3NT6A

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANSGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
source organism Shewanella loihica
molecule tags Oxidoreductase
total genus 172
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3nt6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A01
4H4ZA 3AEGA 2HQMA 1NHPA 3QSMA 3GWDA 1NG3A 3GRSA 4EQRA 4FX9A 2GF3A 2E5VA 2X50A 4B65A 5JCMA 4WX1A 3C4NA 4EQWA 3SFEA 2A2KA 5HBPA 3QVPA 2BS3A 3BHKA 4BV6A 1KF6A 5JCKA 3BHFA 3EAOA 2DCQA 3AE8A 4GDPA 4YSYA 2GRTA 5FS7A 1PJ7A 2EQ7A 3BNMA 5FS6A 3DA1A 1F3PA 2RGHA 4A5LA 2YLTA 3AE4A 3DJEA 4EIQA 4JGTA 1K0JA 4JY2A 5EB5A 2YG6A 4H4QA 4H50A 1E1MA 2YR6A 2BS2A 4BJYA 3OC4A 4J57A 2R4EA 1TDFA 1GXFA 4CY6A 1H82A 1Z6LA 3AE2A 2IVDA 3OZ2A 1H7WA 3OP3A 2YWLA 4Y4NA 4J36A 1OJCA 3AECA 1JOAA 4IV9A 3TP9A 2TPRA 2YG3A 1PBFA 1DOBA 2VZ2A 3ATQA 2GR0A 3Q6JA 3UKKA 4AT0A 4GUVA 4KX6A 1XDIA 4ZCCA 1H86A 2GMHA 1BZLA 4YXDA 3QFAA 1XPQA 1X31B 1LJ1A 1YQ4A 2Z5YA 4D04A 1GRHA 2ZZ0A 3UOZA 2GVCA 3SGLA 4OPTA 3NYEA 3C96A 4O5UA 1OJAA 4M52A 3H8IA 5ER0A 1DJNA 2OALA 2EQ6A 2XLSA 3K7MX 1L9CA 2B76A 2C66A 4H4PA 2XVFA 3II4A 1ONFA 2H89A 3NK0X 1GRBA 3FG2P 2ZZCA 1Y56B 2YR4A 1S2YA 4K5RA 3FPZA 1YKJA 2V3AA 2XLTA 4IVOB 2NPXA 3BI4A 4Y4MA 4Z26A 2XYOA 1DXLA 1FL2A 4C5OA 3CGBA 1TYTA 3B6DA 3ALJA 5HXIA 4U8NA 2WDQA 4U8KA 1UARA 2WHDA 3ATRA 4IA5A 2EG4B 1H6VA 2WDVA 1H83A 2EG4A 4JN9A 5J60A 3EANA 4PAAA 1YQZA 1ZMDA 2Y6QA 4CY8A 1L9DA 3CGDA 4U8PA 3HIXA 4WH7A 3DH9A 1B5QA 1KNRA 3NGCX 3AE6A 3LJPA 2WOIA 3VQRA 5BUKA 2A8XA 1GV4A 2EG3A 1BGNA 1FEAA 3KA7A 2BACA 3F8PA 3VRDB 1NHQA 1B8SA 2WP9A 1CC6A 1GRTA 5EB4A 4XWRA 3AE1A 4J34A 3SQPA 2OA1A 3IC9A 3AXBA 3C4AA 4BK1A 3CGEA 4EQSA 1YMLA 3H8LA 3UTEA 3NIXA 2AQJA 1CJCA 1CWRA 3V3NA 4YKFA 2HHGA 1M6IA 1S2QA 2BC0A 4K22A 4EIPA 1Q1RA 3KKJA 3TG3A 3FMWA 2YQUA 1TDNA 2IIDA 1YY5A 4REKA 5M10A 4ZCDA 2WLRA 3LB8A 5LAMA 3UOVA 2APGA 1DOEA 1Q1WA 3AEEA 1NHRA 1NEKA 4U8OA 2DKIA 2PYXA 5U1OA 4AOSA 1PS9A 2ARDA 4O5QA 3NNEA 4U8JA 5U63A 4LA1A 5JCLA 2FJEA 3I3LA 4Z44A 4OVIA 2X8HA 1YT8A 2C7GA 1RP0A 1H84A 2C64A 2WOWA 3GMBA 2Q0LA 2QA1A 3JSKA 3PVCA 4TM1A 4UDPA 1UKVG 1OJTA 1E1NA 1LQUA 2BCGG 2F5ZA 3IWAA 4HB9A 5FS8A 2BCPA 4YTMA 4AP3A 2A87A 1DP2A 4H4XA 2C67A 3KLJA 2WPCA 2R46A 3VRBA 3PS9A 1NG4A 1RYIA 4B66A 5TR3A 3RP8A 2V6OA 3S61A 2JK6A 4A9WA 2VSWA 2OLOA 3GDNA 2VRLA 1H4MX 3GSIA 4GR1A 1P2EA 4CBQA 4K5SA 3CPIG 1FECA 1QJDA 2W0HA 1CL0A 4RSLA 2MOLA 4K7ZA 4Y4LA 1PN0A 4CNJA 4DSGA 3KPFA 4F67A 3M12A 1OKGA 3I6DA 2ZBWA 3UTHA 5KVHA 1GOSA 1PJ6A 2NVKX 2YVJA 1F8SA 4GCMA 4BK2A 4TM0A 1F6MA 2GB0A 4A99A 2X99A 1H4KX 1ZX9A 2WU2A 1GTEA 1VRQB 2JB2A 3NKSA 2JBVA 2WEUA 5KXJA 3UKLA 1KSSA 4BURA 1ELIA 1H81A 2YVGA 4GF7A 4NZHA 4X4JA 3AE9A 5KWFA 3GWFA 2R9ZA 4JY3A 2C70A 2VVMA 4FDCB 2BK5A 3AEDA 1GPEA 3P3AA 4H7UA 3KVEA 4IVMB 4H4RA 2WPFA 4DGKA 1GRFA 2H88A 3NTDA 1N4UA 3CIRA 4CCRA 3FLHA 2JB3A 5JCIA 2WPEA 2C65A 4J33A 3DK4A 3GK5A 1VG0A 4JQ9A 2Y6RA 1E39A 4Z43A 2Q6UA 3HZUA 1TYPA 1CBOA 3P4RA 4RG3A 3NLCA 3LXDA 5CKUA 3UKHA 4AP1A 4OPLA 2FSXA 3CNSA 1ZOVA 1WV9A 3NT6A 3DMEA 1GTHA 2YM1A 3B3RA 3VR8A 1EL8A 2YAUA 1VQWA 2V3BA 1D4DA 1MO9A 2J6PA 1GERA 1CC2A 2BC1A 1TRBA 1GESA 2C75A 1Q9IA 3AE5A 3IHMA 5C3JA 1Y56A 3CTYA 5IPYA 4UDRA 2KL3A 5HBQA 1YQ3A 2JAEA 4H2NA 4J2WA 2RGOA 3COXA 1ORBA 3D8XA 1HYUA 1E1KA 2GAGB 4USRA 2B7RA 1KNPA 1S3BA 3S5WA 2ZZBA 2GR3A 4KPRA 1O5WA 3M13A 4FK1A 4BK3A 2YLXA 3CN8A 4X9MA 4ECHA 2XVHA 3R9UA 2FBWA 1N1PA 2IFDA 4WH9A 3IHGA 4H2RA 2XFUA 2ORAA 3E1TA 1VG9A 3NK2X 1XHCA 1GEUA 3ALLA 4OPGA 4A65A 2C3CA 2WP5A 3KD9A 2J3NA 1F8WA 1QB0A 3P4SA 1WHBA 3AAYA 2XFOA 3M0OA 4A6NB 3ICSA 2PHHA 2JTRA 2RABA 2XVIA 3ZYXA 4Z25A 1JNZA 4YSZA 1YS0A 1JRZA 2YM2A 3CNDA 3LOVA 4H4VA 3HZLA 4I59A 4JNAA 5CQFA 3D1PA 2GMJA 5DBJA 1ZMCA 5HBLA 3G5JA 3IWHA 2GV8A 1REOA 5HY5A 3K9RA 3F4AA 4YWOA 1QLBA 1EBDA 3SFDA 4J31A 3WE0A 2O9ZA 2WS3A 3NG7X 2DKHA 1CJ3A 3BI5A 3KU9A 4OPIA 4TLZA 2YG4A 3ZDNA 1PXAA 4P9SA 4C3YA 2C73A 4H4WA 1BOHA 1TDEA 3AB1A 3K7QX 2Q0KA 4USQA 5U25A 2VRMA 4NEVA 2BA9A 3CNTA 2YG7A 2C76A 2VVLG 3AEFA 1K0IA 1BKWA 4H2PA 3NYFA 1E6EA 3K7TA 3EPTA 4IA6A 3F8DA 4LIIA 1E7PA 1ZK7A 3UTFA 2AR8A 2XCGA 2XLRA 1CWSA 3RP6A 2BK4A 4EMJA 3FS5A 4Z2UA 4K8DA 2Z5XA 1JNRA 1CJ2A 4XXGA 2EQ8A 1LV0A 3Q9TA 4TM3A 5HBOA 2BXRA 3FIMB 2CULA 1PBBA 3LZXA 1PXCA 3AEBA 5GSNA 4AOXA 3AEAA 2B9YA 2GH5A 2XDOA 3GRTA 4ICYA 4CRTA 4YT0A 3AE7A 3SM8A 2GAHB 2XLUA 3DK8A 4B63A 3CNPA 2X8GA 1D4CA 2QA2A 2V61A 1CC4A 5JCNA 2XFNA 3DK9A 3NK1X 3UP5A 1GMXA 3QJ4A 2R45A 2GEWA 3AD8B 1N4WA 3ICTA 2WBAA 5BVAA 1EL5A 2E1MA 2AAQA 3AD7B 3P9UA 1IUVA 3RNMA 1JEHA 3NN0X 1GALA 3L1RA 1C25A 2XFQA 4BJZA 1DNCA 1EL7A 3UOYA 3FBSA 2FJBA 2XLPA 4I58A 1PJ5A 4U8IA 4H4UA 1IUTA 2VQBA 1LTXR 4N9XA 4DNAA 2OUCA 5L46A 2YVFA 4ADWA 1E0CA 1FOHA 3UP4A 3AD9B 3G5SA 3MZZA 1PDHA 4K2XA 4TLXA 1L9EA 2R0PA 3GD3A 3K30A 3DJDA 4X9NA 5C2TA 2MOIA 1CWTA 5IQ4A 1TDKA 2GR2A 1NHSA 3UKFA 2FJAA 5FS9A 1BOIA 4APNA 4WCTA 3HWIA 5LV9A 4OPDA 3P4QA 4U2SA 1S3EA 3P1WA 4U2LA 4U8MA 1KFYA 1NDAA 3IPPA 4J56A 1L0VA 1COYA 4OPCA 1CHUA 1GNDA 4B69A 1NAAA 4H4TA 2VVLA 4CNKA 1B37A 1GRAA 3NH3X 1H7XA 1PHHA 4NTCA 3RP7A 2JB1A 3AYIA 1LPFA 1NENA 1BGJA 2Q7VA 1URHA 3L8KA 3LADA 4LU6A 5J7XA 3T37A 1D7YA 3FOJA 1MOKA 2YLWA 4EQXA 4EMIA 3ALMA 3OLHA 2WP6A 3G5QA 2E4GA 1CF3A 2CVJA 4GDEA 1T3KA 3DGHA 1OJ9A 2VOUA 4H4YA 4Z2RA 3CNJA 5BULA 2YR5A 2R0GA 4NTEA 1FCDA 5LAOA 3ABVA 1VDCA 5M0ZA 1SEZA 3GD4A 2FJDA 4YTNA 3BI2A 3QSEA 1YMDA 2IVEA 3GYJA 4EMWA 2XVEA 1VEEA 3P4PA 1AOGA 3QFBA 2R4JA 2QCUA 3AYJA 2WLXA 2QAEA 2WQYA 2X3NA 2XFPA 1YMKA 1PBEA 3ITJA 1YM9A 3RHAA 2TMDA 3F8RA 4YSXA 3CGCA 1OJDA 2UZZA 1KSUA 2CDUA 1KDGA 4A6NA 3UCLA 1ZKQA 1ZOYA 4UP3A 1RSGA 1RHSA 1QXNA 2JTQA 3AAXA 3I3UA 3FNJA 4OPUA 3UOXA 2A89A 4A79A 4DSHA 3UTNX 4JNQA 4H4SA 1JU2A 1PBDA 2BABA 2BXSA 2GQWA 3UKPA 2V60A 4B68A 3DGZA 1IJHA 2GR1A 2YLRA 2YLSA 4XWZA 2K0ZA 2X8CA 3CPHG 1GETA 1PBCA 4PABA 4C77A 3V3OA 1D5TA 2EQ9A 2UZQA 1TQ1A 3IPOA 2C72A 2XVJA 1K0LA 4EM4A 1V59A 4UDQA 4JDRA 4NTDA 2WDRA 4E0VA 1LVLA 1LQTA 3I2VA 2IFVA 3ICRA 3DJGX 5HPAA 3H4KA 1B4VA 4CCQA 4U2TA 5KVIA 3UKAA 1IUUA 1ZDLA 2B7SA 2BS4A 3BNUA 3GMCA 3O0HA 5EBKA 2R0CA 1DODA 2B9WA 2GQFA 4MJWA 1GREA 1BF3A 4H2QA 1MXTA 5IQ1A 1W4XA 1GRGA 4U8LA 5HYMA 5EOWA 1P2HA 2V5ZA 2CFYA 4YSHA 4EM3A 5HHFA 1JRXA 3CPJG 1IUSA 1HZMA 1QO8A 1Y0PA 2JKCA 2WETA 1O94A 1DOCA 2MRMA 2WOVA 3GYIA 1GN0A 3NRNA 3NHVA 4TM4A 1JRYA 3LZWA 3D1CA 3VRAA 1GT8A 5GRTA 3R2UA 3NN6X 4HA6A 3V76A 4B67A 2VQ7A 1E1LA 3O3WA 5KOWA 2BK3A 1D4EA 1K4QA 1EL9A 1ZP0A 4Z24A 3URHA 1GSNA 3UTGA 1F8RA 3DJJA 4B64A 2YLZA 3ADAB 2WU5A 4ZN0A 1CJ4A 1ZY8A 3VR9A 4A7AA 2YG5A 2WESA 3NHOX 3REDA 3TG1B 1N4VA 1NPXA 1TDOA 3QSSA 1D7LA 4GRTA 4FK1C 2OLNA 1IUWA 5BRTA 1O95A 3AYLA 5KRQA 3AE3A 3ILMA 3EF6A 2ACZA 4D03A 3QVRA 2BYBA 4B1BA 2GWFA 1IUXA 3NYCA 2RGJA 4NEWA 4YKGA 2JTSA 3PO7A 1BWCA 1PXBA 5KOXA 3G5RA 3GDPA 4Z2TA 3UKQA 2I0ZA 4C3XA 2OAMA 3IF9A 4AT2A 3NTAA 1DJQA 5FMHA 3AWIA 4RG4A 4YTPA 3ISHA 1XANA 1FEBA 1RHDA 2B9XA 2C3DA 1M64A 4C74A 4OCGA
chains in the Genus database with same CATH superfamily
4H4ZA 3AEGA 2HQMA 1NHPA 3QSMA 3GWDA 1NG3A 3GRSA 4EQRA 4FX9A 2GF3A 2E5VA 2X50A 4B65A 5JCMA 4WX1A 3C4NA 4EQWA 3SFEA 2A2KA 5HBPA 3QVPA 2BS3A 3BHKA 4BV6A 1KF6A 5JCKA 3BHFA 3EAOA 2DCQA 3AE8A 4GDPA 4YSYA 2GRTA 5FS7A 1PJ7A 2EQ7A 3BNMA 5FS6A 3DA1A 1F3PA 2RGHA 4A5LA 2YLTA 3AE4A 3DJEA 4EIQA 4JGTA 1K0JA 4JY2A 5EB5A 2YG6A 4H4QA 4H50A 1E1MA 2YR6A 2BS2A 4BJYA 3OC4A 4J57A 2R4EA 1TDFA 1GXFA 4CY6A 1H82A 1Z6LA 3AE2A 2IVDA 3OZ2A 1H7WA 3OP3A 2YWLA 4Y4NA 4J36A 1OJCA 3AECA 1JOAA 4IV9A 3TP9A 2TPRA 2YG3A 1PBFA 1DOBA 2VZ2A 3ATQA 2GR0A 3Q6JA 3UKKA 4AT0A 4GUVA 4KX6A 1XDIA 4ZCCA 1H86A 2GMHA 1BZLA 4YXDA 3QFAA 1XPQA 1X31B 1LJ1A 1YQ4A 2Z5YA 4D04A 1GRHA 2ZZ0A 3UOZA 2GVCA 3SGLA 4OPTA 3NYEA 3C96A 4O5UA 1OJAA 4M52A 3H8IA 5ER0A 1DJNA 2OALA 2EQ6A 2XLSA 3K7MX 1L9CA 2B76A 2C66A 4H4PA 2XVFA 3II4A 1ONFA 2H89A 3NK0X 1GRBA 3FG2P 2ZZCA 1Y56B 2YR4A 1S2YA 4K5RA 2BRYA 1YKJA 2V3AA 2XLTA 3FPZA 2NPXA 3BI4A 4IVOB 4Y4MA 4Z26A 2XYOA 1DXLA 1FL2A 4C5OA 3CGBA 1TYTA 3B6DA 3T0KA 3ALJA 5HXIA 4U8NA 2WDQA 4U8KA 1UARA 2WHDA 3ATRA 4IA5A 2EG4B 1H6VA 2WDVA 1H83A 2EG4A 4JN9A 5J60A 3EANA 4PAAA 1YQZA 1ZMDA 2Y6QA 4CY8A 1L9DA 3CGDA 4U8PA 3HIXA 4WH7A 3DH9A 1B5QA 1KNRA 3HYWA 3AE6A 3LJPA 3NGCX 2WOIA 3VQRA 5BUKA 2A8XA 1GV4A 2EG3A 1BGNA 1FEAA 3KA7A 2BACA 3F8PA 3VRDB 1NHQA 3SZWA 1B8SA 2WP9A 1CC6A 3SXIA 1GRTA 5EB4A 4XWRA 3AE1A 4J34A 3SQPA 2OA1A 3IC9A 3AXBA 3C4AA 4BK1A 3CGEA 3ITJA 1YMLA 3H8LA 3UTEA 4EQSA 3NIXA 2AQJA 1CJCA 1CWRA 3V3NA 4YKFA 2HHGA 1M6IA 1S2QA 2BC0A 4K22A 4EIPA 1Q1RA 3KKJA 3TG3A 3FMWA 5L46A 2YQUA 1TDNA 2IIDA 1YY5A 4REKA 3T31A 5M10A 4ZCDA 2WLRA 3LB8A 5LAMA 3UOVA 2APGA 1DOEA 1Q1WA 3AEEA 1NHRA 1NEKA 4U8OA 2DKIA 2PYXA 5U1OA 4AOSA 1PS9A 2ARDA 4O5QA 3NNEA 4U8JA 5U63A 4LA1A 5JCLA 2FJEA 3I3LA 4Z44A 4OVIA 2X8HA 1YT8A 2C7GA 1RP0A 1H84A 2C64A 2WOWA 3GMBA 2Q0LA 2QA1A 3JSKA 3PVCA 4TM1A 4UDPA 1UKVG 1OJTA 1E1NA 1LQUA 2BCGG 2F5ZA 3IWAA 4HB9A 5FS8A 2BCPA 4YTMA 4AP3A 2A87A 1DP2A 4H4XA 2C67A 3KLJA 2WPCA 2R46A 3VRBA 3PS9A 1NG4A 1RYIA 4B66A 5TR3A 3RP8A 2V6OA 3S61A 2JK6A 4A9WA 2VSWA 2OLOA 3GDNA 2VRLA 1H4MX 3GSIA 4GR1A 1P2EA 4CBQA 4K5SA 3CPIG 1FECA 1QJDA 2W0HA 1CL0A 4RSLA 2MOLA 4K7ZA 4Y4LA 1PN0A 4CNJA 4DSGA 3KPFA 4F67A 3M12A 1OKGA 3I6DA 2ZBWA 3UTHA 5KVHA 1GOSA 1PJ6A 2NVKX 2YVJA 1F8SA 4GCMA 4BK2A 4TM0A 1F6MA 2GB0A 4A99A 2X99A 1H4KX 1ZX9A 2WU2A 1GTEA 1VRQB 2JB2A 3NKSA 2JBVA 2WEUA 5KXJA 3UKLA 1KSSA 4BURA 1ELIA 1H81A 2YVGA 4GF7A 4NZHA 4X4JA 3AE9A 5KWFA 3GWFA 2R9ZA 4JY3A 2C70A 2VVMA 4FDCB 2BK5A 3AEDA 1GPEA 3P3AA 4H7UA 3KVEA 4IVMB 4H4RA 2WPFA 4DGKA 1GRFA 2H88A 3NTDA 1N4UA 3CIRA 4CCRA 3FLHA 2JB3A 5JCIA 2WPEA 2C65A 4J33A 3DK4A 3GK5A 1VG0A 4JQ9A 2Y6RA 1E39A 4Z43A 2Q6UA 3HZUA 1TYPA 1CBOA 4G74A 3P4RA 4RG3A 3NLCA 3LXDA 5CKUA 3UKHA 4AP1A 4OPLA 2FSXA 3CNSA 4NWZA 1ZOVA 1WV9A 3NT6A 3DMEA 1GTHA 2YM1A 3B3RA 3VR8A 1EL8A 2YAUA 1VQWA 2V3BA 1D4DA 1MO9A 2J6PA 1GERA 1CC2A 2BC1A 1TRBA 1GESA 2C75A 1Q9IA 3AE5A 3IHMA 5C3JA 1Y56A 3CTYA 5IPYA 4UDRA 2KL3A 5HBQA 1YQ3A 2JAEA 4H2NA 4J2WA 2RGOA 3COXA 1ORBA 3D8XA 1HYUA 1E1KA 2GAGB 4USRA 2B7RA 1KNPA 1S3BA 3S5WA 2ZZBA 2GR3A 4KPRA 4II2A 1O5WA 3M13A 4FK1A 4BK3A 2YLXA 3CN8A 4X9MA 4ECHA 2XVHA 3R9UA 2FBWA 1N1PA 2IFDA 4WH9A 3IHGA 4H2RA 2XFUA 2ORAA 3E1TA 1VG9A 3NK2X 1XHCA 1GEUA 3ALLA 4OPGA 4A65A 2C3CA 2WP5A 3KD9A 2J3NA 1F8WA 1QB0A 3P4SA 1WHBA 3AAYA 2XFOA 3M0OA 4A6NB 3ICSA 2PHHA 2JTRA 2RABA 2XVIA 3ZYXA 4Z25A 5KNLA 3KPKA 1JNZA 4YSZA 4G73A 1YS0A 1JRZA 2YM2A 3CNDA 3LOVA 4H4VA 3HZLA 4I59A 4JNAA 5CQFA 3D1PA 2GMJA 5DBJA 1ZMCA 5HBLA 3G5JA 3IWHA 2GV8A 1REOA 5HY5A 3K9RA 3F4AA 4YWOA 1QLBA 1EBDA 3SFDA 4J31A 3WE0A 2O9ZA 3T2YA 2WS3A 3NG7X 2DKHA 1CJ3A 3BI5A 3KU9A 4OPIA 4TLZA 2YG4A 4GAPA 3ZDNA 1PXAA 4P9SA 4C3YA 2C73A 4H4WA 1BOHA 1TDEA 3AB1A 3K7QX 2Q0KA 4USQA 5U25A 2VRMA 4NEVA 2BA9A 2C4CA 3CNTA 2YG7A 2C76A 4NNJA 2VVLG 3AEFA 1K0IA 3SYIA 1BKWA 4H2PA 3NYFA 1E6EA 3K7TA 3EPTA 4IA6A 3F8DA 4LIIA 1E7PA 1ZK7A 3UTFA 2AR8A 2XCGA 2XLRA 1CWSA 3RP6A 5KMRA 2BK4A 4EMJA 3FS5A 4Z2UA 4K8DA 2Z5XA 1JNRA 1CJ2A 4XXGA 2EQ8A 1LV0A 3Q9TA 4TM3A 5HBOA 2BXRA 3FIMB 2CULA 1PBBA 3LZXA 1PXCA 3AEBA 4G6HA 5GSNA 4AOXA 3AEAA 2B9YA 2GH5A 2XDOA 3GRTA 4ICYA 4CRTA 4YT0A 3AE7A 3SM8A 2GAHB 2XLUA 3DK8A 4B63A 3CNPA 3SZFA 4II3A 2X8GA 3SZ0A 1D4CA 2QA2A 2V61A 1CC4A 5JCNA 2XFNA 3DK9A 3NK1X 3UP5A 1GMXA 3QJ4A 2R45A 2GEWA 3AD8B 1N4WA 3ICTA 2WBAA 5BVAA 5KMPA 1EL5A 2E1MA 2AAQA 3AD7B 3P9UA 1IUVA 3RNMA 1JEHA 3NN0X 1GALA 3L1RA 2Q82A 1C25A 2XFQA 4BJZA 1DNCA 1EL7A 3UOYA 3FBSA 2FJBA 2XLPA 4I58A 1PJ5A 4U8IA 4H4UA 1IUTA 2VQBA 1LTXR 3CMMA 4N9XA 2OUCA 4DNAA 2YVFA 4ADWA 1E0CA 1FOHA 3SX6A 3AD9B 3G5SA 3UP4A 3MZZA 1PDHA 4K2XA 4TLXA 1L9EA 2R0PA 3GD3A 3K30A 3DJDA 4X9NA 5C2TA 2MOIA 1CWTA 5IQ4A 1TDKA 2GR2A 1NHSA 3UKFA 2FJAA 5FS9A 1BOIA 4G6GA 4APNA 4WCTA 3HWIA 5LV9A 4OPDA 3P4QA 4U2SA 1S3EA 3P1WA 4U2LA 4U8MA 1KFYA 1NDAA 3IPPA 4J56A 1L0VA 1COYA 4OPCA 1CHUA 1GNDA 4B69A 1NAAA 4H4TA 2VVLA 4CNKA 1B37A 1GRAA 3NH3X 1H7XA 1PHHA 4NTCA 3RP7A 2JB1A 3AYIA 1LPFA 1NENA 1BGJA 2Q7VA 1URHA 3L8KA 3LADA 4LU6A 5J7XA 3T37A 1D7YA 3FOJA 1MOKA 2YLWA 4EQXA 4EMIA 3ALMA 3OLHA 2WP6A 3G5QA 2E4GA 1CF3A 2CVJA 4GDEA 1T3KA 3DGHA 1OJ9A 2VOUA 4H4YA 4Z2RA 3CNJA 5BULA 2YR5A 2R0GA 4NTEA 1FCDA 5LAOA 3ABVA 1VDCA 5M0ZA 3HYVA 1SEZA 3GD4A 2FJDA 4YTNA 3BI2A 3QSEA 1YMDA 2IVEA 3GYJA 4EMWA 2XVEA 1VEEA 3P4PA 1AOGA 3QFBA 2BRAA 2QCUA 2R4JA 2WLXA 2QAEA 2WQYA 2X3NA 2XFPA 1YMKA 1PBEA 3AYJA 1YM9A 3RHAA 2TMDA 3F8RA 3GYXA 4YSXA 3CGCA 1OJDA 2UZZA 1KSUA 2CDUA 1KDGA 4A6NA 3UCLA 1ZKQA 1ZOYA 4UP3A 1RSGA 1RHSA 1QXNA 2JTQA 3AAXA 3I3UA 3FNJA 4OPUA 3UOXA 2A89A 3T14A 4A79A 4DSHA 3UTNX 4JNQA 4H4SA 1JU2A 1PBDA 2BABA 2BXSA 2GQWA 3UKPA 2V60A 4B68A 3DGZA 1IJHA 2GR1A 2YLRA 2YLSA 4XWZA 2K0ZA 2X8CA 3CPHG 1GETA 1PBCA 4PABA 4C77A 3V3OA 1D5TA 2EQ9A 2UZQA 1TQ1A 3IPOA 2C72A 2XVJA 3SZCA 1K0LA 4EM4A 1V59A 4UDQA 4JDRA 4NTDA 2WDRA 4E0VA 1LVLA 1LQTA 3I2VA 2IFVA 3ICRA 3DJGX 5HPAA 3H4KA 1B4VA 4CCQA 4U2TA 5KVIA 3UKAA 1IUUA 1ZDLA 2B7SA 2BS4A 3BNUA 3GMCA 3O0HA 5EBKA 3SY4A 2R0CA 1DODA 2B9WA 2GQFA 5KMQA 4MJWA 1GREA 1BF3A 4H2QA 1MXTA 5IQ1A 4GAVA 1W4XA 1GRGA 4U8LA 5HYMA 5EOWA 1P2HA 2V5ZA 2CFYA 4YSHA 4EM3A 5HHFA 1JRXA 3CPJG 1IUSA 1HZMA 1QO8A 1Y0PA 2JKCA 2WETA 3T2ZA 1O94A 1DOCA 2MRMA 2WOVA 3GYIA 1GN0A 3NRNA 3NHVA 4TM4A 1JRYA 3LZWA 5KMSA 3D1CA 3VRAA 1GT8A 5GRTA 3R2UA 3NN6X 4HA6A 3V76A 4B67A 2VQ7A 4G9KA 1E1LA 3O3WA 5KOWA 2BK3A 1D4EA 1K4QA 1EL9A 1ZP0A 4Z24A 3URHA 1GSNA 3UTGA 1F8RA 3DJJA 4B64A 2YLZA 3ADAB 2WU5A 3HYXA 4ZN0A 1CJ4A 1ZY8A 3VR9A 4A7AA 2YG5A 2WESA 3NHOX 3REDA 3TG1B 1N4VA 1NPXA 1TDOA 3QSSA 1D7LA 4GRTA 4FK1C 2OLNA 1IUWA 5BRTA 1O95A 3AYLA 5KRQA 3AE3A 3T2KA 3ILMA 3EF6A 2ACZA 4D03A 3QVRA 2BYBA 4B1BA 2GWFA 1IUXA 3NYCA 2RGJA 4NEWA 4YKGA 2JTSA 3PO7A 1BWCA 1PXBA 5KOXA 3G5RA 3GDPA 4Z2TA 3UKQA 2I0ZA 4C3XA 2OAMA 3IF9A 4AT2A 3NTAA 1DJQA 5FMHA 3AWIA 4RG4A 4YTPA 3ISHA 1XANA 1FEBA 1RHDA 2B9XA 2C3DA 1M64A 4C74A 4OCGA
chains in the Genus database with same CATH topology
4H4ZA 3AEGA 2HQMA 1NHPA 3QSMA 3GWDA 1NG3A 3GRSA 4EQRA 4FX9A 2GF3A 2E5VA 2X50A 4B65A 5JCMA 4WX1A 3C4NA 4EQWA 3SFEA 2A2KA 5HBPA 3QVPA 2BS3A 3BHKA 4BV6A 1KF6A 5JCKA 3BHFA 3EAOA 2DCQA 3AE8A 4GDPA 4YSYA 2GRTA 5FS7A 1PJ7A 2EQ7A 3BNMA 5FS6A 3DA1A 1F3PA 2RGHA 4A5LA 2YLTA 3AE4A 3DJEA 4EIQA 4JGTA 1K0JA 4JY2A 5EB5A 2YG6A 4H4QA 4H50A 1E1MA 2YR6A 2BS2A 4BJYA 3OC4A 4J57A 2R4EA 1TDFA 1GXFA 4CY6A 1H82A 1Z6LA 3AE2A 2IVDA 3OZ2A 1H7WA 3OP3A 2YWLA 4Y4NA 4J36A 1OJCA 3AECA 1JOAA 4IV9A 3TP9A 2TPRA 2YG3A 1PBFA 1DOBA 2VZ2A 3ATQA 2GR0A 3Q6JA 3UKKA 4AT0A 4GUVA 4KX6A 1XDIA 4ZCCA 1H86A 2GMHA 1BZLA 4YXDA 3QFAA 1XPQA 1X31B 1LJ1A 1YQ4A 2Z5YA 4D04A 1GRHA 2ZZ0A 3UOZA 2GVCA 3SGLA 4OPTA 3NYEA 3C96A 4O5UA 1OJAA 4M52A 3H8IA 5ER0A 1DJNA 2OALA 2EQ6A 2XLSA 3K7MX 1L9CA 2B76A 2C66A 4H4PA 2XVFA 3II4A 1ONFA 2H89A 3NK0X 1GRBA 3FG2P 2ZZCA 1Y56B 2YR4A 1S2YA 4K5RA 2BRYA 1YKJA 2V3AA 2XLTA 3FPZA 2NPXA 3BI4A 4IVOB 4Y4MA 4Z26A 2XYOA 1DXLA 1FL2A 4C5OA 3CGBA 1TYTA 3B6DA 3T0KA 3ALJA 5HXIA 4U8NA 2WDQA 4U8KA 1UARA 2WHDA 3ATRA 4IA5A 2EG4B 1H6VA 2WDVA 1H83A 2EG4A 4JN9A 5J60A 3EANA 4PAAA 1YQZA 1ZMDA 2Y6QA 4CY8A 1L9DA 3CGDA 4U8PA 3HIXA 4WH7A 3DH9A 1B5QA 1KNRA 3HYWA 3AE6A 3LJPA 3NGCX 2WOIA 3VQRA 5BUKA 2A8XA 1GV4A 2EG3A 1BGNA 1FEAA 3KA7A 2BACA 3F8PA 3VRDB 1NHQA 3SZWA 1B8SA 2WP9A 1CC6A 3SXIA 1GRTA 5EB4A 4XWRA 3AE1A 4J34A 3SQPA 2OA1A 3IC9A 3AXBA 3C4AA 4BK1A 3CGEA 3ITJA 1YMLA 3H8LA 3UTEA 4EQSA 3NIXA 2AQJA 1CJCA 1CWRA 3V3NA 4YKFA 2HHGA 1M6IA 1S2QA 2BC0A 4K22A 4EIPA 1Q1RA 3KKJA 3TG3A 3FMWA 5L46A 2YQUA 1TDNA 2IIDA 1YY5A 4REKA 3T31A 5M10A 4ZCDA 2WLRA 3LB8A 5LAMA 3UOVA 2APGA 1DOEA 1Q1WA 3AEEA 1NHRA 1NEKA 4U8OA 2DKIA 2PYXA 5U1OA 4AOSA 1PS9A 2ARDA 4O5QA 3NNEA 4U8JA 5U63A 4LA1A 5JCLA 2FJEA 3I3LA 4Z44A 4OVIA 2X8HA 1YT8A 2C7GA 1RP0A 1H84A 2C64A 2WOWA 3GMBA 2Q0LA 2QA1A 3JSKA 3PVCA 4TM1A 4UDPA 1UKVG 1OJTA 1E1NA 1LQUA 2BCGG 2F5ZA 3IWAA 4HB9A 5FS8A 2BCPA 4YTMA 4AP3A 2A87A 1DP2A 4H4XA 2C67A 3KLJA 2WPCA 2R46A 3VRBA 3PS9A 1NG4A 1RYIA 4B66A 5TR3A 3RP8A 2V6OA 3S61A 2JK6A 4A9WA 2VSWA 2OLOA 3GDNA 2VRLA 1H4MX 3GSIA 4GR1A 1P2EA 4CBQA 4K5SA 3CPIG 1FECA 1QJDA 2W0HA 1CL0A 4RSLA 2MOLA 4K7ZA 4Y4LA 1PN0A 4CNJA 4DSGA 3KPFA 4F67A 3M12A 1OKGA 3I6DA 2ZBWA 3UTHA 5KVHA 1GOSA 1PJ6A 2NVKX 2YVJA 1F8SA 4GCMA 4BK2A 4TM0A 1F6MA 2GB0A 4A99A 2X99A 1H4KX 1ZX9A 2WU2A 1GTEA 1VRQB 2JB2A 3NKSA 2JBVA 2WEUA 5KXJA 3UKLA 1KSSA 4BURA 1ELIA 1H81A 2YVGA 4GF7A 4NZHA 4X4JA 3AE9A 5KWFA 3GWFA 2R9ZA 4JY3A 2C70A 2VVMA 4FDCB 2BK5A 3AEDA 1GPEA 3P3AA 4H7UA 3KVEA 4IVMB 4H4RA 2WPFA 4DGKA 1GRFA 2H88A 3NTDA 1N4UA 3CIRA 4CCRA 3FLHA 2JB3A 5JCIA 2WPEA 2C65A 4J33A 3DK4A 3GK5A 1VG0A 4JQ9A 2Y6RA 1E39A 4Z43A 2Q6UA 3HZUA 1TYPA 1CBOA 4G74A 3P4RA 4RG3A 3NLCA 3LXDA 5CKUA 3UKHA 4AP1A 4OPLA 2FSXA 3CNSA 4NWZA 1ZOVA 1WV9A 3NT6A 3DMEA 1GTHA 2YM1A 3B3RA 3VR8A 1EL8A 2YAUA 1VQWA 2V3BA 1D4DA 1MO9A 2J6PA 1GERA 1CC2A 2BC1A 1TRBA 1GESA 2C75A 1Q9IA 3AE5A 3IHMA 5C3JA 1Y56A 3CTYA 5IPYA 4UDRA 2KL3A 5HBQA 1YQ3A 2JAEA 4H2NA 4J2WA 2RGOA 3COXA 1ORBA 3D8XA 1HYUA 1E1KA 2GAGB 4USRA 2B7RA 1KNPA 1S3BA 3S5WA 2ZZBA 2GR3A 4KPRA 4II2A 1O5WA 3M13A 4FK1A 4BK3A 2YLXA 3CN8A 4X9MA 4ECHA 2XVHA 3R9UA 2FBWA 1N1PA 2IFDA 4WH9A 3IHGA 4H2RA 2XFUA 2ORAA 3E1TA 1VG9A 3NK2X 1XHCA 1GEUA 3ALLA 4OPGA 4A65A 2C3CA 2WP5A 3KD9A 2J3NA 1F8WA 1QB0A 3P4SA 1WHBA 3AAYA 2XFOA 3M0OA 4A6NB 3ICSA 2PHHA 2JTRA 2RABA 2XVIA 3ZYXA 4Z25A 5KNLA 3KPKA 1JNZA 4YSZA 4G73A 1YS0A 1JRZA 2YM2A 3CNDA 3LOVA 4H4VA 3HZLA 4I59A 4JNAA 5CQFA 3D1PA 2GMJA 5DBJA 1ZMCA 5HBLA 3G5JA 3IWHA 2GV8A 1REOA 5HY5A 3K9RA 3F4AA 4YWOA 1QLBA 1EBDA 3SFDA 4J31A 3WE0A 2O9ZA 3T2YA 2WS3A 3NG7X 2DKHA 1CJ3A 3BI5A 3KU9A 4OPIA 4TLZA 2YG4A 4GAPA 3ZDNA 1PXAA 4P9SA 4C3YA 2C73A 4H4WA 1BOHA 1TDEA 3AB1A 3K7QX 2Q0KA 4USQA 5U25A 2VRMA 4NEVA 2BA9A 2C4CA 3CNTA 2YG7A 2C76A 4NNJA 2VVLG 3AEFA 1K0IA 3SYIA 1BKWA 4H2PA 3NYFA 1E6EA 3K7TA 3EPTA 4IA6A 3F8DA 4LIIA 1E7PA 1ZK7A 3UTFA 2AR8A 2XCGA 2XLRA 1CWSA 3RP6A 5KMRA 2BK4A 4EMJA 3FS5A 4Z2UA 4K8DA 2Z5XA 1JNRA 1CJ2A 4XXGA 2EQ8A 1LV0A 3Q9TA 4TM3A 5HBOA 2BXRA 3FIMB 2CULA 1PBBA 3LZXA 1PXCA 3AEBA 4G6HA 5GSNA 4AOXA 3AEAA 2B9YA 2GH5A 2XDOA 3GRTA 4ICYA 4CRTA 4YT0A 3AE7A 3SM8A 2GAHB 2XLUA 3DK8A 4B63A 3CNPA 3SZFA 4II3A 2X8GA 3SZ0A 1D4CA 2QA2A 2V61A 1CC4A 5JCNA 2XFNA 3DK9A 3NK1X 3UP5A 1GMXA 3QJ4A 2R45A 2GEWA 3AD8B 1N4WA 3ICTA 2WBAA 5BVAA 5KMPA 1EL5A 2E1MA 2AAQA 3AD7B 3P9UA 1IUVA 3RNMA 1JEHA 3NN0X 1GALA 3L1RA 1C25A 2XFQA 4BJZA 1DNCA 1EL7A 3UOYA 3FBSA 2FJBA 2XLPA 4I58A 1PJ5A 4U8IA 4H4UA 1IUTA 2VQBA 1LTXR 3CMMA 4N9XA 2OUCA 4DNAA 2YVFA 4ADWA 1E0CA 1FOHA 3SX6A 3AD9B 3G5SA 3UP4A 3MZZA 1PDHA 4K2XA 4TLXA 1L9EA 2R0PA 3GD3A 3K30A 3DJDA 4X9NA 5C2TA 2MOIA 1CWTA 5IQ4A 1TDKA 2GR2A 1NHSA 3UKFA 2FJAA 5FS9A 1BOIA 4G6GA 4APNA 4WCTA 3HWIA 5LV9A 4OPDA 3P4QA 4U2SA 1S3EA 3P1WA 4U2LA 4U8MA 1KFYA 1NDAA 3IPPA 4J56A 1L0VA 1COYA 4OPCA 1CHUA 1GNDA 4B69A 1NAAA 4H4TA 2VVLA 4CNKA 1B37A 1GRAA 3NH3X 1H7XA 1PHHA 4NTCA 3RP7A 2JB1A 3AYIA 1LPFA 1NENA 1BGJA 2Q7VA 1URHA 3L8KA 3LADA 4LU6A 5J7XA 3T37A 1D7YA 3FOJA 1MOKA 2YLWA 4EQXA 4EMIA 3ALMA 3OLHA 2WP6A 3G5QA 2E4GA 1CF3A 2CVJA 4GDEA 1T3KA 3DGHA 1OJ9A 2VOUA 4H4YA 4Z2RA 3CNJA 5BULA 2YR5A 2R0GA 4NTEA 1FCDA 5LAOA 3ABVA 1VDCA 5M0ZA 3HYVA 1SEZA 3GD4A 2FJDA 4YTNA 3BI2A 3QSEA 1YMDA 2IVEA 3GYJA 4EMWA 2XVEA 1VEEA 3P4PA 1AOGA 3QFBA 2BRAA 2QCUA 2R4JA 2WLXA 2QAEA 2WQYA 2X3NA 2XFPA 1YMKA 1PBEA 3AYJA 1YM9A 3RHAA 2TMDA 3F8RA 3GYXA 4YSXA 3CGCA 1OJDA 2UZZA 1KSUA 2CDUA 1KDGA 4A6NA 3UCLA 1ZKQA 1ZOYA 4UP3A 1RSGA 1RHSA 1QXNA 2JTQA 3AAXA 3I3UA 3FNJA 4OPUA 3UOXA 2A89A 3T14A 4A79A 4DSHA 3UTNX 4JNQA 4H4SA 1JU2A 1PBDA 2BABA 2BXSA 2GQWA 3UKPA 2V60A 4B68A 3DGZA 1IJHA 2GR1A 2YLRA 2YLSA 4XWZA 2K0ZA 2X8CA 3CPHG 1GETA 1PBCA 4PABA 4C77A 3V3OA 1D5TA 2EQ9A 2UZQA 1TQ1A 3IPOA 2C72A 2XVJA 3SZCA 1K0LA 4EM4A 1V59A 4UDQA 4JDRA 4NTDA 2WDRA 4E0VA 1LVLA 1LQTA 3I2VA 2IFVA 3ICRA 3DJGX 5HPAA 3H4KA 1B4VA 4CCQA 4U2TA 5KVIA 3UKAA 1IUUA 1ZDLA 2B7SA 2BS4A 3BNUA 3GMCA 3O0HA 5EBKA 3SY4A 2R0CA 1DODA 2B9WA 2GQFA 5KMQA 4MJWA 1GREA 1BF3A 4H2QA 1MXTA 5IQ1A 4GAVA 1W4XA 1GRGA 4U8LA 5HYMA 5EOWA 1P2HA 2V5ZA 2CFYA 4YSHA 4EM3A 5HHFA 1JRXA 3CPJG 1IUSA 1HZMA 1QO8A 1Y0PA 2JKCA 2WETA 3T2ZA 1O94A 1DOCA 2MRMA 2WOVA 3GYIA 1GN0A 3NRNA 3NHVA 4TM4A 1JRYA 3LZWA 5KMSA 3D1CA 3VRAA 1GT8A 5GRTA 3R2UA 3NN6X 4HA6A 3V76A 4B67A 2VQ7A 4G9KA 1E1LA 3O3WA 5KOWA 2BK3A 1D4EA 1K4QA 1EL9A 1ZP0A 4Z24A 3URHA 1GSNA 3UTGA 1F8RA 3DJJA 4B64A 2YLZA 3ADAB 2WU5A 3HYXA 4ZN0A 1CJ4A 1ZY8A 3VR9A 4A7AA 2YG5A 2WESA 3NHOX 3REDA 3TG1B 1N4VA 1NPXA 1TDOA 3QSSA 1D7LA 4GRTA 4FK1C 2OLNA 1IUWA 5BRTA 1O95A 3AYLA 5KRQA 3AE3A 3T2KA 3ILMA 3EF6A 2ACZA 4D03A 3QVRA 2BYBA 4B1BA 2GWFA 1IUXA 3NYCA 2RGJA 4NEWA 4YKGA 2JTSA 3PO7A 1BWCA 1PXBA 5KOXA 3G5RA 3GDPA 4Z2TA 3UKQA 2I0ZA 4C3XA 2OAMA 3IF9A 4AT2A 3NTAA 1DJQA 5FMHA 3AWIA 4RG4A 4YTPA 3ISHA 1XANA 1FEBA 1RHDA 2B9XA 2C3DA 1M64A 4C74A 4OCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4Z A;  3AEG A;  2HQM A;  1NHP A;  3QSM A;  3GWD A;  1NG3 A;  3GRS A;  4EQR A;  4FX9 A;  2GF3 A;  2E5V A;  2X50 A;  4B65 A;  5JCM A;  4WX1 A;  3C4N A;  4EQW A;  3SFE A;  2A2K A;  5HBP A;  3QVP A;  2BS3 A;  3BHK A;  4BV6 A;  1KF6 A;  5JCK A;  3BHF A;  3EAO A;  2DCQ A;  3AE8 A;  4GDP A;  4YSY A;  2GRT A;  5FS7 A;  1PJ7 A;  2EQ7 A;  3BNM A;  5FS6 A;  3DA1 A;  1F3P A;  2RGH A;  4A5L A;  2YLT A;  3AE4 A;  3DJE A;  4EIQ A;  4JGT A;  1K0J A;  4JY2 A;  5EB5 A;  2YG6 A;  4H4Q A;  4H50 A;  1E1M A;  2YR6 A;  2BS2 A;  4BJY A;  3OC4 A;  4J57 A;  2R4E A;  1TDF A;  1GXF A;  4CY6 A;  1H82 A;  1Z6L A;  3AE2 A;  2IVD A;  3OZ2 A;  1H7W A;  3OP3 A;  2YWL A;  4Y4N A;  4J36 A;  1OJC A;  3AEC A;  1JOA A;  4IV9 A;  3TP9 A;  2TPR A;  2YG3 A;  1PBF A;  1DOB A;  2VZ2 A;  3ATQ A;  2GR0 A;  3Q6J A;  3UKK A;  4AT0 A;  4GUV A;  4KX6 A;  1XDI A;  4ZCC A;  1H86 A;  2GMH A;  1BZL A;  4YXD A;  3QFA A;  1XPQ A;  1X31 B;  1LJ1 A;  1YQ4 A;  2Z5Y A;  4D04 A;  1GRH A;  2ZZ0 A;  3UOZ A;  2GVC A;  3SGL A;  4OPT A;  3NYE A;  3C96 A;  4O5U A;  1OJA A;  4M52 A;  3H8I A;  5ER0 A;  1DJN A;  2OAL A;  2EQ6 A;  2XLS A;  3K7M X;  1L9C A;  2B76 A;  2C66 A;  4H4P A;  2XVF A;  3II4 A;  1ONF A;  2H89 A;  3NK0 X;  1GRB A;  3FG2 P;  2ZZC A;  1Y56 B;  2YR4 A;  1S2Y A;  4K5R A;  3FPZ A;  1YKJ A;  2V3A A;  2XLT A;  4IVO B;  2NPX A;  3BI4 A;  4Y4M A;  4Z26 A;  2XYO A;  1DXL A;  1FL2 A;  4C5O A;  3CGB A;  1TYT A;  3B6D A;  3ALJ A;  5HXI A;  4U8N A;  2WDQ A;  4U8K A;  1UAR A;  2WHD A;  3ATR A;  4IA5 A;  2EG4 B;  1H6V A;  2WDV A;  1H83 A;  2EG4 A;  4JN9 A;  5J60 A;  3EAN A;  4PAA A;  1YQZ A;  1ZMD A;  2Y6Q A;  4CY8 A;  1L9D A;  3CGD A;  4U8P A;  3HIX A;  4WH7 A;  3DH9 A;  1B5Q A;  1KNR A;  3NGC X;  3AE6 A;  3LJP A;  2WOI A;  3VQR A;  5BUK A;  2A8X A;  1GV4 A;  2EG3 A;  1BGN A;  1FEA A;  3KA7 A;  2BAC A;  3F8P A;  3VRD B;  1NHQ A;  1B8S A;  2WP9 A;  1CC6 A;  1GRT A;  5EB4 A;  4XWR A;  3AE1 A;  4J34 A;  3SQP A;  2OA1 A;  3IC9 A;  3AXB A;  3C4A A;  4BK1 A;  3CGE A;  4EQS A;  1YML A;  3H8L A;  3UTE A;  3NIX A;  2AQJ A;  1CJC A;  1CWR A;  3V3N A;  4YKF A;  2HHG A;  1M6I A;  1S2Q A;  2BC0 A;  4K22 A;  4EIP A;  1Q1R A;  3KKJ A;  3TG3 A;  3FMW A;  2YQU A;  1TDN A;  2IID A;  1YY5 A;  4REK A;  5M10 A;  4ZCD A;  2WLR A;  3LB8 A;  5LAM A;  3UOV A;  2APG A;  1DOE A;  1Q1W A;  3AEE A;  1NHR A;  1NEK A;  4U8O A;  2DKI A;  2PYX A;  5U1O A;  4AOS A;  1PS9 A;  2ARD A;  4O5Q A;  3NNE A;  4U8J A;  5U63 A;  4LA1 A;  5JCL A;  2FJE A;  3I3L A;  4Z44 A;  4OVI A;  2X8H A;  1YT8 A;  2C7G A;  1RP0 A;  1H84 A;  2C64 A;  2WOW A;  3GMB A;  2Q0L A;  2QA1 A;  3JSK A;  3PVC A;  4TM1 A;  4UDP A;  1UKV G;  1OJT A;  1E1N A;  1LQU A;  2BCG G;  2F5Z A;  3IWA A;  4HB9 A;  5FS8 A;  2BCP A;  4YTM A;  4AP3 A;  2A87 A;  1DP2 A;  4H4X A;  2C67 A;  3KLJ A;  2WPC A;  2R46 A;  3VRB A;  3PS9 A;  1NG4 A;  1RYI A;  4B66 A;  5TR3 A;  3RP8 A;  2V6O A;  3S61 A;  2JK6 A;  4A9W A;  2VSW A;  2OLO A;  3GDN A;  2VRL A;  1H4M X;  3GSI A;  4GR1 A;  1P2E A;  4CBQ A;  4K5S A;  3CPI G;  1FEC A;  1QJD A;  2W0H A;  1CL0 A;  4RSL A;  2MOL A;  4K7Z A;  4Y4L A;  1PN0 A;  4CNJ A;  4DSG A;  3KPF A;  4F67 A;  3M12 A;  1OKG A;  3I6D A;  2ZBW A;  3UTH A;  5KVH A;  1GOS A;  1PJ6 A;  2NVK X;  2YVJ A;  1F8S A;  4GCM A;  4BK2 A;  4TM0 A;  1F6M A;  2GB0 A;  4A99 A;  2X99 A;  1H4K X;  1ZX9 A;  2WU2 A;  1GTE A;  1VRQ B;  2JB2 A;  3NKS A;  2JBV A;  2WEU A;  5KXJ A;  3UKL A;  1KSS A;  4BUR A;  1ELI A;  1H81 A;  2YVG A;  4GF7 A;  4NZH A;  4X4J A;  3AE9 A;  5KWF A;  3GWF A;  2R9Z A;  4JY3 A;  2C70 A;  2VVM A;  4FDC B;  2BK5 A;  3AED A;  1GPE A;  3P3A A;  4H7U A;  3KVE A;  4IVM B;  4H4R A;  2WPF A;  4DGK A;  1GRF A;  2H88 A;  3NTD A;  1N4U A;  3CIR A;  4CCR A;  3FLH A;  2JB3 A;  5JCI A;  2WPE A;  2C65 A;  4J33 A;  3DK4 A;  3GK5 A;  1VG0 A;  4JQ9 A;  2Y6R A;  1E39 A;  4Z43 A;  2Q6U A;  3HZU A;  1TYP A;  1CBO A;  3P4R A;  4RG3 A;  3NLC A;  3LXD A;  5CKU A;  3UKH A;  4AP1 A;  4OPL A;  2FSX A;  3CNS A;  1ZOV A;  1WV9 A;  3NT6 A;  3DME A;  1GTH A;  2YM1 A;  3B3R A;  3VR8 A;  1EL8 A;  2YAU A;  1VQW A;  2V3B A;  1D4D A;  1MO9 A;  2J6P A;  1GER A;  1CC2 A;  2BC1 A;  1TRB A;  1GES A;  2C75 A;  1Q9I A;  3AE5 A;  3IHM A;  5C3J A;  1Y56 A;  3CTY A;  5IPY A;  4UDR A;  2KL3 A;  5HBQ A;  1YQ3 A;  2JAE A;  4H2N A;  4J2W A;  2RGO A;  3COX A;  1ORB A;  3D8X A;  1HYU A;  1E1K A;  2GAG B;  4USR A;  2B7R A;  1KNP A;  1S3B A;  3S5W A;  2ZZB A;  2GR3 A;  4KPR A;  1O5W A;  3M13 A;  4FK1 A;  4BK3 A;  2YLX A;  3CN8 A;  4X9M A;  4ECH A;  2XVH A;  3R9U A;  2FBW A;  1N1P A;  2IFD A;  4WH9 A;  3IHG A;  4H2R A;  2XFU A;  2ORA A;  3E1T A;  1VG9 A;  3NK2 X;  1XHC A;  1GEU A;  3ALL A;  4OPG A;  4A65 A;  2C3C A;  2WP5 A;  3KD9 A;  2J3N A;  1F8W A;  1QB0 A;  3P4S A;  1WHB A;  3AAY A;  2XFO A;  3M0O A;  4A6N B;  3ICS A;  2PHH A;  2JTR A;  2RAB A;  2XVI A;  3ZYX A;  4Z25 A;  1JNZ A;  4YSZ A;  1YS0 A;  1JRZ A;  2YM2 A;  3CND A;  3LOV A;  4H4V A;  3HZL A;  4I59 A;  4JNA A;  5CQF A;  3D1P A;  2GMJ A;  5DBJ A;  1ZMC A;  5HBL A;  3G5J A;  3IWH A;  2GV8 A;  1REO A;  5HY5 A;  3K9R A;  3F4A A;  4YWO A;  1QLB A;  1EBD A;  3SFD A;  4J31 A;  3WE0 A;  2O9Z A;  2WS3 A;  3NG7 X;  2DKH A;  1CJ3 A;  3BI5 A;  3KU9 A;  4OPI A;  4TLZ A;  2YG4 A;  3ZDN A;  1PXA A;  4P9S A;  4C3Y A;  2C73 A;  4H4W A;  1BOH A;  1TDE A;  3AB1 A;  3K7Q X;  2Q0K A;  4USQ A;  5U25 A;  2VRM A;  4NEV A;  2BA9 A;  3CNT A;  2YG7 A;  2C76 A;  2VVL G;  3AEF A;  1K0I A;  1BKW A;  4H2P A;  3NYF A;  1E6E A;  3K7T A;  3EPT A;  4IA6 A;  3F8D A;  4LII A;  1E7P A;  1ZK7 A;  3UTF A;  2AR8 A;  2XCG A;  2XLR A;  1CWS A;  3RP6 A;  2BK4 A;  4EMJ A;  3FS5 A;  4Z2U A;  4K8D A;  2Z5X A;  1JNR A;  1CJ2 A;  4XXG A;  2EQ8 A;  1LV0 A;  3Q9T A;  4TM3 A;  5HBO A;  2BXR A;  3FIM B;  2CUL A;  1PBB A;  3LZX A;  1PXC A;  3AEB A;  5GSN A;  4AOX A;  3AEA A;  2B9Y A;  2GH5 A;  2XDO A;  3GRT A;  4ICY A;  4CRT A;  4YT0 A;  3AE7 A;  3SM8 A;  2GAH B;  2XLU A;  3DK8 A;  4B63 A;  3CNP A;  2X8G A;  1D4C A;  2QA2 A;  2V61 A;  1CC4 A;  5JCN A;  2XFN A;  3DK9 A;  3NK1 X;  3UP5 A;  1GMX A;  3QJ4 A;  2R45 A;  2GEW A;  3AD8 B;  1N4W A;  3ICT A;  2WBA A;  5BVA A;  1EL5 A;  2E1M A;  2AAQ A;  3AD7 B;  3P9U A;  1IUV A;  3RNM A;  1JEH A;  3NN0 X;  1GAL A;  3L1R A;  1C25 A;  2XFQ A;  4BJZ A;  1DNC A;  1EL7 A;  3UOY A;  3FBS A;  2FJB A;  2XLP A;  4I58 A;  1PJ5 A;  4U8I A;  4H4U A;  1IUT A;  2VQB A;  1LTX R;  4N9X A;  4DNA A;  2OUC A;  5L46 A;  2YVF A;  4ADW A;  1E0C A;  1FOH A;  3UP4 A;  3AD9 B;  3G5S A;  3MZZ A;  1PDH A;  4K2X A;  4TLX A;  1L9E A;  2R0P A;  3GD3 A;  3K30 A;  3DJD A;  4X9N A;  5C2T A;  2MOI A;  1CWT A;  5IQ4 A;  1TDK A;  2GR2 A;  1NHS A;  3UKF A;  2FJA A;  5FS9 A;  1BOI A;  4APN A;  4WCT A;  3HWI A;  5LV9 A;  4OPD A;  3P4Q A;  4U2S A;  1S3E A;  3P1W A;  4U2L A;  4U8M A;  1KFY A;  1NDA A;  3IPP A;  4J56 A;  1L0V A;  1COY A;  4OPC A;  1CHU A;  1GND A;  4B69 A;  1NAA A;  4H4T A;  2VVL A;  4CNK A;  1B37 A;  1GRA A;  3NH3 X;  1H7X A;  1PHH A;  4NTC A;  3RP7 A;  2JB1 A;  3AYI A;  1LPF A;  1NEN A;  1BGJ A;  2Q7V A;  1URH A;  3L8K A;  3LAD A;  4LU6 A;  5J7X A;  3T37 A;  1D7Y A;  3FOJ A;  1MOK A;  2YLW A;  4EQX A;  4EMI A;  3ALM A;  3OLH A;  2WP6 A;  3G5Q A;  2E4G A;  1CF3 A;  2CVJ A;  4GDE A;  1T3K A;  3DGH A;  1OJ9 A;  2VOU A;  4H4Y A;  4Z2R A;  3CNJ A;  5BUL A;  2YR5 A;  2R0G A;  4NTE A;  1FCD A;  5LAO A;  3ABV A;  1VDC A;  5M0Z A;  1SEZ A;  3GD4 A;  2FJD A;  4YTN A;  3BI2 A;  3QSE A;  1YMD A;  2IVE A;  3GYJ A;  4EMW A;  2XVE A;  1VEE A;  3P4P A;  1AOG A;  3QFB A;  2R4J A;  2QCU A;  3AYJ A;  2WLX A;  2QAE A;  2WQY A;  2X3N A;  2XFP A;  1YMK A;  1PBE A;  3ITJ A;  1YM9 A;  3RHA A;  2TMD A;  3F8R A;  4YSX A;  3CGC A;  1OJD A;  2UZZ A;  1KSU A;  2CDU A;  1KDG A;  4A6N A;  3UCL A;  1ZKQ A;  1ZOY A;  4UP3 A;  1RSG A;  1RHS A;  1QXN A;  2JTQ A;  3AAX A;  3I3U A;  3FNJ A;  4OPU A;  3UOX A;  2A89 A;  4A79 A;  4DSH A;  3UTN X;  4JNQ A;  4H4S A;  1JU2 A;  1PBD A;  2BAB A;  2BXS A;  2GQW A;  3UKP A;  2V60 A;  4B68 A;  3DGZ A;  1IJH A;  2GR1 A;  2YLR A;  2YLS A;  4XWZ A;  2K0Z A;  2X8C A;  3CPH G;  1GET A;  1PBC A;  4PAB A;  4C77 A;  3V3O A;  1D5T A;  2EQ9 A;  2UZQ A;  1TQ1 A;  3IPO A;  2C72 A;  2XVJ A;  1K0L A;  4EM4 A;  1V59 A;  4UDQ A;  4JDR A;  4NTD A;  2WDR A;  4E0V A;  1LVL A;  1LQT A;  3I2V A;  2IFV A;  3ICR A;  3DJG X;  5HPA A;  3H4K A;  1B4V A;  4CCQ A;  4U2T A;  5KVI A;  3UKA A;  1IUU A;  1ZDL A;  2B7S A;  2BS4 A;  3BNU A;  3GMC A;  3O0H A;  5EBK A;  2R0C A;  1DOD A;  2B9W A;  2GQF A;  4MJW A;  1GRE A;  1BF3 A;  4H2Q A;  1MXT A;  5IQ1 A;  1W4X A;  1GRG A;  4U8L A;  5HYM A;  5EOW A;  1P2H A;  2V5Z A;  2CFY A;  4YSH A;  4EM3 A;  5HHF A;  1JRX A;  3CPJ G;  1IUS A;  1HZM A;  1QO8 A;  1Y0P A;  2JKC A;  2WET A;  1O94 A;  1DOC A;  2MRM A;  2WOV A;  3GYI A;  1GN0 A;  3NRN A;  3NHV A;  4TM4 A;  1JRY A;  3LZW A;  3D1C A;  3VRA A;  1GT8 A;  5GRT A;  3R2U A;  3NN6 X;  4HA6 A;  3V76 A;  4B67 A;  2VQ7 A;  1E1L A;  3O3W A;  5KOW A;  2BK3 A;  1D4E A;  1K4Q A;  1EL9 A;  1ZP0 A;  4Z24 A;  3URH A;  1GSN A;  3UTG A;  1F8R A;  3DJJ A;  4B64 A;  2YLZ A;  3ADA B;  2WU5 A;  4ZN0 A;  1CJ4 A;  1ZY8 A;  3VR9 A;  4A7A A;  2YG5 A;  2WES A;  3NHO X;  3RED A;  3TG1 B;  1N4V A;  1NPX A;  1TDO A;  3QSS A;  1D7L A;  4GRT A;  4FK1 C;  2OLN A;  1IUW A;  5BRT A;  1O95 A;  3AYL A;  5KRQ A;  3AE3 A;  3ILM A;  3EF6 A;  2ACZ A;  4D03 A;  3QVR A;  2BYB A;  4B1B A;  2GWF A;  1IUX A;  3NYC A;  2RGJ A;  4NEW A;  4YKG A;  2JTS A;  3PO7 A;  1BWC A;  1PXB A;  5KOX A;  3G5R A;  3GDP A;  4Z2T A;  3UKQ A;  2I0Z A;  4C3X A;  2OAM A;  3IF9 A;  4AT2 A;  3NTA A;  1DJQ A;  5FMH A;  3AWI A;  4RG4 A;  4YTP A;  3ISH A;  1XAN A;  1FEB A;  1RHD A;  2B9X A;  2C3D A;  1M64 A;  4C74 A;  4OCG A; 
#chains in the Genus database with same CATH topology
 4H4Z A;  3AEG A;  2HQM A;  1NHP A;  3QSM A;  3GWD A;  1NG3 A;  3GRS A;  4EQR A;  4FX9 A;  2GF3 A;  2E5V A;  2X50 A;  4B65 A;  5JCM A;  4WX1 A;  3C4N A;  4EQW A;  3SFE A;  2A2K A;  5HBP A;  3QVP A;  2BS3 A;  3BHK A;  4BV6 A;  1KF6 A;  5JCK A;  3BHF A;  3EAO A;  2DCQ A;  3AE8 A;  4GDP A;  4YSY A;  2GRT A;  5FS7 A;  1PJ7 A;  2EQ7 A;  3BNM A;  5FS6 A;  3DA1 A;  1F3P A;  2RGH A;  4A5L A;  2YLT A;  3AE4 A;  3DJE A;  4EIQ A;  4JGT A;  1K0J A;  4JY2 A;  5EB5 A;  2YG6 A;  4H4Q A;  4H50 A;  1E1M A;  2YR6 A;  2BS2 A;  4BJY A;  3OC4 A;  4J57 A;  2R4E A;  1TDF A;  1GXF A;  4CY6 A;  1H82 A;  1Z6L A;  3AE2 A;  2IVD A;  3OZ2 A;  1H7W A;  3OP3 A;  2YWL A;  4Y4N A;  4J36 A;  1OJC A;  3AEC A;  1JOA A;  4IV9 A;  3TP9 A;  2TPR A;  2YG3 A;  1PBF A;  1DOB A;  2VZ2 A;  3ATQ A;  2GR0 A;  3Q6J A;  3UKK A;  4AT0 A;  4GUV A;  4KX6 A;  1XDI A;  4ZCC A;  1H86 A;  2GMH A;  1BZL A;  4YXD A;  3QFA A;  1XPQ A;  1X31 B;  1LJ1 A;  1YQ4 A;  2Z5Y A;  4D04 A;  1GRH A;  2ZZ0 A;  3UOZ A;  2GVC A;  3SGL A;  4OPT A;  3NYE A;  3C96 A;  4O5U A;  1OJA A;  4M52 A;  3H8I A;  5ER0 A;  1DJN A;  2OAL A;  2EQ6 A;  2XLS A;  3K7M X;  1L9C A;  2B76 A;  2C66 A;  4H4P A;  2XVF A;  3II4 A;  1ONF A;  2H89 A;  3NK0 X;  1GRB A;  3FG2 P;  2ZZC A;  1Y56 B;  2YR4 A;  1S2Y A;  4K5R A;  2BRY A;  1YKJ A;  2V3A A;  2XLT A;  3FPZ A;  2NPX A;  3BI4 A;  4IVO B;  4Y4M A;  4Z26 A;  2XYO A;  1DXL A;  1FL2 A;  4C5O A;  3CGB A;  1TYT A;  3B6D A;  3T0K A;  3ALJ A;  5HXI A;  4U8N A;  2WDQ A;  4U8K A;  1UAR A;  2WHD A;  3ATR A;  4IA5 A;  2EG4 B;  1H6V A;  2WDV A;  1H83 A;  2EG4 A;  4JN9 A;  5J60 A;  3EAN A;  4PAA A;  1YQZ A;  1ZMD A;  2Y6Q A;  4CY8 A;  1L9D A;  3CGD A;  4U8P A;  3HIX A;  4WH7 A;  3DH9 A;  1B5Q A;  1KNR A;  3HYW A;  3AE6 A;  3LJP A;  3NGC X;  2WOI A;  3VQR A;  5BUK A;  2A8X A;  1GV4 A;  2EG3 A;  1BGN A;  1FEA A;  3KA7 A;  2BAC A;  3F8P A;  3VRD B;  1NHQ A;  3SZW A;  1B8S A;  2WP9 A;  1CC6 A;  3SXI A;  1GRT A;  5EB4 A;  4XWR A;  3AE1 A;  4J34 A;  3SQP A;  2OA1 A;  3IC9 A;  3AXB A;  3C4A A;  4BK1 A;  3CGE A;  3ITJ A;  1YML A;  3H8L A;  3UTE A;  4EQS A;  3NIX A;  2AQJ A;  1CJC A;  1CWR A;  3V3N A;  4YKF A;  2HHG A;  1M6I A;  1S2Q A;  2BC0 A;  4K22 A;  4EIP A;  1Q1R A;  3KKJ A;  3TG3 A;  3FMW A;  5L46 A;  2YQU A;  1TDN A;  2IID A;  1YY5 A;  4REK A;  3T31 A;  5M10 A;  4ZCD A;  2WLR A;  3LB8 A;  5LAM A;  3UOV A;  2APG A;  1DOE A;  1Q1W A;  3AEE A;  1NHR A;  1NEK A;  4U8O A;  2DKI A;  2PYX A;  5U1O A;  4AOS A;  1PS9 A;  2ARD A;  4O5Q A;  3NNE A;  4U8J A;  5U63 A;  4LA1 A;  5JCL A;  2FJE A;  3I3L A;  4Z44 A;  4OVI A;  2X8H A;  1YT8 A;  2C7G A;  1RP0 A;  1H84 A;  2C64 A;  2WOW A;  3GMB A;  2Q0L A;  2QA1 A;  3JSK A;  3PVC A;  4TM1 A;  4UDP A;  1UKV G;  1OJT A;  1E1N A;  1LQU A;  2BCG G;  2F5Z A;  3IWA A;  4HB9 A;  5FS8 A;  2BCP A;  4YTM A;  4AP3 A;  2A87 A;  1DP2 A;  4H4X A;  2C67 A;  3KLJ A;  2WPC A;  2R46 A;  3VRB A;  3PS9 A;  1NG4 A;  1RYI A;  4B66 A;  5TR3 A;  3RP8 A;  2V6O A;  3S61 A;  2JK6 A;  4A9W A;  2VSW A;  2OLO A;  3GDN A;  2VRL A;  1H4M X;  3GSI A;  4GR1 A;  1P2E A;  4CBQ A;  4K5S A;  3CPI G;  1FEC A;  1QJD A;  2W0H A;  1CL0 A;  4RSL A;  2MOL A;  4K7Z A;  4Y4L A;  1PN0 A;  4CNJ A;  4DSG A;  3KPF A;  4F67 A;  3M12 A;  1OKG A;  3I6D A;  2ZBW A;  3UTH A;  5KVH A;  1GOS A;  1PJ6 A;  2NVK X;  2YVJ A;  1F8S A;  4GCM A;  4BK2 A;  4TM0 A;  1F6M A;  2GB0 A;  4A99 A;  2X99 A;  1H4K X;  1ZX9 A;  2WU2 A;  1GTE A;  1VRQ B;  2JB2 A;  3NKS A;  2JBV A;  2WEU A;  5KXJ A;  3UKL A;  1KSS A;  4BUR A;  1ELI A;  1H81 A;  2YVG A;  4GF7 A;  4NZH A;  4X4J A;  3AE9 A;  5KWF A;  3GWF A;  2R9Z A;  4JY3 A;  2C70 A;  2VVM A;  4FDC B;  2BK5 A;  3AED A;  1GPE A;  3P3A A;  4H7U A;  3KVE A;  4IVM B;  4H4R A;  2WPF A;  4DGK A;  1GRF A;  2H88 A;  3NTD A;  1N4U A;  3CIR A;  4CCR A;  3FLH A;  2JB3 A;  5JCI A;  2WPE A;  2C65 A;  4J33 A;  3DK4 A;  3GK5 A;  1VG0 A;  4JQ9 A;  2Y6R A;  1E39 A;  4Z43 A;  2Q6U A;  3HZU A;  1TYP A;  1CBO A;  4G74 A;  3P4R A;  4RG3 A;  3NLC A;  3LXD A;  5CKU A;  3UKH A;  4AP1 A;  4OPL A;  2FSX A;  3CNS A;  4NWZ A;  1ZOV A;  1WV9 A;  3NT6 A;  3DME A;  1GTH A;  2YM1 A;  3B3R A;  3VR8 A;  1EL8 A;  2YAU A;  1VQW A;  2V3B A;  1D4D A;  1MO9 A;  2J6P A;  1GER A;  1CC2 A;  2BC1 A;  1TRB A;  1GES A;  2C75 A;  1Q9I A;  3AE5 A;  3IHM A;  5C3J A;  1Y56 A;  3CTY A;  5IPY A;  4UDR A;  2KL3 A;  5HBQ A;  1YQ3 A;  2JAE A;  4H2N A;  4J2W A;  2RGO A;  3COX A;  1ORB A;  3D8X A;  1HYU A;  1E1K A;  2GAG B;  4USR A;  2B7R A;  1KNP A;  1S3B A;  3S5W A;  2ZZB A;  2GR3 A;  4KPR A;  4II2 A;  1O5W A;  3M13 A;  4FK1 A;  4BK3 A;  2YLX A;  3CN8 A;  4X9M A;  4ECH A;  2XVH A;  3R9U A;  2FBW A;  1N1P A;  2IFD A;  4WH9 A;  3IHG A;  4H2R A;  2XFU A;  2ORA A;  3E1T A;  1VG9 A;  3NK2 X;  1XHC A;  1GEU A;  3ALL A;  4OPG A;  4A65 A;  2C3C A;  2WP5 A;  3KD9 A;  2J3N A;  1F8W A;  1QB0 A;  3P4S A;  1WHB A;  3AAY A;  2XFO A;  3M0O A;  4A6N B;  3ICS A;  2PHH A;  2JTR A;  2RAB A;  2XVI A;  3ZYX A;  4Z25 A;  5KNL A;  3KPK A;  1JNZ A;  4YSZ A;  4G73 A;  1YS0 A;  1JRZ A;  2YM2 A;  3CND A;  3LOV A;  4H4V A;  3HZL A;  4I59 A;  4JNA A;  5CQF A;  3D1P A;  2GMJ A;  5DBJ A;  1ZMC A;  5HBL A;  3G5J A;  3IWH A;  2GV8 A;  1REO A;  5HY5 A;  3K9R A;  3F4A A;  4YWO A;  1QLB A;  1EBD A;  3SFD A;  4J31 A;  3WE0 A;  2O9Z A;  3T2Y A;  2WS3 A;  3NG7 X;  2DKH A;  1CJ3 A;  3BI5 A;  3KU9 A;  4OPI A;  4TLZ A;  2YG4 A;  4GAP A;  3ZDN A;  1PXA A;  4P9S A;  4C3Y A;  2C73 A;  4H4W A;  1BOH A;  1TDE A;  3AB1 A;  3K7Q X;  2Q0K A;  4USQ A;  5U25 A;  2VRM A;  4NEV A;  2BA9 A;  2C4C A;  3CNT A;  2YG7 A;  2C76 A;  4NNJ A;  2VVL G;  3AEF A;  1K0I A;  3SYI A;  1BKW A;  4H2P A;  3NYF A;  1E6E A;  3K7T A;  3EPT A;  4IA6 A;  3F8D A;  4LII A;  1E7P A;  1ZK7 A;  3UTF A;  2AR8 A;  2XCG A;  2XLR A;  1CWS A;  3RP6 A;  5KMR A;  2BK4 A;  4EMJ A;  3FS5 A;  4Z2U A;  4K8D A;  2Z5X A;  1JNR A;  1CJ2 A;  4XXG A;  2EQ8 A;  1LV0 A;  3Q9T A;  4TM3 A;  5HBO A;  2BXR A;  3FIM B;  2CUL A;  1PBB A;  3LZX A;  1PXC A;  3AEB A;  4G6H A;  5GSN A;  4AOX A;  3AEA A;  2B9Y A;  2GH5 A;  2XDO A;  3GRT A;  4ICY A;  4CRT A;  4YT0 A;  3AE7 A;  3SM8 A;  2GAH B;  2XLU A;  3DK8 A;  4B63 A;  3CNP A;  3SZF A;  4II3 A;  2X8G A;  3SZ0 A;  1D4C A;  2QA2 A;  2V61 A;  1CC4 A;  5JCN A;  2XFN A;  3DK9 A;  3NK1 X;  3UP5 A;  1GMX A;  3QJ4 A;  2R45 A;  2GEW A;  3AD8 B;  1N4W A;  3ICT A;  2WBA A;  5BVA A;  5KMP A;  1EL5 A;  2E1M A;  2AAQ A;  3AD7 B;  3P9U A;  1IUV A;  3RNM A;  1JEH A;  3NN0 X;  1GAL A;  3L1R A;  2Q82 A;  1C25 A;  2XFQ A;  4BJZ A;  1DNC A;  1EL7 A;  3UOY A;  3FBS A;  2FJB A;  2XLP A;  4I58 A;  1PJ5 A;  4U8I A;  4H4U A;  1IUT A;  2VQB A;  1LTX R;  3CMM A;  4N9X A;  2OUC A;  4DNA A;  2YVF A;  4ADW A;  1E0C A;  1FOH A;  3SX6 A;  3AD9 B;  3G5S A;  3UP4 A;  3MZZ A;  1PDH A;  4K2X A;  4TLX A;  1L9E A;  2R0P A;  3GD3 A;  3K30 A;  3DJD A;  4X9N A;  5C2T A;  2MOI A;  1CWT A;  5IQ4 A;  1TDK A;  2GR2 A;  1NHS A;  3UKF A;  2FJA A;  5FS9 A;  1BOI A;  4G6G A;  4APN A;  4WCT A;  3HWI A;  5LV9 A;  4OPD A;  3P4Q A;  4U2S A;  1S3E A;  3P1W A;  4U2L A;  4U8M A;  1KFY A;  1NDA A;  3IPP A;  4J56 A;  1L0V A;  1COY A;  4OPC A;  1CHU A;  1GND A;  4B69 A;  1NAA A;  4H4T A;  2VVL A;  4CNK A;  1B37 A;  1GRA A;  3NH3 X;  1H7X A;  1PHH A;  4NTC A;  3RP7 A;  2JB1 A;  3AYI A;  1LPF A;  1NEN A;  1BGJ A;  2Q7V A;  1URH A;  3L8K A;  3LAD A;  4LU6 A;  5J7X A;  3T37 A;  1D7Y A;  3FOJ A;  1MOK A;  2YLW A;  4EQX A;  4EMI A;  3ALM A;  3OLH A;  2WP6 A;  3G5Q A;  2E4G A;  1CF3 A;  2CVJ A;  4GDE A;  1T3K A;  3DGH A;  1OJ9 A;  2VOU A;  4H4Y A;  4Z2R A;  3CNJ A;  5BUL A;  2YR5 A;  2R0G A;  4NTE A;  1FCD A;  5LAO A;  3ABV A;  1VDC A;  5M0Z A;  3HYV A;  1SEZ A;  3GD4 A;  2FJD A;  4YTN A;  3BI2 A;  3QSE A;  1YMD A;  2IVE A;  3GYJ A;  4EMW A;  2XVE A;  1VEE A;  3P4P A;  1AOG A;  3QFB A;  2BRA A;  2QCU A;  2R4J A;  2WLX A;  2QAE A;  2WQY A;  2X3N A;  2XFP A;  1YMK A;  1PBE A;  3AYJ A;  1YM9 A;  3RHA A;  2TMD A;  3F8R A;  3GYX A;  4YSX A;  3CGC A;  1OJD A;  2UZZ A;  1KSU A;  2CDU A;  1KDG A;  4A6N A;  3UCL A;  1ZKQ A;  1ZOY A;  4UP3 A;  1RSG A;  1RHS A;  1QXN A;  2JTQ A;  3AAX A;  3I3U A;  3FNJ A;  4OPU A;  3UOX A;  2A89 A;  3T14 A;  4A79 A;  4DSH A;  3UTN X;  4JNQ A;  4H4S A;  1JU2 A;  1PBD A;  2BAB A;  2BXS A;  2GQW A;  3UKP A;  2V60 A;  4B68 A;  3DGZ A;  1IJH A;  2GR1 A;  2YLR A;  2YLS A;  4XWZ A;  2K0Z A;  2X8C A;  3CPH G;  1GET A;  1PBC A;  4PAB A;  4C77 A;  3V3O A;  1D5T A;  2EQ9 A;  2UZQ A;  1TQ1 A;  3IPO A;  2C72 A;  2XVJ A;  3SZC A;  1K0L A;  4EM4 A;  1V59 A;  4UDQ A;  4JDR A;  4NTD A;  2WDR A;  4E0V A;  1LVL A;  1LQT A;  3I2V A;  2IFV A;  3ICR A;  3DJG X;  5HPA A;  3H4K A;  1B4V A;  4CCQ A;  4U2T A;  5KVI A;  3UKA A;  1IUU A;  1ZDL A;  2B7S A;  2BS4 A;  3BNU A;  3GMC A;  3O0H A;  5EBK A;  3SY4 A;  2R0C A;  1DOD A;  2B9W A;  2GQF A;  5KMQ A;  4MJW A;  1GRE A;  1BF3 A;  4H2Q A;  1MXT A;  5IQ1 A;  4GAV A;  1W4X A;  1GRG A;  4U8L A;  5HYM A;  5EOW A;  1P2H A;  2V5Z A;  2CFY A;  4YSH A;  4EM3 A;  5HHF A;  1JRX A;  3CPJ G;  1IUS A;  1HZM A;  1QO8 A;  1Y0P A;  2JKC A;  2WET A;  3T2Z A;  1O94 A;  1DOC A;  2MRM A;  2WOV A;  3GYI A;  1GN0 A;  3NRN A;  3NHV A;  4TM4 A;  1JRY A;  3LZW A;  5KMS A;  3D1C A;  3VRA A;  1GT8 A;  5GRT A;  3R2U A;  3NN6 X;  4HA6 A;  3V76 A;  4B67 A;  2VQ7 A;  4G9K A;  1E1L A;  3O3W A;  5KOW A;  2BK3 A;  1D4E A;  1K4Q A;  1EL9 A;  1ZP0 A;  4Z24 A;  3URH A;  1GSN A;  3UTG A;  1F8R A;  3DJJ A;  4B64 A;  2YLZ A;  3ADA B;  2WU5 A;  3HYX A;  4ZN0 A;  1CJ4 A;  1ZY8 A;  3VR9 A;  4A7A A;  2YG5 A;  2WES A;  3NHO X;  3RED A;  3TG1 B;  1N4V A;  1NPX A;  1TDO A;  3QSS A;  1D7L A;  4GRT A;  4FK1 C;  2OLN A;  1IUW A;  5BRT A;  1O95 A;  3AYL A;  5KRQ A;  3AE3 A;  3T2K A;  3ILM A;  3EF6 A;  2ACZ A;  4D03 A;  3QVR A;  2BYB A;  4B1B A;  2GWF A;  1IUX A;  3NYC A;  2RGJ A;  4NEW A;  4YKG A;  2JTS A;  3PO7 A;  1BWC A;  1PXB A;  5KOX A;  3G5R A;  3GDP A;  4Z2T A;  3UKQ A;  2I0Z A;  4C3X A;  2OAM A;  3IF9 A;  4AT2 A;  3NTA A;  1DJQ A;  5FMH A;  3AWI A;  4RG4 A;  4YTP A;  3ISH A;  1XAN A;  1FEB A;  1RHD A;  2B9X A;  2C3D A;  1M64 A;  4C74 A;  4OCG A; 
#chains in the Genus database with same CATH homology
 4H4Z A;  3AEG A;  2HQM A;  1NHP A;  3QSM A;  3GWD A;  1NG3 A;  3GRS A;  4EQR A;  4FX9 A;  2GF3 A;  2E5V A;  2X50 A;  4B65 A;  5JCM A;  4WX1 A;  3C4N A;  4EQW A;  3SFE A;  2A2K A;  5HBP A;  3QVP A;  2BS3 A;  3BHK A;  4BV6 A;  1KF6 A;  5JCK A;  3BHF A;  3EAO A;  2DCQ A;  3AE8 A;  4GDP A;  4YSY A;  2GRT A;  5FS7 A;  1PJ7 A;  2EQ7 A;  3BNM A;  5FS6 A;  3DA1 A;  1F3P A;  2RGH A;  4A5L A;  2YLT A;  3AE4 A;  3DJE A;  4EIQ A;  4JGT A;  1K0J A;  4JY2 A;  5EB5 A;  2YG6 A;  4H4Q A;  4H50 A;  1E1M A;  2YR6 A;  2BS2 A;  4BJY A;  3OC4 A;  4J57 A;  2R4E A;  1TDF A;  1GXF A;  4CY6 A;  1H82 A;  1Z6L A;  3AE2 A;  2IVD A;  3OZ2 A;  1H7W A;  3OP3 A;  2YWL A;  4Y4N A;  4J36 A;  1OJC A;  3AEC A;  1JOA A;  4IV9 A;  3TP9 A;  2TPR A;  2YG3 A;  1PBF A;  1DOB A;  2VZ2 A;  3ATQ A;  2GR0 A;  3Q6J A;  3UKK A;  4AT0 A;  4GUV A;  4KX6 A;  1XDI A;  4ZCC A;  1H86 A;  2GMH A;  1BZL A;  4YXD A;  3QFA A;  1XPQ A;  1X31 B;  1LJ1 A;  1YQ4 A;  2Z5Y A;  4D04 A;  1GRH A;  2ZZ0 A;  3UOZ A;  2GVC A;  3SGL A;  4OPT A;  3NYE A;  3C96 A;  4O5U A;  1OJA A;  4M52 A;  3H8I A;  5ER0 A;  1DJN A;  2OAL A;  2EQ6 A;  2XLS A;  3K7M X;  1L9C A;  2B76 A;  2C66 A;  4H4P A;  2XVF A;  3II4 A;  1ONF A;  2H89 A;  3NK0 X;  1GRB A;  3FG2 P;  2ZZC A;  1Y56 B;  2YR4 A;  1S2Y A;  4K5R A;  2BRY A;  1YKJ A;  2V3A A;  2XLT A;  3FPZ A;  2NPX A;  3BI4 A;  4IVO B;  4Y4M A;  4Z26 A;  2XYO A;  1DXL A;  1FL2 A;  4C5O A;  3CGB A;  1TYT A;  3B6D A;  3T0K A;  3ALJ A;  5HXI A;  4U8N A;  2WDQ A;  4U8K A;  1UAR A;  2WHD A;  3ATR A;  4IA5 A;  2EG4 B;  1H6V A;  2WDV A;  1H83 A;  2EG4 A;  4JN9 A;  5J60 A;  3EAN A;  4PAA A;  1YQZ A;  1ZMD A;  2Y6Q A;  4CY8 A;  1L9D A;  3CGD A;  4U8P A;  3HIX A;  4WH7 A;  3DH9 A;  1B5Q A;  1KNR A;  3HYW A;  3AE6 A;  3LJP A;  3NGC X;  2WOI A;  3VQR A;  5BUK A;  2A8X A;  1GV4 A;  2EG3 A;  1BGN A;  1FEA A;  3KA7 A;  2BAC A;  3F8P A;  3VRD B;  1NHQ A;  3SZW A;  1B8S A;  2WP9 A;  1CC6 A;  3SXI A;  1GRT A;  5EB4 A;  4XWR A;  3AE1 A;  4J34 A;  3SQP A;  2OA1 A;  3IC9 A;  3AXB A;  3C4A A;  4BK1 A;  3CGE A;  3ITJ A;  1YML A;  3H8L A;  3UTE A;  4EQS A;  3NIX A;  2AQJ A;  1CJC A;  1CWR A;  3V3N A;  4YKF A;  2HHG A;  1M6I A;  1S2Q A;  2BC0 A;  4K22 A;  4EIP A;  1Q1R A;  3KKJ A;  3TG3 A;  3FMW A;  5L46 A;  2YQU A;  1TDN A;  2IID A;  1YY5 A;  4REK A;  3T31 A;  5M10 A;  4ZCD A;  2WLR A;  3LB8 A;  5LAM A;  3UOV A;  2APG A;  1DOE A;  1Q1W A;  3AEE A;  1NHR A;  1NEK A;  4U8O A;  2DKI A;  2PYX A;  5U1O A;  4AOS A;  1PS9 A;  2ARD A;  4O5Q A;  3NNE A;  4U8J A;  5U63 A;  4LA1 A;  5JCL A;  2FJE A;  3I3L A;  4Z44 A;  4OVI A;  2X8H A;  1YT8 A;  2C7G A;  1RP0 A;  1H84 A;  2C64 A;  2WOW A;  3GMB A;  2Q0L A;  2QA1 A;  3JSK A;  3PVC A;  4TM1 A;  4UDP A;  1UKV G;  1OJT A;  1E1N A;  1LQU A;  2BCG G;  2F5Z A;  3IWA A;  4HB9 A;  5FS8 A;  2BCP A;  4YTM A;  4AP3 A;  2A87 A;  1DP2 A;  4H4X A;  2C67 A;  3KLJ A;  2WPC A;  2R46 A;  3VRB A;  3PS9 A;  1NG4 A;  1RYI A;  4B66 A;  5TR3 A;  3RP8 A;  2V6O A;  3S61 A;  2JK6 A;  4A9W A;  2VSW A;  2OLO A;  3GDN A;  2VRL A;  1H4M X;  3GSI A;  4GR1 A;  1P2E A;  4CBQ A;  4K5S A;  3CPI G;  1FEC A;  1QJD A;  2W0H A;  1CL0 A;  4RSL A;  2MOL A;  4K7Z A;  4Y4L A;  1PN0 A;  4CNJ A;  4DSG A;  3KPF A;  4F67 A;  3M12 A;  1OKG A;  3I6D A;  2ZBW A;  3UTH A;  5KVH A;  1GOS A;  1PJ6 A;  2NVK X;  2YVJ A;  1F8S A;  4GCM A;  4BK2 A;  4TM0 A;  1F6M A;  2GB0 A;  4A99 A;  2X99 A;  1H4K X;  1ZX9 A;  2WU2 A;  1GTE A;  1VRQ B;  2JB2 A;  3NKS A;  2JBV A;  2WEU A;  5KXJ A;  3UKL A;  1KSS A;  4BUR A;  1ELI A;  1H81 A;  2YVG A;  4GF7 A;  4NZH A;  4X4J A;  3AE9 A;  5KWF A;  3GWF A;  2R9Z A;  4JY3 A;  2C70 A;  2VVM A;  4FDC B;  2BK5 A;  3AED A;  1GPE A;  3P3A A;  4H7U A;  3KVE A;  4IVM B;  4H4R A;  2WPF A;  4DGK A;  1GRF A;  2H88 A;  3NTD A;  1N4U A;  3CIR A;  4CCR A;  3FLH A;  2JB3 A;  5JCI A;  2WPE A;  2C65 A;  4J33 A;  3DK4 A;  3GK5 A;  1VG0 A;  4JQ9 A;  2Y6R A;  1E39 A;  4Z43 A;  2Q6U A;  3HZU A;  1TYP A;  1CBO A;  4G74 A;  3P4R A;  4RG3 A;  3NLC A;  3LXD A;  5CKU A;  3UKH A;  4AP1 A;  4OPL A;  2FSX A;  3CNS A;  4NWZ A;  1ZOV A;  1WV9 A;  3NT6 A;  3DME A;  1GTH A;  2YM1 A;  3B3R A;  3VR8 A;  1EL8 A;  2YAU A;  1VQW A;  2V3B A;  1D4D A;  1MO9 A;  2J6P A;  1GER A;  1CC2 A;  2BC1 A;  1TRB A;  1GES A;  2C75 A;  1Q9I A;  3AE5 A;  3IHM A;  5C3J A;  1Y56 A;  3CTY A;  5IPY A;  4UDR A;  2KL3 A;  5HBQ A;  1YQ3 A;  2JAE A;  4H2N A;  4J2W A;  2RGO A;  3COX A;  1ORB A;  3D8X A;  1HYU A;  1E1K A;  2GAG B;  4USR A;  2B7R A;  1KNP A;  1S3B A;  3S5W A;  2ZZB A;  2GR3 A;  4KPR A;  4II2 A;  1O5W A;  3M13 A;  4FK1 A;  4BK3 A;  2YLX A;  3CN8 A;  4X9M A;  4ECH A;  2XVH A;  3R9U A;  2FBW A;  1N1P A;  2IFD A;  4WH9 A;  3IHG A;  4H2R A;  2XFU A;  2ORA A;  3E1T A;  1VG9 A;  3NK2 X;  1XHC A;  1GEU A;  3ALL A;  4OPG A;  4A65 A;  2C3C A;  2WP5 A;  3KD9 A;  2J3N A;  1F8W A;  1QB0 A;  3P4S A;  1WHB A;  3AAY A;  2XFO A;  3M0O A;  4A6N B;  3ICS A;  2PHH A;  2JTR A;  2RAB A;  2XVI A;  3ZYX A;  4Z25 A;  5KNL A;  3KPK A;  1JNZ A;  4YSZ A;  4G73 A;  1YS0 A;  1JRZ A;  2YM2 A;  3CND A;  3LOV A;  4H4V A;  3HZL A;  4I59 A;  4JNA A;  5CQF A;  3D1P A;  2GMJ A;  5DBJ A;  1ZMC A;  5HBL A;  3G5J A;  3IWH A;  2GV8 A;  1REO A;  5HY5 A;  3K9R A;  3F4A A;  4YWO A;  1QLB A;  1EBD A;  3SFD A;  4J31 A;  3WE0 A;  2O9Z A;  3T2Y A;  2WS3 A;  3NG7 X;  2DKH A;  1CJ3 A;  3BI5 A;  3KU9 A;  4OPI A;  4TLZ A;  2YG4 A;  4GAP A;  3ZDN A;  1PXA A;  4P9S A;  4C3Y A;  2C73 A;  4H4W A;  1BOH A;  1TDE A;  3AB1 A;  3K7Q X;  2Q0K A;  4USQ A;  5U25 A;  2VRM A;  4NEV A;  2BA9 A;  2C4C A;  3CNT A;  2YG7 A;  2C76 A;  4NNJ A;  2VVL G;  3AEF A;  1K0I A;  3SYI A;  1BKW A;  4H2P A;  3NYF A;  1E6E A;  3K7T A;  3EPT A;  4IA6 A;  3F8D A;  4LII A;  1E7P A;  1ZK7 A;  3UTF A;  2AR8 A;  2XCG A;  2XLR A;  1CWS A;  3RP6 A;  5KMR A;  2BK4 A;  4EMJ A;  3FS5 A;  4Z2U A;  4K8D A;  2Z5X A;  1JNR A;  1CJ2 A;  4XXG A;  2EQ8 A;  1LV0 A;  3Q9T A;  4TM3 A;  5HBO A;  2BXR A;  3FIM B;  2CUL A;  1PBB A;  3LZX A;  1PXC A;  3AEB A;  4G6H A;  5GSN A;  4AOX A;  3AEA A;  2B9Y A;  2GH5 A;  2XDO A;  3GRT A;  4ICY A;  4CRT A;  4YT0 A;  3AE7 A;  3SM8 A;  2GAH B;  2XLU A;  3DK8 A;  4B63 A;  3CNP A;  3SZF A;  4II3 A;  2X8G A;  3SZ0 A;  1D4C A;  2QA2 A;  2V61 A;  1CC4 A;  5JCN A;  2XFN A;  3DK9 A;  3NK1 X;  3UP5 A;  1GMX A;  3QJ4 A;  2R45 A;  2GEW A;  3AD8 B;  1N4W A;  3ICT A;  2WBA A;  5BVA A;  5KMP A;  1EL5 A;  2E1M A;  2AAQ A;  3AD7 B;  3P9U A;  1IUV A;  3RNM A;  1JEH A;  3NN0 X;  1GAL A;  3L1R A;  1C25 A;  2XFQ A;  4BJZ A;  1DNC A;  1EL7 A;  3UOY A;  3FBS A;  2FJB A;  2XLP A;  4I58 A;  1PJ5 A;  4U8I A;  4H4U A;  1IUT A;  2VQB A;  1LTX R;  3CMM A;  4N9X A;  2OUC A;  4DNA A;  2YVF A;  4ADW A;  1E0C A;  1FOH A;  3SX6 A;  3AD9 B;  3G5S A;  3UP4 A;  3MZZ A;  1PDH A;  4K2X A;  4TLX A;  1L9E A;  2R0P A;  3GD3 A;  3K30 A;  3DJD A;  4X9N A;  5C2T A;  2MOI A;  1CWT A;  5IQ4 A;  1TDK A;  2GR2 A;  1NHS A;  3UKF A;  2FJA A;  5FS9 A;  1BOI A;  4G6G A;  4APN A;  4WCT A;  3HWI A;  5LV9 A;  4OPD A;  3P4Q A;  4U2S A;  1S3E A;  3P1W A;  4U2L A;  4U8M A;  1KFY A;  1NDA A;  3IPP A;  4J56 A;  1L0V A;  1COY A;  4OPC A;  1CHU A;  1GND A;  4B69 A;  1NAA A;  4H4T A;  2VVL A;  4CNK A;  1B37 A;  1GRA A;  3NH3 X;  1H7X A;  1PHH A;  4NTC A;  3RP7 A;  2JB1 A;  3AYI A;  1LPF A;  1NEN A;  1BGJ A;  2Q7V A;  1URH A;  3L8K A;  3LAD A;  4LU6 A;  5J7X A;  3T37 A;  1D7Y A;  3FOJ A;  1MOK A;  2YLW A;  4EQX A;  4EMI A;  3ALM A;  3OLH A;  2WP6 A;  3G5Q A;  2E4G A;  1CF3 A;  2CVJ A;  4GDE A;  1T3K A;  3DGH A;  1OJ9 A;  2VOU A;  4H4Y A;  4Z2R A;  3CNJ A;  5BUL A;  2YR5 A;  2R0G A;  4NTE A;  1FCD A;  5LAO A;  3ABV A;  1VDC A;  5M0Z A;  3HYV A;  1SEZ A;  3GD4 A;  2FJD A;  4YTN A;  3BI2 A;  3QSE A;  1YMD A;  2IVE A;  3GYJ A;  4EMW A;  2XVE A;  1VEE A;  3P4P A;  1AOG A;  3QFB A;  2BRA A;  2QCU A;  2R4J A;  2WLX A;  2QAE A;  2WQY A;  2X3N A;  2XFP A;  1YMK A;  1PBE A;  3AYJ A;  1YM9 A;  3RHA A;  2TMD A;  3F8R A;  3GYX A;  4YSX A;  3CGC A;  1OJD A;  2UZZ A;  1KSU A;  2CDU A;  1KDG A;  4A6N A;  3UCL A;  1ZKQ A;  1ZOY A;  4UP3 A;  1RSG A;  1RHS A;  1QXN A;  2JTQ A;  3AAX A;  3I3U A;  3FNJ A;  4OPU A;  3UOX A;  2A89 A;  3T14 A;  4A79 A;  4DSH A;  3UTN X;  4JNQ A;  4H4S A;  1JU2 A;  1PBD A;  2BAB A;  2BXS A;  2GQW A;  3UKP A;  2V60 A;  4B68 A;  3DGZ A;  1IJH A;  2GR1 A;  2YLR A;  2YLS A;  4XWZ A;  2K0Z A;  2X8C A;  3CPH G;  1GET A;  1PBC A;  4PAB A;  4C77 A;  3V3O A;  1D5T A;  2EQ9 A;  2UZQ A;  1TQ1 A;  3IPO A;  2C72 A;  2XVJ A;  3SZC A;  1K0L A;  4EM4 A;  1V59 A;  4UDQ A;  4JDR A;  4NTD A;  2WDR A;  4E0V A;  1LVL A;  1LQT A;  3I2V A;  2IFV A;  3ICR A;  3DJG X;  5HPA A;  3H4K A;  1B4V A;  4CCQ A;  4U2T A;  5KVI A;  3UKA A;  1IUU A;  1ZDL A;  2B7S A;  2BS4 A;  3BNU A;  3GMC A;  3O0H A;  5EBK A;  3SY4 A;  2R0C A;  1DOD A;  2B9W A;  2GQF A;  5KMQ A;  4MJW A;  1GRE A;  1BF3 A;  4H2Q A;  1MXT A;  5IQ1 A;  4GAV A;  1W4X A;  1GRG A;  4U8L A;  5HYM A;  5EOW A;  1P2H A;  2V5Z A;  2CFY A;  4YSH A;  4EM3 A;  5HHF A;  1JRX A;  3CPJ G;  1IUS A;  1HZM A;  1QO8 A;  1Y0P A;  2JKC A;  2WET A;  3T2Z A;  1O94 A;  1DOC A;  2MRM A;  2WOV A;  3GYI A;  1GN0 A;  3NRN A;  3NHV A;  4TM4 A;  1JRY A;  3LZW A;  5KMS A;  3D1C A;  3VRA A;  1GT8 A;  5GRT A;  3R2U A;  3NN6 X;  4HA6 A;  3V76 A;  4B67 A;  2VQ7 A;  4G9K A;  1E1L A;  3O3W A;  5KOW A;  2BK3 A;  1D4E A;  1K4Q A;  1EL9 A;  1ZP0 A;  4Z24 A;  3URH A;  1GSN A;  3UTG A;  1F8R A;  3DJJ A;  4B64 A;  2YLZ A;  3ADA B;  2WU5 A;  3HYX A;  4ZN0 A;  1CJ4 A;  1ZY8 A;  3VR9 A;  4A7A A;  2YG5 A;  2WES A;  3NHO X;  3RED A;  3TG1 B;  1N4V A;  1NPX A;  1TDO A;  3QSS A;  1D7L A;  4GRT A;  4FK1 C;  2OLN A;  1IUW A;  5BRT A;  1O95 A;  3AYL A;  5KRQ A;  3AE3 A;  3T2K A;  3ILM A;  3EF6 A;  2ACZ A;  4D03 A;  3QVR A;  2BYB A;  4B1B A;  2GWF A;  1IUX A;  3NYC A;  2RGJ A;  4NEW A;  4YKG A;  2JTS A;  3PO7 A;  1BWC A;  1PXB A;  5KOX A;  3G5R A;  3GDP A;  4Z2T A;  3UKQ A;  2I0Z A;  4C3X A;  2OAM A;  3IF9 A;  4AT2 A;  3NTA A;  1DJQ A;  5FMH A;  3AWI A;  4RG4 A;  4YTP A;  3ISH A;  1XAN A;  1FEB A;  1RHD A;  2B9X A;  2C3D A;  1M64 A;  4C74 A;  4OCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...