3NT6A

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANSGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
total genus 172
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3nt6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A01
2WLXA 1EL9A 4JY2A 4M52A 3UOYA 2E4GA 1NPXA 1FL2A 1GRBA 2JB1A 1K0IA 3UKHA 2PHHA 2YM1A 4GF7A 2YLXA 1VEEA 3RP8A 2ACZA 1K0JA 1BWCA 2FJEA 1COYA 1V59A 5C3JA 3NRNA 2ARDA 1P2EA 1GERA 1S3EA 2XYOA 3NYEA 2C64A 4C3YA 3CPHG 4NTEA 2YM2A 1BGNA 3UOXA 4IVOB 1JRXA 4RSLA 1YM9A 1CJCA 2EQ9A 2WDVA 1RHSA 3QJ4A 4H4VA 4JY3A 2XFQA 2WU5A 4XWRA 5CKUA 5JCIA 2C3DA 2XLRA 1JNRA 2YLSA 4U8IA 5HYMA 4EQRA 3RP7A 2GR2A 4U2LA 2VQBA 2HQMA 3DJJA 4WH9A 1GXFA 2JTSA 1QB0A 1OJTA 2AR8A 2C76A 2CDUA 2GMHA 3ABVA 3CPIG 3L1RA 3NHOX 3BNUA 1GREA 4EM4A 3BI4A 3AYLA 2H88A 3KPFA 2GVCA 3O0HA 4H2QA 4P9SA 2GMJA 1F8SA 1KFYA 3AE9A 5U1OA 4U8KA 3LOVA 1C25A 4EIQA 1E1NA 1GRTA 1NHSA 5FS9A 5HXIA 3AXBA 2NVKX 2JK6A 4RG4A 1H6VA 1WV9A 1MOKA 1YT8A 1Q1RA 1S2YA 3VRDB 4A7AA 2BS3A 2IIDA 1N4UA 4U8NA 3NYFA 1FECA 3CNTA 4YKGA 2XLPA 1NHRA 2JKCA 4RG3A 2V5ZA 2J6PA 4Z43A 5J7XA 5BUKA 2WU2A 2A8XA 4CCQA 2K0ZA 1NG3A 2GAGB 4J56A 4CY8A 3UOVA 3TP9A 2I0ZA 1LTXR 2WPCA 3QVRA 4EIPA 5IPYA 2WQYA 1TDNA 2WESA 1DODA 3GYJA 1YS0A 3D1CA 2BXSA 4REKA 4CNKA 1HYUA 2RGOA 3GD4A 3UTNX 3IWHA 3CNSA 1VG0A 2C7GA 4CRTA 4EMWA 2ORAA 1RSGA 2VVLA 2XLTA 4GCMA 2B7SA 3TG1B 4Y4NA 4K5SA 3PS9A 4EQXA 1L9DA 2TPRA 1URHA 2C70A 4D04A 4OVIA 3F4AA 4Z2UA 2YR4A 4C5OA 3H8IA 1D7LA 3FLHA 4DGKA 1QXNA 2R46A 4ZN0A 3ITJA 2YLZA 1HZMA 2EG4B 2BABA 2WDRA 4B64A 3NLCA 3CPJG 3NTAA 5CQFA 2EQ7A 4OPCA 4Y4LA 3QSMA 3K7TA 1PN0A 1GRGA 2BK4A 4TLXA 2YVFA 3K7QX 3IPPA 2JBVA 3AE5A 1H7WA 1CJ2A 1YQ3A 1CL0A 3Q9TA 3GMCA 4A5LA 3B6DA 1ZKQA 1YY5A 4FX9A 2WOIA 1EBDA 2DKIA 5M0ZA 3LZXA 4TM3A 1UARA 1CC4A 1TYTA 4CNJA 2XFUA 3BHFA 3OC4A 4FDCB 5KOWA 1PBDA 1ZOVA 3BNMA 3D1PA 1CWSA 1B37A 4YTMA 2MOIA 1DJQA 4APNA 3IHMA 1VRQB 4OPIA 1EL8A 1H82A 4J57A 3C4NA 4E0VA 2B9YA 3GRTA 1Q1WA 2CFYA 2VRMA 2ZZBA 2XVIA 4B63A 3OLHA 1TDKA 2UZZA 2HHGA 1PJ6A 4I58A 4IVMB 1Z6LA 2FJBA 2OLNA 2XFOA 1E1LA 5FS7A 3B3RA 1PJ7A 3HZLA 3Q6JA 1YMKA 3O3WA 1IUWA 1H81A 1KSSA 2XVFA 2XLSA 3SGLA 3HZUA 1FCDA 1H86A 4Z25A 4A6NA 3CGDA 1TRBA 2BCGG 4F67A 5DBJA 3VQRA 2B9WA 1CF3A 3AEEA 4KPRA 1ELIA 2X8CA 5U63A 4AP3A 3AYJA 1NHQA 4ECHA 4Y4MA 2Y6RA 4PAAA 3GDNA 4CY6A 3AE1A 4JNQA 3NG7X 4X4JA 3KA7A 1KDGA 4H2PA 3S61A 1B8SA 1BGJA 3AD7B 1GESA 2EG4A 3AECA 4B1BA 4C77A 1ZY8A 3NH3X 2AQJA 3AEAA 3CGCA 4JDRA 3NK0X 5HBOA 3DGZA 4H4SA 2DCQA 1DXLA 3QFBA 1YQZA 2EQ6A 4JNAA 4D03A 2C72A 2A2KA 4B69A 4Z2TA 2X99A 4C3XA 4LU6A 1YMLA 1GETA 1IUVA 1GRFA 3VRBA 4X9MA 3DA1A 3IHGA 5U25A 1OJDA 2R9ZA 1GALA 2UZQA 3REDA 3ATQA 4GR1A 1BOIA 2YG6A 4H7UA 4ZCDA 2XVHA 2YLTA 1GPEA 3GWDA 1PS9A 3FIMB 3IF9A 4CCRA 4EM3A 3HIXA 3EAOA 2MRMA 3HWIA 1D4EA 1E39A 1PBFA 4TM0A 1TDOA 3K7MX 1BOHA 2V3BA 3NGCX 3DK9A 3FS5A 3NKSA 1FOHA 2GEWA 2QCUA 1KF6A 1P2HA 4YSYA 2YVGA 1QJDA 3JSKA 5KVHA 1L9CA 2WP9A 3DJEA 4H2RA 2QA1A 4AOSA 1NHPA 2YAUA 1OJAA 1K0LA 4H2NA 1PXBA 2V3AA 4K7ZA 3RHAA 1GTEA 3NK2X 4USQA 2JB2A 2WETA 3UKKA 3D8XA 2H89A 5FMHA 4A6NB 3DH9A 2YLWA 1B5QA 1DJNA 2BA9A 2BC1A 1O95A 3BHKA 1DOCA 3LB8A 4GDPA 4A9WA 4EQWA 5KOXA 4YWOA 2CULA 3AWIA 3II4A 2V61A 4USRA 1CWTA 3P3AA 1D7YA 2B9XA 2R4EA 5FS6A 3ALLA 3KU9A 1W4XA 3RP6A 2NPXA 4ICYA 5GSNA 1UKVG 3SQPA 3V3NA 1LPFA 2VSWA 2WHDA 2FJDA 2FBWA 4H4RA 4DSHA 1BZLA 1D4CA 2GR3A 3R2UA 3F8RA 5HBQA 1BF3A 1M64A 1T3KA 5C2TA 5HBPA 1OKGA 1F6MA 2BC0A 3NHVA 3BI2A 1KSUA 2C3CA 2VRLA 3NIXA 2AAQA 3VRAA 3E1TA 3LXDA 4AT0A 3GYIA 2YR6A 4U8MA 2YG4A 4I59A 5J60A 2GQFA 3M0OA 4BK2A 1CWRA 1IUXA 2YLRA 1CJ4A 3DGHA 2KL3A 4J2WA 4Z44A 4YSHA 3GMBA 2WS3A 5IQ4A 1IUUA 1GOSA 4UP3A 3UTGA 4OCGA 3UKPA 2R0CA 3ALJA 4H4WA 4U8LA 3M13A 1B4VA 2GH5A 3KVEA 2R0PA 4A79A 1MXTA 1VQWA 5KVIA 3AAXA 4ADWA 1PBCA 2C75A 2X8GA 1TDFA 3FG2P 2BXRA 4ZCCA 4DNAA 4EMJA 4K5RA 1LV0A 2QA2A 2ZZ0A 4H4QA 3P4QA 3RNMA 2GF3A 3NNEA 4U2SA 1X31B 2FSXA 2GRTA 2GV8A 3UP5A 1QO8A 1FEAA 3PO7A 3P1WA 3AD9B 2WP5A 1GN0A 3SFEA 4AP1A 3DJGX 3FOJA 3OZ2A 4H4UA 2BACA 5EB5A 1H83A 3DK4A 2OLOA 2XVJA 3FMWA 2GB0A 1N4WA 1GEUA 1DOEA 1YKJA 1OJCA 4XXGA 4A99A 1BKWA 4Z2RA 1JRYA 3AEGA 5GRTA 5JCMA 2XLUA 4UDPA 1E1MA 4B66A 1CJ3A 3UTEA 3P4PA 4YTNA 3L8KA 4HB9A 2XVEA 2X8HA 3G5SA 3UKAA 5ER0A 4GRTA 2W0HA 1RP0A 3G5RA 1H7XA 3G5QA 4JN9A 3ZDNA 4CBQA 1EL7A 3AE2A 4BJZA 2YG7A 1E6EA 2Q6UA 5JCKA 3NT6A 1M6IA 2B7RA 3LADA 4TM1A 2TMDA 4MJWA 4YSXA 2Q0KA 3DJDA 3KD9A 3SFDA 1NG4A 5JCLA 1GRHA 3I6DA 3P9UA 4NTDA 1PHHA 3C96A 5LAMA 2Q0LA 4UDQA 4YT0A 3ICSA 2E1MA 2C67A 3IWAA 1O94A 2OAMA 3CNJA 4NZHA 3G5JA 4U8OA 5FS8A 3AE6A 3AYIA 4H4ZA 2YG3A 3F8DA 2BS4A 4WH7A 4DSGA 4AT2A 2RABA 3DK8A 3K9RA 3NYCA 2WLRA 2WOWA 3VR9A 4BURA 1F8RA 5KXJA 2R4JA 1YMDA 3CN8A 3GK5A 1DOBA 3AE4A 4JGTA 1O5WA 4XWZA 2V60A 3K30A 3R9UA 1N4VA 1PBBA 1YQ4A 2WOVA 4JQ9A 3FNJA 2XDOA 4BK1A 1PJ5A 3EF6A 2YQUA 3NN6X 2YR5A 1GTHA 2J3NA 3ADAB 1ONFA 3OP3A 3AB1A 2JTRA 2VVLG 3QSEA 3LZWA 2A87A 2WPEA 2QAEA 4U8JA 2GAHB 3P4RA 4OPUA 5LV9A 4BJYA 2GQWA 4J36A 4EMIA 3NTDA 1ORBA 4IV9A 3UOZA 2BK3A 1H84A 1NENA 3QSSA 1E7PA 1K4QA 1Q9IA 1ZP0A 1E0CA 3ICRA 2JAEA 3FPZA 4YSZA 3NN0X 2XCGA 4FK1C 4K8DA 3KLJA 3URHA 3I2VA 3GDPA 3CIRA 1GV4A 3TG3A 1LJ1A 2PYXA 1SEZA 1XPQA 1PBEA 3P4SA 1PXAA 4NEVA 4X9NA 5JCNA 2WDQA 2C66A 2ZBWA 5EB4A 1QLBA 1RHDA 2IFVA 3SM8A 4LIIA 1Y56A 3GRSA 1DP2A 3AAYA 4H4XA 5L46A 3UKQA 4BK3A 4J34A 2C73A 2Z5XA 1AOGA 4B68A 2MOLA 3AE8A 4H4PA 2JTQA 1PXCA 1TYPA 2DKHA 4NTCA 3S5WA 1VDCA 4O5UA 4BV6A 1JNZA 1VG9A 3I3UA 1JRZA 1TQ1A 3COXA 2F5ZA 3AEFA 4HA6A 2EQ8A 5HHFA 1GRAA 5BVAA 1NAAA 2OA1A 1XDIA 2OALA 4J31A 3UP4A 4WX1A 1ZOYA 2Z5YA 3ATRA 3ISHA 1ZDLA 4U8PA 1IUTA 5TR3A 4H4YA 3F8PA 2IFDA 1CC6A 1CBOA 1CC2A 1F8WA 4Z24A 1OJ9A 5LAOA 2A89A 4GUVA 1ZMCA 4H4TA 4Z26A 3UKLA 4GDEA 2APGA 3GSIA 2IVDA 2WPFA 3IC9A 3WE0A 1JU2A 1NDAA 3MZZA 1PDHA 1CHUA 2BK5A 4LA1A 1E1KA 2E5VA 3VR8A 3AEDA 1KNRA 2VVMA 4EQSA 4YXDA 2OUCA 2GR0A 2GWFA 4YKFA 3CGBA 4U2TA 4A65A 2RGJA 1MO9A 1JEHA 4IA6A 3V3OA 1IJHA 1N1PA 1GMXA 2R0GA 3LJPA 2YWLA 4PABA 2X3NA 3CGEA 4TLZA 3ILMA 5HPAA 1LVLA 5EBKA 1L0VA 1DNCA 4AOXA 5KWFA 4C74A 1WHBA 3CNDA 4K2XA 3V76A 3UTHA 2BCPA 1GNDA 4OPLA 2BS2A 3QVPA 4UDRA 4K22A 1ZK7A 1H4KX 3ALMA 2VZ2A 3QFAA 1ZMDA 4KX6A 3GWFA 4YTPA 1F3PA 1D5TA 3T37A 2YVJA 3UTFA 5KRQA 4FK1A 2Y6QA 1Y56B 3FBSA 5M10A 1S2QA 2B76A 3GD3A 2O9ZA 4NEWA 4H50A 3C4AA 4OPDA 1JOAA 2FJAA 1LQTA 3AE7A 1Y0PA 2XFNA 4O5QA 1L9EA 2ZZCA 3PVCA 1TDEA 3BI5A 2RGHA 3H4KA 4IA5A 4N9XA 1S3BA 1XANA 2C65A 1RYIA 2X50A 1ZX9A 2JB3A 4TM4A 3EPTA 2V6OA 3UCLA 4B67A 1REOA 2XFPA 1NEKA 3UKFA 5BULA 2WEUA 4WCTA 2R45A 3I3LA 2EG3A 3CNPA 3AEBA 3ZYXA 5HY5A 1H4MX 2GR1A 2IVEA 3CTYA 4J33A 1LQUA 5EOWA 2CVJA 1XHCA 4OPGA 5HBLA 3ICTA 1GT8A 4B65A 3H8LA 3AE3A 1D4DA 5BRTA 3NK1X 1KNPA 3EANA 2BYBA 3IPOA 4OPTA 1GSNA 2VOUA 2WBAA 3DMEA 3M12A 2VQ7A 1FEBA 2YG5A 3KKJA 1EL5A 2Q7VA 3AD8B 1IUSA 5IQ1A 2WP6A
chains in the Genus database with same CATH superfamily
2WLXA 1EL9A 4JY2A 4M52A 3UOYA 2E4GA 1NPXA 1FL2A 1GRBA 2JB1A 1K0IA 3UKHA 2PHHA 2YM1A 3HYXA 4GF7A 4II3A 2YLXA 1VEEA 3RP8A 2ACZA 1K0JA 1BWCA 2FJEA 1COYA 1V59A 5C3JA 3NRNA 2ARDA 4G9KA 1P2EA 1GERA 1S3EA 2XYOA 3NYEA 2C64A 4C3YA 3CPHG 4NTEA 2YM2A 1BGNA 3UOXA 4IVOB 1JRXA 4RSLA 1YM9A 1CJCA 2EQ9A 2WDVA 1RHSA 3QJ4A 4H4VA 4JY3A 2XFQA 2WU5A 4XWRA 5CKUA 5JCIA 2C3DA 2XLRA 1JNRA 2YLSA 4U8IA 5HYMA 4G74A 4EQRA 3RP7A 2GR2A 4U2LA 2VQBA 2HQMA 3DJJA 4WH9A 1GXFA 2JTSA 1QB0A 1OJTA 2AR8A 2C76A 2CDUA 2GMHA 3ABVA 3CPIG 3L1RA 3NHOX 3BNUA 1GREA 4EM4A 3BI4A 3AYLA 2H88A 3KPFA 2GVCA 3O0HA 4H2QA 4P9SA 2GMJA 1F8SA 1KFYA 3AE9A 5U1OA 4U8KA 3LOVA 1C25A 4EIQA 1E1NA 1GRTA 1NHSA 3HYVA 5FS9A 5HXIA 3AXBA 2NVKX 2JK6A 4RG4A 1H6VA 1WV9A 1MOKA 1YT8A 1Q1RA 1S2YA 3VRDB 4AOXA 4A7AA 2BS3A 2IIDA 1N4UA 4U8NA 3NYFA 1FECA 3CNTA 4YKGA 2XLPA 1NHRA 2JKCA 4RG3A 2V5ZA 2J6PA 4Z43A 5J7XA 5BUKA 2WU2A 2A8XA 4CCQA 2K0ZA 1NG3A 2GAGB 4J56A 4CY8A 3UOVA 3TP9A 2I0ZA 1LTXR 2WPCA 3QVRA 4EIPA 5IPYA 2WQYA 1TDNA 2WESA 1DODA 3GYJA 1YS0A 3D1CA 2BXSA 4REKA 4CNKA 1HYUA 2RGOA 3GD4A 3UTNX 3IWHA 3CNSA 1VG0A 2C7GA 4CRTA 4EMWA 2ORAA 1RSGA 2VVLA 2XLTA 4GCMA 2B7SA 3TG1B 4Y4NA 4K5SA 3PS9A 4EQXA 1L9DA 2TPRA 1URHA 2C70A 3T31A 4D04A 4OVIA 3F4AA 4Z2UA 2YR4A 4C5OA 3H8IA 1D7LA 3FLHA 4DGKA 1QXNA 2R46A 4ZN0A 3ITJA 2YLZA 4G73A 3SXIA 1HZMA 2EG4B 2BABA 2WDRA 4B64A 3NLCA 3CPJG 3NTAA 5CQFA 2EQ7A 4OPCA 4Y4LA 3QSMA 3K7TA 1PN0A 1GRGA 2BK4A 4TLXA 2YVFA 3SY4A 3K7QX 3IPPA 2JBVA 3AE5A 1H7WA 1CJ2A 1YQ3A 3CMMA 1CL0A 3Q9TA 3GMCA 4A5LA 3B6DA 1ZKQA 1YY5A 4FX9A 2WOIA 1EBDA 2DKIA 5M0ZA 3LZXA 4TM3A 1UARA 1CC4A 1TYTA 4CNJA 2XFUA 3BHFA 3OC4A 4FDCB 5KOWA 1PBDA 1ZOVA 3BNMA 3D1PA 1CWSA 1B37A 4YTMA 2MOIA 1DJQA 4APNA 3IHMA 1VRQB 4OPIA 1EL8A 1H82A 4J57A 3C4NA 4E0VA 2B9YA 3GRTA 1Q1WA 2CFYA 2VRMA 2ZZBA 2XVIA 4B63A 3OLHA 1TDKA 2UZZA 2HHGA 1PJ6A 4I58A 4II2A 4IVMB 1Z6LA 2FJBA 5KMSA 2OLNA 2XFOA 1E1LA 5FS7A 3B3RA 1PJ7A 3HZLA 3Q6JA 1YMKA 3O3WA 1IUWA 1H81A 1KSSA 2XVFA 2XLSA 3SGLA 3HZUA 1FCDA 1H86A 4Z25A 4A6NA 3CGDA 1TRBA 2BCGG 4F67A 5DBJA 3VQRA 2B9WA 1CF3A 3AEEA 4KPRA 1ELIA 2X8CA 5U63A 4AP3A 3AYJA 1NHQA 4ECHA 4Y4MA 2Y6RA 4PAAA 3GDNA 3T2KA 4CY6A 3AE1A 4JNQA 3NG7X 4X4JA 3KA7A 1KDGA 4H2PA 3S61A 1B8SA 1BGJA 3AD7B 1GESA 2EG4A 3AECA 4B1BA 4C77A 1ZY8A 3NH3X 2AQJA 3AEAA 3CGCA 4JDRA 3NK0X 5HBOA 3DGZA 4H4SA 2DCQA 1DXLA 3QFBA 1YQZA 2EQ6A 4JNAA 4D03A 2C72A 2A2KA 4B69A 4Z2TA 2X99A 4C3XA 4LU6A 1YMLA 1GETA 1IUVA 1GRFA 3VRBA 4X9MA 3DA1A 3IHGA 5U25A 1OJDA 2R9ZA 1GALA 2UZQA 3REDA 3ATQA 4GR1A 1BOIA 2YG6A 4H7UA 4ZCDA 2XVHA 2YLTA 1GPEA 3GWDA 1PS9A 3FIMB 3IF9A 4CCRA 4EM3A 3HIXA 3EAOA 2MRMA 3HWIA 1D4EA 1E39A 1PBFA 4TM0A 1TDOA 3K7MX 1BOHA 2V3BA 3NGCX 3DK9A 3FS5A 3NKSA 1FOHA 2GEWA 2QCUA 1KF6A 1P2HA 4YSYA 2YVGA 1QJDA 3JSKA 5KVHA 1L9CA 2WP9A 3DJEA 4H2RA 2QA1A 4AOSA 1NHPA 2YAUA 1OJAA 1K0LA 4H2NA 3KPKA 1PXBA 5KWFA 2V3AA 4K7ZA 3RHAA 1GTEA 3NK2X 4USQA 2JB2A 2WETA 3UKKA 3D8XA 2H89A 5FMHA 4A6NB 3DH9A 2YLWA 1B5QA 2BRYA 1DJNA 2BA9A 2BC1A 4NNJA 1O95A 3BHKA 1DOCA 3LB8A 4GDPA 4A9WA 4EQWA 5KOXA 2Q82A 4YWOA 2CULA 3AWIA 3II4A 2V61A 4USRA 1CWTA 3P3AA 1D7YA 2B9XA 2R4EA 5FS6A 3ALLA 3KU9A 1W4XA 3RP6A 2NPXA 4ICYA 5GSNA 1UKVG 3SQPA 3V3NA 1LPFA 2VSWA 2WHDA 2FJDA 2FBWA 4H4RA 4DSHA 1BZLA 1D4CA 2GR3A 3R2UA 3F8RA 5HBQA 1BF3A 1M64A 1T3KA 5C2TA 5HBPA 1OKGA 1F6MA 2BC0A 3NHVA 3BI2A 4G6GA 1KSUA 2C3CA 2VRLA 3NIXA 2AAQA 3SZWA 3E1TA 3LXDA 3VRAA 4AT0A 3GYIA 2YR6A 4U8MA 2YG4A 4I59A 5J60A 2GQFA 3SZ0A 3M0OA 4BK2A 1CWRA 1IUXA 2YLRA 1CJ4A 3DGHA 2KL3A 4J2WA 4Z44A 4YSHA 3GMBA 2WS3A 5IQ4A 1IUUA 1GOSA 4UP3A 3UTGA 4OCGA 3UKPA 2R0CA 3ALJA 4H4WA 4U8LA 3M13A 1B4VA 2GH5A 3KVEA 2R0PA 4A79A 1MXTA 1VQWA 5KVIA 3AAXA 4ADWA 1PBCA 2C75A 2X8GA 1TDFA 3FG2P 2BXRA 4ZCCA 4DNAA 4EMJA 4K5RA 1LV0A 2QA2A 2ZZ0A 4H4QA 3P4QA 3RNMA 2GF3A 3NNEA 4U2SA 1X31B 2FSXA 2GRTA 2GV8A 3SYIA 1QO8A 1FEAA 3PO7A 3P1WA 3AD9B 3UP5A 2WP5A 1GN0A 3SFEA 3SX6A 4AP1A 3DJGX 3FOJA 3OZ2A 4H4UA 2BACA 5EB5A 1H83A 3DK4A 2OLOA 2XVJA 3FMWA 2GB0A 1N4WA 1GEUA 1DOEA 1YKJA 1OJCA 4XXGA 4A99A 1BKWA 4Z2RA 1JRYA 3AEGA 5GRTA 5JCMA 2XLUA 4UDPA 1E1MA 4B66A 1CJ3A 3UTEA 3P4PA 4YTNA 3L8KA 4HB9A 2XVEA 2X8HA 3G5SA 3UKAA 5ER0A 4GRTA 2W0HA 1RP0A 3G5RA 1H7XA 3G5QA 4JN9A 3ZDNA 4CBQA 1EL7A 3AE2A 4BJZA 2YG7A 1E6EA 2Q6UA 5JCKA 3NT6A 1M6IA 2B7RA 3LADA 4TM1A 2TMDA 4MJWA 4YSXA 2Q0KA 3DJDA 3KD9A 3SFDA 1NG4A 5JCLA 1GRHA 3I6DA 3P9UA 5KMQA 4NTDA 1PHHA 3C96A 5LAMA 2Q0LA 4UDQA 4YT0A 3ICSA 2E1MA 2C67A 3IWAA 3T14A 1O94A 2OAMA 3CNJA 4NZHA 3G5JA 4U8OA 5FS8A 3AE6A 3AYIA 4H4ZA 5KMPA 2YG3A 2BRAA 3F8DA 2BS4A 4WH7A 4DSGA 4AT2A 2RABA 3DK8A 3K9RA 3NYCA 2WLRA 2WOWA 3VR9A 4BURA 1F8RA 5KXJA 2R4JA 1YMDA 3CN8A 3GK5A 1DOBA 3AE4A 4JGTA 1O5WA 4XWZA 2V60A 3K30A 3R9UA 1N4VA 1PBBA 3T2ZA 1YQ4A 2WOVA 4JQ9A 3FNJA 2XDOA 4BK1A 1PJ5A 3EF6A 2YQUA 3NN6X 2YR5A 1GTHA 2J3NA 3ADAB 1ONFA 3OP3A 3AB1A 2JTRA 2VVLG 3QSEA 3LZWA 2A87A 2WPEA 2QAEA 4U8JA 2GAHB 3P4RA 4B68A 4OPUA 5LV9A 4BJYA 2GQWA 4J36A 4EMIA 3NTDA 1ORBA 4IV9A 3UOZA 2BK3A 1H84A 1NENA 3QSSA 1E7PA 1K4QA 1Q9IA 1ZP0A 1E0CA 3ICRA 2JAEA 3FPZA 4YSZA 3NN0X 2XCGA 4FK1C 4K8DA 3KLJA 3URHA 3I2VA 3GDPA 3CIRA 1GV4A 3TG3A 1LJ1A 2PYXA 1SEZA 1XPQA 1PBEA 3P4SA 1PXAA 4NEVA 4X9NA 5JCNA 5KMRA 2WDQA 2C66A 2ZBWA 5EB4A 1QLBA 4GAVA 1RHDA 2IFVA 3SM8A 4LIIA 1Y56A 3GRSA 1DP2A 3AAYA 4H4XA 5L46A 3UKQA 4BK3A 4J34A 2C73A 2Z5XA 1AOGA 4GAPA 2MOLA 3AE8A 4H4PA 2JTQA 1PXCA 1TYPA 2DKHA 4NTCA 3S5WA 1VDCA 4O5UA 4BV6A 1JNZA 1VG9A 3I3UA 1JRZA 1TQ1A 3COXA 2F5ZA 3AEFA 4HA6A 2EQ8A 5HHFA 1GRAA 5BVAA 1NAAA 2OA1A 1XDIA 2OALA 4J31A 3UP4A 4WX1A 1ZOYA 4NWZA 2Z5YA 3ATRA 3ISHA 1ZDLA 4U8PA 1IUTA 5TR3A 4H4YA 3F8PA 2IFDA 1CC6A 1CBOA 1CC2A 1F8WA 4Z24A 1OJ9A 5LAOA 2A89A 4GUVA 1ZMCA 4H4TA 4Z26A 3UKLA 4GDEA 2APGA 3GSIA 2IVDA 2WPFA 3IC9A 3WE0A 1JU2A 1NDAA 3MZZA 1PDHA 1CHUA 2BK5A 4LA1A 1E1KA 2E5VA 3VR8A 3AEDA 1KNRA 2VVMA 4EQSA 4YXDA 2OUCA 2GR0A 2GWFA 4YKFA 3CGBA 4U2TA 4A65A 2RGJA 1MO9A 1JEHA 4IA6A 3V3OA 1IJHA 1N1PA 1GMXA 2R0GA 3LJPA 2YWLA 4PABA 2X3NA 3CGEA 4TLZA 3ILMA 5HPAA 1LVLA 2C4CA 3GYXA 1DNCA 5EBKA 1L0VA 3SZCA 3HYWA 4C74A 1WHBA 3CNDA 4K2XA 3V76A 3UTHA 2BCPA 1GNDA 4OPLA 2BS2A 3QVPA 4UDRA 4K22A 1ZK7A 1H4KX 3ALMA 2VZ2A 3QFAA 1ZMDA 4KX6A 3GWFA 4YTPA 1F3PA 1D5TA 3T37A 2YVJA 3UTFA 5KRQA 4FK1A 2Y6QA 1Y56B 3FBSA 5M10A 1S2QA 2B76A 3GD3A 2O9ZA 4NEWA 4H50A 3C4AA 4OPDA 1JOAA 2FJAA 3T0KA 1LQTA 3AE7A 1Y0PA 2XFNA 4O5QA 1L9EA 2ZZCA 3PVCA 1TDEA 3BI5A 2RGHA 3H4KA 4IA5A 4N9XA 1S3BA 1XANA 2C65A 1RYIA 2X50A 1ZX9A 2JB3A 4TM4A 3EPTA 2V6OA 3UCLA 4B67A 1REOA 2XFPA 1NEKA 3UKFA 5BULA 4G6HA 2WEUA 4WCTA 2R45A 3I3LA 2EG3A 3CNPA 5KNLA 3AEBA 3ZYXA 5HY5A 1H4MX 2GR1A 2IVEA 3CTYA 4J33A 1LQUA 5EOWA 2CVJA 1XHCA 4OPGA 5HBLA 3ICTA 1GT8A 4B65A 3H8LA 3AE3A 1D4DA 5BRTA 3NK1X 1KNPA 3EANA 2BYBA 3IPOA 4OPTA 1GSNA 2VOUA 2WBAA 3DMEA 3M12A 2VQ7A 1FEBA 2YG5A 3KKJA 1EL5A 3SZFA 2Q7VA 3T2YA 3AD8B 1IUSA 5IQ1A 2WP6A
chains in the Genus database with same CATH topology
2WLXA 1EL9A 4JY2A 4M52A 3UOYA 2E4GA 1NPXA 1FL2A 1GRBA 2JB1A 1K0IA 3UKHA 2PHHA 2YM1A 3HYXA 4GF7A 4II3A 2YLXA 1VEEA 3RP8A 2ACZA 1K0JA 1BWCA 2FJEA 1COYA 1V59A 5C3JA 3NRNA 2ARDA 4G9KA 1P2EA 1GERA 1S3EA 2XYOA 3NYEA 2C64A 4C3YA 3CPHG 4NTEA 2YM2A 1BGNA 3UOXA 4IVOB 1JRXA 4RSLA 1YM9A 1CJCA 2EQ9A 2WDVA 1RHSA 3QJ4A 4H4VA 4JY3A 2XFQA 2WU5A 4XWRA 5CKUA 5JCIA 2C3DA 2XLRA 1JNRA 2YLSA 4U8IA 5HYMA 4G74A 4EQRA 3RP7A 2GR2A 4U2LA 2VQBA 2HQMA 3DJJA 4WH9A 1GXFA 2JTSA 1QB0A 1OJTA 2AR8A 2C76A 2CDUA 2GMHA 3ABVA 3CPIG 3L1RA 3NHOX 3BNUA 1GREA 4EM4A 3BI4A 3AYLA 2H88A 3KPFA 2GVCA 3O0HA 4H2QA 4P9SA 2GMJA 1F8SA 1KFYA 3AE9A 5U1OA 4U8KA 3LOVA 1C25A 4EIQA 1E1NA 1GRTA 1NHSA 3HYVA 5FS9A 5HXIA 3AXBA 2NVKX 2JK6A 4RG4A 1H6VA 1WV9A 1MOKA 1YT8A 1Q1RA 1S2YA 3VRDB 4AOXA 4A7AA 2BS3A 2IIDA 1N4UA 4U8NA 3NYFA 1FECA 3CNTA 4YKGA 2XLPA 1NHRA 2JKCA 4RG3A 2V5ZA 2J6PA 4Z43A 5J7XA 5BUKA 2WU2A 2A8XA 4CCQA 2K0ZA 1NG3A 2GAGB 4J56A 4CY8A 3UOVA 3TP9A 2I0ZA 1LTXR 2WPCA 3QVRA 4EIPA 5IPYA 2WQYA 1TDNA 2WESA 1DODA 3GYJA 1YS0A 3D1CA 2BXSA 4REKA 4CNKA 1HYUA 2RGOA 3GD4A 3UTNX 3IWHA 3CNSA 1VG0A 2C7GA 4CRTA 4EMWA 2ORAA 1RSGA 2VVLA 2XLTA 4GCMA 2B7SA 3TG1B 4Y4NA 4K5SA 3PS9A 4EQXA 1L9DA 2TPRA 1URHA 2C70A 3T31A 4D04A 4OVIA 3F4AA 4Z2UA 2YR4A 4C5OA 3H8IA 1D7LA 3FLHA 4DGKA 1QXNA 2R46A 4ZN0A 3ITJA 2YLZA 4G73A 3SXIA 1HZMA 2EG4B 2BABA 2WDRA 4B64A 3NLCA 3CPJG 3NTAA 5CQFA 2EQ7A 4OPCA 4Y4LA 3QSMA 3K7TA 1PN0A 1GRGA 2BK4A 4TLXA 2YVFA 3SY4A 3K7QX 3IPPA 2JBVA 3AE5A 1H7WA 1CJ2A 1YQ3A 3CMMA 1CL0A 3Q9TA 3GMCA 4A5LA 3B6DA 1ZKQA 1YY5A 4FX9A 2WOIA 1EBDA 2DKIA 5M0ZA 3LZXA 4TM3A 1UARA 1CC4A 1TYTA 4CNJA 2XFUA 3BHFA 3OC4A 4FDCB 5KOWA 1PBDA 1ZOVA 3BNMA 3D1PA 1CWSA 1B37A 4YTMA 2MOIA 1DJQA 4APNA 3IHMA 1VRQB 4OPIA 1EL8A 1H82A 4J57A 3C4NA 4E0VA 2B9YA 3GRTA 1Q1WA 2CFYA 2VRMA 2ZZBA 2XVIA 4B63A 3OLHA 1TDKA 2UZZA 2HHGA 1PJ6A 4I58A 4II2A 4IVMB 1Z6LA 2FJBA 5KMSA 2OLNA 2XFOA 1E1LA 5FS7A 3B3RA 1PJ7A 3HZLA 3Q6JA 1YMKA 3O3WA 1IUWA 1H81A 1KSSA 2XVFA 2XLSA 3SGLA 3HZUA 1FCDA 1H86A 4Z25A 4A6NA 3CGDA 1TRBA 2BCGG 4F67A 5DBJA 3VQRA 2B9WA 1CF3A 3AEEA 4KPRA 1ELIA 2X8CA 5U63A 4AP3A 3AYJA 1NHQA 4ECHA 4Y4MA 2Y6RA 4PAAA 3GDNA 3T2KA 4CY6A 3AE1A 4JNQA 3NG7X 4X4JA 3KA7A 1KDGA 4H2PA 3S61A 1B8SA 1BGJA 3AD7B 1GESA 2EG4A 3AECA 4B1BA 4C77A 1ZY8A 3NH3X 2AQJA 3AEAA 3CGCA 4JDRA 3NK0X 5HBOA 3DGZA 4H4SA 2DCQA 1DXLA 3QFBA 1YQZA 2EQ6A 4JNAA 4D03A 2C72A 2A2KA 4B69A 4Z2TA 2X99A 4C3XA 4LU6A 1YMLA 1GETA 1IUVA 1GRFA 3VRBA 4X9MA 3DA1A 3IHGA 5U25A 1OJDA 2R9ZA 1GALA 2UZQA 3REDA 3ATQA 4GR1A 1BOIA 2YG6A 4H7UA 4ZCDA 2XVHA 2YLTA 1GPEA 3GWDA 1PS9A 3FIMB 3IF9A 4CCRA 4EM3A 3HIXA 3EAOA 2MRMA 3HWIA 1D4EA 1E39A 1PBFA 4TM0A 1TDOA 3K7MX 1BOHA 2V3BA 3NGCX 3DK9A 3FS5A 3NKSA 1FOHA 2GEWA 2QCUA 1KF6A 1P2HA 4YSYA 2YVGA 1QJDA 3JSKA 5KVHA 1L9CA 2WP9A 3DJEA 4H2RA 2QA1A 4AOSA 1NHPA 2YAUA 1OJAA 1K0LA 4H2NA 3KPKA 1PXBA 5KWFA 2V3AA 4K7ZA 3RHAA 1GTEA 3NK2X 4USQA 2JB2A 2WETA 3UKKA 3D8XA 2H89A 5FMHA 4A6NB 3DH9A 2YLWA 1B5QA 2BRYA 1DJNA 2BA9A 2BC1A 4NNJA 1O95A 3BHKA 1DOCA 3LB8A 4GDPA 4A9WA 4EQWA 5KOXA 4YWOA 2CULA 3AWIA 3II4A 2V61A 4USRA 1CWTA 3P3AA 1D7YA 2B9XA 2R4EA 5FS6A 3ALLA 3KU9A 1W4XA 3RP6A 2NPXA 4ICYA 5GSNA 1UKVG 3SQPA 3V3NA 1LPFA 2VSWA 2WHDA 2FJDA 2FBWA 4H4RA 4DSHA 1BZLA 1D4CA 2GR3A 3R2UA 3F8RA 5HBQA 1BF3A 1M64A 1T3KA 5C2TA 5HBPA 1OKGA 1F6MA 2BC0A 3NHVA 3BI2A 4G6GA 1KSUA 2C3CA 2VRLA 3NIXA 2AAQA 3SZWA 3E1TA 3LXDA 3VRAA 4AT0A 3GYIA 2YR6A 4U8MA 2YG4A 4I59A 5J60A 2GQFA 3SZ0A 3M0OA 4BK2A 1CWRA 1IUXA 2YLRA 1CJ4A 3DGHA 2KL3A 4J2WA 4Z44A 4YSHA 3GMBA 2WS3A 5IQ4A 1IUUA 1GOSA 4UP3A 3UTGA 4OCGA 3UKPA 2R0CA 3ALJA 4H4WA 4U8LA 3M13A 1B4VA 2GH5A 3KVEA 2R0PA 4A79A 1MXTA 1VQWA 5KVIA 3AAXA 4ADWA 1PBCA 2C75A 2X8GA 1TDFA 3FG2P 2BXRA 4ZCCA 4DNAA 4EMJA 4K5RA 1LV0A 2QA2A 2ZZ0A 4H4QA 3P4QA 3RNMA 2GF3A 3NNEA 4U2SA 1X31B 2FSXA 2GRTA 2GV8A 3SYIA 1QO8A 1FEAA 3PO7A 3P1WA 3AD9B 3UP5A 2WP5A 1GN0A 3SFEA 3SX6A 4AP1A 3DJGX 3FOJA 3OZ2A 4H4UA 2BACA 5EB5A 1H83A 3DK4A 2OLOA 2XVJA 3FMWA 2GB0A 1N4WA 1GEUA 1DOEA 1YKJA 1OJCA 4XXGA 4A99A 1BKWA 4Z2RA 1JRYA 3AEGA 5GRTA 5JCMA 2XLUA 4UDPA 1E1MA 4B66A 1CJ3A 3UTEA 3P4PA 4YTNA 3L8KA 4HB9A 2XVEA 2X8HA 3G5SA 3UKAA 5ER0A 4GRTA 2W0HA 1RP0A 3G5RA 1H7XA 3G5QA 4JN9A 3ZDNA 4CBQA 1EL7A 3AE2A 4BJZA 2YG7A 1E6EA 2Q6UA 5JCKA 3NT6A 1M6IA 2B7RA 3LADA 4TM1A 2TMDA 4MJWA 4YSXA 2Q0KA 3DJDA 3KD9A 3SFDA 1NG4A 5JCLA 1GRHA 3I6DA 3P9UA 5KMQA 4NTDA 1PHHA 3C96A 5LAMA 2Q0LA 4UDQA 4YT0A 3ICSA 2E1MA 2C67A 3IWAA 3T14A 1O94A 2OAMA 3CNJA 4NZHA 3G5JA 4U8OA 5FS8A 3AE6A 3AYIA 4H4ZA 5KMPA 2YG3A 2BRAA 3F8DA 2BS4A 4WH7A 4DSGA 4AT2A 2RABA 3DK8A 3K9RA 3NYCA 2WLRA 2WOWA 3VR9A 4BURA 1F8RA 5KXJA 2R4JA 1YMDA 3CN8A 3GK5A 1DOBA 3AE4A 4JGTA 1O5WA 4XWZA 2V60A 3K30A 3R9UA 1N4VA 1PBBA 3T2ZA 1YQ4A 2WOVA 4JQ9A 3FNJA 2XDOA 4BK1A 1PJ5A 3EF6A 2YQUA 3NN6X 2YR5A 1GTHA 2J3NA 3ADAB 1ONFA 3OP3A 3AB1A 2JTRA 2VVLG 3QSEA 3LZWA 2A87A 2WPEA 2QAEA 4U8JA 2GAHB 3P4RA 4B68A 4OPUA 5LV9A 4BJYA 2GQWA 4J36A 4EMIA 3NTDA 1ORBA 4IV9A 3UOZA 2BK3A 1H84A 1NENA 3QSSA 1E7PA 1K4QA 1Q9IA 1ZP0A 1E0CA 3ICRA 2JAEA 3FPZA 4YSZA 3NN0X 2XCGA 4FK1C 4K8DA 3KLJA 3URHA 3I2VA 3GDPA 3CIRA 1GV4A 3TG3A 1LJ1A 2PYXA 1SEZA 1XPQA 1PBEA 3P4SA 1PXAA 4NEVA 4X9NA 5JCNA 5KMRA 2WDQA 2C66A 2ZBWA 5EB4A 1QLBA 4GAVA 1RHDA 2IFVA 3SM8A 4LIIA 1Y56A 3GRSA 1DP2A 3AAYA 4H4XA 5L46A 3UKQA 4BK3A 4J34A 2C73A 2Z5XA 1AOGA 4GAPA 2MOLA 3AE8A 4H4PA 2JTQA 1PXCA 1TYPA 2DKHA 4NTCA 3S5WA 1VDCA 4O5UA 4BV6A 1JNZA 1VG9A 3I3UA 1JRZA 1TQ1A 3COXA 2F5ZA 3AEFA 4HA6A 2EQ8A 5HHFA 1GRAA 5BVAA 1NAAA 2OA1A 1XDIA 2OALA 4J31A 3UP4A 4WX1A 1ZOYA 4NWZA 2Z5YA 3ATRA 3ISHA 1ZDLA 4U8PA 1IUTA 5TR3A 4H4YA 3F8PA 2IFDA 1CC6A 1CBOA 1CC2A 1F8WA 4Z24A 1OJ9A 5LAOA 2A89A 4GUVA 1ZMCA 4H4TA 4Z26A 3UKLA 4GDEA 2APGA 3GSIA 2IVDA 2WPFA 3IC9A 3WE0A 1JU2A 1NDAA 3MZZA 1PDHA 1CHUA 2BK5A 4LA1A 1E1KA 2E5VA 3VR8A 3AEDA 1KNRA 2VVMA 4EQSA 4YXDA 2OUCA 2GR0A 2GWFA 4YKFA 3CGBA 4U2TA 4A65A 2RGJA 1MO9A 1JEHA 4IA6A 3V3OA 1IJHA 1N1PA 1GMXA 2R0GA 3LJPA 2YWLA 4PABA 2X3NA 3CGEA 4TLZA 3ILMA 5HPAA 1LVLA 2C4CA 3GYXA 1DNCA 5EBKA 1L0VA 3SZCA 3HYWA 4C74A 1WHBA 3CNDA 4K2XA 3V76A 3UTHA 2BCPA 1GNDA 4OPLA 2BS2A 3QVPA 4UDRA 4K22A 1ZK7A 1H4KX 3ALMA 2VZ2A 3QFAA 1ZMDA 4KX6A 3GWFA 4YTPA 1F3PA 1D5TA 3T37A 2YVJA 3UTFA 5KRQA 4FK1A 2Y6QA 1Y56B 3FBSA 5M10A 1S2QA 2B76A 3GD3A 2O9ZA 4NEWA 4H50A 3C4AA 4OPDA 1JOAA 2FJAA 3T0KA 1LQTA 3AE7A 1Y0PA 2XFNA 4O5QA 1L9EA 2ZZCA 3PVCA 1TDEA 3BI5A 2RGHA 3H4KA 4IA5A 4N9XA 1S3BA 1XANA 2C65A 1RYIA 2X50A 1ZX9A 2JB3A 4TM4A 3EPTA 2V6OA 3UCLA 4B67A 1REOA 2XFPA 1NEKA 3UKFA 5BULA 4G6HA 2WEUA 4WCTA 2R45A 3I3LA 2EG3A 3CNPA 5KNLA 3AEBA 3ZYXA 5HY5A 1H4MX 2GR1A 2IVEA 3CTYA 4J33A 1LQUA 5EOWA 2CVJA 1XHCA 4OPGA 5HBLA 3ICTA 1GT8A 4B65A 3H8LA 3AE3A 1D4DA 5BRTA 3NK1X 1KNPA 3EANA 2BYBA 3IPOA 4OPTA 1GSNA 2VOUA 2WBAA 3DMEA 3M12A 2VQ7A 1FEBA 2YG5A 3KKJA 1EL5A 3SZFA 2Q7VA 3T2YA 3AD8B 1IUSA 5IQ1A 2WP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLX A;  1EL9 A;  4JY2 A;  4M52 A;  3UOY A;  2E4G A;  1NPX A;  1FL2 A;  1GRB A;  2JB1 A;  1K0I A;  3UKH A;  2PHH A;  2YM1 A;  4GF7 A;  2YLX A;  1VEE A;  3RP8 A;  2ACZ A;  1K0J A;  1BWC A;  2FJE A;  1COY A;  1V59 A;  5C3J A;  3NRN A;  2ARD A;  1P2E A;  1GER A;  1S3E A;  2XYO A;  3NYE A;  2C64 A;  4C3Y A;  3CPH G;  4NTE A;  2YM2 A;  1BGN A;  3UOX A;  4IVO B;  1JRX A;  4RSL A;  1YM9 A;  1CJC A;  2EQ9 A;  2WDV A;  1RHS A;  3QJ4 A;  4H4V A;  4JY3 A;  2XFQ A;  2WU5 A;  4XWR A;  5CKU A;  5JCI A;  2C3D A;  2XLR A;  1JNR A;  2YLS A;  4U8I A;  5HYM A;  4EQR A;  3RP7 A;  2GR2 A;  4U2L A;  2VQB A;  2HQM A;  3DJJ A;  4WH9 A;  1GXF A;  2JTS A;  1QB0 A;  1OJT A;  2AR8 A;  2C76 A;  2CDU A;  2GMH A;  3ABV A;  3CPI G;  3L1R A;  3NHO X;  3BNU A;  1GRE A;  4EM4 A;  3BI4 A;  3AYL A;  2H88 A;  3KPF A;  2GVC A;  3O0H A;  4H2Q A;  4P9S A;  2GMJ A;  1F8S A;  1KFY A;  3AE9 A;  5U1O A;  4U8K A;  3LOV A;  1C25 A;  4EIQ A;  1E1N A;  1GRT A;  1NHS A;  5FS9 A;  5HXI A;  3AXB A;  2NVK X;  2JK6 A;  4RG4 A;  1H6V A;  1WV9 A;  1MOK A;  1YT8 A;  1Q1R A;  1S2Y A;  3VRD B;  4A7A A;  2BS3 A;  2IID A;  1N4U A;  4U8N A;  3NYF A;  1FEC A;  3CNT A;  4YKG A;  2XLP A;  1NHR A;  2JKC A;  4RG3 A;  2V5Z A;  2J6P A;  4Z43 A;  5J7X A;  5BUK A;  2WU2 A;  2A8X A;  4CCQ A;  2K0Z A;  1NG3 A;  2GAG B;  4J56 A;  4CY8 A;  3UOV A;  3TP9 A;  2I0Z A;  1LTX R;  2WPC A;  3QVR A;  4EIP A;  5IPY A;  2WQY A;  1TDN A;  2WES A;  1DOD A;  3GYJ A;  1YS0 A;  3D1C A;  2BXS A;  4REK A;  4CNK A;  1HYU A;  2RGO A;  3GD4 A;  3UTN X;  3IWH A;  3CNS A;  1VG0 A;  2C7G A;  4CRT A;  4EMW A;  2ORA A;  1RSG A;  2VVL A;  2XLT A;  4GCM A;  2B7S A;  3TG1 B;  4Y4N A;  4K5S A;  3PS9 A;  4EQX A;  1L9D A;  2TPR A;  1URH A;  2C70 A;  4D04 A;  4OVI A;  3F4A A;  4Z2U A;  2YR4 A;  4C5O A;  3H8I A;  1D7L A;  3FLH A;  4DGK A;  1QXN A;  2R46 A;  4ZN0 A;  3ITJ A;  2YLZ A;  1HZM A;  2EG4 B;  2BAB A;  2WDR A;  4B64 A;  3NLC A;  3CPJ G;  3NTA A;  5CQF A;  2EQ7 A;  4OPC A;  4Y4L A;  3QSM A;  3K7T A;  1PN0 A;  1GRG A;  2BK4 A;  4TLX A;  2YVF A;  3K7Q X;  3IPP A;  2JBV A;  3AE5 A;  1H7W A;  1CJ2 A;  1YQ3 A;  1CL0 A;  3Q9T A;  3GMC A;  4A5L A;  3B6D A;  1ZKQ A;  1YY5 A;  4FX9 A;  2WOI A;  1EBD A;  2DKI A;  5M0Z A;  3LZX A;  4TM3 A;  1UAR A;  1CC4 A;  1TYT A;  4CNJ A;  2XFU A;  3BHF A;  3OC4 A;  4FDC B;  5KOW A;  1PBD A;  1ZOV A;  3BNM A;  3D1P A;  1CWS A;  1B37 A;  4YTM A;  2MOI A;  1DJQ A;  4APN A;  3IHM A;  1VRQ B;  4OPI A;  1EL8 A;  1H82 A;  4J57 A;  3C4N A;  4E0V A;  2B9Y A;  3GRT A;  1Q1W A;  2CFY A;  2VRM A;  2ZZB A;  2XVI A;  4B63 A;  3OLH A;  1TDK A;  2UZZ A;  2HHG A;  1PJ6 A;  4I58 A;  4IVM B;  1Z6L A;  2FJB A;  2OLN A;  2XFO A;  1E1L A;  5FS7 A;  3B3R A;  1PJ7 A;  3HZL A;  3Q6J A;  1YMK A;  3O3W A;  1IUW A;  1H81 A;  1KSS A;  2XVF A;  2XLS A;  3SGL A;  3HZU A;  1FCD A;  1H86 A;  4Z25 A;  4A6N A;  3CGD A;  1TRB A;  2BCG G;  4F67 A;  5DBJ A;  3VQR A;  2B9W A;  1CF3 A;  3AEE A;  4KPR A;  1ELI A;  2X8C A;  5U63 A;  4AP3 A;  3AYJ A;  1NHQ A;  4ECH A;  4Y4M A;  2Y6R A;  4PAA A;  3GDN A;  4CY6 A;  3AE1 A;  4JNQ A;  3NG7 X;  4X4J A;  3KA7 A;  1KDG A;  4H2P A;  3S61 A;  1B8S A;  1BGJ A;  3AD7 B;  1GES A;  2EG4 A;  3AEC A;  4B1B A;  4C77 A;  1ZY8 A;  3NH3 X;  2AQJ A;  3AEA A;  3CGC A;  4JDR A;  3NK0 X;  5HBO A;  3DGZ A;  4H4S A;  2DCQ A;  1DXL A;  3QFB A;  1YQZ A;  2EQ6 A;  4JNA A;  4D03 A;  2C72 A;  2A2K A;  4B69 A;  4Z2T A;  2X99 A;  4C3X A;  4LU6 A;  1YML A;  1GET A;  1IUV A;  1GRF A;  3VRB A;  4X9M A;  3DA1 A;  3IHG A;  5U25 A;  1OJD A;  2R9Z A;  1GAL A;  2UZQ A;  3RED A;  3ATQ A;  4GR1 A;  1BOI A;  2YG6 A;  4H7U A;  4ZCD A;  2XVH A;  2YLT A;  1GPE A;  3GWD A;  1PS9 A;  3FIM B;  3IF9 A;  4CCR A;  4EM3 A;  3HIX A;  3EAO A;  2MRM A;  3HWI A;  1D4E A;  1E39 A;  1PBF A;  4TM0 A;  1TDO A;  3K7M X;  1BOH A;  2V3B A;  3NGC X;  3DK9 A;  3FS5 A;  3NKS A;  1FOH A;  2GEW A;  2QCU A;  1KF6 A;  1P2H A;  4YSY A;  2YVG A;  1QJD A;  3JSK A;  5KVH A;  1L9C A;  2WP9 A;  3DJE A;  4H2R A;  2QA1 A;  4AOS A;  1NHP A;  2YAU A;  1OJA A;  1K0L A;  4H2N A;  1PXB A;  2V3A A;  4K7Z A;  3RHA A;  1GTE A;  3NK2 X;  4USQ A;  2JB2 A;  2WET A;  3UKK A;  3D8X A;  2H89 A;  5FMH A;  4A6N B;  3DH9 A;  2YLW A;  1B5Q A;  1DJN A;  2BA9 A;  2BC1 A;  1O95 A;  3BHK A;  1DOC A;  3LB8 A;  4GDP A;  4A9W A;  4EQW A;  5KOX A;  4YWO A;  2CUL A;  3AWI A;  3II4 A;  2V61 A;  4USR A;  1CWT A;  3P3A A;  1D7Y A;  2B9X A;  2R4E A;  5FS6 A;  3ALL A;  3KU9 A;  1W4X A;  3RP6 A;  2NPX A;  4ICY A;  5GSN A;  1UKV G;  3SQP A;  3V3N A;  1LPF A;  2VSW A;  2WHD A;  2FJD A;  2FBW A;  4H4R A;  4DSH A;  1BZL A;  1D4C A;  2GR3 A;  3R2U A;  3F8R A;  5HBQ A;  1BF3 A;  1M64 A;  1T3K A;  5C2T A;  5HBP A;  1OKG A;  1F6M A;  2BC0 A;  3NHV A;  3BI2 A;  1KSU A;  2C3C A;  2VRL A;  3NIX A;  2AAQ A;  3VRA A;  3E1T A;  3LXD A;  4AT0 A;  3GYI A;  2YR6 A;  4U8M A;  2YG4 A;  4I59 A;  5J60 A;  2GQF A;  3M0O A;  4BK2 A;  1CWR A;  1IUX A;  2YLR A;  1CJ4 A;  3DGH A;  2KL3 A;  4J2W A;  4Z44 A;  4YSH A;  3GMB A;  2WS3 A;  5IQ4 A;  1IUU A;  1GOS A;  4UP3 A;  3UTG A;  4OCG A;  3UKP A;  2R0C A;  3ALJ A;  4H4W A;  4U8L A;  3M13 A;  1B4V A;  2GH5 A;  3KVE A;  2R0P A;  4A79 A;  1MXT A;  1VQW A;  5KVI A;  3AAX A;  4ADW A;  1PBC A;  2C75 A;  2X8G A;  1TDF A;  3FG2 P;  2BXR A;  4ZCC A;  4DNA A;  4EMJ A;  4K5R A;  1LV0 A;  2QA2 A;  2ZZ0 A;  4H4Q A;  3P4Q A;  3RNM A;  2GF3 A;  3NNE A;  4U2S A;  1X31 B;  2FSX A;  2GRT A;  2GV8 A;  3UP5 A;  1QO8 A;  1FEA A;  3PO7 A;  3P1W A;  3AD9 B;  2WP5 A;  1GN0 A;  3SFE A;  4AP1 A;  3DJG X;  3FOJ A;  3OZ2 A;  4H4U A;  2BAC A;  5EB5 A;  1H83 A;  3DK4 A;  2OLO A;  2XVJ A;  3FMW A;  2GB0 A;  1N4W A;  1GEU A;  1DOE A;  1YKJ A;  1OJC A;  4XXG A;  4A99 A;  1BKW A;  4Z2R A;  1JRY A;  3AEG A;  5GRT A;  5JCM A;  2XLU A;  4UDP A;  1E1M A;  4B66 A;  1CJ3 A;  3UTE A;  3P4P A;  4YTN A;  3L8K A;  4HB9 A;  2XVE A;  2X8H A;  3G5S A;  3UKA A;  5ER0 A;  4GRT A;  2W0H A;  1RP0 A;  3G5R A;  1H7X A;  3G5Q A;  4JN9 A;  3ZDN A;  4CBQ A;  1EL7 A;  3AE2 A;  4BJZ A;  2YG7 A;  1E6E A;  2Q6U A;  5JCK A;  3NT6 A;  1M6I A;  2B7R A;  3LAD A;  4TM1 A;  2TMD A;  4MJW A;  4YSX A;  2Q0K A;  3DJD A;  3KD9 A;  3SFD A;  1NG4 A;  5JCL A;  1GRH A;  3I6D A;  3P9U A;  4NTD A;  1PHH A;  3C96 A;  5LAM A;  2Q0L A;  4UDQ A;  4YT0 A;  3ICS A;  2E1M A;  2C67 A;  3IWA A;  1O94 A;  2OAM A;  3CNJ A;  4NZH A;  3G5J A;  4U8O A;  5FS8 A;  3AE6 A;  3AYI A;  4H4Z A;  2YG3 A;  3F8D A;  2BS4 A;  4WH7 A;  4DSG A;  4AT2 A;  2RAB A;  3DK8 A;  3K9R A;  3NYC A;  2WLR A;  2WOW A;  3VR9 A;  4BUR A;  1F8R A;  5KXJ A;  2R4J A;  1YMD A;  3CN8 A;  3GK5 A;  1DOB A;  3AE4 A;  4JGT A;  1O5W A;  4XWZ A;  2V60 A;  3K30 A;  3R9U A;  1N4V A;  1PBB A;  1YQ4 A;  2WOV A;  4JQ9 A;  3FNJ A;  2XDO A;  4BK1 A;  1PJ5 A;  3EF6 A;  2YQU A;  3NN6 X;  2YR5 A;  1GTH A;  2J3N A;  3ADA B;  1ONF A;  3OP3 A;  3AB1 A;  2JTR A;  2VVL G;  3QSE A;  3LZW A;  2A87 A;  2WPE A;  2QAE A;  4U8J A;  2GAH B;  3P4R A;  4OPU A;  5LV9 A;  4BJY A;  2GQW A;  4J36 A;  4EMI A;  3NTD A;  1ORB A;  4IV9 A;  3UOZ A;  2BK3 A;  1H84 A;  1NEN A;  3QSS A;  1E7P A;  1K4Q A;  1Q9I A;  1ZP0 A;  1E0C A;  3ICR A;  2JAE A;  3FPZ A;  4YSZ A;  3NN0 X;  2XCG A;  4FK1 C;  4K8D A;  3KLJ A;  3URH A;  3I2V A;  3GDP A;  3CIR A;  1GV4 A;  3TG3 A;  1LJ1 A;  2PYX A;  1SEZ A;  1XPQ A;  1PBE A;  3P4S A;  1PXA A;  4NEV A;  4X9N A;  5JCN A;  2WDQ A;  2C66 A;  2ZBW A;  5EB4 A;  1QLB A;  1RHD A;  2IFV A;  3SM8 A;  4LII A;  1Y56 A;  3GRS A;  1DP2 A;  3AAY A;  4H4X A;  5L46 A;  3UKQ A;  4BK3 A;  4J34 A;  2C73 A;  2Z5X A;  1AOG A;  4B68 A;  2MOL A;  3AE8 A;  4H4P A;  2JTQ A;  1PXC A;  1TYP A;  2DKH A;  4NTC A;  3S5W A;  1VDC A;  4O5U A;  4BV6 A;  1JNZ A;  1VG9 A;  3I3U A;  1JRZ A;  1TQ1 A;  3COX A;  2F5Z A;  3AEF A;  4HA6 A;  2EQ8 A;  5HHF A;  1GRA A;  5BVA A;  1NAA A;  2OA1 A;  1XDI A;  2OAL A;  4J31 A;  3UP4 A;  4WX1 A;  1ZOY A;  2Z5Y A;  3ATR A;  3ISH A;  1ZDL A;  4U8P A;  1IUT A;  5TR3 A;  4H4Y A;  3F8P A;  2IFD A;  1CC6 A;  1CBO A;  1CC2 A;  1F8W A;  4Z24 A;  1OJ9 A;  5LAO A;  2A89 A;  4GUV A;  1ZMC A;  4H4T A;  4Z26 A;  3UKL A;  4GDE A;  2APG A;  3GSI A;  2IVD A;  2WPF A;  3IC9 A;  3WE0 A;  1JU2 A;  1NDA A;  3MZZ A;  1PDH A;  1CHU A;  2BK5 A;  4LA1 A;  1E1K A;  2E5V A;  3VR8 A;  3AED A;  1KNR A;  2VVM A;  4EQS A;  4YXD A;  2OUC A;  2GR0 A;  2GWF A;  4YKF A;  3CGB A;  4U2T A;  4A65 A;  2RGJ A;  1MO9 A;  1JEH A;  4IA6 A;  3V3O A;  1IJH A;  1N1P A;  1GMX A;  2R0G A;  3LJP A;  2YWL A;  4PAB A;  2X3N A;  3CGE A;  4TLZ A;  3ILM A;  5HPA A;  1LVL A;  5EBK A;  1L0V A;  1DNC A;  4AOX A;  5KWF A;  4C74 A;  1WHB A;  3CND A;  4K2X A;  3V76 A;  3UTH A;  2BCP A;  1GND A;  4OPL A;  2BS2 A;  3QVP A;  4UDR A;  4K22 A;  1ZK7 A;  1H4K X;  3ALM A;  2VZ2 A;  3QFA A;  1ZMD A;  4KX6 A;  3GWF A;  4YTP A;  1F3P A;  1D5T A;  3T37 A;  2YVJ A;  3UTF A;  5KRQ A;  4FK1 A;  2Y6Q A;  1Y56 B;  3FBS A;  5M10 A;  1S2Q A;  2B76 A;  3GD3 A;  2O9Z A;  4NEW A;  4H50 A;  3C4A A;  4OPD A;  1JOA A;  2FJA A;  1LQT A;  3AE7 A;  1Y0P A;  2XFN A;  4O5Q A;  1L9E A;  2ZZC A;  3PVC A;  1TDE A;  3BI5 A;  2RGH A;  3H4K A;  4IA5 A;  4N9X A;  1S3B A;  1XAN A;  2C65 A;  1RYI A;  2X50 A;  1ZX9 A;  2JB3 A;  4TM4 A;  3EPT A;  2V6O A;  3UCL A;  4B67 A;  1REO A;  2XFP A;  1NEK A;  3UKF A;  5BUL A;  2WEU A;  4WCT A;  2R45 A;  3I3L A;  2EG3 A;  3CNP A;  3AEB A;  3ZYX A;  5HY5 A;  1H4M X;  2GR1 A;  2IVE A;  3CTY A;  4J33 A;  1LQU A;  5EOW A;  2CVJ A;  1XHC A;  4OPG A;  5HBL A;  3ICT A;  1GT8 A;  4B65 A;  3H8L A;  3AE3 A;  1D4D A;  5BRT A;  3NK1 X;  1KNP A;  3EAN A;  2BYB A;  3IPO A;  4OPT A;  1GSN A;  2VOU A;  2WBA A;  3DME A;  3M12 A;  2VQ7 A;  1FEB A;  2YG5 A;  3KKJ A;  1EL5 A;  2Q7V A;  3AD8 B;  1IUS A;  5IQ1 A;  2WP6 A; 
#chains in the Genus database with same CATH topology
 2WLX A;  1EL9 A;  4JY2 A;  4M52 A;  3UOY A;  2E4G A;  1NPX A;  1FL2 A;  1GRB A;  2JB1 A;  1K0I A;  3UKH A;  2PHH A;  2YM1 A;  3HYX A;  4GF7 A;  4II3 A;  2YLX A;  1VEE A;  3RP8 A;  2ACZ A;  1K0J A;  1BWC A;  2FJE A;  1COY A;  1V59 A;  5C3J A;  3NRN A;  2ARD A;  4G9K A;  1P2E A;  1GER A;  1S3E A;  2XYO A;  3NYE A;  2C64 A;  4C3Y A;  3CPH G;  4NTE A;  2YM2 A;  1BGN A;  3UOX A;  4IVO B;  1JRX A;  4RSL A;  1YM9 A;  1CJC A;  2EQ9 A;  2WDV A;  1RHS A;  3QJ4 A;  4H4V A;  4JY3 A;  2XFQ A;  2WU5 A;  4XWR A;  5CKU A;  5JCI A;  2C3D A;  2XLR A;  1JNR A;  2YLS A;  4U8I A;  5HYM A;  4G74 A;  4EQR A;  3RP7 A;  2GR2 A;  4U2L A;  2VQB A;  2HQM A;  3DJJ A;  4WH9 A;  1GXF A;  2JTS A;  1QB0 A;  1OJT A;  2AR8 A;  2C76 A;  2CDU A;  2GMH A;  3ABV A;  3CPI G;  3L1R A;  3NHO X;  3BNU A;  1GRE A;  4EM4 A;  3BI4 A;  3AYL A;  2H88 A;  3KPF A;  2GVC A;  3O0H A;  4H2Q A;  4P9S A;  2GMJ A;  1F8S A;  1KFY A;  3AE9 A;  5U1O A;  4U8K A;  3LOV A;  1C25 A;  4EIQ A;  1E1N A;  1GRT A;  1NHS A;  3HYV A;  5FS9 A;  5HXI A;  3AXB A;  2NVK X;  2JK6 A;  4RG4 A;  1H6V A;  1WV9 A;  1MOK A;  1YT8 A;  1Q1R A;  1S2Y A;  3VRD B;  4AOX A;  4A7A A;  2BS3 A;  2IID A;  1N4U A;  4U8N A;  3NYF A;  1FEC A;  3CNT A;  4YKG A;  2XLP A;  1NHR A;  2JKC A;  4RG3 A;  2V5Z A;  2J6P A;  4Z43 A;  5J7X A;  5BUK A;  2WU2 A;  2A8X A;  4CCQ A;  2K0Z A;  1NG3 A;  2GAG B;  4J56 A;  4CY8 A;  3UOV A;  3TP9 A;  2I0Z A;  1LTX R;  2WPC A;  3QVR A;  4EIP A;  5IPY A;  2WQY A;  1TDN A;  2WES A;  1DOD A;  3GYJ A;  1YS0 A;  3D1C A;  2BXS A;  4REK A;  4CNK A;  1HYU A;  2RGO A;  3GD4 A;  3UTN X;  3IWH A;  3CNS A;  1VG0 A;  2C7G A;  4CRT A;  4EMW A;  2ORA A;  1RSG A;  2VVL A;  2XLT A;  4GCM A;  2B7S A;  3TG1 B;  4Y4N A;  4K5S A;  3PS9 A;  4EQX A;  1L9D A;  2TPR A;  1URH A;  2C70 A;  3T31 A;  4D04 A;  4OVI A;  3F4A A;  4Z2U A;  2YR4 A;  4C5O A;  3H8I A;  1D7L A;  3FLH A;  4DGK A;  1QXN A;  2R46 A;  4ZN0 A;  3ITJ A;  2YLZ A;  4G73 A;  3SXI A;  1HZM A;  2EG4 B;  2BAB A;  2WDR A;  4B64 A;  3NLC A;  3CPJ G;  3NTA A;  5CQF A;  2EQ7 A;  4OPC A;  4Y4L A;  3QSM A;  3K7T A;  1PN0 A;  1GRG A;  2BK4 A;  4TLX A;  2YVF A;  3SY4 A;  3K7Q X;  3IPP A;  2JBV A;  3AE5 A;  1H7W A;  1CJ2 A;  1YQ3 A;  3CMM A;  1CL0 A;  3Q9T A;  3GMC A;  4A5L A;  3B6D A;  1ZKQ A;  1YY5 A;  4FX9 A;  2WOI A;  1EBD A;  2DKI A;  5M0Z A;  3LZX A;  4TM3 A;  1UAR A;  1CC4 A;  1TYT A;  4CNJ A;  2XFU A;  3BHF A;  3OC4 A;  4FDC B;  5KOW A;  1PBD A;  1ZOV A;  3BNM A;  3D1P A;  1CWS A;  1B37 A;  4YTM A;  2MOI A;  1DJQ A;  4APN A;  3IHM A;  1VRQ B;  4OPI A;  1EL8 A;  1H82 A;  4J57 A;  3C4N A;  4E0V A;  2B9Y A;  3GRT A;  1Q1W A;  2CFY A;  2VRM A;  2ZZB A;  2XVI A;  4B63 A;  3OLH A;  1TDK A;  2UZZ A;  2HHG A;  1PJ6 A;  4I58 A;  4II2 A;  4IVM B;  1Z6L A;  2FJB A;  5KMS A;  2OLN A;  2XFO A;  1E1L A;  5FS7 A;  3B3R A;  1PJ7 A;  3HZL A;  3Q6J A;  1YMK A;  3O3W A;  1IUW A;  1H81 A;  1KSS A;  2XVF A;  2XLS A;  3SGL A;  3HZU A;  1FCD A;  1H86 A;  4Z25 A;  4A6N A;  3CGD A;  1TRB A;  2BCG G;  4F67 A;  5DBJ A;  3VQR A;  2B9W A;  1CF3 A;  3AEE A;  4KPR A;  1ELI A;  2X8C A;  5U63 A;  4AP3 A;  3AYJ A;  1NHQ A;  4ECH A;  4Y4M A;  2Y6R A;  4PAA A;  3GDN A;  3T2K A;  4CY6 A;  3AE1 A;  4JNQ A;  3NG7 X;  4X4J A;  3KA7 A;  1KDG A;  4H2P A;  3S61 A;  1B8S A;  1BGJ A;  3AD7 B;  1GES A;  2EG4 A;  3AEC A;  4B1B A;  4C77 A;  1ZY8 A;  3NH3 X;  2AQJ A;  3AEA A;  3CGC A;  4JDR A;  3NK0 X;  5HBO A;  3DGZ A;  4H4S A;  2DCQ A;  1DXL A;  3QFB A;  1YQZ A;  2EQ6 A;  4JNA A;  4D03 A;  2C72 A;  2A2K A;  4B69 A;  4Z2T A;  2X99 A;  4C3X A;  4LU6 A;  1YML A;  1GET A;  1IUV A;  1GRF A;  3VRB A;  4X9M A;  3DA1 A;  3IHG A;  5U25 A;  1OJD A;  2R9Z A;  1GAL A;  2UZQ A;  3RED A;  3ATQ A;  4GR1 A;  1BOI A;  2YG6 A;  4H7U A;  4ZCD A;  2XVH A;  2YLT A;  1GPE A;  3GWD A;  1PS9 A;  3FIM B;  3IF9 A;  4CCR A;  4EM3 A;  3HIX A;  3EAO A;  2MRM A;  3HWI A;  1D4E A;  1E39 A;  1PBF A;  4TM0 A;  1TDO A;  3K7M X;  1BOH A;  2V3B A;  3NGC X;  3DK9 A;  3FS5 A;  3NKS A;  1FOH A;  2GEW A;  2QCU A;  1KF6 A;  1P2H A;  4YSY A;  2YVG A;  1QJD A;  3JSK A;  5KVH A;  1L9C A;  2WP9 A;  3DJE A;  4H2R A;  2QA1 A;  4AOS A;  1NHP A;  2YAU A;  1OJA A;  1K0L A;  4H2N A;  3KPK A;  1PXB A;  5KWF A;  2V3A A;  4K7Z A;  3RHA A;  1GTE A;  3NK2 X;  4USQ A;  2JB2 A;  2WET A;  3UKK A;  3D8X A;  2H89 A;  5FMH A;  4A6N B;  3DH9 A;  2YLW A;  1B5Q A;  2BRY A;  1DJN A;  2BA9 A;  2BC1 A;  4NNJ A;  1O95 A;  3BHK A;  1DOC A;  3LB8 A;  4GDP A;  4A9W A;  4EQW A;  5KOX A;  2Q82 A;  4YWO A;  2CUL A;  3AWI A;  3II4 A;  2V61 A;  4USR A;  1CWT A;  3P3A A;  1D7Y A;  2B9X A;  2R4E A;  5FS6 A;  3ALL A;  3KU9 A;  1W4X A;  3RP6 A;  2NPX A;  4ICY A;  5GSN A;  1UKV G;  3SQP A;  3V3N A;  1LPF A;  2VSW A;  2WHD A;  2FJD A;  2FBW A;  4H4R A;  4DSH A;  1BZL A;  1D4C A;  2GR3 A;  3R2U A;  3F8R A;  5HBQ A;  1BF3 A;  1M64 A;  1T3K A;  5C2T A;  5HBP A;  1OKG A;  1F6M A;  2BC0 A;  3NHV A;  3BI2 A;  4G6G A;  1KSU A;  2C3C A;  2VRL A;  3NIX A;  2AAQ A;  3SZW A;  3E1T A;  3LXD A;  3VRA A;  4AT0 A;  3GYI A;  2YR6 A;  4U8M A;  2YG4 A;  4I59 A;  5J60 A;  2GQF A;  3SZ0 A;  3M0O A;  4BK2 A;  1CWR A;  1IUX A;  2YLR A;  1CJ4 A;  3DGH A;  2KL3 A;  4J2W A;  4Z44 A;  4YSH A;  3GMB A;  2WS3 A;  5IQ4 A;  1IUU A;  1GOS A;  4UP3 A;  3UTG A;  4OCG A;  3UKP A;  2R0C A;  3ALJ A;  4H4W A;  4U8L A;  3M13 A;  1B4V A;  2GH5 A;  3KVE A;  2R0P A;  4A79 A;  1MXT A;  1VQW A;  5KVI A;  3AAX A;  4ADW A;  1PBC A;  2C75 A;  2X8G A;  1TDF A;  3FG2 P;  2BXR A;  4ZCC A;  4DNA A;  4EMJ A;  4K5R A;  1LV0 A;  2QA2 A;  2ZZ0 A;  4H4Q A;  3P4Q A;  3RNM A;  2GF3 A;  3NNE A;  4U2S A;  1X31 B;  2FSX A;  2GRT A;  2GV8 A;  3SYI A;  1QO8 A;  1FEA A;  3PO7 A;  3P1W A;  3AD9 B;  3UP5 A;  2WP5 A;  1GN0 A;  3SFE A;  3SX6 A;  4AP1 A;  3DJG X;  3FOJ A;  3OZ2 A;  4H4U A;  2BAC A;  5EB5 A;  1H83 A;  3DK4 A;  2OLO A;  2XVJ A;  3FMW A;  2GB0 A;  1N4W A;  1GEU A;  1DOE A;  1YKJ A;  1OJC A;  4XXG A;  4A99 A;  1BKW A;  4Z2R A;  1JRY A;  3AEG A;  5GRT A;  5JCM A;  2XLU A;  4UDP A;  1E1M A;  4B66 A;  1CJ3 A;  3UTE A;  3P4P A;  4YTN A;  3L8K A;  4HB9 A;  2XVE A;  2X8H A;  3G5S A;  3UKA A;  5ER0 A;  4GRT A;  2W0H A;  1RP0 A;  3G5R A;  1H7X A;  3G5Q A;  4JN9 A;  3ZDN A;  4CBQ A;  1EL7 A;  3AE2 A;  4BJZ A;  2YG7 A;  1E6E A;  2Q6U A;  5JCK A;  3NT6 A;  1M6I A;  2B7R A;  3LAD A;  4TM1 A;  2TMD A;  4MJW A;  4YSX A;  2Q0K A;  3DJD A;  3KD9 A;  3SFD A;  1NG4 A;  5JCL A;  1GRH A;  3I6D A;  3P9U A;  5KMQ A;  4NTD A;  1PHH A;  3C96 A;  5LAM A;  2Q0L A;  4UDQ A;  4YT0 A;  3ICS A;  2E1M A;  2C67 A;  3IWA A;  3T14 A;  1O94 A;  2OAM A;  3CNJ A;  4NZH A;  3G5J A;  4U8O A;  5FS8 A;  3AE6 A;  3AYI A;  4H4Z A;  5KMP A;  2YG3 A;  2BRA A;  3F8D A;  2BS4 A;  4WH7 A;  4DSG A;  4AT2 A;  2RAB A;  3DK8 A;  3K9R A;  3NYC A;  2WLR A;  2WOW A;  3VR9 A;  4BUR A;  1F8R A;  5KXJ A;  2R4J A;  1YMD A;  3CN8 A;  3GK5 A;  1DOB A;  3AE4 A;  4JGT A;  1O5W A;  4XWZ A;  2V60 A;  3K30 A;  3R9U A;  1N4V A;  1PBB A;  3T2Z A;  1YQ4 A;  2WOV A;  4JQ9 A;  3FNJ A;  2XDO A;  4BK1 A;  1PJ5 A;  3EF6 A;  2YQU A;  3NN6 X;  2YR5 A;  1GTH A;  2J3N A;  3ADA B;  1ONF A;  3OP3 A;  3AB1 A;  2JTR A;  2VVL G;  3QSE A;  3LZW A;  2A87 A;  2WPE A;  2QAE A;  4U8J A;  2GAH B;  3P4R A;  4B68 A;  4OPU A;  5LV9 A;  4BJY A;  2GQW A;  4J36 A;  4EMI A;  3NTD A;  1ORB A;  4IV9 A;  3UOZ A;  2BK3 A;  1H84 A;  1NEN A;  3QSS A;  1E7P A;  1K4Q A;  1Q9I A;  1ZP0 A;  1E0C A;  3ICR A;  2JAE A;  3FPZ A;  4YSZ A;  3NN0 X;  2XCG A;  4FK1 C;  4K8D A;  3KLJ A;  3URH A;  3I2V A;  3GDP A;  3CIR A;  1GV4 A;  3TG3 A;  1LJ1 A;  2PYX A;  1SEZ A;  1XPQ A;  1PBE A;  3P4S A;  1PXA A;  4NEV A;  4X9N A;  5JCN A;  5KMR A;  2WDQ A;  2C66 A;  2ZBW A;  5EB4 A;  1QLB A;  4GAV A;  1RHD A;  2IFV A;  3SM8 A;  4LII A;  1Y56 A;  3GRS A;  1DP2 A;  3AAY A;  4H4X A;  5L46 A;  3UKQ A;  4BK3 A;  4J34 A;  2C73 A;  2Z5X A;  1AOG A;  4GAP A;  2MOL A;  3AE8 A;  4H4P A;  2JTQ A;  1PXC A;  1TYP A;  2DKH A;  4NTC A;  3S5W A;  1VDC A;  4O5U A;  4BV6 A;  1JNZ A;  1VG9 A;  3I3U A;  1JRZ A;  1TQ1 A;  3COX A;  2F5Z A;  3AEF A;  4HA6 A;  2EQ8 A;  5HHF A;  1GRA A;  5BVA A;  1NAA A;  2OA1 A;  1XDI A;  2OAL A;  4J31 A;  3UP4 A;  4WX1 A;  1ZOY A;  4NWZ A;  2Z5Y A;  3ATR A;  3ISH A;  1ZDL A;  4U8P A;  1IUT A;  5TR3 A;  4H4Y A;  3F8P A;  2IFD A;  1CC6 A;  1CBO A;  1CC2 A;  1F8W A;  4Z24 A;  1OJ9 A;  5LAO A;  2A89 A;  4GUV A;  1ZMC A;  4H4T A;  4Z26 A;  3UKL A;  4GDE A;  2APG A;  3GSI A;  2IVD A;  2WPF A;  3IC9 A;  3WE0 A;  1JU2 A;  1NDA A;  3MZZ A;  1PDH A;  1CHU A;  2BK5 A;  4LA1 A;  1E1K A;  2E5V A;  3VR8 A;  3AED A;  1KNR A;  2VVM A;  4EQS A;  4YXD A;  2OUC A;  2GR0 A;  2GWF A;  4YKF A;  3CGB A;  4U2T A;  4A65 A;  2RGJ A;  1MO9 A;  1JEH A;  4IA6 A;  3V3O A;  1IJH A;  1N1P A;  1GMX A;  2R0G A;  3LJP A;  2YWL A;  4PAB A;  2X3N A;  3CGE A;  4TLZ A;  3ILM A;  5HPA A;  1LVL A;  2C4C A;  3GYX A;  1DNC A;  5EBK A;  1L0V A;  3SZC A;  3HYW A;  4C74 A;  1WHB A;  3CND A;  4K2X A;  3V76 A;  3UTH A;  2BCP A;  1GND A;  4OPL A;  2BS2 A;  3QVP A;  4UDR A;  4K22 A;  1ZK7 A;  1H4K X;  3ALM A;  2VZ2 A;  3QFA A;  1ZMD A;  4KX6 A;  3GWF A;  4YTP A;  1F3P A;  1D5T A;  3T37 A;  2YVJ A;  3UTF A;  5KRQ A;  4FK1 A;  2Y6Q A;  1Y56 B;  3FBS A;  5M10 A;  1S2Q A;  2B76 A;  3GD3 A;  2O9Z A;  4NEW A;  4H50 A;  3C4A A;  4OPD A;  1JOA A;  2FJA A;  3T0K A;  1LQT A;  3AE7 A;  1Y0P A;  2XFN A;  4O5Q A;  1L9E A;  2ZZC A;  3PVC A;  1TDE A;  3BI5 A;  2RGH A;  3H4K A;  4IA5 A;  4N9X A;  1S3B A;  1XAN A;  2C65 A;  1RYI A;  2X50 A;  1ZX9 A;  2JB3 A;  4TM4 A;  3EPT A;  2V6O A;  3UCL A;  4B67 A;  1REO A;  2XFP A;  1NEK A;  3UKF A;  5BUL A;  4G6H A;  2WEU A;  4WCT A;  2R45 A;  3I3L A;  2EG3 A;  3CNP A;  5KNL A;  3AEB A;  3ZYX A;  5HY5 A;  1H4M X;  2GR1 A;  2IVE A;  3CTY A;  4J33 A;  1LQU A;  5EOW A;  2CVJ A;  1XHC A;  4OPG A;  5HBL A;  3ICT A;  1GT8 A;  4B65 A;  3H8L A;  3AE3 A;  1D4D A;  5BRT A;  3NK1 X;  1KNP A;  3EAN A;  2BYB A;  3IPO A;  4OPT A;  1GSN A;  2VOU A;  2WBA A;  3DME A;  3M12 A;  2VQ7 A;  1FEB A;  2YG5 A;  3KKJ A;  1EL5 A;  3SZF A;  2Q7V A;  3T2Y A;  3AD8 B;  1IUS A;  5IQ1 A;  2WP6 A; 
#chains in the Genus database with same CATH homology
 2WLX A;  1EL9 A;  4JY2 A;  4M52 A;  3UOY A;  2E4G A;  1NPX A;  1FL2 A;  1GRB A;  2JB1 A;  1K0I A;  3UKH A;  2PHH A;  2YM1 A;  3HYX A;  4GF7 A;  4II3 A;  2YLX A;  1VEE A;  3RP8 A;  2ACZ A;  1K0J A;  1BWC A;  2FJE A;  1COY A;  1V59 A;  5C3J A;  3NRN A;  2ARD A;  4G9K A;  1P2E A;  1GER A;  1S3E A;  2XYO A;  3NYE A;  2C64 A;  4C3Y A;  3CPH G;  4NTE A;  2YM2 A;  1BGN A;  3UOX A;  4IVO B;  1JRX A;  4RSL A;  1YM9 A;  1CJC A;  2EQ9 A;  2WDV A;  1RHS A;  3QJ4 A;  4H4V A;  4JY3 A;  2XFQ A;  2WU5 A;  4XWR A;  5CKU A;  5JCI A;  2C3D A;  2XLR A;  1JNR A;  2YLS A;  4U8I A;  5HYM A;  4G74 A;  4EQR A;  3RP7 A;  2GR2 A;  4U2L A;  2VQB A;  2HQM A;  3DJJ A;  4WH9 A;  1GXF A;  2JTS A;  1QB0 A;  1OJT A;  2AR8 A;  2C76 A;  2CDU A;  2GMH A;  3ABV A;  3CPI G;  3L1R A;  3NHO X;  3BNU A;  1GRE A;  4EM4 A;  3BI4 A;  3AYL A;  2H88 A;  3KPF A;  2GVC A;  3O0H A;  4H2Q A;  4P9S A;  2GMJ A;  1F8S A;  1KFY A;  3AE9 A;  5U1O A;  4U8K A;  3LOV A;  1C25 A;  4EIQ A;  1E1N A;  1GRT A;  1NHS A;  3HYV A;  5FS9 A;  5HXI A;  3AXB A;  2NVK X;  2JK6 A;  4RG4 A;  1H6V A;  1WV9 A;  1MOK A;  1YT8 A;  1Q1R A;  1S2Y A;  3VRD B;  4AOX A;  4A7A A;  2BS3 A;  2IID A;  1N4U A;  4U8N A;  3NYF A;  1FEC A;  3CNT A;  4YKG A;  2XLP A;  1NHR A;  2JKC A;  4RG3 A;  2V5Z A;  2J6P A;  4Z43 A;  5J7X A;  5BUK A;  2WU2 A;  2A8X A;  4CCQ A;  2K0Z A;  1NG3 A;  2GAG B;  4J56 A;  4CY8 A;  3UOV A;  3TP9 A;  2I0Z A;  1LTX R;  2WPC A;  3QVR A;  4EIP A;  5IPY A;  2WQY A;  1TDN A;  2WES A;  1DOD A;  3GYJ A;  1YS0 A;  3D1C A;  2BXS A;  4REK A;  4CNK A;  1HYU A;  2RGO A;  3GD4 A;  3UTN X;  3IWH A;  3CNS A;  1VG0 A;  2C7G A;  4CRT A;  4EMW A;  2ORA A;  1RSG A;  2VVL A;  2XLT A;  4GCM A;  2B7S A;  3TG1 B;  4Y4N A;  4K5S A;  3PS9 A;  4EQX A;  1L9D A;  2TPR A;  1URH A;  2C70 A;  3T31 A;  4D04 A;  4OVI A;  3F4A A;  4Z2U A;  2YR4 A;  4C5O A;  3H8I A;  1D7L A;  3FLH A;  4DGK A;  1QXN A;  2R46 A;  4ZN0 A;  3ITJ A;  2YLZ A;  4G73 A;  3SXI A;  1HZM A;  2EG4 B;  2BAB A;  2WDR A;  4B64 A;  3NLC A;  3CPJ G;  3NTA A;  5CQF A;  2EQ7 A;  4OPC A;  4Y4L A;  3QSM A;  3K7T A;  1PN0 A;  1GRG A;  2BK4 A;  4TLX A;  2YVF A;  3SY4 A;  3K7Q X;  3IPP A;  2JBV A;  3AE5 A;  1H7W A;  1CJ2 A;  1YQ3 A;  3CMM A;  1CL0 A;  3Q9T A;  3GMC A;  4A5L A;  3B6D A;  1ZKQ A;  1YY5 A;  4FX9 A;  2WOI A;  1EBD A;  2DKI A;  5M0Z A;  3LZX A;  4TM3 A;  1UAR A;  1CC4 A;  1TYT A;  4CNJ A;  2XFU A;  3BHF A;  3OC4 A;  4FDC B;  5KOW A;  1PBD A;  1ZOV A;  3BNM A;  3D1P A;  1CWS A;  1B37 A;  4YTM A;  2MOI A;  1DJQ A;  4APN A;  3IHM A;  1VRQ B;  4OPI A;  1EL8 A;  1H82 A;  4J57 A;  3C4N A;  4E0V A;  2B9Y A;  3GRT A;  1Q1W A;  2CFY A;  2VRM A;  2ZZB A;  2XVI A;  4B63 A;  3OLH A;  1TDK A;  2UZZ A;  2HHG A;  1PJ6 A;  4I58 A;  4II2 A;  4IVM B;  1Z6L A;  2FJB A;  5KMS A;  2OLN A;  2XFO A;  1E1L A;  5FS7 A;  3B3R A;  1PJ7 A;  3HZL A;  3Q6J A;  1YMK A;  3O3W A;  1IUW A;  1H81 A;  1KSS A;  2XVF A;  2XLS A;  3SGL A;  3HZU A;  1FCD A;  1H86 A;  4Z25 A;  4A6N A;  3CGD A;  1TRB A;  2BCG G;  4F67 A;  5DBJ A;  3VQR A;  2B9W A;  1CF3 A;  3AEE A;  4KPR A;  1ELI A;  2X8C A;  5U63 A;  4AP3 A;  3AYJ A;  1NHQ A;  4ECH A;  4Y4M A;  2Y6R A;  4PAA A;  3GDN A;  3T2K A;  4CY6 A;  3AE1 A;  4JNQ A;  3NG7 X;  4X4J A;  3KA7 A;  1KDG A;  4H2P A;  3S61 A;  1B8S A;  1BGJ A;  3AD7 B;  1GES A;  2EG4 A;  3AEC A;  4B1B A;  4C77 A;  1ZY8 A;  3NH3 X;  2AQJ A;  3AEA A;  3CGC A;  4JDR A;  3NK0 X;  5HBO A;  3DGZ A;  4H4S A;  2DCQ A;  1DXL A;  3QFB A;  1YQZ A;  2EQ6 A;  4JNA A;  4D03 A;  2C72 A;  2A2K A;  4B69 A;  4Z2T A;  2X99 A;  4C3X A;  4LU6 A;  1YML A;  1GET A;  1IUV A;  1GRF A;  3VRB A;  4X9M A;  3DA1 A;  3IHG A;  5U25 A;  1OJD A;  2R9Z A;  1GAL A;  2UZQ A;  3RED A;  3ATQ A;  4GR1 A;  1BOI A;  2YG6 A;  4H7U A;  4ZCD A;  2XVH A;  2YLT A;  1GPE A;  3GWD A;  1PS9 A;  3FIM B;  3IF9 A;  4CCR A;  4EM3 A;  3HIX A;  3EAO A;  2MRM A;  3HWI A;  1D4E A;  1E39 A;  1PBF A;  4TM0 A;  1TDO A;  3K7M X;  1BOH A;  2V3B A;  3NGC X;  3DK9 A;  3FS5 A;  3NKS A;  1FOH A;  2GEW A;  2QCU A;  1KF6 A;  1P2H A;  4YSY A;  2YVG A;  1QJD A;  3JSK A;  5KVH A;  1L9C A;  2WP9 A;  3DJE A;  4H2R A;  2QA1 A;  4AOS A;  1NHP A;  2YAU A;  1OJA A;  1K0L A;  4H2N A;  3KPK A;  1PXB A;  5KWF A;  2V3A A;  4K7Z A;  3RHA A;  1GTE A;  3NK2 X;  4USQ A;  2JB2 A;  2WET A;  3UKK A;  3D8X A;  2H89 A;  5FMH A;  4A6N B;  3DH9 A;  2YLW A;  1B5Q A;  2BRY A;  1DJN A;  2BA9 A;  2BC1 A;  4NNJ A;  1O95 A;  3BHK A;  1DOC A;  3LB8 A;  4GDP A;  4A9W A;  4EQW A;  5KOX A;  4YWO A;  2CUL A;  3AWI A;  3II4 A;  2V61 A;  4USR A;  1CWT A;  3P3A A;  1D7Y A;  2B9X A;  2R4E A;  5FS6 A;  3ALL A;  3KU9 A;  1W4X A;  3RP6 A;  2NPX A;  4ICY A;  5GSN A;  1UKV G;  3SQP A;  3V3N A;  1LPF A;  2VSW A;  2WHD A;  2FJD A;  2FBW A;  4H4R A;  4DSH A;  1BZL A;  1D4C A;  2GR3 A;  3R2U A;  3F8R A;  5HBQ A;  1BF3 A;  1M64 A;  1T3K A;  5C2T A;  5HBP A;  1OKG A;  1F6M A;  2BC0 A;  3NHV A;  3BI2 A;  4G6G A;  1KSU A;  2C3C A;  2VRL A;  3NIX A;  2AAQ A;  3SZW A;  3E1T A;  3LXD A;  3VRA A;  4AT0 A;  3GYI A;  2YR6 A;  4U8M A;  2YG4 A;  4I59 A;  5J60 A;  2GQF A;  3SZ0 A;  3M0O A;  4BK2 A;  1CWR A;  1IUX A;  2YLR A;  1CJ4 A;  3DGH A;  2KL3 A;  4J2W A;  4Z44 A;  4YSH A;  3GMB A;  2WS3 A;  5IQ4 A;  1IUU A;  1GOS A;  4UP3 A;  3UTG A;  4OCG A;  3UKP A;  2R0C A;  3ALJ A;  4H4W A;  4U8L A;  3M13 A;  1B4V A;  2GH5 A;  3KVE A;  2R0P A;  4A79 A;  1MXT A;  1VQW A;  5KVI A;  3AAX A;  4ADW A;  1PBC A;  2C75 A;  2X8G A;  1TDF A;  3FG2 P;  2BXR A;  4ZCC A;  4DNA A;  4EMJ A;  4K5R A;  1LV0 A;  2QA2 A;  2ZZ0 A;  4H4Q A;  3P4Q A;  3RNM A;  2GF3 A;  3NNE A;  4U2S A;  1X31 B;  2FSX A;  2GRT A;  2GV8 A;  3SYI A;  1QO8 A;  1FEA A;  3PO7 A;  3P1W A;  3AD9 B;  3UP5 A;  2WP5 A;  1GN0 A;  3SFE A;  3SX6 A;  4AP1 A;  3DJG X;  3FOJ A;  3OZ2 A;  4H4U A;  2BAC A;  5EB5 A;  1H83 A;  3DK4 A;  2OLO A;  2XVJ A;  3FMW A;  2GB0 A;  1N4W A;  1GEU A;  1DOE A;  1YKJ A;  1OJC A;  4XXG A;  4A99 A;  1BKW A;  4Z2R A;  1JRY A;  3AEG A;  5GRT A;  5JCM A;  2XLU A;  4UDP A;  1E1M A;  4B66 A;  1CJ3 A;  3UTE A;  3P4P A;  4YTN A;  3L8K A;  4HB9 A;  2XVE A;  2X8H A;  3G5S A;  3UKA A;  5ER0 A;  4GRT A;  2W0H A;  1RP0 A;  3G5R A;  1H7X A;  3G5Q A;  4JN9 A;  3ZDN A;  4CBQ A;  1EL7 A;  3AE2 A;  4BJZ A;  2YG7 A;  1E6E A;  2Q6U A;  5JCK A;  3NT6 A;  1M6I A;  2B7R A;  3LAD A;  4TM1 A;  2TMD A;  4MJW A;  4YSX A;  2Q0K A;  3DJD A;  3KD9 A;  3SFD A;  1NG4 A;  5JCL A;  1GRH A;  3I6D A;  3P9U A;  5KMQ A;  4NTD A;  1PHH A;  3C96 A;  5LAM A;  2Q0L A;  4UDQ A;  4YT0 A;  3ICS A;  2E1M A;  2C67 A;  3IWA A;  3T14 A;  1O94 A;  2OAM A;  3CNJ A;  4NZH A;  3G5J A;  4U8O A;  5FS8 A;  3AE6 A;  3AYI A;  4H4Z A;  5KMP A;  2YG3 A;  2BRA A;  3F8D A;  2BS4 A;  4WH7 A;  4DSG A;  4AT2 A;  2RAB A;  3DK8 A;  3K9R A;  3NYC A;  2WLR A;  2WOW A;  3VR9 A;  4BUR A;  1F8R A;  5KXJ A;  2R4J A;  1YMD A;  3CN8 A;  3GK5 A;  1DOB A;  3AE4 A;  4JGT A;  1O5W A;  4XWZ A;  2V60 A;  3K30 A;  3R9U A;  1N4V A;  1PBB A;  3T2Z A;  1YQ4 A;  2WOV A;  4JQ9 A;  3FNJ A;  2XDO A;  4BK1 A;  1PJ5 A;  3EF6 A;  2YQU A;  3NN6 X;  2YR5 A;  1GTH A;  2J3N A;  3ADA B;  1ONF A;  3OP3 A;  3AB1 A;  2JTR A;  2VVL G;  3QSE A;  3LZW A;  2A87 A;  2WPE A;  2QAE A;  4U8J A;  2GAH B;  3P4R A;  4B68 A;  4OPU A;  5LV9 A;  4BJY A;  2GQW A;  4J36 A;  4EMI A;  3NTD A;  1ORB A;  4IV9 A;  3UOZ A;  2BK3 A;  1H84 A;  1NEN A;  3QSS A;  1E7P A;  1K4Q A;  1Q9I A;  1ZP0 A;  1E0C A;  3ICR A;  2JAE A;  3FPZ A;  4YSZ A;  3NN0 X;  2XCG A;  4FK1 C;  4K8D A;  3KLJ A;  3URH A;  3I2V A;  3GDP A;  3CIR A;  1GV4 A;  3TG3 A;  1LJ1 A;  2PYX A;  1SEZ A;  1XPQ A;  1PBE A;  3P4S A;  1PXA A;  4NEV A;  4X9N A;  5JCN A;  5KMR A;  2WDQ A;  2C66 A;  2ZBW A;  5EB4 A;  1QLB A;  4GAV A;  1RHD A;  2IFV A;  3SM8 A;  4LII A;  1Y56 A;  3GRS A;  1DP2 A;  3AAY A;  4H4X A;  5L46 A;  3UKQ A;  4BK3 A;  4J34 A;  2C73 A;  2Z5X A;  1AOG A;  4GAP A;  2MOL A;  3AE8 A;  4H4P A;  2JTQ A;  1PXC A;  1TYP A;  2DKH A;  4NTC A;  3S5W A;  1VDC A;  4O5U A;  4BV6 A;  1JNZ A;  1VG9 A;  3I3U A;  1JRZ A;  1TQ1 A;  3COX A;  2F5Z A;  3AEF A;  4HA6 A;  2EQ8 A;  5HHF A;  1GRA A;  5BVA A;  1NAA A;  2OA1 A;  1XDI A;  2OAL A;  4J31 A;  3UP4 A;  4WX1 A;  1ZOY A;  4NWZ A;  2Z5Y A;  3ATR A;  3ISH A;  1ZDL A;  4U8P A;  1IUT A;  5TR3 A;  4H4Y A;  3F8P A;  2IFD A;  1CC6 A;  1CBO A;  1CC2 A;  1F8W A;  4Z24 A;  1OJ9 A;  5LAO A;  2A89 A;  4GUV A;  1ZMC A;  4H4T A;  4Z26 A;  3UKL A;  4GDE A;  2APG A;  3GSI A;  2IVD A;  2WPF A;  3IC9 A;  3WE0 A;  1JU2 A;  1NDA A;  3MZZ A;  1PDH A;  1CHU A;  2BK5 A;  4LA1 A;  1E1K A;  2E5V A;  3VR8 A;  3AED A;  1KNR A;  2VVM A;  4EQS A;  4YXD A;  2OUC A;  2GR0 A;  2GWF A;  4YKF A;  3CGB A;  4U2T A;  4A65 A;  2RGJ A;  1MO9 A;  1JEH A;  4IA6 A;  3V3O A;  1IJH A;  1N1P A;  1GMX A;  2R0G A;  3LJP A;  2YWL A;  4PAB A;  2X3N A;  3CGE A;  4TLZ A;  3ILM A;  5HPA A;  1LVL A;  2C4C A;  3GYX A;  1DNC A;  5EBK A;  1L0V A;  3SZC A;  3HYW A;  4C74 A;  1WHB A;  3CND A;  4K2X A;  3V76 A;  3UTH A;  2BCP A;  1GND A;  4OPL A;  2BS2 A;  3QVP A;  4UDR A;  4K22 A;  1ZK7 A;  1H4K X;  3ALM A;  2VZ2 A;  3QFA A;  1ZMD A;  4KX6 A;  3GWF A;  4YTP A;  1F3P A;  1D5T A;  3T37 A;  2YVJ A;  3UTF A;  5KRQ A;  4FK1 A;  2Y6Q A;  1Y56 B;  3FBS A;  5M10 A;  1S2Q A;  2B76 A;  3GD3 A;  2O9Z A;  4NEW A;  4H50 A;  3C4A A;  4OPD A;  1JOA A;  2FJA A;  3T0K A;  1LQT A;  3AE7 A;  1Y0P A;  2XFN A;  4O5Q A;  1L9E A;  2ZZC A;  3PVC A;  1TDE A;  3BI5 A;  2RGH A;  3H4K A;  4IA5 A;  4N9X A;  1S3B A;  1XAN A;  2C65 A;  1RYI A;  2X50 A;  1ZX9 A;  2JB3 A;  4TM4 A;  3EPT A;  2V6O A;  3UCL A;  4B67 A;  1REO A;  2XFP A;  1NEK A;  3UKF A;  5BUL A;  4G6H A;  2WEU A;  4WCT A;  2R45 A;  3I3L A;  2EG3 A;  3CNP A;  5KNL A;  3AEB A;  3ZYX A;  5HY5 A;  1H4M X;  2GR1 A;  2IVE A;  3CTY A;  4J33 A;  1LQU A;  5EOW A;  2CVJ A;  1XHC A;  4OPG A;  5HBL A;  3ICT A;  1GT8 A;  4B65 A;  3H8L A;  3AE3 A;  1D4D A;  5BRT A;  3NK1 X;  1KNP A;  3EAN A;  2BYB A;  3IPO A;  4OPT A;  1GSN A;  2VOU A;  2WBA A;  3DME A;  3M12 A;  2VQ7 A;  1FEB A;  2YG5 A;  3KKJ A;  1EL5 A;  3SZF A;  2Q7V A;  3T2Y A;  3AD8 B;  1IUS A;  5IQ1 A;  2WP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...