4W4NA 3ILQD 2PXYA 3OLEA 3FT9A 2P52A 4ZS6D 4IU2B 4XNQB 4JFYA 1OAKL 3ME0B 2Y6SD 4FHBD 5T3XH 4R5XA 2CBMA 4AUUA 3CSTA 1H6UA 4I48B 2H1LM 3UGUA 2ID5A 2VC2H 5DURB 1KBKA 4AK1A 3OSVA 3I6SA 4UM9D 3W0WD 5I1IH 4LRNL 4KTGA 5C0EA 3L5WA 2B16A 5FB8B 1NBYA 3ZKXC 4O51B 3AWFA 1XGUA 2ICEC 4DFIA 4BIKA 3L1OL 2GSGA 3V2AR 3W11D 4ENED 2E8ZA 2OMWA 2QSQA 3DOHA 3FQRB 1J87A 1R3LA 4N26A 5E03A 3HNVH 1U0QA 4ALAL 1UQSB 4KKLD 4DNLA 1X6LA 5JHLH 4HPYL 3ARPA 1ZTXE 5JHAA 1DJGA 1MW1A 4HUCA 5SWSD 5T1MB 2F58L 3BLKA 3DJRA 5E5MA 3VJ6A 4A6YH 1I9JH 1R5VB 3Q43A 4J1UA 2CRZA 1NQBA 4PG2C 3P0YH 1HAWA 3F83A 1SDDB 3BUYB 2EEBA 3S96A 4H25A 1WZ1H 4WVRA 2CDGB 2IBGA 3MBXL 5D7LD 5LGJA 4UAOC 1RZPA 3DSNB 3N42F 4H8VA 4J3OG 4PUBL 4ZQKA 5AEAA 5I15L 1ORSA 2YSTA 3DXAE 3MV7D 3NAAH 4XVSL 4WI6A 5MHSD 2D03L 5GGRY 4LT7A 1CGYA 3NJMA 4LIQL 1T7XA 2AV7A 2YPLA 2MH4A 3CHQA 2IAMB 1E8YA 4PYGA 2YGVA 1UZ6E 1EJOH 1UXWA 4UILL 1T22B 2OSWA 2AAAA 1OCRB 3TO4A 5I9QB 3RX7A 3D6GA 4LVOB 3LRHA 4LSVL 3U79A 4NQCD 3AVEA 1OSZB 3IJEB 3PAYA 2B2XH 3T8XA 3ZY7A 4OQ1A 2ZP8A 4AQEA 1MCOH 4P5RA 1OAQL 4KAQH 2H9GA 4JHAH 4LLYB 3RFZB 3FSVA 4I2XE 4ZNCD 1P84J 3V5DA 5CZVL 2FIRT 1U42A 5KYXA 2J1KA 4JM4H 4PJDA 4IOIA 4N2OA 4PRHA 4M1CD 5I8CA 1U3HB 3BESR 1U3YA 2KLRA 3I6GA 4WGVB 5EIQA 1JZ2A 3VXNB 5IMLB 2QTVA 1FZJB 1RURL 1C5BL 4HXBH 4KVCL 1BD2B 2G30A 4OJYA 5AOLA 5TDPA 4DTGH 4NO0B 3KLAA 1KC5L 4FZEH 3ROOB 5AL0A 2XXGA 5CM1A 2FR4A 5L0QC 4YAQA 4GW4A 1QKZL 3NACL 3UAJD 2ZKWA 3EFDL 1TJMA 3DMMB 2HB0A 4MAUL 2WYTA 1BM3L 5I1KL 4N20A 2ZOUA 5F1SA 1FNEA 5EU4B 2YD8A 1ZEAL 1I7ZA 4NKQB 3KPQB 1EFXA 3HAEH 4H20L 1IGIL 1U33A 4Z7QF 5EF0A 3R06B 5INDB 1KCSL 5DMKA 3DHMA 3V5HA 4PJCF 3ARRA 3ESUF 4HKXA 4ODXA 5FW8A 4PJCE 4AMXA 2WKLA 3SYAA 1LE9A 3WS6C 3QI9B 4Z0XB 2YD7A 4U1IB 3QCVH 4UUJB 4HOXA 2DYSB 3M8OH 1AXTH 2EH7H 2FJFB 2XQBL 3N55A 4XR8C 4KQ3L 3UP6A 4D9LL 2Y1VA 4U31A 4N0UB 4O51A 3DVGB 2PO6B 4MS8D 2J20A 2JLPA 1NFDA 4KDWA 4IOFC 1KCUH 4X6DA 3PNWB 5F3FA 5T5FH 3RVXD 1HQRA 3H42H 2HFFA 4URTB 2YBRB 4W4OC 5EF3A 2BRRL 3VXUD 1J9QA 3MJWA 5DHMC 2LU7A 1FIGH 1XF1A 1U30A 2GTWB 5B38A 3M6DA 3DVNB 5E2TL 4LHUG 1WFOA 2AXWA 3VD5A 1IAIL 1ED3A 2VDML 3MOBH 3QPQD 4GKSA 2JXMB 4Q9RH 1Q9OA 2OV0A 4XH2B 4AYMC 3B2PA 4R90L 1YYCA 1QSZA 3U7AA 1UWYA 4X99A 1K4CA 1F6AB 3BEWB 4K5LA 4PV8A 1H6EA 5IQ9A 5C2UB 5IIEB 3QQDA 3IXAB 3FONA 3LQMA 1AHWB 4HULB 1KJVB 5ESAA 1WJ3A 2A9CA 1F8TL 1MXDA 2HVJB 2IG2L 4HPOH 2FL5B 4PJAA 1BLIA 3JV4A 3S3JA 4LSSL 1J9SA 5DMGD 3VWJB 4PTTB 3A6CH 1W15A 2DTMH 2CUHA 4JY5L 4K94C 5HDQL 4KHTL 3GNML 5E5LA 4AE0A 2V6HA 4U1LB 1ECYA 4HJUA 3TNMB 3ARDD 1EXGA 4IS6B 1T80A 1NCBH 4K3GA 3ZKQD 3OQ3B 5I8EB 3GNMH 1NWPA 1NEZA 4FN0A 4KVNH 5E2WH 5AOMA 4MCNA 5DZPA 3IFLH 2CO6B 3CLFH 5DD5H 3ZRSA 4B60A 1O7DE 4LEXH 2BC4B 1D5MA 1IGJB 3PDGA 2ITFA 5TPWL 1YY8A 4OCRH 3QQXA 1J5OL 4M7KH 2A4ZA 2IDTA 1DN0A 2J12B 4RWYH 5SWZD 2F2HA 4Z7QB 4PP1D 1WFNA 3EYVA 2HKHL 1ZLUH 2XUWA 4DKEH 2J2ZB 2Y9RT 3O9WD 4S1SL 5EU6B 4FG6D 2C9AA 4XWOC 2FEEL 4NQEE 3CX5K 5IMKB 3DO7B 2IEPA 4U1JB 2V2XA 5E4EC 5F3BA 1CJYA 2Y7MA 4OCXH 1KT2B 3TJPA 3ULVH 3MLXH 1RZ8B 5EFIA 3L7FB 1J0YA 3T4YB 1ZXKA 3G5ZB 3IS1X 4JKPH 1BZDA 3QNZB 4OZIB 1JPGA 3KYOB 4LKXA 2B1AH 4P2OB 1IGCH 4CVZB 5F0JB 1TTCA 5IVOA 2P80A 2E9GA 2VLJE 4I0PB 3B7YA 4ANWA 2Q76B 1DJIA 4UF7C 2VE6A 3V8OA 1TETH 4A37A 1DVZA 1QABA 3O11A 2VERA 1D3CA 1FYTD 1MIMH 2NY7H 2EO9A 4I1NB 4IKNA 4ODTH 4Y16C 5FA3B 3MODH 4ZTEA 2OMYB 4F7CA 2WK2A 1GOHA 1S7SA 3P0VL 4JG1H 2XZCH 2GC4C 4DGIH 5D70L 1M56B 3NCFB 1S5IL 3GUFA 2J44A 3E8UH 3W39A 2KZKA 2WHVA 1MW0A 4HXAL 3JV0A 3ZYJA 2QKIA 5DF0A 1ZLVK 2Y2WA 1ZS8B 2VLJA 5L7XL 3V6OE 3O81A 4RISL 5KYNA 3JTTA 3NT0A 4PJ6A 3RWDA 2F8OA 4IGBA 1J8HB 2AS5M 5HTSA 2VZ1A 3QWOA 5BS0E 1QRNE 4RLDA 3AU1B 1EJFA 2P9RA 4J8QA 2FLRT 5CO1A 4AIZB 3CPLB 4IBTA 4OGQC 1A25A 3H7BB 1X5YA 3KPNA 4YC2C 3SDDB 1RHFA 4K7PY 3O6FA 1ED3B 3F7QA 1E5UI 5DD0L 1RIVL 1N70A 2VSDA 2TAAA 3U9UA 5I0DA 5JXED 1SFDA 1CR9H 1RUQH 4XWGH 4JDTL 3ILPA 2NRDA 4Z95L 5KYYA 2ICEB 1GZPB 5D1ZC 1ZLEA 4PRIB 1FV1A 1XZWA 2EP6A 1R24B 4XPTH 4XX5A 3V4UL 3WKQA 2UUDH 4X7FC 4DERA 4YJZL 3P40A 3BSGA 1M3IA 1DVFA 2F0CA 1ODAA 4IGBD 2X3BA 3D25A 4F2MA 3K2KA 5LAXA 1LDPH 4Q6YA 3CHXA 4ZBJA 5B3JF 1L3NA 3M88A 3MRGB 4HWBH 1WYJA 4Y1TA 1OP5H 3UTTE 1EO7A 3ZW3A 4CDGC 3MRPA 3TIEA 2I25N 3O8XB 1BPLB 3C5ZD 3Q2VA 3PDDA 1S7VB 3FT4B 1ZK5A 5HHXL 4F7MB 1OHQA 4NS0A 4CMHC 4NQDA 1MY7A 4PY8I 2BP8B 2WAQA 3QIBB 3QQ4A 2PPCA 3QQ9C 4G1MA 4OGYL 3DTXA 4XMKL 4NQED 1ZLWH 5B1CA 3KDPB 5E6ZA 4N6RA 5GJSH 3IFPA 5HP5A 4Q9BA 4F15C 4GMTH 1AIFA 1TXKA 5CJBA 1AHKA 5SWZE 4B0MB 2IAND 3SDCC 3KM1A 3KS0H 3IDUA 3MCYA 1JDAA 1HKLL 4D0DA 1J0KA 2QHLA 1YVLA 4OV5B 5DO2D 3LZOA 1JXGA 5CJ5A 2XN9D 4MWFB 3QDGD 1UACH 2WOBA 2PTUA 3TX4A 1RL1A 4EI5B 2PYFB 5SV4A 4E9YA 1Y0LB 3LDBC 3MJ8A 4NZUH 4X7TB 4E5XG 4FCHA 1W2KT 2NZIA 3FCTB 4M43L 2C3GA 3QHTC 2IALA 1F86A 3V4PA 1MCJA 4FLRA 5MEOB 3ZQ9A 4X7CC 4PJ9C 2X3AA 3HLAB 4DUXA 5L4JA 2Z8VC 5IMOB 3RZCC 1T0OA 1OSPH 3CHSA 4HISA 2CHXA 3AITA 3IPBA 4XVJL 3HI1A 1OAYH 2Z9TA 5E1HB 4B9CA 1JBJA 3DHJA 3GSWA 4XX1E 4CVXB 1TLMA 3UPRB 4ZD3L 1XGUB 1FH2A 3BGMA 5H94A 5JUEH 4XPAH 5E8PA 4CSSA 3MBXH 4QRPA 4I0PA 5CHNA 3Q6GH 5D2NA 2FJGB 5B7MA 2W8CA 4UT6H 3DROB 1J0JA 3F7VA 2AJZB 4KFMA 2AC0A 2IWGA 3FMGL 3GIZH 5JW4N 1L7TH 1XTMA 5CEYB 1QLRA 4Q74A 2RFXA 1YN6A 4HSQA 3BEVB 3CZUB 3QAZB 2X42A 4WY7L 1ZLWK 1BOYA 3T1FA 1DBJH 1JMZA 1SYSB 3PIQA 1LXMA 5IB2B 4WUUB 1SXAA 3B9KC 1OT4A 5H4ZA 3BH8B 4U6HA 3RAJH 2ESVB 1VSCA 4H1LG 4A2HA 4JKLA 5I1HH 1JTTA 1DBJL 5BOZG 5I82A 2YMTA 1JNJA 2VLJB 2J71A 3F7KA 4ABWA 5EN2A 2Q6WB 2Z3FA 1FE8H 1LHZA 2X88A 4PRNB 1ZXQA 2VR7A 1G1OA 1FFOA 5G55A 1JN6B 1GGTA 4O5LL 5C07E 2NY3C 4Y5YA 1QX1A 2LE9A 1YYLH 3L4XA 5B3NA 4JG0L 4D0CB 3I9IA 5MEQA 4JCLA 4OGAD 3AXLB 4AIXA 2DIEA 3LPGA 3UYOD 2EDLA 4TNFA 4PB9L 5IUCA 2F15A 2HT3C 1V3KA 4QRQB 3QQ4B 4G1MB 3RJOA 2YKKA 4YGVB 4YFLF 1HHJB 2CRYA 3TWYA 4DHLA 4PJIF 3SKOB 4OSUL 4WCYL 3I6LD 1A7RL 2QQKH 3C5XA 5IKCA 3DUUB 3OKLA 5IBTH 4K3EL 3JWNH 3ML9A 1KZYA 1ZHNB 4HIPA 3BQUB 4XI5D 3SYPA 3ULUF 5H35B 2IIJA 3ZE0B 2OBGA 4O4YL 4PM1A 1WEJL 3ZTJH 3IT8D 1UH2A 4N90E 4MB1A 1EDQA 1JGLH 1GGBH 1MJ7L 4OV5A 2NYYC 4K15A 3HA0A 3D39B 2VLME 1NAKH 1WC7B 4WKZA 3G3LA 1OM3L 2ZXWB 5FYLE 4BDVA 2EVJA 1Z9OA 5ICYB 1T1WA 2VLRA 4QHMA 1EAOA 2QDVA 5IG7B 4I0PC 3MRBA 2V9RA 2YD9A 3Q3GA 3KMDA 3LKQB 2CQVA 5F1KC 1XL6A 4LMQI 4ZW5A 1GZHA 2HLEB 3GJFH 4TRPH 4EO5A 5IVNA 4JZNA 5C7XL 3CSYB 5SWSB 4BFBD 1LO3L 2BZ7A 1PIGA 2PWDA 3DV4A 3FQTB 3MJ9L 4QCIB 3HB3C 4QHUB 1UFUA 2WWNA 3LVEA 3JBG7 2EH8H 1GIGH 4MMZC 4FEMA 4P5TB 3F00A 1XWVA 4OM0L 4PJ7A 1SBBA 2R23A 1R3HB 2OXGB 5DC0A 4NZRL 3BH4A 5INDA 3VGAB 3IKCB 5CP3H 1X4YA 3EJQA 3U36B 1CLCA 5HSFA 1F2QA 4Y5YC 5KSBA 2E59A 3K6SA 1ASOA 4QWWC 2EADA 4JFXB 4PJ8A 4PVNA 1YN6B 4FQXB 4OBSA 5IJKC 1JFQL 1IM9D 1RU9L 2JNZA 1E30A 4KI1A 1S9XB 3M1CA 3D4YA 5D7IE 4J3XA 1IEAA 4HIJB 4X5WA 3CXDL 2BDNH 5FW7A 3D9AH 3GXDA 3W9DB 4JRYB 3FOLB 4ZI8A 4KK5C 4HPYH 3NSXA 5C6TL 1BJ1H 1H0DB 1ACYH 3MRQB 2K9UA 4NM8H 1RJLB 4XE0A 3ESPA 1YEHL 2MMXA 3MC0A 3ZKMD 2J4WL 4OCSL 4NM8L 5I30H 5CWSA 3HHSB 1Q9OB 4IKJA 1ZJAA 4XH2A 3H2QA 3P73A 1IM9A 3BAKA 1UC6A 1HHGA 1A5FH 1VZIA 3M45A 3CZSA 5CS7A 3HG1D 3RI5F 2WIMA 4ZFFA 1SOKA 3RJQB 3X14A 3UJJL 3IRCA 5ADOH 4AQZA 4LCUB 4PS4L 4XBGB 5JHDE 3WKYA 2NNAA 2EDMA 2KI6A 1OPOA 4PJHB 2YEQA 3B43A 3QYNA 1S7QB 5B7FA 4YPGB 1GC1C 5F9OL 1IGCL 2G75A 3KAAA 4X6DF 5GGQL 3N41F 4G8GE 4KJYA 3PE9A 4WNQB 3WTTA 4YHIB 2F5BH 5CP7B 2OP4H 4JRXA 5DK0B 3FK3A 3E6FA 1QD0A 3H7LA 2R0WL 4MMZA 5I75B 2BFGA 2X09A 1OLZA 1ZSDA 4DGIL 1HS6A 2VTFA 1JRHI 2X4TB 5E9DB 2Z0UA 4TTDC 3T77B 2MCG1 2HAZA 3ZTJG 3RDTD 2JKNA 5A2LH 4FQIL 4QRAA 3V5KB 3V7MA 3B2DC 3GJFA 5K93A 4AM0A 2YAQA 1N8ZB 1T1ZA 2RALA 3PL6D 5LWYL 4KI5D 3K2MC 1ZA6B 4U1HB 4JEGB 1BQRA 4EUPG 4JZNB 5ID1B 3EH2A 5T1KA 5JIQA 5DS1A 5LNEA 4I4WB 3P9WB 4FYRA 4TSAH 4BH7A 3A24A 2CO7A 3VMOA 3L5WB 1E4JA 4ZOBA 3WE6A 5FOBA 1CLOH 2GPZA 2ZYSA 3D33A 1XCWA 1HVXA 4G1EA 4UZUA 1RSFA 4LVHC 3REWA 4CW1A 1P7KA 2MOQA 1CFBA 4NNXB 4LL9A 3T65B 4QRPE 4JM2A 2EACA 1J7VR 2GBVA 3QUZB 2XJKA 3RJDA 4NWTL 3NSDA 1N5AB 2NR6D 2CXKA 4A7GF 1LO4L 3QNXA 1HILA 2EIZA 4LB8A 5LN8A 4ESKA 2VDOH 3RNQB 2R7EA 1A6WL 4IJTA 4NRYA 3U9PH 3RPKA 3GSOA 3ZDWA 2HKFH 4AQ1A 4M9PA 3CN4A 3FTGA 4NBXB 4WFGD 3U4AA 5I17B 1UZ8B 3DX7B 3CVHB 2I07A 1NSNH 1XGPA 4HOWA 3MLZH 1F02I 1OWWA 4U3SA 3BCDA 1CICA 1MELA 3JTTB 4GAFB 3H9YA 1V3JA 3DX9A 1AGCB 1H0DA 1ZPLA 1FGNL 2B1HH 3IGAA 4FI8A 1BJ8A 4AY0A 3FUJA 4WWPA 3C5SB 5C7XH 3ARGC 2N7AA 5A1AA 4D8PA 4KNQA 5GGTH 1OTSD 1S3RA 3ABGA 1CGSL 5TQ2H 1A8ZA 7TAAA 3E1F1 3H3BC 2AJSL 1PX3A 2Y69B 3D39E 5IHZA 3US1A 1F8TH 3S8WA 3LB6D 2H5UA 5EU3A 4Z7OF 2PCFA 3FQNB 1VADA 2XRAL 5LBGA 1M71B 5GS3A 1FWXA 2IQ9H 2R0ZH 2UY6A 1PFOA 5IVXB 1T83A 3OKNB 1JV2A 1BX2B 2XDHA 5JW4M 3OJDA 5B3SB 4JFHD 5E00A 2XKUA 3C8KA 3HMWL 1D9KC 1UQSA 2F1EA 2CUAA 3SZ6A 3FSWA 3TZVB 1NCHA 3NGBB 5E4AA 4P9HH 4FFYL 4TLUA 4DQOH 4L3CA 4X7DC 2VSCA 1FORH 3QO0A 3ZBMA 3KLQA 4JRYE 2R2EA 4LSTL 5C9JB 1L0QA 4PRID 1B9ZA 1WFTA 2XYBA 5LGYA 6CGTA 3C87A 2AXFB 1QZNA 4DEUA 5CN1A 2PYFA 4LVOC 5C0CA 1OAZL 2CRMA 1MJJA 1E90A 5TDOA 3QT2A 3V0DA 3CVIH 4BELD 3RWFA 4BZYA 1TO5A 1ZRUA 3FB7B 4OFQA 4JLRA 5I16A 3EYOA 4K3JH 3U0TB 2RAMA 1B88A 2J88L 2VC2B 4EN3B 4B9ZA 1XMWA 3ZMNA 1AO7D 3MA7B 1CDIA 5GGSA 3GMOB 4U1IA 5T3ZL 4HKZB 4G42B 4ZAKD 1L6XA 1HHHB 1A21A 2DS4A 2VLMD 4OFVA 4BH8A 1OSZA 3O0LA 3GK8L 2IGTA 1KXHA 5DK0A 4BGDA 3JWDL 3TVMA 5I1JH 5D7IF 3LKSB 1AHWC 3IDIB 3DI2B 3HG3A 4R7NB 4DUVA 1T89A 1YMHA 1KMGA 4QOKE 3QS2A 1ZLVH 4GSDH 4WGWB 4M8UA 1TCMA 1YMME 1XXFC 3B5GA 5DGRA 3EO1A 4CN1A 4NI6A 3RWCA 1WSST 5E99H 4HJJL 3D8MA 1U8PA 4C83B 4D94A 4RMTA 4L4TA 5GZND 1HEHC 1J8SA 4LVHB 1F90H 3CSPA 3EG9A 1JZ6A 3L3GA 1FL5B 5EEZA 1IAOB 3RL2A 4A6YA 1VFBB 1P7QB 5ITFB 2A6DA 2DQIL 1F90L 3PU7A 3GMPB 2Q7YA 4V11A 1QEWA 1ORQB 4E5XB 3SCMB 5EEXA 1G7IB 2Q10A 1RP9A 1OB0A 1DVUA 1P6WA 1QSEE 3T8VA 3FFCA 3BE1H 3QYMA 1AMXA 1WE5A 3EFFA 1XB6A 4J12A 3BMWA 3FRUB 1CI5A 4Z7QE 4FTVE 2R69L 2EDTA 4XOCA 2DRUA 3VFPA 4GIOA 3LEXA 5EPMB 2KZBA 3ARYA 4PY7A 4XP5H 1F13A 1QRKA 4XHQA 5F8QC 5F7HA 4DGVH 5KZCD 5MP6H 2F8XC 2BOCA 1JG9A 1MF2H 4OF5A 1WWBX 4QXGH 2BZDA 5CZVH 3J07A 5EU3B 2E75C 2V8MA 3QQDB 3WY1A 5ITBH 3OZ9L 2NZ9D 1CFMA 1U36A 2J7LA 3V52L 5AD0B 1U8LB 1X9RA 3BT2H 4HUXB 1V3LA 3X12A 2VH5H 4QOKD 2HPTA 4BFGA 2VR5A 5INCA 4PRNA 4EQ2A 4F9LC 2B59B 3J7HA 3EJTA 4FNTA 3BWSA 4G8GA 2H2PC 2ZWLT 2APBA 2EC9U 4HIIA 4TQHA 5DUPH 1GGUA 1YECL 3BXNB 5HHPA 2K1MA 4Y5YB 3RRQA 3J2PA 1D5ZA 2H6PB 1NMCC 2Z1KA 1AC6A 1MG2C 3HR5A 1QQDA 4H8PA 2FX9H 1KACB 4GSXA 1W16A 2K3HA 3T3PF 3W82A 4DN4H 1AQHA 2A99A 1WCQA 1MW3A 4GO9A 4XPTL 1PCXA 3F12A 4A2LA 1Z5HA 1AHWA 1RZJC 2IFFH 4N3UA 2DI8A 3GPEA 1MCPL 4L8DA 3QWRD 1U41A 1YEFL 3CFJA 5FO2A 4PGBA 4XPFH 4OY9A 1FBIL 1ZHNA 2NQ3A 4MJHA 1HSAB 2PCPA 2W0FB 4NHUA 3IGFA 2KBGA 4G8GD 3T9WA 3SDAC 1D7BA 1KJ3L 2VCOA 5DHVB 4MAYA 2B3IA 1YC8A 5AG8A 1HHHA 1NOLA 3DRQB 1CE1H 1KB5A 1U8HB 3U83A 4C56E 5K5YA 1SJEB 4HWUA 3M07A 3L1OH 1TNMA 5FGCB 2QADB 4EJ1C 5KJ7E 4D3CL 1D6EB 1LMKA 1KPRB 2ZNWA 3V6OC 3RWHA 2P3YA 4UT7L 3ZTDC 3G6DL 1H6FA 4ERSH 5JIMA 5KBKA 1S5HA 2WUBL 1QSVA 3L17A 5IQ7H 3HE7B 4B9YA 3KPNB 5L4MA 3IM1A 3CFEB 2EYTB 1M3JA 4HG4K 2WSDA 1CI3M 1B3JA 4NZTH 4AYFB 1HNGA 3BKYH 4QTIL 3RKPA 1FZMB 4Y4FD 3QQ3A 1FDLL 2IBZY 4K94H 3AADB 4I3SL 3H3PH 3QORD 4PRPD 3HJEA 4E41A 5FF6A 1DEDA 2XCMC 1I7RA 4HETA 3VXRE 5JW4Q 1HEZA 1U92B 1WAPA 4JFDD 1KLFA 4LCYB 3U30C 1JPTH 3P1VA 3TH4T 4I85A 3WBDA 5T3ZH 4N5EC 1A7OL 3MOAL 4D8OA 2ZKMX 3EBAA 4F9PC 2ALWA 1BVLA 5CR1A 3GMQB 4F5CA 2CBQA 3UL4A 4M1GL 3DURA 3WN5A 5I0ZA 1CFQB 5DJYB 1G9EA 5D7JA 3K6SB 1XH3B 1NCIA 5FYKU 5HGBB 1A2YB 1R33A 2VWEE 4UNTA 4O9HL 1KWKA 4QXUL 4RMSA 4P2QE 1QAWA 2NUPB 4P5TC 3A23A 4NQDB 5CJXC 2VDNB 1BPVA 3VMNA 5C0BE 4F7TA 4RGOH 3KDMB 1MWAH 1U8MB 1HT6A 3VWKC 1MCRA 4WO4A 4BV1A 3FU0A 3ETBF 4JANB 4LBAA 3JV6B 5BRZA 1E40A 1JWSB 2ARJB 3JWNE 1QVOA 3FQ2A 3KJ6H 5HJ3B 1RJLA 3FT0A 4NP9A 3SGDI 1PJWA 2WLMA 4LGRB 3Q48A 1QFHA 1DQKA 3MRPB 5D7JD 5EZOL 5EBLB 1S3KH 3CV5A 3QZNA 4M93B 5DQ9A 3NCEB 2E7HA 2HFGL 2DD8L 3LZFL 3HZMB 5H37H 4PYHA 2MOGA 1XIWC 1IGYB 5F0PB 5C2BH 1HXMB 4H88L 1REIA 5BV7B 3CFKB 2CRIA 4WI2A 5DJAB 3V6OA 2P5WA 3WIIL 3WTYA 3NZHL 3L2LA 2ICEA 2VMCA 4E2OA 4N2HA 4RGNE 1QBLL 1S78C 4ZFOL 3ZOAA 1ZGLP 5GRVK 3A67H 4G8EB 4HS6B 4PW9A 3C2SA 4QT5B 2NSXA 4Q8BA 3RL1B 3IBOA 3HE6C 3MV9B 4XZ4A 1UJ3A 4MCZB 4WHDA 4MMXB 1U8NA 1VZHA 1OF2B 2EXWD 3OHXA 4GAYB 3IJ8A 5CIPH 4AITA 4E9WA 3QPXH 2IPTL 5CCKL 4NZFA 1OWRM 2WB1A 1E2ZA 1Q1JL 4ABQA 2JKLA 1I3UA 4KMLB 4PG2A 3N9GL 2SEBA 2EEAA 3PJSB 3MRLB 3K71A 1DSYA 2W5PA 5HYSG 3IAGC 1NCNA 4XNYL 4ELDA 3LS5L 1R3IH 1AP2B 1OKEA 2FUQA 4DPAX 3TBBA 2XX1A 3F7LA 4RVBA 1MPAH 3BSZA 4BFFA 4J6RH 1QI4A 1UZGA 3E6HA 4BQ8A 2AJZA 3V0VA 5KS9F 2XQYG 2YD5A 4BXSV 5T1LD 3STBA 2HJKB 3KWXA 4BKSC 3SJVB 4LP4A 5GGVY 3TESA 1E4KA 4JDTH 3WKNA 3O41B 3KGUA 4FC3E 4UV7H 5D93C 1ZK9A 4YHYB 3BDYH 4BFJA 3DVGA 2VDLL 1OCCB 3OG4B 2Z93A 3VD9A 4W93A 2DYRB 2AQ3A 2OJEA 3K6DA 1IIKA 1MW2A 2W65B 4OZHB 4OGXH 1T0MB 1AY1H 2SODB 3FL7A 3MGAA 4M61B 5IB4B 1MRDL 3UCRA 3HE7A 1KPUB 3GGWB 3GZPA 4JKPL 3CUPB 1OSPL 4WU7A 5BOJA 5HYIA 4AI7A 2CXGA 1A66A 2BDNL 1F4HA 5GXBB 3D4ZA 1KLGA 1PD1A 2F53A 4KO9A 4N2LA 2PCFB 3FQNA 4ERSL 3VXOA 1U8MA 1MWAB 3D85B 3IWUA 4RFEB 3CHRA 1EZVX 1VAHA 4ELKB 2BK8A 2OX5A 3L3HA 3N06B 3QAZC 3VG0H 4LEOB 3GEWB 2YBGA 3UH8A 4Y2DC 2IWKA 5ADPL 1MCOL 4U0RB 1IEHA 1NBZA 2VAJA 4NO2A 1ONQA 4N4YB 1TSRA 3C5SA 4O00A 5KW9H 4IS6A 4LHQB 4YXHH 5HHNB 4A2MA 4NAJA 4C56B 1YPZA 1CDCA 1E4HA 4KVNL 2IGLA 4LLAA 1NOAA 5IFAH 1MVYA 4WDIB 1AS7A 5K33A 3U0WL 3LKPA 3UO8B 1K4CB 1MCNA 3DX1A 1NFIA 3H3KA 1LM8V 2RD0A 3KXFA 5DUJA 1U8KB 5KYUA 1YEKH 4WO4B 4ZW3A 4FA7B 2NQDA 3H1ZA 4IU3A 5E6YA 4YX2H 4U1SB 1MI5A 2UY6B 3BW9B 5MENB 2A2QT 1IUZA 5AG9A 1I53A 3AM8A 4WWKA 3WJJC 2J2ZA 3WV0A 5HVHC 1UZ6F 4JBSA 4NPJA 4DP1X 5H35A 2Y6TE 1JDCA 1YMMA 1UJ3B 1OAYL 1JF1A 4WI0A 3IETB 2VDRB 2HJFA 4MAZA 5F89A 4KKBD 5T1DL 1KGUA 1TYJA 5EIIG 4YFEA 3D85D 2BS71 1E9QB 5F7YC 5IBLC 2ILLA 1LO5A 3ZT5A 3T4YA 3OKMB 4PU2A 3D3VD 4WFEE 3ZDZE 3P11L 1H8SA 5IK3B 4PJHE 1T0NA 5L8LB 1OK8A 3QZPA 1A6UH 4CVZA 1F3JA 4K2UL 1X7TA