3NT6A

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANSGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 172
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3nt6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A01
4EM3A 1BKWA 3VRBA 1KSUA 2FBWA 1O95A 4GUVA 3HWIA 4OCGA 2JTSA 3AE8A 3ZDNA 5J60A 5KRQA 2JTRA 2C73A 2VSWA 2CULA 4BV6A 1H81A 1O94A 3GDPA 5BVAA 2H89A 2YG4A 1DXLA 4U8IA 3NTAA 2R4JA 1K0JA 4H4QA 3F4AA 1LQTA 4JDRA 3C4AA 5JCLA 3AEDA 1Q9IA 4GDEA 1F6MA 1S2QA 2WBAA 3GMCA 2GV8A 1H86A 5BRTA 1CC6A 1PS9A 2WOWA 1GXFA 2ORAA 3QFBA 3AYJA 4H4RA 5KVIA 4YTNA 1H83A 3F8RA 2GEWA 2RGHA 1EBDA 1Z6LA 2R0GA 4JY2A 1K4QA 3H8LA 1H4KX 3IPPA 3B3RA 1RP0A 2ACZA 4J33A 1ONFA 1NG3A 5JCKA 1E7PA 3FPZA 2KL3A 1QO8A 4RG3A 2R46A 3PVCA 1YQ4A 1GEUA 1X31B 4GRTA 1JRXA 2J3NA 2XLRA 4FX9A 2XVIA 2Q7VA 4YKGA 2WU2A 2JBVA 3AECA 2MOLA 2WLRA 3UTNX 5HPAA 4FK1A 1DJQA 5FS7A 1LPFA 1VDCA 4EQXA 3CTYA 4JGTA 4EIQA 1RYIA 4H2NA 4YXDA 1JNRA 1GRGA 4U8JA 4XWRA 4GR1A 4YT0A 2QA2A 4CY6A 1NPXA 4H7UA 2JTQA 2B9XA 2WP6A 2XVJA 3AWIA 1H82A 2YG7A 3RP6A 1EL9A 3NH3X 1CWTA 2FJAA 3GSIA 3NK0X 4ZCDA 3KA7A 1VQWA 3L8KA 1NDAA 2WPFA 4PAAA 1L0VA 2VOUA 4AP3A 2B9WA 4A5LA 3E1TA 1PXCA 4H4ZA 2DKIA 5M0ZA 3KLJA 1GESA 1NHRA 4U8MA 1K0IA 3DJGX 1OJ9A 3UCLA 2V3BA 1PXBA 2XFOA 1Q1RA 1XPQA 1GNDA 3AE4A 3CNPA 2Y6QA 2YLTA 5U1OA 4K22A 4XXGA 2XYOA 3DMEA 4Z2UA 4YTPA 4LIIA 4JQ9A 4EMWA 3EAOA 1YQZA 2RGOA 1OJCA 3BNUA 2R0PA 2B7RA 2BS2A 4H4XA 4K2XA 2O9ZA 5KOWA 3C96A 4X4JA 3IF9A 1IUVA 5KWFA 4TLZA 5HYMA 1D5TA 4OPCA 1QB0A 1T3KA 3NTDA 2X3NA 3RP7A 2YG5A 1ORBA 2Z5XA 3FS5A 3DK8A 1SEZA 4A6NB 4U8OA 1BF3A 2BK3A 3FBSA 2WOIA 4TM3A 3EF6A 4DNAA 3NNEA 3GYIA 3QVRA 2H88A 1ELIA 4H2PA 1LJ1A 3NN0X 4AP1A 2E1MA 3K30A 3UKPA 1GRBA 3MZZA 1GSNA 4EMJA 3UKFA 2BS3A 4U8PA 3H8IA 4BURA 1P2EA 2VRLA 2YWLA 1KFYA 2TPRA 3QJ4A 4BJYA 3CN8A 3AE7A 4CBQA 4WH7A 5GSNA 1IUSA 2X50A 3QSMA 1GMXA 1ZMDA 3VRAA 3UOZA 2GR1A 3S5WA 2GAHB 1DOEA 4AT0A 3AE3A 2XDOA 4AOSA 4LA1A 1E1LA 3BHKA 3AD9B 4M52A 3IC9A 5KOXA 1IUTA 1JRYA 3NRNA 2YLSA 3HZUA 2C70A 1DOBA 4K7ZA 2WP5A 1D4CA 5IQ1A 2FJBA 2MOIA 5IQ4A 2C7GA 2R9ZA 2WEUA 2XLSA 3ALMA 3DK4A 4EMIA 1YM9A 3NYFA 1N1PA 2FJDA 3ALLA 1CJCA 2E4GA 4PABA 4IVOB 2C3CA 4AOXA 2EQ8A 3UP4A 1BZLA 3P9UA 4U2SA 1URHA 2BC1A 3F8PA 2YM2A 3G5JA 1YMLA 4CNKA 3P3AA 3AE1A 1YS0A 3D1PA 1H7WA 1B4VA 1MO9A 4H4SA 4Y4NA 1TRBA 4U8NA 4J57A 1XHCA 5EBKA 3NK1X 2HQMA 2BACA 4Z2RA 2J6PA 4YSYA 2EG4A 1REOA 2B7SA 2QA1A 2YG6A 2F5ZA 1F3PA 4BK1A 2XLUA 1EL5A 1FL2A 4MJWA 3FLHA 3CGDA 3QSSA 2GQFA 3IWAA 3CNJA 4LU6A 2C65A 4CNJA 5JCMA 2AQJA 1JU2A 2CFYA 3CNDA 3GRTA 4H4WA 2OA1A 2R4EA 1ZKQA 1PBBA 4REKA 4B69A 4C74A 3NYEA 4J36A 4OPTA 4H4UA 1PBFA 2AAQA 2V6OA 2OAMA 2EG3A 4FDCB 1GALA 3S61A 5HBQA 1B5QA 1VG9A 3BHFA 4X9NA 1QLBA 1P2HA 5ER0A 4EM4A 1KNRA 3P1WA 2WDRA 1AOGA 4UDQA 4DSHA 3KD9A 1PHHA 3RHAA 2BK5A 3UKHA 2JAEA 4U8LA 3M12A 3VQRA 2XLPA 3DA1A 1COYA 1H6VA 1F8WA 3CGBA 5FS8A 1RHSA 3D8XA 1E1MA 4IA5A 3ICSA 3RP8A 2VRMA 2UZZA 1PJ5A 4IA6A 1TYTA 1CL0A 1DODA 1TYPA 1S3EA 1NHQA 1O5WA 3I6DA 4EQRA 1C25A 4H2QA 5EB4A 1HYUA 1H7XA 3BI4A 3FIMB 3FOJA 1Y56B 3ABVA 4OPUA 4H4PA 3UTEA 4JNQA 3NT6A 1HZMA 3M0OA 4OPDA 3K7MX 3SGLA 1GT8A 4B1BA 4B64A 3NGCX 4HA6A 4NTCA 1DNCA 3TG3A 1V59A 3AEFA 2XVFA 2V61A 1PBEA 5HBPA 4KX6A 3QFAA 4A65A 2Y6RA 1D4EA 3ATQA 2IFVA 3UKAA 1TDOA 4K5SA 3UKQA 4A99A 1GETA 1DP2A 1UARA 3M13A 2DCQA 4JN9A 2WPCA 5J7XA 1ZDLA 3ADAB 2W0HA 1BGNA 3IHGA 3R2UA 4BK3A 1NAAA 5KXJA 2A8XA 2C67A 2EQ9A 3SFDA 3NG7X 2YR6A 4CCRA 4A6NA 2A89A 1E1KA 1D7LA 1E6EA 1LQUA 3KKJA 4K5RA 3UOYA 4USQA 3T37A 3CIRA 3AEGA 3ISHA 5GRTA 1N4VA 1TDFA 1FEBA 3OC4A 3IPOA 1L9DA 1YKJA 3LB8A 1Y0PA 3VRDB 4I58A 3GDNA 1MXTA 4EQWA 4A9WA 3AEBA 1TQ1A 3P4QA 3EANA 3C4NA 1GTHA 4B67A 2R0CA 3CPHG 4J34A 2ZZBA 2WDVA 3G5QA 3UTHA 4J56A 1CHUA 4D03A 1VRQB 2C64A 2A2KA 2X8CA 4H2RA 4OPIA 2R45A 2X99A 2Z5YA 4TM1A 2GMJA 3P4SA 1PJ7A 3UOXA 1YMKA 1EL7A 1MOKA 1GOSA 3NIXA 4D04A 2GAGB 3DJJA 1S3BA 4ICYA 1CWSA 2YVGA 3CPIG 4USRA 5DBJA 4Z2TA 5BUKA 1XANA 3ITJA 1PDHA 1GERA 1PJ6A 2OLNA 3K9RA 2GRTA 2GR0A 2QCUA 1QJDA 2V60A 3BNMA 2V5ZA 3DH9A 1NENA 3WE0A 1OKGA 1GRFA 3AYIA 2YLXA 3GD4A 3CGEA 2WP9A 4EQSA 2WQYA 3G5SA 3QVPA 1CC2A 3SQPA 4NEVA 1YMDA 4O5QA 3DGZA 3FG2P 2XFNA 3AD8B 1CC4A 2V3AA 2XLTA 4P9SA 4A79A 1FEAA 3UTGA 5LAMA 4OPLA 1NHPA 3SM8A 1M6IA 2GH5A 3EPTA 4OPGA 3KPFA 2DKHA 2JB2A 2VQ7A 1E0CA 4RG4A 1KF6A 4B66A 3CPJG 3UKKA 1N4WA 3UP5A 1BGJA 3FNJA 1N4UA 3II4A 5CQFA 2JB1A 3KVEA 2GVCA 1CJ4A 2I0ZA 1CF3A 3LJPA 1WV9A 4NZHA 3RNMA 3AEAA 5C3JA 4Z26A 3AE9A 1PBCA 3P4RA 4WX1A 2WESA 2XFPA 2X8GA 3AE2A 3NLCA 1IUUA 5HHFA 1WHBA 4UDPA 3IWHA 2XVEA 2BXRA 3G5RA 1YY5A 1GTEA 1TDEA 4YKFA 2RABA 2B9YA 4YWOA 5EOWA 4U2TA 3GMBA 3ICTA 5LAOA 3UKLA 4FK1C 2GWFA 5EB5A 3GK5A 1IUXA 1LTXR 4IV9A 3SFEA 2BA9A 2WETA 1Q1WA 4J2WA 1FCDA 3LXDA 4B65A 3ICRA 4U2LA 2ARDA 3DJDA 3DK9A 1RHDA 2YLZA 3O0HA 1YT8A 2YVJA 1S2YA 2B76A 4K8DA 4TM0A 3QSEA 2WS3A 5IPYA 4BJZA 1QXNA 4RSLA 1CJ2A 1NHSA 2GR3A 4H4YA 4A7AA 3TP9A 1JEHA 1BWCA 2VVLA 4C3YA 2PHHA 3OLHA 1GRHA 1PBDA 1D7YA 3LOVA 2NPXA 2Q0LA 4TLXA 4Z24A 3VR9A 1H4MX 2WU5A 1ZOYA 2YLWA 3B6DA 4BK2A 3Q6JA 4H4TA 3VR8A 2HHGA 1H84A 3CNSA 4Z43A 3CGCA 2CDUA 4AT2A 3COXA 4Y4LA 2A87A 1JOAA 2XFUA 1DOCA 3HZLA 3AE5A 3R9UA 1ZY8A 2GMHA 2GQWA 2Q6UA 2YR4A 1KDGA 3NHOX 1PXAA 3P4PA 2WLXA 4TM4A 2BYBA 2BXSA 2WOVA 3ALJA 3PO7A 3AAYA 4YSHA 3HIXA 4EIPA 1BOIA 3K7TA 5JCNA 4F67A 3FMWA 3V3OA 5HBLA 5BULA 3H4KA 2GB0A 4JY3A 2C3DA 4NEWA 1ZX9A 4N9XA 2YG3A 2IVDA 4U8KA 1W4XA 3AB1A 5FS6A 4Z44A 1IUWA 4H4VA 2E5VA 1CBOA 4CY8A 5M10A 4B68A 4NTDA 2EG4B 3AE6A 5U63A 4E0VA 2ZZ0A 3TG1B 2YLRA 1F8SA 4Z25A 1E1NA 2VZ2A 2WDQA 2C75A 2BCPA 2WHDA 2JB3A 2BS4A 1TDKA 4ECHA 2YAUA 1DJNA 4X9MA 1VG0A 4WCTA 3AAXA 2EQ6A 4NTEA 3PS9A 1D4DA 1KSSA 1L9EA 3GWDA 4YSZA 1M64A 5KVHA 2FJEA 4GF7A 1ZK7A 2Q0KA 2FSXA 4UDRA 3ATRA 4O5UA 5TR3A 1NEKA 3UTFA 5JCIA 4DSGA 3GWFA 3REDA 1ZMCA 4HB9A 2GR2A 5LV9A 3GRSA 3JSKA 3GYJA 1ZOVA 2VQBA 3K7QX 4B63A 2C76A 3BI5A 4APNA 4XWZA 1L9CA 1UKVG 1GREA 3I3UA 1XDIA 5HXIA 5U25A 2IVEA 1FECA 4KPRA 1VEEA 4C5OA 2YM1A 3GD3A 1BOHA 2WPEA 2AR8A 2QAEA 3AXBA 2MRMA 3OP3A 3L1RA 3AD7B 3V3NA 4DGKA 1GN0A 1GRAA 3NHVA 4WH9A 4IVMB 1IJHA 5HY5A 1CWRA 4ADWA 1NG4A 2YVFA 3V76A 4CRTA 1OJTA 4ZN0A 3ZYXA 1KNPA 5FMHA 1CJ3A 1Y56A 1RSGA 2ZZCA 1GRTA 2BC0A 1EL8A 1B37A 3LZWA 3O3WA 3F8DA 2VVLG 2BK4A 3I2VA 1TDNA 2JK6A 3LZXA 4ZCCA 1B8SA 2X8HA 1JNZA 2IFDA 1F8RA 1LVLA 3DGHA 3D1CA 3Q9TA 2EQ7A 1GV4A 2IIDA 2NVKX 2OALA 3AYLA 3I3LA 2GF3A 4YTMA 5HBOA 4J31A 1YQ3A 5CKUA 4Y4MA 4UP3A 4C77A 3DJEA 1JRZA 2XVHA 2BABA 2XCGA 3NYCA 1K0LA 3AEEA 4CCQA 3LADA 2C66A 1GPEA 2VVMA 5FS9A 3CNTA 3NK2X 4GCMA 2YQUA 4H50A 1E39A 1OJAA 2K0ZA 2YR5A 5L46A 2JKCA 2OUCA 1PN0A 2ZBWA 3IHMA 3BI2A 1OJDA 4GDPA 3URHA 3NKSA 3OZ2A 2TMDA 3UOVA 3KU9A 1LV0A 3NN6X 2UZQA 4C3XA 2RGJA 2PYXA 2OLOA 1ZP0A 2XFQA 4JNAA 2BCGG 4I59A 4OVIA 1FOHA 2APGA 2C72A 4YSXA 5C2TA 3ILMA 2CVJA
chains in the Genus database with same CATH superfamily
4EM3A 1BKWA 3VRBA 1KSUA 2FBWA 1O95A 4GUVA 3HWIA 4OCGA 2JTSA 3AE8A 3ZDNA 5J60A 5KRQA 2JTRA 2C73A 2VSWA 2CULA 4BV6A 1H81A 1O94A 3GDPA 5BVAA 2H89A 2YG4A 1DXLA 4U8IA 3NTAA 2R4JA 1K0JA 4H4QA 3F4AA 1LQTA 4JDRA 3C4AA 5JCLA 4GAVA 3AEDA 1Q9IA 4GDEA 1F6MA 1S2QA 2WBAA 4NNJA 3GMCA 2GV8A 1H86A 4NWZA 1CC6A 1PS9A 2WOWA 5BRTA 1GXFA 2ORAA 3QFBA 3AYJA 4H4RA 5KVIA 4YTNA 3T2KA 1H83A 3F8RA 2GEWA 2RGHA 1EBDA 1Z6LA 2R0GA 4JY2A 1K4QA 3H8LA 1H4KX 3IPPA 3B3RA 1RP0A 2ACZA 4J33A 1ONFA 1NG3A 5JCKA 1E7PA 3FPZA 2KL3A 1QO8A 4RG3A 2R46A 3PVCA 1YQ4A 1GEUA 1X31B 4GRTA 1JRXA 2J3NA 2XLRA 4FX9A 2XVIA 2Q7VA 5KMSA 4YKGA 2WU2A 2JBVA 3AECA 2MOLA 2WLRA 3UTNX 5HPAA 4FK1A 1DJQA 5FS7A 1LPFA 1VDCA 4EQXA 3CTYA 4JGTA 4EIQA 1RYIA 4H2NA 4YXDA 1JNRA 1GRGA 4U8JA 4XWRA 4GR1A 4YT0A 2QA2A 4CY6A 1NPXA 4H7UA 2JTQA 2B9XA 2WP6A 2XVJA 3AWIA 1H82A 2YG7A 3RP6A 1EL9A 3NH3X 1CWTA 2FJAA 3GSIA 3NK0X 4ZCDA 3KA7A 1VQWA 3L8KA 1NDAA 2WPFA 4PAAA 1L0VA 2VOUA 4AP3A 2B9WA 4A5LA 3E1TA 1PXCA 4H4ZA 2DKIA 5M0ZA 3KLJA 1GESA 1NHRA 4U8MA 1K0IA 3DJGX 1OJ9A 3UCLA 2V3BA 1PXBA 2XFOA 1Q1RA 1XPQA 1GNDA 3AE4A 3CNPA 2Y6QA 2YLTA 5U1OA 4K22A 4XXGA 2XYOA 3DMEA 4Z2UA 4YTPA 4LIIA 4JQ9A 4EMWA 3EAOA 1YQZA 2RGOA 1OJCA 3BNUA 2R0PA 2B7RA 2BS2A 4H4XA 4K2XA 2O9ZA 5KOWA 3C96A 4X4JA 3IF9A 1IUVA 5KWFA 4TLZA 5HYMA 1D5TA 4OPCA 1QB0A 1T3KA 3NTDA 2X3NA 3RP7A 2YG5A 1ORBA 2Z5XA 3FS5A 3DK8A 1SEZA 3CMMA 4G6GA 4U8OA 1BF3A 2BK3A 4A6NB 3FBSA 2WOIA 4TM3A 3EF6A 4DNAA 3NNEA 3GYIA 3QVRA 2H88A 1ELIA 4H2PA 1LJ1A 3NN0X 4AP1A 2Q82A 2E1MA 3K30A 1GRBA 3UKPA 3MZZA 1GSNA 4EMJA 3UKFA 2BS3A 4U8PA 3H8IA 4BURA 1P2EA 2VRLA 2YWLA 1KFYA 2TPRA 3QJ4A 4BJYA 3CN8A 3AE7A 4CBQA 4WH7A 5GSNA 1IUSA 2X50A 3QSMA 1GMXA 3SZ0A 1ZMDA 3VRAA 3UOZA 2GR1A 3S5WA 2GAHB 1DOEA 4AT0A 3AE3A 2XDOA 4AOSA 4LA1A 1E1LA 3BHKA 3AD9B 3T31A 4M52A 3IC9A 5KOXA 1IUTA 1JRYA 3NRNA 2YLSA 3HZUA 2C70A 2C4CA 3SXIA 1DOBA 4K7ZA 2WP5A 1D4CA 5IQ1A 2FJBA 2MOIA 5IQ4A 2C7GA 2R9ZA 2WEUA 2XLSA 3ALMA 3DK4A 4EMIA 1YM9A 3NYFA 1N1PA 2FJDA 3ALLA 1CJCA 2E4GA 4PABA 4IVOB 5KMRA 2C3CA 4AOXA 2EQ8A 3UP4A 1BZLA 3P9UA 4U2SA 1URHA 2BC1A 3F8PA 2YM2A 3G5JA 1YMLA 4CNKA 3P3AA 3AE1A 1YS0A 3D1PA 1H7WA 1B4VA 1MO9A 4H4SA 4Y4NA 1TRBA 4U8NA 4J57A 1XHCA 5EBKA 3NK1X 2HQMA 2BACA 4Z2RA 2J6PA 4YSYA 2EG4A 1REOA 2B7SA 2QA1A 2YG6A 2F5ZA 1F3PA 4BK1A 2XLUA 1EL5A 1FL2A 4MJWA 3FLHA 3CGDA 3QSSA 2GQFA 3IWAA 3CNJA 4LU6A 2C65A 4CNJA 5JCMA 2AQJA 1JU2A 2CFYA 3CNDA 3T0KA 3GRTA 4H4WA 2OA1A 2R4EA 1ZKQA 1PBBA 4REKA 4B69A 4C74A 3NYEA 4J36A 4OPTA 4H4UA 1PBFA 2AAQA 2V6OA 2OAMA 2EG3A 4FDCB 1GALA 3S61A 5HBQA 1B5QA 1VG9A 3BHFA 4X9NA 1QLBA 1P2HA 5ER0A 4EM4A 1KNRA 3P1WA 2WDRA 1AOGA 4UDQA 4DSHA 3KD9A 1PHHA 3RHAA 2BK5A 3UKHA 2JAEA 4II3A 4U8LA 3M12A 3VQRA 2XLPA 3DA1A 1COYA 1H6VA 2BRAA 1F8WA 3CGBA 5FS8A 1RHSA 3D8XA 1E1MA 4IA5A 3ICSA 3RP8A 2VRMA 3SYIA 2UZZA 1PJ5A 4IA6A 1TYTA 1CL0A 1DODA 1TYPA 1S3EA 1NHQA 1O5WA 3I6DA 4EQRA 1C25A 4H2QA 5EB4A 1HYUA 1H7XA 3BI4A 3FIMB 3FOJA 1Y56B 3ABVA 4OPUA 4H4PA 3UTEA 4JNQA 3NT6A 1HZMA 3M0OA 4OPDA 3K7MX 3SGLA 1GT8A 4B1BA 4B64A 3NGCX 4HA6A 4NTCA 1DNCA 3TG3A 1V59A 3AEFA 2XVFA 2V61A 1PBEA 5HBPA 4KX6A 3QFAA 4A65A 2Y6RA 1D4EA 3ATQA 2IFVA 3UKAA 4G73A 1TDOA 4K5SA 3UKQA 4A99A 1GETA 1DP2A 1UARA 3M13A 2DCQA 4JN9A 2WPCA 5J7XA 1ZDLA 3ADAB 2W0HA 1BGNA 3IHGA 3R2UA 4BK3A 1NAAA 5KXJA 2A8XA 2C67A 2EQ9A 3HYWA 3SFDA 3NG7X 2YR6A 4CCRA 4A6NA 2A89A 1E1KA 1D7LA 1E6EA 1LQUA 3KKJA 4K5RA 3UOYA 4USQA 3T37A 3CIRA 3AEGA 3ISHA 5GRTA 1N4VA 1TDFA 1FEBA 3OC4A 3IPOA 1L9DA 1YKJA 3LB8A 1Y0PA 3VRDB 4I58A 3GDNA 1MXTA 3T2ZA 4EQWA 4A9WA 3AEBA 1TQ1A 3P4QA 3EANA 3HYXA 3C4NA 1GTHA 4B67A 2R0CA 3CPHG 4J34A 2ZZBA 2WDVA 3G5QA 3UTHA 4J56A 1CHUA 4D03A 1VRQB 2C64A 2A2KA 2X8CA 4H2RA 4OPIA 2R45A 2X99A 2Z5YA 4TM1A 2GMJA 3P4SA 1PJ7A 3UOXA 1YMKA 1EL7A 1MOKA 1GOSA 3NIXA 4D04A 2GAGB 3DJJA 1S3BA 4ICYA 1CWSA 2YVGA 3CPIG 4USRA 5DBJA 4Z2TA 5BUKA 1XANA 3ITJA 1PDHA 1GERA 1PJ6A 4II2A 2OLNA 3K9RA 2GRTA 2GR0A 2QCUA 1QJDA 2V60A 3BNMA 2V5ZA 3DH9A 1NENA 3WE0A 1OKGA 1GRFA 3AYIA 2YLXA 3GD4A 3SX6A 3CGEA 2WP9A 4EQSA 2WQYA 3G5SA 3QVPA 1CC2A 3SQPA 4NEVA 1YMDA 4O5QA 3DGZA 3FG2P 2XFNA 3AD8B 3HYVA 1CC4A 2V3AA 2XLTA 4P9SA 4A79A 1FEAA 3UTGA 5LAMA 4OPLA 1NHPA 3SM8A 1M6IA 2GH5A 3EPTA 4OPGA 3KPFA 2DKHA 2JB2A 2VQ7A 1E0CA 4RG4A 1KF6A 4B66A 3CPJG 3UKKA 1N4WA 3UP5A 1BGJA 3FNJA 1N4UA 3II4A 5CQFA 2JB1A 3KVEA 2GVCA 1CJ4A 2I0ZA 1CF3A 3LJPA 1WV9A 4NZHA 3RNMA 3AEAA 5C3JA 4Z26A 3AE9A 1PBCA 5KNLA 3P4RA 4WX1A 2WESA 2XFPA 2BRYA 2X8GA 3AE2A 3NLCA 1IUUA 5HHFA 1WHBA 4UDPA 3IWHA 2XVEA 2BXRA 3G5RA 1YY5A 1GTEA 1TDEA 4YKFA 2RABA 2B9YA 4YWOA 5EOWA 4U2TA 3GMBA 3ICTA 5LAOA 3UKLA 4FK1C 2GWFA 5EB5A 3GK5A 1IUXA 1LTXR 4IV9A 3SFEA 2BA9A 2WETA 1Q1WA 4J2WA 1FCDA 3LXDA 4B65A 3ICRA 4U2LA 2ARDA 3DJDA 3DK9A 1RHDA 2YLZA 4G74A 3O0HA 1YT8A 2YVJA 1S2YA 2B76A 4K8DA 4TM0A 3QSEA 2WS3A 5IPYA 5KMQA 4BJZA 1QXNA 4RSLA 1CJ2A 1NHSA 2GR3A 4H4YA 4A7AA 3TP9A 1JEHA 1BWCA 2VVLA 4G6HA 4C3YA 2PHHA 3OLHA 1GRHA 1PBDA 1D7YA 3LOVA 2NPXA 2Q0LA 4TLXA 4Z24A 3SY4A 1H4MX 2WU5A 1ZOYA 2YLWA 3B6DA 4BK2A 3KPKA 3GYXA 3Q6JA 4H4TA 3T14A 2HHGA 1H84A 3CNSA 3VR8A 3CGCA 2CDUA 4Z43A 4AT2A 3COXA 4Y4LA 2A87A 1JOAA 2XFUA 1DOCA 3HZLA 3AE5A 3R9UA 1ZY8A 2GMHA 2GQWA 2Q6UA 2YR4A 1KDGA 3NHOX 1PXAA 3P4PA 2WLXA 4TM4A 2BYBA 2BXSA 2WOVA 3ALJA 3PO7A 3VR9A 3AAYA 4YSHA 3HIXA 4EIPA 1BOIA 3K7TA 5JCNA 4F67A 3FMWA 3V3OA 5HBLA 5BULA 3H4KA 2GB0A 4JY3A 2C3DA 4NEWA 1ZX9A 4N9XA 2YG3A 2IVDA 4U8KA 1W4XA 3AB1A 5FS6A 4Z44A 1IUWA 4H4VA 5KMPA 2E5VA 1CBOA 4CY8A 5M10A 4B68A 4NTDA 2EG4B 3AE6A 5U63A 4E0VA 2ZZ0A 3TG1B 2YLRA 1F8SA 4Z25A 1E1NA 2VZ2A 2WDQA 4GAPA 2C75A 2BCPA 2WHDA 2JB3A 2BS4A 1TDKA 4ECHA 2YAUA 1DJNA 4X9MA 3T2YA 1VG0A 4WCTA 3AAXA 2EQ6A 4NTEA 3PS9A 1D4DA 1KSSA 1L9EA 3GWDA 4G9KA 1M64A 4YSZA 5KVHA 2FJEA 4GF7A 1ZK7A 2Q0KA 2FSXA 4UDRA 3ATRA 4O5UA 5TR3A 1NEKA 3UTFA 5JCIA 4DSGA 3GWFA 3REDA 1ZMCA 4HB9A 3SZCA 2GR2A 5LV9A 3GRSA 3JSKA 3GYJA 1ZOVA 2VQBA 3K7QX 4B63A 2C76A 3BI5A 4APNA 4XWZA 1L9CA 1UKVG 1GREA 3I3UA 1XDIA 5HXIA 5U25A 2IVEA 1FECA 4KPRA 1VEEA 4C5OA 2YM1A 3GD3A 1BOHA 2WPEA 2AR8A 2QAEA 3AXBA 2MRMA 3OP3A 3L1RA 3AD7B 3V3NA 4DGKA 1GN0A 1GRAA 3NHVA 4WH9A 4IVMB 1IJHA 5HY5A 1CWRA 4ADWA 1NG4A 2YVFA 3V76A 4CRTA 1OJTA 4ZN0A 3ZYXA 1KNPA 5FMHA 3SZWA 1CJ3A 1Y56A 1RSGA 2ZZCA 1GRTA 2BC0A 1EL8A 1B37A 3LZWA 3O3WA 3F8DA 2VVLG 2BK4A 3I2VA 1TDNA 2JK6A 3LZXA 4ZCCA 1B8SA 2X8HA 1JNZA 2IFDA 1F8RA 1LVLA 3DGHA 3D1CA 3Q9TA 2EQ7A 1GV4A 2IIDA 2NVKX 2OALA 3AYLA 3I3LA 2GF3A 4YTMA 5HBOA 4J31A 1YQ3A 5CKUA 4Y4MA 4UP3A 4C77A 3DJEA 1JRZA 2XVHA 2BABA 2XCGA 3NYCA 1K0LA 3AEEA 4CCQA 3LADA 2C66A 1GPEA 2VVMA 5FS9A 3CNTA 3NK2X 4GCMA 2YQUA 4H50A 1E39A 1OJAA 2K0ZA 2YR5A 5L46A 2JKCA 2OUCA 1PN0A 2ZBWA 3IHMA 3BI2A 1OJDA 4GDPA 3URHA 3NKSA 3OZ2A 2TMDA 3UOVA 3KU9A 1LV0A 3NN6X 2UZQA 4C3XA 2RGJA 2PYXA 2OLOA 1ZP0A 2XFQA 3SZFA 4JNAA 2BCGG 4I59A 4OVIA 1FOHA 2APGA 2C72A 4YSXA 5C2TA 3ILMA 2CVJA
chains in the Genus database with same CATH topology
4EM3A 1BKWA 3VRBA 1KSUA 2FBWA 1O95A 4GUVA 3HWIA 4OCGA 2JTSA 3AE8A 3ZDNA 5J60A 5KRQA 2JTRA 2C73A 2VSWA 2CULA 4BV6A 1H81A 1O94A 3GDPA 5BVAA 2H89A 2YG4A 1DXLA 4U8IA 3NTAA 2R4JA 1K0JA 4H4QA 3F4AA 1LQTA 4JDRA 3C4AA 5JCLA 4GAVA 3AEDA 1Q9IA 4GDEA 1F6MA 1S2QA 2WBAA 4NNJA 3GMCA 2GV8A 1H86A 4NWZA 1CC6A 1PS9A 2WOWA 5BRTA 1GXFA 2ORAA 3QFBA 3AYJA 4H4RA 5KVIA 4YTNA 3T2KA 1H83A 3F8RA 2GEWA 2RGHA 1EBDA 1Z6LA 2R0GA 4JY2A 1K4QA 3H8LA 1H4KX 3IPPA 3B3RA 1RP0A 2ACZA 4J33A 1ONFA 1NG3A 5JCKA 1E7PA 3FPZA 2KL3A 1QO8A 4RG3A 2R46A 3PVCA 1YQ4A 1GEUA 1X31B 4GRTA 1JRXA 2J3NA 2XLRA 4FX9A 2XVIA 2Q7VA 5KMSA 4YKGA 2WU2A 2JBVA 3AECA 2MOLA 2WLRA 3UTNX 5HPAA 4FK1A 1DJQA 5FS7A 1LPFA 1VDCA 4EQXA 3CTYA 4JGTA 4EIQA 1RYIA 4H2NA 4YXDA 1JNRA 1GRGA 4U8JA 4XWRA 4GR1A 4YT0A 2QA2A 4CY6A 1NPXA 4H7UA 2JTQA 2B9XA 2WP6A 2XVJA 3AWIA 1H82A 2YG7A 3RP6A 1EL9A 3NH3X 1CWTA 2FJAA 3GSIA 3NK0X 4ZCDA 3KA7A 1VQWA 3L8KA 1NDAA 2WPFA 4PAAA 1L0VA 2VOUA 4AP3A 2B9WA 4A5LA 3E1TA 1PXCA 4H4ZA 2DKIA 5M0ZA 3KLJA 1GESA 1NHRA 4U8MA 1K0IA 3DJGX 1OJ9A 3UCLA 2V3BA 1PXBA 2XFOA 1Q1RA 1XPQA 1GNDA 3AE4A 3CNPA 2Y6QA 2YLTA 5U1OA 4K22A 4XXGA 2XYOA 3DMEA 4Z2UA 4YTPA 4LIIA 4JQ9A 4EMWA 3EAOA 1YQZA 2RGOA 1OJCA 3BNUA 2R0PA 2B7RA 2BS2A 4H4XA 4K2XA 2O9ZA 5KOWA 3C96A 4X4JA 3IF9A 1IUVA 5KWFA 4TLZA 5HYMA 1D5TA 4OPCA 1QB0A 1T3KA 3NTDA 2X3NA 3RP7A 2YG5A 1ORBA 2Z5XA 3FS5A 3DK8A 1SEZA 3CMMA 4G6GA 4U8OA 1BF3A 2BK3A 4A6NB 3FBSA 2WOIA 4TM3A 3EF6A 4DNAA 3NNEA 3GYIA 3QVRA 2H88A 1ELIA 4H2PA 1LJ1A 3NN0X 4AP1A 2E1MA 3K30A 3UKPA 1GRBA 3MZZA 1GSNA 4EMJA 3UKFA 2BS3A 4U8PA 3H8IA 4BURA 1P2EA 2VRLA 2YWLA 1KFYA 2TPRA 3QJ4A 4BJYA 3CN8A 3AE7A 4CBQA 4WH7A 5GSNA 1IUSA 2X50A 3QSMA 1GMXA 3SZ0A 1ZMDA 3VRAA 3UOZA 2GR1A 3S5WA 2GAHB 1DOEA 4AT0A 3AE3A 2XDOA 4AOSA 4LA1A 1E1LA 3BHKA 3AD9B 3T31A 4M52A 3IC9A 5KOXA 1IUTA 1JRYA 3NRNA 2YLSA 3HZUA 2C70A 2C4CA 3SXIA 1DOBA 4K7ZA 2WP5A 1D4CA 5IQ1A 2FJBA 2MOIA 5IQ4A 2C7GA 2R9ZA 2WEUA 2XLSA 3ALMA 3DK4A 4EMIA 1YM9A 3NYFA 1N1PA 2FJDA 3ALLA 1CJCA 2E4GA 4PABA 4IVOB 5KMRA 2C3CA 4AOXA 2EQ8A 3UP4A 1BZLA 3P9UA 4U2SA 1URHA 2BC1A 3F8PA 2YM2A 3G5JA 1YMLA 4CNKA 3P3AA 3AE1A 1YS0A 3D1PA 1H7WA 1B4VA 1MO9A 4H4SA 4Y4NA 1TRBA 4U8NA 4J57A 1XHCA 5EBKA 3NK1X 2HQMA 2BACA 4Z2RA 2J6PA 4YSYA 2EG4A 1REOA 2B7SA 2QA1A 2YG6A 2F5ZA 1F3PA 4BK1A 2XLUA 1EL5A 1FL2A 4MJWA 3FLHA 3CGDA 3QSSA 2GQFA 3IWAA 3CNJA 4LU6A 2C65A 4CNJA 5JCMA 2AQJA 1JU2A 2CFYA 3CNDA 3T0KA 3GRTA 4H4WA 2OA1A 2R4EA 1ZKQA 1PBBA 4REKA 4B69A 4C74A 3NYEA 4J36A 4OPTA 4H4UA 1PBFA 2AAQA 2V6OA 2OAMA 2EG3A 4FDCB 1GALA 3S61A 5HBQA 1B5QA 1VG9A 3BHFA 4X9NA 1QLBA 1P2HA 5ER0A 4EM4A 1KNRA 3P1WA 2WDRA 1AOGA 4UDQA 4DSHA 3KD9A 1PHHA 3RHAA 2BK5A 3UKHA 2JAEA 4II3A 4U8LA 3M12A 3VQRA 2XLPA 3DA1A 1COYA 1H6VA 2BRAA 1F8WA 3CGBA 5FS8A 1RHSA 3D8XA 1E1MA 4IA5A 3ICSA 3RP8A 2VRMA 3SYIA 2UZZA 1PJ5A 4IA6A 1TYTA 1CL0A 1DODA 1TYPA 1S3EA 1NHQA 1O5WA 3I6DA 4EQRA 1C25A 4H2QA 5EB4A 1HYUA 1H7XA 3BI4A 3FIMB 3FOJA 1Y56B 3ABVA 4OPUA 4H4PA 3UTEA 4JNQA 3NT6A 1HZMA 3M0OA 4OPDA 3K7MX 3SGLA 1GT8A 4B1BA 4B64A 3NGCX 4HA6A 4NTCA 1DNCA 3TG3A 1V59A 3AEFA 2XVFA 2V61A 1PBEA 5HBPA 4KX6A 3QFAA 4A65A 2Y6RA 1D4EA 3ATQA 2IFVA 3UKAA 4G73A 1TDOA 4K5SA 3UKQA 4A99A 1GETA 1DP2A 1UARA 3M13A 2DCQA 4JN9A 2WPCA 5J7XA 1ZDLA 3ADAB 2W0HA 1BGNA 3IHGA 3R2UA 4BK3A 1NAAA 5KXJA 2A8XA 2C67A 2EQ9A 3HYWA 3SFDA 3NG7X 2YR6A 4CCRA 4A6NA 2A89A 1E1KA 1D7LA 1E6EA 1LQUA 3KKJA 4K5RA 3UOYA 4USQA 3T37A 3CIRA 3AEGA 3ISHA 5GRTA 1N4VA 1TDFA 1FEBA 3OC4A 3IPOA 1L9DA 1YKJA 3LB8A 1Y0PA 3VRDB 4I58A 3GDNA 1MXTA 3T2ZA 4EQWA 4A9WA 3AEBA 1TQ1A 3P4QA 3EANA 3HYXA 3C4NA 1GTHA 4B67A 2R0CA 3CPHG 4J34A 2ZZBA 2WDVA 3G5QA 3UTHA 4J56A 1CHUA 4D03A 1VRQB 2C64A 2A2KA 2X8CA 4H2RA 4OPIA 2R45A 2X99A 2Z5YA 4TM1A 2GMJA 3P4SA 1PJ7A 3UOXA 1YMKA 1EL7A 1MOKA 1GOSA 3NIXA 4D04A 2GAGB 3DJJA 1S3BA 4ICYA 1CWSA 2YVGA 3CPIG 4USRA 5DBJA 4Z2TA 5BUKA 1XANA 3ITJA 1PDHA 1GERA 1PJ6A 4II2A 2OLNA 3K9RA 2GRTA 2GR0A 2QCUA 1QJDA 2V60A 3BNMA 2V5ZA 3DH9A 1NENA 3WE0A 1OKGA 1GRFA 3AYIA 2YLXA 3GD4A 3SX6A 3CGEA 2WP9A 4EQSA 2WQYA 3G5SA 3QVPA 1CC2A 3SQPA 4NEVA 1YMDA 4O5QA 3DGZA 3FG2P 2XFNA 3AD8B 3HYVA 1CC4A 2V3AA 2XLTA 4P9SA 4A79A 1FEAA 3UTGA 5LAMA 4OPLA 1NHPA 3SM8A 1M6IA 2GH5A 3EPTA 4OPGA 3KPFA 2DKHA 2JB2A 2VQ7A 1E0CA 4RG4A 1KF6A 4B66A 3CPJG 3UKKA 1N4WA 3UP5A 1BGJA 3FNJA 1N4UA 3II4A 5CQFA 2JB1A 3KVEA 2GVCA 1CJ4A 2I0ZA 1CF3A 3LJPA 1WV9A 4NZHA 3RNMA 3AEAA 5C3JA 4Z26A 3AE9A 1PBCA 5KNLA 3P4RA 4WX1A 2WESA 2XFPA 2BRYA 2X8GA 3AE2A 3NLCA 1IUUA 5HHFA 1WHBA 4UDPA 3IWHA 2XVEA 2BXRA 3G5RA 1YY5A 1GTEA 1TDEA 4YKFA 2RABA 2B9YA 4YWOA 5EOWA 4U2TA 3GMBA 3ICTA 5LAOA 3UKLA 4FK1C 2GWFA 5EB5A 3GK5A 1IUXA 1LTXR 4IV9A 3SFEA 2BA9A 2WETA 1Q1WA 4J2WA 1FCDA 3LXDA 4B65A 3ICRA 4U2LA 2ARDA 3DJDA 3DK9A 1RHDA 2YLZA 4G74A 3O0HA 1YT8A 2YVJA 1S2YA 2B76A 4K8DA 4TM0A 3QSEA 2WS3A 5IPYA 5KMQA 4BJZA 1QXNA 4RSLA 1CJ2A 1NHSA 2GR3A 4H4YA 4A7AA 3TP9A 1JEHA 1BWCA 2VVLA 4G6HA 4C3YA 2PHHA 3OLHA 1GRHA 1PBDA 1D7YA 3LOVA 2NPXA 2Q0LA 4TLXA 4Z24A 3SY4A 1H4MX 2WU5A 1ZOYA 2YLWA 3B6DA 4BK2A 3KPKA 3GYXA 3Q6JA 4H4TA 3T14A 2HHGA 1H84A 3CNSA 3VR8A 3CGCA 2CDUA 4Z43A 4AT2A 3COXA 4Y4LA 2A87A 1JOAA 2XFUA 1DOCA 3HZLA 3AE5A 3R9UA 1ZY8A 2GMHA 2GQWA 2Q6UA 2YR4A 1KDGA 3NHOX 1PXAA 3P4PA 2WLXA 4TM4A 2BYBA 2BXSA 2WOVA 3ALJA 3PO7A 3VR9A 3AAYA 4YSHA 3HIXA 4EIPA 1BOIA 3K7TA 5JCNA 4F67A 3FMWA 3V3OA 5HBLA 5BULA 3H4KA 2GB0A 4JY3A 2C3DA 4NEWA 1ZX9A 4N9XA 2YG3A 2IVDA 4U8KA 1W4XA 3AB1A 5FS6A 4Z44A 1IUWA 4H4VA 5KMPA 2E5VA 1CBOA 4CY8A 5M10A 4B68A 4NTDA 2EG4B 3AE6A 5U63A 4E0VA 2ZZ0A 3TG1B 2YLRA 1F8SA 4Z25A 1E1NA 2VZ2A 2WDQA 4GAPA 2C75A 2BCPA 2WHDA 2JB3A 2BS4A 1TDKA 4ECHA 2YAUA 1DJNA 4X9MA 3T2YA 1VG0A 4WCTA 3AAXA 2EQ6A 4NTEA 3PS9A 1D4DA 1KSSA 1L9EA 3GWDA 4G9KA 1M64A 4YSZA 5KVHA 2FJEA 4GF7A 1ZK7A 2Q0KA 2FSXA 4UDRA 3ATRA 4O5UA 5TR3A 1NEKA 3UTFA 5JCIA 4DSGA 3GWFA 3REDA 1ZMCA 4HB9A 3SZCA 2GR2A 5LV9A 3GRSA 3JSKA 3GYJA 1ZOVA 2VQBA 3K7QX 4B63A 2C76A 3BI5A 4APNA 4XWZA 1L9CA 1UKVG 1GREA 3I3UA 1XDIA 5HXIA 5U25A 2IVEA 1FECA 4KPRA 1VEEA 4C5OA 2YM1A 3GD3A 1BOHA 2WPEA 2AR8A 2QAEA 3AXBA 2MRMA 3OP3A 3L1RA 3AD7B 3V3NA 4DGKA 1GN0A 1GRAA 3NHVA 4WH9A 4IVMB 1IJHA 5HY5A 1CWRA 4ADWA 1NG4A 2YVFA 3V76A 4CRTA 1OJTA 4ZN0A 3ZYXA 1KNPA 5FMHA 3SZWA 1CJ3A 1Y56A 1RSGA 2ZZCA 1GRTA 2BC0A 1EL8A 1B37A 3LZWA 3O3WA 3F8DA 2VVLG 2BK4A 3I2VA 1TDNA 2JK6A 3LZXA 4ZCCA 1B8SA 2X8HA 1JNZA 2IFDA 1F8RA 1LVLA 3DGHA 3D1CA 3Q9TA 2EQ7A 1GV4A 2IIDA 2NVKX 2OALA 3AYLA 3I3LA 2GF3A 4YTMA 5HBOA 4J31A 1YQ3A 5CKUA 4Y4MA 4UP3A 4C77A 3DJEA 1JRZA 2XVHA 2BABA 2XCGA 3NYCA 1K0LA 3AEEA 4CCQA 3LADA 2C66A 1GPEA 2VVMA 5FS9A 3CNTA 3NK2X 4GCMA 2YQUA 4H50A 1E39A 1OJAA 2K0ZA 2YR5A 5L46A 2JKCA 2OUCA 1PN0A 2ZBWA 3IHMA 3BI2A 1OJDA 4GDPA 3URHA 3NKSA 3OZ2A 2TMDA 3UOVA 3KU9A 1LV0A 3NN6X 2UZQA 4C3XA 2RGJA 2PYXA 2OLOA 1ZP0A 2XFQA 3SZFA 4JNAA 2BCGG 4I59A 4OVIA 1FOHA 2APGA 2C72A 4YSXA 5C2TA 3ILMA 2CVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM3 A;  1BKW A;  3VRB A;  1KSU A;  2FBW A;  1O95 A;  4GUV A;  3HWI A;  4OCG A;  2JTS A;  3AE8 A;  3ZDN A;  5J60 A;  5KRQ A;  2JTR A;  2C73 A;  2VSW A;  2CUL A;  4BV6 A;  1H81 A;  1O94 A;  3GDP A;  5BVA A;  2H89 A;  2YG4 A;  1DXL A;  4U8I A;  3NTA A;  2R4J A;  1K0J A;  4H4Q A;  3F4A A;  1LQT A;  4JDR A;  3C4A A;  5JCL A;  3AED A;  1Q9I A;  4GDE A;  1F6M A;  1S2Q A;  2WBA A;  3GMC A;  2GV8 A;  1H86 A;  5BRT A;  1CC6 A;  1PS9 A;  2WOW A;  1GXF A;  2ORA A;  3QFB A;  3AYJ A;  4H4R A;  5KVI A;  4YTN A;  1H83 A;  3F8R A;  2GEW A;  2RGH A;  1EBD A;  1Z6L A;  2R0G A;  4JY2 A;  1K4Q A;  3H8L A;  1H4K X;  3IPP A;  3B3R A;  1RP0 A;  2ACZ A;  4J33 A;  1ONF A;  1NG3 A;  5JCK A;  1E7P A;  3FPZ A;  2KL3 A;  1QO8 A;  4RG3 A;  2R46 A;  3PVC A;  1YQ4 A;  1GEU A;  1X31 B;  4GRT A;  1JRX A;  2J3N A;  2XLR A;  4FX9 A;  2XVI A;  2Q7V A;  4YKG A;  2WU2 A;  2JBV A;  3AEC A;  2MOL A;  2WLR A;  3UTN X;  5HPA A;  4FK1 A;  1DJQ A;  5FS7 A;  1LPF A;  1VDC A;  4EQX A;  3CTY A;  4JGT A;  4EIQ A;  1RYI A;  4H2N A;  4YXD A;  1JNR A;  1GRG A;  4U8J A;  4XWR A;  4GR1 A;  4YT0 A;  2QA2 A;  4CY6 A;  1NPX A;  4H7U A;  2JTQ A;  2B9X A;  2WP6 A;  2XVJ A;  3AWI A;  1H82 A;  2YG7 A;  3RP6 A;  1EL9 A;  3NH3 X;  1CWT A;  2FJA A;  3GSI A;  3NK0 X;  4ZCD A;  3KA7 A;  1VQW A;  3L8K A;  1NDA A;  2WPF A;  4PAA A;  1L0V A;  2VOU A;  4AP3 A;  2B9W A;  4A5L A;  3E1T A;  1PXC A;  4H4Z A;  2DKI A;  5M0Z A;  3KLJ A;  1GES A;  1NHR A;  4U8M A;  1K0I A;  3DJG X;  1OJ9 A;  3UCL A;  2V3B A;  1PXB A;  2XFO A;  1Q1R A;  1XPQ A;  1GND A;  3AE4 A;  3CNP A;  2Y6Q A;  2YLT A;  5U1O A;  4K22 A;  4XXG A;  2XYO A;  3DME A;  4Z2U A;  4YTP A;  4LII A;  4JQ9 A;  4EMW A;  3EAO A;  1YQZ A;  2RGO A;  1OJC A;  3BNU A;  2R0P A;  2B7R A;  2BS2 A;  4H4X A;  4K2X A;  2O9Z A;  5KOW A;  3C96 A;  4X4J A;  3IF9 A;  1IUV A;  5KWF A;  4TLZ A;  5HYM A;  1D5T A;  4OPC A;  1QB0 A;  1T3K A;  3NTD A;  2X3N A;  3RP7 A;  2YG5 A;  1ORB A;  2Z5X A;  3FS5 A;  3DK8 A;  1SEZ A;  4A6N B;  4U8O A;  1BF3 A;  2BK3 A;  3FBS A;  2WOI A;  4TM3 A;  3EF6 A;  4DNA A;  3NNE A;  3GYI A;  3QVR A;  2H88 A;  1ELI A;  4H2P A;  1LJ1 A;  3NN0 X;  4AP1 A;  2E1M A;  3K30 A;  3UKP A;  1GRB A;  3MZZ A;  1GSN A;  4EMJ A;  3UKF A;  2BS3 A;  4U8P A;  3H8I A;  4BUR A;  1P2E A;  2VRL A;  2YWL A;  1KFY A;  2TPR A;  3QJ4 A;  4BJY A;  3CN8 A;  3AE7 A;  4CBQ A;  4WH7 A;  5GSN A;  1IUS A;  2X50 A;  3QSM A;  1GMX A;  1ZMD A;  3VRA A;  3UOZ A;  2GR1 A;  3S5W A;  2GAH B;  1DOE A;  4AT0 A;  3AE3 A;  2XDO A;  4AOS A;  4LA1 A;  1E1L A;  3BHK A;  3AD9 B;  4M52 A;  3IC9 A;  5KOX A;  1IUT A;  1JRY A;  3NRN A;  2YLS A;  3HZU A;  2C70 A;  1DOB A;  4K7Z A;  2WP5 A;  1D4C A;  5IQ1 A;  2FJB A;  2MOI A;  5IQ4 A;  2C7G A;  2R9Z A;  2WEU A;  2XLS A;  3ALM A;  3DK4 A;  4EMI A;  1YM9 A;  3NYF A;  1N1P A;  2FJD A;  3ALL A;  1CJC A;  2E4G A;  4PAB A;  4IVO B;  2C3C A;  4AOX A;  2EQ8 A;  3UP4 A;  1BZL A;  3P9U A;  4U2S A;  1URH A;  2BC1 A;  3F8P A;  2YM2 A;  3G5J A;  1YML A;  4CNK A;  3P3A A;  3AE1 A;  1YS0 A;  3D1P A;  1H7W A;  1B4V A;  1MO9 A;  4H4S A;  4Y4N A;  1TRB A;  4U8N A;  4J57 A;  1XHC A;  5EBK A;  3NK1 X;  2HQM A;  2BAC A;  4Z2R A;  2J6P A;  4YSY A;  2EG4 A;  1REO A;  2B7S A;  2QA1 A;  2YG6 A;  2F5Z A;  1F3P A;  4BK1 A;  2XLU A;  1EL5 A;  1FL2 A;  4MJW A;  3FLH A;  3CGD A;  3QSS A;  2GQF A;  3IWA A;  3CNJ A;  4LU6 A;  2C65 A;  4CNJ A;  5JCM A;  2AQJ A;  1JU2 A;  2CFY A;  3CND A;  3GRT A;  4H4W A;  2OA1 A;  2R4E A;  1ZKQ A;  1PBB A;  4REK A;  4B69 A;  4C74 A;  3NYE A;  4J36 A;  4OPT A;  4H4U A;  1PBF A;  2AAQ A;  2V6O A;  2OAM A;  2EG3 A;  4FDC B;  1GAL A;  3S61 A;  5HBQ A;  1B5Q A;  1VG9 A;  3BHF A;  4X9N A;  1QLB A;  1P2H A;  5ER0 A;  4EM4 A;  1KNR A;  3P1W A;  2WDR A;  1AOG A;  4UDQ A;  4DSH A;  3KD9 A;  1PHH A;  3RHA A;  2BK5 A;  3UKH A;  2JAE A;  4U8L A;  3M12 A;  3VQR A;  2XLP A;  3DA1 A;  1COY A;  1H6V A;  1F8W A;  3CGB A;  5FS8 A;  1RHS A;  3D8X A;  1E1M A;  4IA5 A;  3ICS A;  3RP8 A;  2VRM A;  2UZZ A;  1PJ5 A;  4IA6 A;  1TYT A;  1CL0 A;  1DOD A;  1TYP A;  1S3E A;  1NHQ A;  1O5W A;  3I6D A;  4EQR A;  1C25 A;  4H2Q A;  5EB4 A;  1HYU A;  1H7X A;  3BI4 A;  3FIM B;  3FOJ A;  1Y56 B;  3ABV A;  4OPU A;  4H4P A;  3UTE A;  4JNQ A;  3NT6 A;  1HZM A;  3M0O A;  4OPD A;  3K7M X;  3SGL A;  1GT8 A;  4B1B A;  4B64 A;  3NGC X;  4HA6 A;  4NTC A;  1DNC A;  3TG3 A;  1V59 A;  3AEF A;  2XVF A;  2V61 A;  1PBE A;  5HBP A;  4KX6 A;  3QFA A;  4A65 A;  2Y6R A;  1D4E A;  3ATQ A;  2IFV A;  3UKA A;  1TDO A;  4K5S A;  3UKQ A;  4A99 A;  1GET A;  1DP2 A;  1UAR A;  3M13 A;  2DCQ A;  4JN9 A;  2WPC A;  5J7X A;  1ZDL A;  3ADA B;  2W0H A;  1BGN A;  3IHG A;  3R2U A;  4BK3 A;  1NAA A;  5KXJ A;  2A8X A;  2C67 A;  2EQ9 A;  3SFD A;  3NG7 X;  2YR6 A;  4CCR A;  4A6N A;  2A89 A;  1E1K A;  1D7L A;  1E6E A;  1LQU A;  3KKJ A;  4K5R A;  3UOY A;  4USQ A;  3T37 A;  3CIR A;  3AEG A;  3ISH A;  5GRT A;  1N4V A;  1TDF A;  1FEB A;  3OC4 A;  3IPO A;  1L9D A;  1YKJ A;  3LB8 A;  1Y0P A;  3VRD B;  4I58 A;  3GDN A;  1MXT A;  4EQW A;  4A9W A;  3AEB A;  1TQ1 A;  3P4Q A;  3EAN A;  3C4N A;  1GTH A;  4B67 A;  2R0C A;  3CPH G;  4J34 A;  2ZZB A;  2WDV A;  3G5Q A;  3UTH A;  4J56 A;  1CHU A;  4D03 A;  1VRQ B;  2C64 A;  2A2K A;  2X8C A;  4H2R A;  4OPI A;  2R45 A;  2X99 A;  2Z5Y A;  4TM1 A;  2GMJ A;  3P4S A;  1PJ7 A;  3UOX A;  1YMK A;  1EL7 A;  1MOK A;  1GOS A;  3NIX A;  4D04 A;  2GAG B;  3DJJ A;  1S3B A;  4ICY A;  1CWS A;  2YVG A;  3CPI G;  4USR A;  5DBJ A;  4Z2T A;  5BUK A;  1XAN A;  3ITJ A;  1PDH A;  1GER A;  1PJ6 A;  2OLN A;  3K9R A;  2GRT A;  2GR0 A;  2QCU A;  1QJD A;  2V60 A;  3BNM A;  2V5Z A;  3DH9 A;  1NEN A;  3WE0 A;  1OKG A;  1GRF A;  3AYI A;  2YLX A;  3GD4 A;  3CGE A;  2WP9 A;  4EQS A;  2WQY A;  3G5S A;  3QVP A;  1CC2 A;  3SQP A;  4NEV A;  1YMD A;  4O5Q A;  3DGZ A;  3FG2 P;  2XFN A;  3AD8 B;  1CC4 A;  2V3A A;  2XLT A;  4P9S A;  4A79 A;  1FEA A;  3UTG A;  5LAM A;  4OPL A;  1NHP A;  3SM8 A;  1M6I A;  2GH5 A;  3EPT A;  4OPG A;  3KPF A;  2DKH A;  2JB2 A;  2VQ7 A;  1E0C A;  4RG4 A;  1KF6 A;  4B66 A;  3CPJ G;  3UKK A;  1N4W A;  3UP5 A;  1BGJ A;  3FNJ A;  1N4U A;  3II4 A;  5CQF A;  2JB1 A;  3KVE A;  2GVC A;  1CJ4 A;  2I0Z A;  1CF3 A;  3LJP A;  1WV9 A;  4NZH A;  3RNM A;  3AEA A;  5C3J A;  4Z26 A;  3AE9 A;  1PBC A;  3P4R A;  4WX1 A;  2WES A;  2XFP A;  2X8G A;  3AE2 A;  3NLC A;  1IUU A;  5HHF A;  1WHB A;  4UDP A;  3IWH A;  2XVE A;  2BXR A;  3G5R A;  1YY5 A;  1GTE A;  1TDE A;  4YKF A;  2RAB A;  2B9Y A;  4YWO A;  5EOW A;  4U2T A;  3GMB A;  3ICT A;  5LAO A;  3UKL A;  4FK1 C;  2GWF A;  5EB5 A;  3GK5 A;  1IUX A;  1LTX R;  4IV9 A;  3SFE A;  2BA9 A;  2WET A;  1Q1W A;  4J2W A;  1FCD A;  3LXD A;  4B65 A;  3ICR A;  4U2L A;  2ARD A;  3DJD A;  3DK9 A;  1RHD A;  2YLZ A;  3O0H A;  1YT8 A;  2YVJ A;  1S2Y A;  2B76 A;  4K8D A;  4TM0 A;  3QSE A;  2WS3 A;  5IPY A;  4BJZ A;  1QXN A;  4RSL A;  1CJ2 A;  1NHS A;  2GR3 A;  4H4Y A;  4A7A A;  3TP9 A;  1JEH A;  1BWC A;  2VVL A;  4C3Y A;  2PHH A;  3OLH A;  1GRH A;  1PBD A;  1D7Y A;  3LOV A;  2NPX A;  2Q0L A;  4TLX A;  4Z24 A;  3VR9 A;  1H4M X;  2WU5 A;  1ZOY A;  2YLW A;  3B6D A;  4BK2 A;  3Q6J A;  4H4T A;  3VR8 A;  2HHG A;  1H84 A;  3CNS A;  4Z43 A;  3CGC A;  2CDU A;  4AT2 A;  3COX A;  4Y4L A;  2A87 A;  1JOA A;  2XFU A;  1DOC A;  3HZL A;  3AE5 A;  3R9U A;  1ZY8 A;  2GMH A;  2GQW A;  2Q6U A;  2YR4 A;  1KDG A;  3NHO X;  1PXA A;  3P4P A;  2WLX A;  4TM4 A;  2BYB A;  2BXS A;  2WOV A;  3ALJ A;  3PO7 A;  3AAY A;  4YSH A;  3HIX A;  4EIP A;  1BOI A;  3K7T A;  5JCN A;  4F67 A;  3FMW A;  3V3O A;  5HBL A;  5BUL A;  3H4K A;  2GB0 A;  4JY3 A;  2C3D A;  4NEW A;  1ZX9 A;  4N9X A;  2YG3 A;  2IVD A;  4U8K A;  1W4X A;  3AB1 A;  5FS6 A;  4Z44 A;  1IUW A;  4H4V A;  2E5V A;  1CBO A;  4CY8 A;  5M10 A;  4B68 A;  4NTD A;  2EG4 B;  3AE6 A;  5U63 A;  4E0V A;  2ZZ0 A;  3TG1 B;  2YLR A;  1F8S A;  4Z25 A;  1E1N A;  2VZ2 A;  2WDQ A;  2C75 A;  2BCP A;  2WHD A;  2JB3 A;  2BS4 A;  1TDK A;  4ECH A;  2YAU A;  1DJN A;  4X9M A;  1VG0 A;  4WCT A;  3AAX A;  2EQ6 A;  4NTE A;  3PS9 A;  1D4D A;  1KSS A;  1L9E A;  3GWD A;  4YSZ A;  1M64 A;  5KVH A;  2FJE A;  4GF7 A;  1ZK7 A;  2Q0K A;  2FSX A;  4UDR A;  3ATR A;  4O5U A;  5TR3 A;  1NEK A;  3UTF A;  5JCI A;  4DSG A;  3GWF A;  3RED A;  1ZMC A;  4HB9 A;  2GR2 A;  5LV9 A;  3GRS A;  3JSK A;  3GYJ A;  1ZOV A;  2VQB A;  3K7Q X;  4B63 A;  2C76 A;  3BI5 A;  4APN A;  4XWZ A;  1L9C A;  1UKV G;  1GRE A;  3I3U A;  1XDI A;  5HXI A;  5U25 A;  2IVE A;  1FEC A;  4KPR A;  1VEE A;  4C5O A;  2YM1 A;  3GD3 A;  1BOH A;  2WPE A;  2AR8 A;  2QAE A;  3AXB A;  2MRM A;  3OP3 A;  3L1R A;  3AD7 B;  3V3N A;  4DGK A;  1GN0 A;  1GRA A;  3NHV A;  4WH9 A;  4IVM B;  1IJH A;  5HY5 A;  1CWR A;  4ADW A;  1NG4 A;  2YVF A;  3V76 A;  4CRT A;  1OJT A;  4ZN0 A;  3ZYX A;  1KNP A;  5FMH A;  1CJ3 A;  1Y56 A;  1RSG A;  2ZZC A;  1GRT A;  2BC0 A;  1EL8 A;  1B37 A;  3LZW A;  3O3W A;  3F8D A;  2VVL G;  2BK4 A;  3I2V A;  1TDN A;  2JK6 A;  3LZX A;  4ZCC A;  1B8S A;  2X8H A;  1JNZ A;  2IFD A;  1F8R A;  1LVL A;  3DGH A;  3D1C A;  3Q9T A;  2EQ7 A;  1GV4 A;  2IID A;  2NVK X;  2OAL A;  3AYL A;  3I3L A;  2GF3 A;  4YTM A;  5HBO A;  4J31 A;  1YQ3 A;  5CKU A;  4Y4M A;  4UP3 A;  4C77 A;  3DJE A;  1JRZ A;  2XVH A;  2BAB A;  2XCG A;  3NYC A;  1K0L A;  3AEE A;  4CCQ A;  3LAD A;  2C66 A;  1GPE A;  2VVM A;  5FS9 A;  3CNT A;  3NK2 X;  4GCM A;  2YQU A;  4H50 A;  1E39 A;  1OJA A;  2K0Z A;  2YR5 A;  5L46 A;  2JKC A;  2OUC A;  1PN0 A;  2ZBW A;  3IHM A;  3BI2 A;  1OJD A;  4GDP A;  3URH A;  3NKS A;  3OZ2 A;  2TMD A;  3UOV A;  3KU9 A;  1LV0 A;  3NN6 X;  2UZQ A;  4C3X A;  2RGJ A;  2PYX A;  2OLO A;  1ZP0 A;  2XFQ A;  4JNA A;  2BCG G;  4I59 A;  4OVI A;  1FOH A;  2APG A;  2C72 A;  4YSX A;  5C2T A;  3ILM A;  2CVJ A; 
#chains in the Genus database with same CATH topology
 4EM3 A;  1BKW A;  3VRB A;  1KSU A;  2FBW A;  1O95 A;  4GUV A;  3HWI A;  4OCG A;  2JTS A;  3AE8 A;  3ZDN A;  5J60 A;  5KRQ A;  2JTR A;  2C73 A;  2VSW A;  2CUL A;  4BV6 A;  1H81 A;  1O94 A;  3GDP A;  5BVA A;  2H89 A;  2YG4 A;  1DXL A;  4U8I A;  3NTA A;  2R4J A;  1K0J A;  4H4Q A;  3F4A A;  1LQT A;  4JDR A;  3C4A A;  5JCL A;  4GAV A;  3AED A;  1Q9I A;  4GDE A;  1F6M A;  1S2Q A;  2WBA A;  4NNJ A;  3GMC A;  2GV8 A;  1H86 A;  4NWZ A;  1CC6 A;  1PS9 A;  2WOW A;  5BRT A;  1GXF A;  2ORA A;  3QFB A;  3AYJ A;  4H4R A;  5KVI A;  4YTN A;  3T2K A;  1H83 A;  3F8R A;  2GEW A;  2RGH A;  1EBD A;  1Z6L A;  2R0G A;  4JY2 A;  1K4Q A;  3H8L A;  1H4K X;  3IPP A;  3B3R A;  1RP0 A;  2ACZ A;  4J33 A;  1ONF A;  1NG3 A;  5JCK A;  1E7P A;  3FPZ A;  2KL3 A;  1QO8 A;  4RG3 A;  2R46 A;  3PVC A;  1YQ4 A;  1GEU A;  1X31 B;  4GRT A;  1JRX A;  2J3N A;  2XLR A;  4FX9 A;  2XVI A;  2Q7V A;  5KMS A;  4YKG A;  2WU2 A;  2JBV A;  3AEC A;  2MOL A;  2WLR A;  3UTN X;  5HPA A;  4FK1 A;  1DJQ A;  5FS7 A;  1LPF A;  1VDC A;  4EQX A;  3CTY A;  4JGT A;  4EIQ A;  1RYI A;  4H2N A;  4YXD A;  1JNR A;  1GRG A;  4U8J A;  4XWR A;  4GR1 A;  4YT0 A;  2QA2 A;  4CY6 A;  1NPX A;  4H7U A;  2JTQ A;  2B9X A;  2WP6 A;  2XVJ A;  3AWI A;  1H82 A;  2YG7 A;  3RP6 A;  1EL9 A;  3NH3 X;  1CWT A;  2FJA A;  3GSI A;  3NK0 X;  4ZCD A;  3KA7 A;  1VQW A;  3L8K A;  1NDA A;  2WPF A;  4PAA A;  1L0V A;  2VOU A;  4AP3 A;  2B9W A;  4A5L A;  3E1T A;  1PXC A;  4H4Z A;  2DKI A;  5M0Z A;  3KLJ A;  1GES A;  1NHR A;  4U8M A;  1K0I A;  3DJG X;  1OJ9 A;  3UCL A;  2V3B A;  1PXB A;  2XFO A;  1Q1R A;  1XPQ A;  1GND A;  3AE4 A;  3CNP A;  2Y6Q A;  2YLT A;  5U1O A;  4K22 A;  4XXG A;  2XYO A;  3DME A;  4Z2U A;  4YTP A;  4LII A;  4JQ9 A;  4EMW A;  3EAO A;  1YQZ A;  2RGO A;  1OJC A;  3BNU A;  2R0P A;  2B7R A;  2BS2 A;  4H4X A;  4K2X A;  2O9Z A;  5KOW A;  3C96 A;  4X4J A;  3IF9 A;  1IUV A;  5KWF A;  4TLZ A;  5HYM A;  1D5T A;  4OPC A;  1QB0 A;  1T3K A;  3NTD A;  2X3N A;  3RP7 A;  2YG5 A;  1ORB A;  2Z5X A;  3FS5 A;  3DK8 A;  1SEZ A;  3CMM A;  4G6G A;  4U8O A;  1BF3 A;  2BK3 A;  4A6N B;  3FBS A;  2WOI A;  4TM3 A;  3EF6 A;  4DNA A;  3NNE A;  3GYI A;  3QVR A;  2H88 A;  1ELI A;  4H2P A;  1LJ1 A;  3NN0 X;  4AP1 A;  2Q82 A;  2E1M A;  3K30 A;  1GRB A;  3UKP A;  3MZZ A;  1GSN A;  4EMJ A;  3UKF A;  2BS3 A;  4U8P A;  3H8I A;  4BUR A;  1P2E A;  2VRL A;  2YWL A;  1KFY A;  2TPR A;  3QJ4 A;  4BJY A;  3CN8 A;  3AE7 A;  4CBQ A;  4WH7 A;  5GSN A;  1IUS A;  2X50 A;  3QSM A;  1GMX A;  3SZ0 A;  1ZMD A;  3VRA A;  3UOZ A;  2GR1 A;  3S5W A;  2GAH B;  1DOE A;  4AT0 A;  3AE3 A;  2XDO A;  4AOS A;  4LA1 A;  1E1L A;  3BHK A;  3AD9 B;  3T31 A;  4M52 A;  3IC9 A;  5KOX A;  1IUT A;  1JRY A;  3NRN A;  2YLS A;  3HZU A;  2C70 A;  2C4C A;  3SXI A;  1DOB A;  4K7Z A;  2WP5 A;  1D4C A;  5IQ1 A;  2FJB A;  2MOI A;  5IQ4 A;  2C7G A;  2R9Z A;  2WEU A;  2XLS A;  3ALM A;  3DK4 A;  4EMI A;  1YM9 A;  3NYF A;  1N1P A;  2FJD A;  3ALL A;  1CJC A;  2E4G A;  4PAB A;  4IVO B;  5KMR A;  2C3C A;  4AOX A;  2EQ8 A;  3UP4 A;  1BZL A;  3P9U A;  4U2S A;  1URH A;  2BC1 A;  3F8P A;  2YM2 A;  3G5J A;  1YML A;  4CNK A;  3P3A A;  3AE1 A;  1YS0 A;  3D1P A;  1H7W A;  1B4V A;  1MO9 A;  4H4S A;  4Y4N A;  1TRB A;  4U8N A;  4J57 A;  1XHC A;  5EBK A;  3NK1 X;  2HQM A;  2BAC A;  4Z2R A;  2J6P A;  4YSY A;  2EG4 A;  1REO A;  2B7S A;  2QA1 A;  2YG6 A;  2F5Z A;  1F3P A;  4BK1 A;  2XLU A;  1EL5 A;  1FL2 A;  4MJW A;  3FLH A;  3CGD A;  3QSS A;  2GQF A;  3IWA A;  3CNJ A;  4LU6 A;  2C65 A;  4CNJ A;  5JCM A;  2AQJ A;  1JU2 A;  2CFY A;  3CND A;  3T0K A;  3GRT A;  4H4W A;  2OA1 A;  2R4E A;  1ZKQ A;  1PBB A;  4REK A;  4B69 A;  4C74 A;  3NYE A;  4J36 A;  4OPT A;  4H4U A;  1PBF A;  2AAQ A;  2V6O A;  2OAM A;  2EG3 A;  4FDC B;  1GAL A;  3S61 A;  5HBQ A;  1B5Q A;  1VG9 A;  3BHF A;  4X9N A;  1QLB A;  1P2H A;  5ER0 A;  4EM4 A;  1KNR A;  3P1W A;  2WDR A;  1AOG A;  4UDQ A;  4DSH A;  3KD9 A;  1PHH A;  3RHA A;  2BK5 A;  3UKH A;  2JAE A;  4II3 A;  4U8L A;  3M12 A;  3VQR A;  2XLP A;  3DA1 A;  1COY A;  1H6V A;  2BRA A;  1F8W A;  3CGB A;  5FS8 A;  1RHS A;  3D8X A;  1E1M A;  4IA5 A;  3ICS A;  3RP8 A;  2VRM A;  3SYI A;  2UZZ A;  1PJ5 A;  4IA6 A;  1TYT A;  1CL0 A;  1DOD A;  1TYP A;  1S3E A;  1NHQ A;  1O5W A;  3I6D A;  4EQR A;  1C25 A;  4H2Q A;  5EB4 A;  1HYU A;  1H7X A;  3BI4 A;  3FIM B;  3FOJ A;  1Y56 B;  3ABV A;  4OPU A;  4H4P A;  3UTE A;  4JNQ A;  3NT6 A;  1HZM A;  3M0O A;  4OPD A;  3K7M X;  3SGL A;  1GT8 A;  4B1B A;  4B64 A;  3NGC X;  4HA6 A;  4NTC A;  1DNC A;  3TG3 A;  1V59 A;  3AEF A;  2XVF A;  2V61 A;  1PBE A;  5HBP A;  4KX6 A;  3QFA A;  4A65 A;  2Y6R A;  1D4E A;  3ATQ A;  2IFV A;  3UKA A;  4G73 A;  1TDO A;  4K5S A;  3UKQ A;  4A99 A;  1GET A;  1DP2 A;  1UAR A;  3M13 A;  2DCQ A;  4JN9 A;  2WPC A;  5J7X A;  1ZDL A;  3ADA B;  2W0H A;  1BGN A;  3IHG A;  3R2U A;  4BK3 A;  1NAA A;  5KXJ A;  2A8X A;  2C67 A;  2EQ9 A;  3HYW A;  3SFD A;  3NG7 X;  2YR6 A;  4CCR A;  4A6N A;  2A89 A;  1E1K A;  1D7L A;  1E6E A;  1LQU A;  3KKJ A;  4K5R A;  3UOY A;  4USQ A;  3T37 A;  3CIR A;  3AEG A;  3ISH A;  5GRT A;  1N4V A;  1TDF A;  1FEB A;  3OC4 A;  3IPO A;  1L9D A;  1YKJ A;  3LB8 A;  1Y0P A;  3VRD B;  4I58 A;  3GDN A;  1MXT A;  3T2Z A;  4EQW A;  4A9W A;  3AEB A;  1TQ1 A;  3P4Q A;  3EAN A;  3HYX A;  3C4N A;  1GTH A;  4B67 A;  2R0C A;  3CPH G;  4J34 A;  2ZZB A;  2WDV A;  3G5Q A;  3UTH A;  4J56 A;  1CHU A;  4D03 A;  1VRQ B;  2C64 A;  2A2K A;  2X8C A;  4H2R A;  4OPI A;  2R45 A;  2X99 A;  2Z5Y A;  4TM1 A;  2GMJ A;  3P4S A;  1PJ7 A;  3UOX A;  1YMK A;  1EL7 A;  1MOK A;  1GOS A;  3NIX A;  4D04 A;  2GAG B;  3DJJ A;  1S3B A;  4ICY A;  1CWS A;  2YVG A;  3CPI G;  4USR A;  5DBJ A;  4Z2T A;  5BUK A;  1XAN A;  3ITJ A;  1PDH A;  1GER A;  1PJ6 A;  4II2 A;  2OLN A;  3K9R A;  2GRT A;  2GR0 A;  2QCU A;  1QJD A;  2V60 A;  3BNM A;  2V5Z A;  3DH9 A;  1NEN A;  3WE0 A;  1OKG A;  1GRF A;  3AYI A;  2YLX A;  3GD4 A;  3SX6 A;  3CGE A;  2WP9 A;  4EQS A;  2WQY A;  3G5S A;  3QVP A;  1CC2 A;  3SQP A;  4NEV A;  1YMD A;  4O5Q A;  3DGZ A;  3FG2 P;  2XFN A;  3AD8 B;  3HYV A;  1CC4 A;  2V3A A;  2XLT A;  4P9S A;  4A79 A;  1FEA A;  3UTG A;  5LAM A;  4OPL A;  1NHP A;  3SM8 A;  1M6I A;  2GH5 A;  3EPT A;  4OPG A;  3KPF A;  2DKH A;  2JB2 A;  2VQ7 A;  1E0C A;  4RG4 A;  1KF6 A;  4B66 A;  3CPJ G;  3UKK A;  1N4W A;  3UP5 A;  1BGJ A;  3FNJ A;  1N4U A;  3II4 A;  5CQF A;  2JB1 A;  3KVE A;  2GVC A;  1CJ4 A;  2I0Z A;  1CF3 A;  3LJP A;  1WV9 A;  4NZH A;  3RNM A;  3AEA A;  5C3J A;  4Z26 A;  3AE9 A;  1PBC A;  5KNL A;  3P4R A;  4WX1 A;  2WES A;  2XFP A;  2BRY A;  2X8G A;  3AE2 A;  3NLC A;  1IUU A;  5HHF A;  1WHB A;  4UDP A;  3IWH A;  2XVE A;  2BXR A;  3G5R A;  1YY5 A;  1GTE A;  1TDE A;  4YKF A;  2RAB A;  2B9Y A;  4YWO A;  5EOW A;  4U2T A;  3GMB A;  3ICT A;  5LAO A;  3UKL A;  4FK1 C;  2GWF A;  5EB5 A;  3GK5 A;  1IUX A;  1LTX R;  4IV9 A;  3SFE A;  2BA9 A;  2WET A;  1Q1W A;  4J2W A;  1FCD A;  3LXD A;  4B65 A;  3ICR A;  4U2L A;  2ARD A;  3DJD A;  3DK9 A;  1RHD A;  2YLZ A;  4G74 A;  3O0H A;  1YT8 A;  2YVJ A;  1S2Y A;  2B76 A;  4K8D A;  4TM0 A;  3QSE A;  2WS3 A;  5IPY A;  5KMQ A;  4BJZ A;  1QXN A;  4RSL A;  1CJ2 A;  1NHS A;  2GR3 A;  4H4Y A;  4A7A A;  3TP9 A;  1JEH A;  1BWC A;  2VVL A;  4G6H A;  4C3Y A;  2PHH A;  3OLH A;  1GRH A;  1PBD A;  1D7Y A;  3LOV A;  2NPX A;  2Q0L A;  4TLX A;  4Z24 A;  3SY4 A;  1H4M X;  2WU5 A;  1ZOY A;  2YLW A;  3B6D A;  4BK2 A;  3KPK A;  3GYX A;  3Q6J A;  4H4T A;  3T14 A;  2HHG A;  1H84 A;  3CNS A;  3VR8 A;  3CGC A;  2CDU A;  4Z43 A;  4AT2 A;  3COX A;  4Y4L A;  2A87 A;  1JOA A;  2XFU A;  1DOC A;  3HZL A;  3AE5 A;  3R9U A;  1ZY8 A;  2GMH A;  2GQW A;  2Q6U A;  2YR4 A;  1KDG A;  3NHO X;  1PXA A;  3P4P A;  2WLX A;  4TM4 A;  2BYB A;  2BXS A;  2WOV A;  3ALJ A;  3PO7 A;  3VR9 A;  3AAY A;  4YSH A;  3HIX A;  4EIP A;  1BOI A;  3K7T A;  5JCN A;  4F67 A;  3FMW A;  3V3O A;  5HBL A;  5BUL A;  3H4K A;  2GB0 A;  4JY3 A;  2C3D A;  4NEW A;  1ZX9 A;  4N9X A;  2YG3 A;  2IVD A;  4U8K A;  1W4X A;  3AB1 A;  5FS6 A;  4Z44 A;  1IUW A;  4H4V A;  5KMP A;  2E5V A;  1CBO A;  4CY8 A;  5M10 A;  4B68 A;  4NTD A;  2EG4 B;  3AE6 A;  5U63 A;  4E0V A;  2ZZ0 A;  3TG1 B;  2YLR A;  1F8S A;  4Z25 A;  1E1N A;  2VZ2 A;  2WDQ A;  4GAP A;  2C75 A;  2BCP A;  2WHD A;  2JB3 A;  2BS4 A;  1TDK A;  4ECH A;  2YAU A;  1DJN A;  4X9M A;  3T2Y A;  1VG0 A;  4WCT A;  3AAX A;  2EQ6 A;  4NTE A;  3PS9 A;  1D4D A;  1KSS A;  1L9E A;  3GWD A;  4G9K A;  1M64 A;  4YSZ A;  5KVH A;  2FJE A;  4GF7 A;  1ZK7 A;  2Q0K A;  2FSX A;  4UDR A;  3ATR A;  4O5U A;  5TR3 A;  1NEK A;  3UTF A;  5JCI A;  4DSG A;  3GWF A;  3RED A;  1ZMC A;  4HB9 A;  3SZC A;  2GR2 A;  5LV9 A;  3GRS A;  3JSK A;  3GYJ A;  1ZOV A;  2VQB A;  3K7Q X;  4B63 A;  2C76 A;  3BI5 A;  4APN A;  4XWZ A;  1L9C A;  1UKV G;  1GRE A;  3I3U A;  1XDI A;  5HXI A;  5U25 A;  2IVE A;  1FEC A;  4KPR A;  1VEE A;  4C5O A;  2YM1 A;  3GD3 A;  1BOH A;  2WPE A;  2AR8 A;  2QAE A;  3AXB A;  2MRM A;  3OP3 A;  3L1R A;  3AD7 B;  3V3N A;  4DGK A;  1GN0 A;  1GRA A;  3NHV A;  4WH9 A;  4IVM B;  1IJH A;  5HY5 A;  1CWR A;  4ADW A;  1NG4 A;  2YVF A;  3V76 A;  4CRT A;  1OJT A;  4ZN0 A;  3ZYX A;  1KNP A;  5FMH A;  3SZW A;  1CJ3 A;  1Y56 A;  1RSG A;  2ZZC A;  1GRT A;  2BC0 A;  1EL8 A;  1B37 A;  3LZW A;  3O3W A;  3F8D A;  2VVL G;  2BK4 A;  3I2V A;  1TDN A;  2JK6 A;  3LZX A;  4ZCC A;  1B8S A;  2X8H A;  1JNZ A;  2IFD A;  1F8R A;  1LVL A;  3DGH A;  3D1C A;  3Q9T A;  2EQ7 A;  1GV4 A;  2IID A;  2NVK X;  2OAL A;  3AYL A;  3I3L A;  2GF3 A;  4YTM A;  5HBO A;  4J31 A;  1YQ3 A;  5CKU A;  4Y4M A;  4UP3 A;  4C77 A;  3DJE A;  1JRZ A;  2XVH A;  2BAB A;  2XCG A;  3NYC A;  1K0L A;  3AEE A;  4CCQ A;  3LAD A;  2C66 A;  1GPE A;  2VVM A;  5FS9 A;  3CNT A;  3NK2 X;  4GCM A;  2YQU A;  4H50 A;  1E39 A;  1OJA A;  2K0Z A;  2YR5 A;  5L46 A;  2JKC A;  2OUC A;  1PN0 A;  2ZBW A;  3IHM A;  3BI2 A;  1OJD A;  4GDP A;  3URH A;  3NKS A;  3OZ2 A;  2TMD A;  3UOV A;  3KU9 A;  1LV0 A;  3NN6 X;  2UZQ A;  4C3X A;  2RGJ A;  2PYX A;  2OLO A;  1ZP0 A;  2XFQ A;  3SZF A;  4JNA A;  2BCG G;  4I59 A;  4OVI A;  1FOH A;  2APG A;  2C72 A;  4YSX A;  5C2T A;  3ILM A;  2CVJ A; 
#chains in the Genus database with same CATH homology
 4EM3 A;  1BKW A;  3VRB A;  1KSU A;  2FBW A;  1O95 A;  4GUV A;  3HWI A;  4OCG A;  2JTS A;  3AE8 A;  3ZDN A;  5J60 A;  5KRQ A;  2JTR A;  2C73 A;  2VSW A;  2CUL A;  4BV6 A;  1H81 A;  1O94 A;  3GDP A;  5BVA A;  2H89 A;  2YG4 A;  1DXL A;  4U8I A;  3NTA A;  2R4J A;  1K0J A;  4H4Q A;  3F4A A;  1LQT A;  4JDR A;  3C4A A;  5JCL A;  4GAV A;  3AED A;  1Q9I A;  4GDE A;  1F6M A;  1S2Q A;  2WBA A;  4NNJ A;  3GMC A;  2GV8 A;  1H86 A;  4NWZ A;  1CC6 A;  1PS9 A;  2WOW A;  5BRT A;  1GXF A;  2ORA A;  3QFB A;  3AYJ A;  4H4R A;  5KVI A;  4YTN A;  3T2K A;  1H83 A;  3F8R A;  2GEW A;  2RGH A;  1EBD A;  1Z6L A;  2R0G A;  4JY2 A;  1K4Q A;  3H8L A;  1H4K X;  3IPP A;  3B3R A;  1RP0 A;  2ACZ A;  4J33 A;  1ONF A;  1NG3 A;  5JCK A;  1E7P A;  3FPZ A;  2KL3 A;  1QO8 A;  4RG3 A;  2R46 A;  3PVC A;  1YQ4 A;  1GEU A;  1X31 B;  4GRT A;  1JRX A;  2J3N A;  2XLR A;  4FX9 A;  2XVI A;  2Q7V A;  5KMS A;  4YKG A;  2WU2 A;  2JBV A;  3AEC A;  2MOL A;  2WLR A;  3UTN X;  5HPA A;  4FK1 A;  1DJQ A;  5FS7 A;  1LPF A;  1VDC A;  4EQX A;  3CTY A;  4JGT A;  4EIQ A;  1RYI A;  4H2N A;  4YXD A;  1JNR A;  1GRG A;  4U8J A;  4XWR A;  4GR1 A;  4YT0 A;  2QA2 A;  4CY6 A;  1NPX A;  4H7U A;  2JTQ A;  2B9X A;  2WP6 A;  2XVJ A;  3AWI A;  1H82 A;  2YG7 A;  3RP6 A;  1EL9 A;  3NH3 X;  1CWT A;  2FJA A;  3GSI A;  3NK0 X;  4ZCD A;  3KA7 A;  1VQW A;  3L8K A;  1NDA A;  2WPF A;  4PAA A;  1L0V A;  2VOU A;  4AP3 A;  2B9W A;  4A5L A;  3E1T A;  1PXC A;  4H4Z A;  2DKI A;  5M0Z A;  3KLJ A;  1GES A;  1NHR A;  4U8M A;  1K0I A;  3DJG X;  1OJ9 A;  3UCL A;  2V3B A;  1PXB A;  2XFO A;  1Q1R A;  1XPQ A;  1GND A;  3AE4 A;  3CNP A;  2Y6Q A;  2YLT A;  5U1O A;  4K22 A;  4XXG A;  2XYO A;  3DME A;  4Z2U A;  4YTP A;  4LII A;  4JQ9 A;  4EMW A;  3EAO A;  1YQZ A;  2RGO A;  1OJC A;  3BNU A;  2R0P A;  2B7R A;  2BS2 A;  4H4X A;  4K2X A;  2O9Z A;  5KOW A;  3C96 A;  4X4J A;  3IF9 A;  1IUV A;  5KWF A;  4TLZ A;  5HYM A;  1D5T A;  4OPC A;  1QB0 A;  1T3K A;  3NTD A;  2X3N A;  3RP7 A;  2YG5 A;  1ORB A;  2Z5X A;  3FS5 A;  3DK8 A;  1SEZ A;  3CMM A;  4G6G A;  4U8O A;  1BF3 A;  2BK3 A;  4A6N B;  3FBS A;  2WOI A;  4TM3 A;  3EF6 A;  4DNA A;  3NNE A;  3GYI A;  3QVR A;  2H88 A;  1ELI A;  4H2P A;  1LJ1 A;  3NN0 X;  4AP1 A;  2E1M A;  3K30 A;  3UKP A;  1GRB A;  3MZZ A;  1GSN A;  4EMJ A;  3UKF A;  2BS3 A;  4U8P A;  3H8I A;  4BUR A;  1P2E A;  2VRL A;  2YWL A;  1KFY A;  2TPR A;  3QJ4 A;  4BJY A;  3CN8 A;  3AE7 A;  4CBQ A;  4WH7 A;  5GSN A;  1IUS A;  2X50 A;  3QSM A;  1GMX A;  3SZ0 A;  1ZMD A;  3VRA A;  3UOZ A;  2GR1 A;  3S5W A;  2GAH B;  1DOE A;  4AT0 A;  3AE3 A;  2XDO A;  4AOS A;  4LA1 A;  1E1L A;  3BHK A;  3AD9 B;  3T31 A;  4M52 A;  3IC9 A;  5KOX A;  1IUT A;  1JRY A;  3NRN A;  2YLS A;  3HZU A;  2C70 A;  2C4C A;  3SXI A;  1DOB A;  4K7Z A;  2WP5 A;  1D4C A;  5IQ1 A;  2FJB A;  2MOI A;  5IQ4 A;  2C7G A;  2R9Z A;  2WEU A;  2XLS A;  3ALM A;  3DK4 A;  4EMI A;  1YM9 A;  3NYF A;  1N1P A;  2FJD A;  3ALL A;  1CJC A;  2E4G A;  4PAB A;  4IVO B;  5KMR A;  2C3C A;  4AOX A;  2EQ8 A;  3UP4 A;  1BZL A;  3P9U A;  4U2S A;  1URH A;  2BC1 A;  3F8P A;  2YM2 A;  3G5J A;  1YML A;  4CNK A;  3P3A A;  3AE1 A;  1YS0 A;  3D1P A;  1H7W A;  1B4V A;  1MO9 A;  4H4S A;  4Y4N A;  1TRB A;  4U8N A;  4J57 A;  1XHC A;  5EBK A;  3NK1 X;  2HQM A;  2BAC A;  4Z2R A;  2J6P A;  4YSY A;  2EG4 A;  1REO A;  2B7S A;  2QA1 A;  2YG6 A;  2F5Z A;  1F3P A;  4BK1 A;  2XLU A;  1EL5 A;  1FL2 A;  4MJW A;  3FLH A;  3CGD A;  3QSS A;  2GQF A;  3IWA A;  3CNJ A;  4LU6 A;  2C65 A;  4CNJ A;  5JCM A;  2AQJ A;  1JU2 A;  2CFY A;  3CND A;  3T0K A;  3GRT A;  4H4W A;  2OA1 A;  2R4E A;  1ZKQ A;  1PBB A;  4REK A;  4B69 A;  4C74 A;  3NYE A;  4J36 A;  4OPT A;  4H4U A;  1PBF A;  2AAQ A;  2V6O A;  2OAM A;  2EG3 A;  4FDC B;  1GAL A;  3S61 A;  5HBQ A;  1B5Q A;  1VG9 A;  3BHF A;  4X9N A;  1QLB A;  1P2H A;  5ER0 A;  4EM4 A;  1KNR A;  3P1W A;  2WDR A;  1AOG A;  4UDQ A;  4DSH A;  3KD9 A;  1PHH A;  3RHA A;  2BK5 A;  3UKH A;  2JAE A;  4II3 A;  4U8L A;  3M12 A;  3VQR A;  2XLP A;  3DA1 A;  1COY A;  1H6V A;  2BRA A;  1F8W A;  3CGB A;  5FS8 A;  1RHS A;  3D8X A;  1E1M A;  4IA5 A;  3ICS A;  3RP8 A;  2VRM A;  3SYI A;  2UZZ A;  1PJ5 A;  4IA6 A;  1TYT A;  1CL0 A;  1DOD A;  1TYP A;  1S3E A;  1NHQ A;  1O5W A;  3I6D A;  4EQR A;  1C25 A;  4H2Q A;  5EB4 A;  1HYU A;  1H7X A;  3BI4 A;  3FIM B;  3FOJ A;  1Y56 B;  3ABV A;  4OPU A;  4H4P A;  3UTE A;  4JNQ A;  3NT6 A;  1HZM A;  3M0O A;  4OPD A;  3K7M X;  3SGL A;  1GT8 A;  4B1B A;  4B64 A;  3NGC X;  4HA6 A;  4NTC A;  1DNC A;  3TG3 A;  1V59 A;  3AEF A;  2XVF A;  2V61 A;  1PBE A;  5HBP A;  4KX6 A;  3QFA A;  4A65 A;  2Y6R A;  1D4E A;  3ATQ A;  2IFV A;  3UKA A;  4G73 A;  1TDO A;  4K5S A;  3UKQ A;  4A99 A;  1GET A;  1DP2 A;  1UAR A;  3M13 A;  2DCQ A;  4JN9 A;  2WPC A;  5J7X A;  1ZDL A;  3ADA B;  2W0H A;  1BGN A;  3IHG A;  3R2U A;  4BK3 A;  1NAA A;  5KXJ A;  2A8X A;  2C67 A;  2EQ9 A;  3HYW A;  3SFD A;  3NG7 X;  2YR6 A;  4CCR A;  4A6N A;  2A89 A;  1E1K A;  1D7L A;  1E6E A;  1LQU A;  3KKJ A;  4K5R A;  3UOY A;  4USQ A;  3T37 A;  3CIR A;  3AEG A;  3ISH A;  5GRT A;  1N4V A;  1TDF A;  1FEB A;  3OC4 A;  3IPO A;  1L9D A;  1YKJ A;  3LB8 A;  1Y0P A;  3VRD B;  4I58 A;  3GDN A;  1MXT A;  3T2Z A;  4EQW A;  4A9W A;  3AEB A;  1TQ1 A;  3P4Q A;  3EAN A;  3HYX A;  3C4N A;  1GTH A;  4B67 A;  2R0C A;  3CPH G;  4J34 A;  2ZZB A;  2WDV A;  3G5Q A;  3UTH A;  4J56 A;  1CHU A;  4D03 A;  1VRQ B;  2C64 A;  2A2K A;  2X8C A;  4H2R A;  4OPI A;  2R45 A;  2X99 A;  2Z5Y A;  4TM1 A;  2GMJ A;  3P4S A;  1PJ7 A;  3UOX A;  1YMK A;  1EL7 A;  1MOK A;  1GOS A;  3NIX A;  4D04 A;  2GAG B;  3DJJ A;  1S3B A;  4ICY A;  1CWS A;  2YVG A;  3CPI G;  4USR A;  5DBJ A;  4Z2T A;  5BUK A;  1XAN A;  3ITJ A;  1PDH A;  1GER A;  1PJ6 A;  4II2 A;  2OLN A;  3K9R A;  2GRT A;  2GR0 A;  2QCU A;  1QJD A;  2V60 A;  3BNM A;  2V5Z A;  3DH9 A;  1NEN A;  3WE0 A;  1OKG A;  1GRF A;  3AYI A;  2YLX A;  3GD4 A;  3SX6 A;  3CGE A;  2WP9 A;  4EQS A;  2WQY A;  3G5S A;  3QVP A;  1CC2 A;  3SQP A;  4NEV A;  1YMD A;  4O5Q A;  3DGZ A;  3FG2 P;  2XFN A;  3AD8 B;  3HYV A;  1CC4 A;  2V3A A;  2XLT A;  4P9S A;  4A79 A;  1FEA A;  3UTG A;  5LAM A;  4OPL A;  1NHP A;  3SM8 A;  1M6I A;  2GH5 A;  3EPT A;  4OPG A;  3KPF A;  2DKH A;  2JB2 A;  2VQ7 A;  1E0C A;  4RG4 A;  1KF6 A;  4B66 A;  3CPJ G;  3UKK A;  1N4W A;  3UP5 A;  1BGJ A;  3FNJ A;  1N4U A;  3II4 A;  5CQF A;  2JB1 A;  3KVE A;  2GVC A;  1CJ4 A;  2I0Z A;  1CF3 A;  3LJP A;  1WV9 A;  4NZH A;  3RNM A;  3AEA A;  5C3J A;  4Z26 A;  3AE9 A;  1PBC A;  5KNL A;  3P4R A;  4WX1 A;  2WES A;  2XFP A;  2BRY A;  2X8G A;  3AE2 A;  3NLC A;  1IUU A;  5HHF A;  1WHB A;  4UDP A;  3IWH A;  2XVE A;  2BXR A;  3G5R A;  1YY5 A;  1GTE A;  1TDE A;  4YKF A;  2RAB A;  2B9Y A;  4YWO A;  5EOW A;  4U2T A;  3GMB A;  3ICT A;  5LAO A;  3UKL A;  4FK1 C;  2GWF A;  5EB5 A;  3GK5 A;  1IUX A;  1LTX R;  4IV9 A;  3SFE A;  2BA9 A;  2WET A;  1Q1W A;  4J2W A;  1FCD A;  3LXD A;  4B65 A;  3ICR A;  4U2L A;  2ARD A;  3DJD A;  3DK9 A;  1RHD A;  2YLZ A;  4G74 A;  3O0H A;  1YT8 A;  2YVJ A;  1S2Y A;  2B76 A;  4K8D A;  4TM0 A;  3QSE A;  2WS3 A;  5IPY A;  5KMQ A;  4BJZ A;  1QXN A;  4RSL A;  1CJ2 A;  1NHS A;  2GR3 A;  4H4Y A;  4A7A A;  3TP9 A;  1JEH A;  1BWC A;  2VVL A;  4G6H A;  4C3Y A;  2PHH A;  3OLH A;  1GRH A;  1PBD A;  1D7Y A;  3LOV A;  2NPX A;  2Q0L A;  4TLX A;  4Z24 A;  3SY4 A;  1H4M X;  2WU5 A;  1ZOY A;  2YLW A;  3B6D A;  4BK2 A;  3KPK A;  3GYX A;  3Q6J A;  4H4T A;  3T14 A;  2HHG A;  1H84 A;  3CNS A;  3VR8 A;  3CGC A;  2CDU A;  4Z43 A;  4AT2 A;  3COX A;  4Y4L A;  2A87 A;  1JOA A;  2XFU A;  1DOC A;  3HZL A;  3AE5 A;  3R9U A;  1ZY8 A;  2GMH A;  2GQW A;  2Q6U A;  2YR4 A;  1KDG A;  3NHO X;  1PXA A;  3P4P A;  2WLX A;  4TM4 A;  2BYB A;  2BXS A;  2WOV A;  3ALJ A;  3PO7 A;  3VR9 A;  3AAY A;  4YSH A;  3HIX A;  4EIP A;  1BOI A;  3K7T A;  5JCN A;  4F67 A;  3FMW A;  3V3O A;  5HBL A;  5BUL A;  3H4K A;  2GB0 A;  4JY3 A;  2C3D A;  4NEW A;  1ZX9 A;  4N9X A;  2YG3 A;  2IVD A;  4U8K A;  1W4X A;  3AB1 A;  5FS6 A;  4Z44 A;  1IUW A;  4H4V A;  5KMP A;  2E5V A;  1CBO A;  4CY8 A;  5M10 A;  4B68 A;  4NTD A;  2EG4 B;  3AE6 A;  5U63 A;  4E0V A;  2ZZ0 A;  3TG1 B;  2YLR A;  1F8S A;  4Z25 A;  1E1N A;  2VZ2 A;  2WDQ A;  4GAP A;  2C75 A;  2BCP A;  2WHD A;  2JB3 A;  2BS4 A;  1TDK A;  4ECH A;  2YAU A;  1DJN A;  4X9M A;  3T2Y A;  1VG0 A;  4WCT A;  3AAX A;  2EQ6 A;  4NTE A;  3PS9 A;  1D4D A;  1KSS A;  1L9E A;  3GWD A;  4G9K A;  1M64 A;  4YSZ A;  5KVH A;  2FJE A;  4GF7 A;  1ZK7 A;  2Q0K A;  2FSX A;  4UDR A;  3ATR A;  4O5U A;  5TR3 A;  1NEK A;  3UTF A;  5JCI A;  4DSG A;  3GWF A;  3RED A;  1ZMC A;  4HB9 A;  3SZC A;  2GR2 A;  5LV9 A;  3GRS A;  3JSK A;  3GYJ A;  1ZOV A;  2VQB A;  3K7Q X;  4B63 A;  2C76 A;  3BI5 A;  4APN A;  4XWZ A;  1L9C A;  1UKV G;  1GRE A;  3I3U A;  1XDI A;  5HXI A;  5U25 A;  2IVE A;  1FEC A;  4KPR A;  1VEE A;  4C5O A;  2YM1 A;  3GD3 A;  1BOH A;  2WPE A;  2AR8 A;  2QAE A;  3AXB A;  2MRM A;  3OP3 A;  3L1R A;  3AD7 B;  3V3N A;  4DGK A;  1GN0 A;  1GRA A;  3NHV A;  4WH9 A;  4IVM B;  1IJH A;  5HY5 A;  1CWR A;  4ADW A;  1NG4 A;  2YVF A;  3V76 A;  4CRT A;  1OJT A;  4ZN0 A;  3ZYX A;  1KNP A;  5FMH A;  3SZW A;  1CJ3 A;  1Y56 A;  1RSG A;  2ZZC A;  1GRT A;  2BC0 A;  1EL8 A;  1B37 A;  3LZW A;  3O3W A;  3F8D A;  2VVL G;  2BK4 A;  3I2V A;  1TDN A;  2JK6 A;  3LZX A;  4ZCC A;  1B8S A;  2X8H A;  1JNZ A;  2IFD A;  1F8R A;  1LVL A;  3DGH A;  3D1C A;  3Q9T A;  2EQ7 A;  1GV4 A;  2IID A;  2NVK X;  2OAL A;  3AYL A;  3I3L A;  2GF3 A;  4YTM A;  5HBO A;  4J31 A;  1YQ3 A;  5CKU A;  4Y4M A;  4UP3 A;  4C77 A;  3DJE A;  1JRZ A;  2XVH A;  2BAB A;  2XCG A;  3NYC A;  1K0L A;  3AEE A;  4CCQ A;  3LAD A;  2C66 A;  1GPE A;  2VVM A;  5FS9 A;  3CNT A;  3NK2 X;  4GCM A;  2YQU A;  4H50 A;  1E39 A;  1OJA A;  2K0Z A;  2YR5 A;  5L46 A;  2JKC A;  2OUC A;  1PN0 A;  2ZBW A;  3IHM A;  3BI2 A;  1OJD A;  4GDP A;  3URH A;  3NKS A;  3OZ2 A;  2TMD A;  3UOV A;  3KU9 A;  1LV0 A;  3NN6 X;  2UZQ A;  4C3X A;  2RGJ A;  2PYX A;  2OLO A;  1ZP0 A;  2XFQ A;  3SZF A;  4JNA A;  2BCG G;  4I59 A;  4OVI A;  1FOH A;  2APG A;  2C72 A;  4YSX A;  5C2T A;  3ILM A;  2CVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...