3NT6A

Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant
Total Genus 172
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
172
sequence length
565
structure length
565
Chain Sequence
MKKILIIGGVAGGASAAARARRLSETAEIIMFERGEYVSFANSGLPYHISGEIAQRSALVLQTPESFKARFNVEVRVKHEVVAIDRAAKLVTVRRLLDGSEYQESYDTLLLSPGAAPIVPPIPGVDNPLTHSLRNIPDMDRILQTIQMNNVEHATVVGGGFIGLEMMESLHHLGIKTTLLELADQVMTPVDREMAGFAHQAIRDQGVDLRLGTALSEVSYQVQTHVASDAAGEDTAHQHIKGHLSLTLSNGELLETDLLIMAIGVRPETQLARDAGLAIGELGGIKVNAMMQTSDPAIYAVGDAVEEQDFVTGQACLVPLAGPANRQGRMAADNMFGREERYQGTQGTAICKVFDLAVGATGKNEKQLKQAGIAFEKVYVHTASHASYYPGAEVVSFKLLFDPVKGTIFGAQAVGKDGIDKRIDVMAVAQRAGMTVEQLQHLELSYAPPYGSAKDVINQAAFVASNIIKGDATPIHFDQIDNLSEDQLLLDVRNPGELQNGGLEGAVNIPVDELRDRMHELPKDKEIIIFSQVGLRGNVAYRQLVNNGYRARNLIGGYRTYKFAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of an NADH-Dependent Persulfide Reductase from Shewanella loihica PV-4: Implications for the Mechanism of Sulfur Respiration via FAD-Dependent Enzymes .
pubmed doi rcsb
molecule keywords FAD-dependent pyridine nucleotide-disulphide oxidoreductase
molecule tags Oxidoreductase
source organism Shewanella loihica
total genus 172
structure length 565
sequence length 565
chains with identical sequence B
ec nomenclature ec 1.8.1.14: CoA-disulfide reductase.
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00581 Rhodanese Rhodanese-like domain
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.250.10 Alpha Beta 3-Layer(aba) Sandwich Oxidized Rhodanese; domain 1 Rhodanese-like domain 3nt6A03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nt6A01
4JGTA 2XVHA 4UDRA 1BKWA 3AE7A 2MRMA 1OJCA 4BV6A 2GQFA 5CQFA 2O9ZA 2R9ZA 1GTEA 3UKFA 3UOXA 4BJZA 1JRXA 4Z2UA 4USQA 1RSGA 3AYIA 1ZOYA 5IQ4A 2JBVA 4C77A 3UCLA 1D4CA 3PO7A 4EMWA 2XFPA 3UP5A 1ORBA 5U1OA 2Q0LA 2R46A 1BOIA 2EQ8A 4TM3A 5L46A 2V60A 1H4MX 3DJDA 5KVIA 1GRFA 3EF6A 2RGJA 2QCUA 3HZLA 3I2VA 4IA6A 1LQTA 3AE3A 2WEUA 1NG3A 3I3LA 1BWCA 2APGA 1KSSA 4IV9A 1YQ4A 1FL2A 1L9DA 1V59A 2BCPA 3DJGX 2YG3A 3NYFA 5FS9A 3AEFA 4B63A 4YSXA 2R4JA 3GWFA 4H7UA 4XWZA 3VRDB 3KA7A 2C7GA 4PAAA 4WCTA 4EQSA 2R0GA 1JEHA 1GPEA 3R2UA 1NPXA 1FCDA 3AE8A 2WP6A 5KXJA 4UDPA 1GRTA 1PHHA 4OPGA 5KWFA 1D4DA 2XLPA 4HB9A 1IJHA 3LADA 1PXCA 4K7ZA 2EG3A 3II4A 3UOYA 4I58A 5KRQA 3NTAA 4CNKA 1H84A 2B76A 3AEGA 1IUSA 1IUXA 2Y6QA 3Q9TA 1Q9IA 3TG1B 4H50A 2EG4B 3ICSA 1CJ4A 2OLNA 2YVJA 4NTEA 3AAXA 1YKJA 4IA5A 2VOUA 2VQBA 1K0LA 3GYIA 1QB0A 2Z5XA 4A6NB 2R0PA 1NDAA 4H4WA 4Z25A 2VVMA 1N4VA 3CPJG 3C4NA 1PS9A 4CBQA 1P2EA 3UTNX 2JB1A 4PABA 4EQXA 2BXRA 3DH9A 3UTGA 4YSYA 2V3AA 3WE0A 4GF7A 2A89A 3QFAA 4H4QA 3NKSA 3GYJA 4D03A 5CKUA 3HIXA 2I0ZA 1S3BA 3G5RA 4H2NA 3VRAA 1PJ5A 3FS5A 1GT8A 2OLOA 1E39A 5HXIA 3UTFA 3I3UA 4XWRA 2YLSA 2YR6A 3NIXA 5FS6A 3NTDA 2BS3A 2V61A 2XLUA 4U2LA 5LAMA 3NK1X 4U8MA 1GALA 3NN0X 1D4EA 3P9UA 1GRAA 2WDRA 4EIPA 4U2TA 1H4KX 3RHAA 2BS2A 4H4TA 4AT0A 1XHCA 4GDPA 3HZUA 4H4ZA 1S3EA 3H4KA 1QJDA 3NH3X 1E1KA 1TDEA 2DKHA 1S2YA 3NGCX 1OJDA 2EQ7A 1L0VA 3BI5A 1D5TA 3FIMB 1E6EA 4A99A 4BJYA 3QSSA 1DP2A 1Y56A 2GB0A 3OZ2A 4ADWA 1NAAA 3SGLA 3UKLA 1E0CA 2WOVA 1JOAA 2WP5A 1ZK7A 2RGOA 2UZQA 3EANA 1D7YA 4Z43A 2WESA 2C72A 1YY5A 2WOWA 2WOIA 5DBJA 1RHDA 4REKA 3REDA 2YWLA 4EM4A 5HYMA 1L9EA 1F8RA 4YTPA 1GOSA 1B37A 3MZZA 2JB2A 2YG7A 4EQRA 1MXTA 1DXLA 1XANA 3CPHG 3P4RA 4OPLA 1K0IA 2HQMA 2C3DA 2JTSA 1UARA 3UOVA 1H82A 4RG3A 1RHSA 4A65A 1GRBA 4M52A 4O5QA 5GSNA 2YG4A 5LV9A 3ILMA 1SEZA 1ZOVA 2XLRA 3GD4A 1PN0A 1PBCA 1OJTA 3AAYA 2R0CA 1GREA 1YS0A 3QJ4A 4JY3A 2Y6RA 3FLHA 3QFBA 1CWSA 2BXSA 1H6VA 3GMCA 3LJPA 2XVIA 2XYOA 3IWHA 2H89A 1XPQA 5GRTA 3F4AA 1CC6A 2GR3A 4NEWA 1QXNA 4Z26A 4J36A 2RGHA 3CTYA 3DA1A 4U8IA 3LOVA 3M12A 3ISHA 3Q6JA 3AE9A 2CULA 2WU5A 3AYJA 4OPDA 4NZHA 4NTDA 3DGHA 3UKQA 1BGNA 2IVEA 2C73A 2XFOA 3AE5A 3C4AA 3M13A 1M6IA 3P4QA 3PVCA 1LV0A 2B9WA 1KFYA 2FJBA 3ATRA 3DJJA 3KD9A 4GR1A 4YKGA 5HY5A 4JN9A 5IQ1A 2XDOA 3AWIA 3AD7B 3CIRA 2AQJA 5JCMA 4GRTA 2AR8A 5JCNA 4N9XA 1XDIA 1F8WA 1NHPA 3BHKA 3NYCA 5JCKA 5IPYA 4YSZA 1E1NA 2B7SA 1GNDA 1DOEA 1E7PA 4H4PA 3IPPA 3IPOA 1LQUA 2ACZA 2CFYA 2JK6A 4K5SA 2JB3A 4B67A 3NT6A 5BVAA 3UKKA 3RP7A 1X31B 2B9XA 2B9YA 4Y4MA 4WX1A 1Y56B 3BI2A 3NG7X 4ECHA 2XFNA 2YG5A 3PS9A 3QSMA 4OPTA 2BCGG 1KNRA 1CBOA 4C3YA 2YQUA 4C74A 1D7LA 3CNDA 4F67A 1DOBA 4YXDA 5HPAA 4ZCDA 3F8PA 1ZP0A 1LJ1A 1KF6A 3CNSA 3CGDA 2HHGA 1Z6LA 2K0ZA 4YTMA 4CRTA 2XFUA 3V3OA 2ORAA 3GMBA 5FMHA 1GTHA 1PBDA 1C25A 1FEAA 4BK3A 5M10A 1TYPA 2ZZ0A 3LZWA 1N1PA 1O5WA 4FK1A 4H4VA 5ER0A 1MOKA 4Y4NA 1M64A 3SFDA 1B4VA 2XFQA 1ZMCA 4NEVA 2X99A 3K9RA 4TLZA 3FBSA 2NVKX 1PDHA 4Z24A 1YMKA 2BK4A 4OPIA 4RSLA 1LVLA 3K30A 3CNTA 4AP1A 4Z44A 1Q1WA 4D04A 5HBQA 1GESA 2YG6A 4OVIA 3ICRA 4C3XA 1W4XA 1TDNA 4A5LA 3B3RA 3ZDNA 3TP9A 1COYA 3NK0X 3NHVA 1EBDA 1TDOA 3LZXA 2WBAA 3FOJA 4C5OA 1BZLA 3P1WA 3GSIA 1EL9A 1FECA 2XVEA 1JRYA 2GH5A 4J33A 2YR5A 2V5ZA 2J6PA 1H83A 4YWOA 4X9NA 3F8DA 1CJ2A 3COXA 1EL5A 2BS4A 2YAUA 1DJNA 1WV9A 4B69A 1OJ9A 1PJ7A 3S5WA 3CGBA 3F8RA 1ZY8A 2Q6UA 2R45A 3AB1A 3NLCA 4OPCA 1JNZA 1QLBA 2RABA 1CL0A 2C65A 2FSXA 1VG9A 2J3NA 1NG4A 4YKFA 4AT2A 3AE4A 2A87A 2C66A 4KX6A 4AOSA 4J31A 2GMJA 1NEKA 3ALMA 2WPFA 4J34A 1H81A 1KSUA 4TM0A 3FPZA 1ZDLA 2WPCA 1OKGA 2X8GA 2GR2A 3VQRA 2KL3A 1NENA 1E1LA 1GETA 3CGEA 1JRZA 3UKAA 1BGJA 2EQ9A 2GAGB 4J2WA 4USRA 2C76A 5U63A 1WHBA 1Q1RA 3DK9A 4X9MA 3CNJA 2YM1A 4A9WA 3NYEA 4OCGA 4B66A 2FJAA 3AECA 4B64A 1CJ3A 2BK5A 1TYTA 1N4WA 1NHQA 2BABA 3AYLA 4U8JA 5TR3A 3RP6A 3URHA 4YTNA 2FBWA 2Q7VA 1QO8A 4J56A 4X4JA 5BUKA 3OP3A 2F5ZA 3ICTA 1JNRA 4CY8A 5HBLA 3EAOA 4EMIA 3BI4A 4Z2RA 4H4XA 3D1PA 3NRNA 3KVEA 3QSEA 3VR9A 1IUVA 2GQWA 2GV8A 3KPFA 2JKCA 4JNQA 1HZMA 1PBBA 1YQZA 2PYXA 1ELIA 2VQ7A 3BNUA 3CGCA 3P4PA 2FJEA 1GV4A 2IFVA 1PXBA 3S61A 1HYUA 5HHFA 1TQ1A 4H4SA 2BC0A 3K7QX 3AE2A 1YQ3A 3L8KA 3LB8A 3NHOX 4ZN0A 1PBFA 4OPUA 1IUUA 4WH9A 1PJ6A 2WS3A 3UKPA 1NHRA 1CJCA 5EB4A 2UZZA 4A79A 2X3NA 5M0ZA 3RP8A 2C75A 1O94A 2MOLA 3VR8A 2NPXA 4CCRA 3T37A 2GEWA 1REOA 1PXAA 2E1MA 1RP0A 2VSWA 2V6OA 3P3AA 5J60A 2X50A 3AEAA 3R9UA 1GEUA 2WETA 5FS7A 3H8LA 1BF3A 1CHUA 1GXFA 1N4UA 4K5RA 1MO9A 4ZCCA 4K2XA 3B6DA 1GMXA 2EQ6A 4U2SA 2FJDA 4DSHA 3ALJA 1FOHA 4LIIA 1KDGA 2A8XA 5JCLA 2AAQA 4U8NA 5C3JA 2WQYA 4H2PA 2DCQA 4APNA 2WP9A 1ZKQA 2W0HA 1AOGA 2XCGA 3HWIA 5J7XA 1Y0PA 2JAEA 1ZMDA 3UTHA 2YLRA 1VEEA 2GR1A 3V3NA 3QVPA 4YT0A 2B7RA 3M0OA 4HA6A 1E1MA 3GD3A 3GDNA 2OALA 4Y4LA 1VRQB 4MJWA 1TDFA 3AD9B 3E1TA 4JDRA 3H8IA 2TPRA 3FG2P 4JQ9A 3CPIG 2YLTA 3AEDA 4UP3A 3GDPA 5C2TA 1UKVG 4ICYA 1YMLA 3NNEA 4K8DA 4XXGA 3QVRA 3ALLA 1T3KA 2E5VA 4LA1A 1F6MA 1GN0A 1F3PA 2WU2A 2Z5YA 4NTCA 4U8OA 4RG4A 1PBEA 1B8SA 3FNJA 2ZBWA 2CDUA 1DNCA 1VQWA 2BA9A 4GDEA 1LTXR 2QA1A 5LAOA 3G5JA 1DODA 1TRBA 3BHFA 1TDKA 2C3CA 2QA2A 4DGKA 2CVJA 1FEBA 4H2RA 2BK3A 4DNAA 3DK8A 3O0HA 3GWDA 4B65A 4BK2A 4EMJA 2C64A 2VVLG 4H2QA 4Z2TA 4CY6A 2XVJA 4E0VA 2XLTA 4FX9A 3KKJA 5BRTA 3RNMA 2WLXA 1LPFA 1F8SA 2XLSA 3SQPA 5KOWA 2XVFA 4AOXA 3DMEA 2VZ2A 4U8PA 2E4GA 3DGZA 1CC2A 2BACA 3AEEA 3G5SA 1KNPA 2GVCA 4IVOB 4O5UA 2DKIA 4B1BA 4WH7A 1CC4A 3ABVA 1GRGA 2H88A 4B68A 1CWTA 4TM1A 4U8LA 3AXBA 3GRSA 3GK5A 3AE1A 4K22A 2VVLA 3CN8A 1JU2A 3AE6A 5EOWA 1DOCA 3G5QA 4I59A 2BYBA 1URHA 1GSNA 1NHSA 2WPEA 3UOZA 5U25A 2V3BA 2VRLA 2JTRA 1EL8A 2C67A 1IUTA 2GMHA 1EL7A 1S2QA 3I6DA 3IHMA 1P2HA 2OA1A 2ARDA 2YVFA 4P9SA 3DK4A 5EB5A 4BURA 2YLXA 4H4YA 1O95A 2BC1A 1IUWA 3IWAA 2IVDA 2OUCA 3IHGA 3C96A 5BULA 2WDQA 1GRHA 4GCMA 3EPTA 3AD8B 3D1CA 2GF3A 3P4SA 1BOHA 1H7XA 4JNAA 1H7WA 4IVMB 3ITJA 3IC9A 5HBOA 3D8XA 2ZZCA 3DJEA 4UDQA 5JCIA 1YT8A 2R4EA 4JY2A 3UKHA 1YM9A 5KOXA 4GUVA 5FS8A 2GWFA 4H4UA 4DSGA 2VRMA 3NN6X 3ZYXA 1ZX9A 4A7AA 2X8HA 4CCQA 3TG3A 3CNPA 4CNJA 4BK1A 1OJAA 5EBKA 2GR0A 2MOIA 2Q0KA 2QAEA 3AEBA 4TM4A 2YLWA 2JTQA 2OAMA 3O3WA 1VDCA 2WLRA 3K7TA 3OC4A 3SFEA 2TMDA 2EG4A 1GERA 2IIDA 4LU6A 4FDCB 4EIQA 2X8CA 4KPRA 1L9CA 2A2KA 2WDVA 2GAHB 3ADAB 3NK2X 2GRTA 1DJQA 2PHHA 2WHDA 2YR4A 2C70A 4A6NA 3UP4A 1VG0A 4EM3A 4U8KA 4TLXA 4H4RA 3KLJA 1RYIA 3KU9A 5HBPA 2YVGA 3V76A 3OLHA 2ZZBA 3ATQA 4FK1C 3LXDA 4AP3A 3VRBA 1H86A 3SM8A 2IFDA 3BNMA 3UTEA 4EQWA 1CF3A 5KVHA 1ONFA 2YM2A 3K7MX 3JSKA 1B5QA 1K4QA 3FMWA 3GRTA 3IF9A 1K0JA 1YMDA 2YLZA 1CWRA 3L1RA 4J57A 4YSHA
chains in the Genus database with same CATH superfamily
4JGTA 2XVHA 4UDRA 1BKWA 3AE7A 2MRMA 1OJCA 4BV6A 2GQFA 5CQFA 2O9ZA 2Q82A 1GTEA 2R9ZA 3T14A 3UKFA 3UOXA 4BJZA 1JRXA 4Z2UA 4USQA 1RSGA 3AYIA 1ZOYA 5IQ4A 2JBVA 4C77A 3UCLA 1D4CA 3PO7A 4EMWA 2XFPA 3UP5A 1ORBA 5U1OA 2Q0LA 2R46A 1BOIA 2EQ8A 4TM3A 5L46A 2V60A 1H4MX 3DJDA 5KVIA 1GRFA 3EF6A 2RGJA 2QCUA 3HZLA 3I2VA 4IA6A 1LQTA 3AE3A 2WEUA 1NG3A 3I3LA 1BWCA 2APGA 1KSSA 4IV9A 1YQ4A 1FL2A 1L9DA 1V59A 2BCPA 3DJGX 2YG3A 3NYFA 5FS9A 3AEFA 4B63A 4YSXA 2R4JA 3GWFA 4H7UA 4XWZA 3VRDB 3KA7A 2C7GA 4G9KA 4PAAA 4WCTA 4EQSA 2R0GA 1JEHA 1GPEA 3R2UA 1NPXA 1FCDA 3AE8A 2WP6A 5KXJA 4UDPA 1GRTA 1PHHA 4OPGA 5KWFA 1D4DA 2XLPA 4HB9A 1IJHA 3LADA 1PXCA 4K7ZA 2EG3A 3II4A 3UOYA 4I58A 5KRQA 3NTAA 4CNKA 1H84A 2B76A 3AEGA 1IUSA 1IUXA 2Y6QA 3Q9TA 1Q9IA 3TG1B 4H50A 2EG4B 3ICSA 1CJ4A 2OLNA 2YVJA 4NTEA 3AAXA 1YKJA 4IA5A 2VOUA 2VQBA 1K0LA 3GYIA 1QB0A 2Z5XA 5KMPA 4A6NB 2R0PA 1NDAA 4H4WA 4Z25A 2VVMA 1N4VA 3CPJG 3C4NA 1PS9A 4CBQA 1P2EA 3UTNX 2JB1A 4PABA 4EQXA 2BXRA 3DH9A 3UTGA 4YSYA 2V3AA 3WE0A 4GF7A 2A89A 3QFAA 4H4QA 3NKSA 3GYJA 4D03A 5CKUA 3HIXA 2I0ZA 1S3BA 3G5RA 4H2NA 3VRAA 1PJ5A 3FS5A 1GT8A 2OLOA 1E39A 5HXIA 3UTFA 5KMSA 3I3UA 4XWRA 2YLSA 2YR6A 3NIXA 5FS6A 3NTDA 2BS3A 2V61A 2XLUA 4U2LA 5LAMA 3NK1X 4U8MA 1GALA 3NN0X 1D4EA 3P9UA 1GRAA 2WDRA 4EIPA 4U2TA 1H4KX 3RHAA 2BS2A 4H4TA 4AT0A 1XHCA 4GDPA 3HZUA 4H4ZA 1S3EA 3H4KA 1QJDA 3GYXA 1E1KA 1TDEA 3NH3X 2DKHA 4GAVA 1S2YA 3NGCX 1OJDA 2EQ7A 1L0VA 3BI5A 1D5TA 3FIMB 1E6EA 3T31A 4A99A 4BJYA 3QSSA 1DP2A 1Y56A 2GB0A 3OZ2A 4ADWA 1NAAA 3SGLA 3UKLA 1E0CA 2WOVA 1JOAA 2WP5A 1ZK7A 2RGOA 2UZQA 3EANA 1D7YA 4Z43A 2WESA 2C72A 1YY5A 2WOWA 2WOIA 5DBJA 1RHDA 4REKA 3REDA 2YWLA 4EM4A 5HYMA 1L9EA 1F8RA 4YTPA 1GOSA 1B37A 3MZZA 2JB2A 2YG7A 4EQRA 1MXTA 1DXLA 1XANA 3CPHG 3P4RA 4OPLA 3SX6A 1K0IA 2HQMA 2C3DA 2JTSA 1UARA 3UOVA 1H82A 4RG3A 1RHSA 4A65A 1GRBA 4M52A 4O5QA 5GSNA 2YG4A 5LV9A 3ILMA 1SEZA 1ZOVA 2XLRA 3GD4A 1PN0A 1PBCA 1OJTA 5KNLA 3AAYA 2R0CA 1GREA 1YS0A 3QJ4A 4JY3A 2Y6RA 3FLHA 3QFBA 1CWSA 2BXSA 1H6VA 3GMCA 3LJPA 2XVIA 2XYOA 3IWHA 2H89A 1XPQA 5GRTA 3F4AA 1CC6A 2GR3A 4NEWA 1QXNA 4Z26A 4J36A 2RGHA 3CTYA 3DA1A 3HYXA 4U8IA 3LOVA 3M12A 3ISHA 3Q6JA 3AE9A 2CULA 2WU5A 3AYJA 4NWZA 4OPDA 4NZHA 4NTDA 3DGHA 3UKQA 1BGNA 2IVEA 2C73A 2XFOA 3AE5A 3C4AA 3M13A 1M6IA 3P4QA 3PVCA 1LV0A 2B9WA 1KFYA 2FJBA 3ATRA 3DJJA 3KD9A 4GR1A 4YKGA 4G73A 4JN9A 5IQ1A 2XDOA 3AWIA 3AD7B 3CIRA 2AQJA 5JCMA 4GRTA 2AR8A 5JCNA 4N9XA 1XDIA 1F8WA 1NHPA 3BHKA 3NYCA 5JCKA 5IPYA 4YSZA 1E1NA 2B7SA 1GNDA 1DOEA 1E7PA 4H4PA 3IPPA 3IPOA 1LQUA 2ACZA 2CFYA 2JK6A 4K5SA 2JB3A 4B67A 3NT6A 5BVAA 3UKKA 3RP7A 1X31B 2B9XA 2B9YA 4Y4MA 4WX1A 1Y56B 3BI2A 3NG7X 4ECHA 2XFNA 2YG5A 3PS9A 3QSMA 4OPTA 2BCGG 1KNRA 1CBOA 4C3YA 2YQUA 4C74A 1D7LA 3CNDA 4F67A 1DOBA 4YXDA 5HPAA 4ZCDA 3F8PA 1ZP0A 1LJ1A 1KF6A 3CNSA 3CGDA 2HHGA 1Z6LA 2K0ZA 4YTMA 4CRTA 2XFUA 4G6GA 3V3OA 2ORAA 3GMBA 5FMHA 1GTHA 1PBDA 1C25A 1FEAA 4BK3A 5M10A 1TYPA 2ZZ0A 3LZWA 1N1PA 1O5WA 4FK1A 4H4VA 5ER0A 1MOKA 4Y4NA 1M64A 3SFDA 1B4VA 2XFQA 1ZMCA 4NEVA 2X99A 3K9RA 4TLZA 3FBSA 2NVKX 1PDHA 4Z24A 1YMKA 2BK4A 4OPIA 4RSLA 1LVLA 3K30A 3CNTA 4AP1A 4Z44A 1Q1WA 4D04A 5HBQA 1GESA 2YG6A 4OVIA 3ICRA 4C3XA 5KMQA 1W4XA 3CMMA 1TDNA 4A5LA 3B3RA 3ZDNA 3TP9A 1COYA 3NK0X 3NHVA 1EBDA 1TDOA 3LZXA 2WBAA 3T2KA 3FOJA 4C5OA 3SZWA 1BZLA 3P1WA 3GSIA 1EL9A 1FECA 2XVEA 1JRYA 2GH5A 4J33A 2YR5A 3SZ0A 2V5ZA 2J6PA 1H83A 4YWOA 4X9NA 3F8DA 1CJ2A 3COXA 1EL5A 2BS4A 2YAUA 1DJNA 1WV9A 4B69A 1OJ9A 1PJ7A 3S5WA 3CGBA 3F8RA 1ZY8A 2Q6UA 2R45A 3AB1A 3NLCA 4OPCA 1JNZA 1QLBA 2RABA 1CL0A 2C65A 2FSXA 1VG9A 2J3NA 1NG4A 4YKFA 4AT2A 3AE4A 2A87A 2C66A 4KX6A 4AOSA 4J31A 2GMJA 1NEKA 3ALMA 2WPFA 4J34A 1H81A 1KSUA 4TM0A 3FPZA 1ZDLA 2WPCA 1OKGA 2X8GA 2GR2A 3VQRA 2KL3A 1NENA 1E1LA 1GETA 3CGEA 1JRZA 3UKAA 1BGJA 2EQ9A 2GAGB 4J2WA 4USRA 2C76A 3SY4A 5U63A 1WHBA 1Q1RA 3DK9A 4X9MA 3CNJA 2YM1A 4A9WA 3NYEA 4OCGA 4B66A 2FJAA 3AECA 4B64A 1CJ3A 2BK5A 1TYTA 1N4WA 1NHQA 2BABA 3AYLA 4G74A 4U8JA 5TR3A 3RP6A 3URHA 4YTNA 2FBWA 2Q7VA 1QO8A 4J56A 4X4JA 5BUKA 3OP3A 2F5ZA 3ICTA 1JNRA 4CY8A 5HBLA 3T2YA 3EAOA 4EMIA 3BI4A 4Z2RA 4H4XA 3D1PA 3NRNA 3KVEA 3QSEA 3VR9A 1IUVA 2GQWA 2GV8A 3KPFA 2C4CA 2JKCA 4JNQA 1HZMA 1PBBA 1YQZA 2PYXA 3HYWA 1ELIA 2VQ7A 3BNUA 3CGCA 3P4PA 2FJEA 1GV4A 2IFVA 1PXBA 3S61A 1HYUA 4NNJA 5HHFA 1TQ1A 4H4SA 2BC0A 3K7QX 3AE2A 1YQ3A 3L8KA 3LB8A 3NHOX 4ZN0A 1PBFA 4OPUA 3T0KA 1IUUA 4WH9A 1PJ6A 2WS3A 3UKPA 1NHRA 1CJCA 5EB4A 2UZZA 4A79A 2X3NA 5M0ZA 3RP8A 2C75A 1O94A 2MOLA 3VR8A 2NPXA 4CCRA 3T37A 2GEWA 1REOA 1PXAA 2E1MA 1RP0A 2VSWA 2V6OA 3P3AA 5J60A 2X50A 3AEAA 3R9UA 1GEUA 2WETA 5FS7A 3H8LA 1BF3A 1CHUA 1GXFA 1N4UA 4K5RA 1MO9A 4ZCCA 4K2XA 3B6DA 1GMXA 2EQ6A 4U2SA 2FJDA 4DSHA 3ALJA 1FOHA 4LIIA 1KDGA 2A8XA 5JCLA 2AAQA 4U8NA 5C3JA 2WQYA 4H2PA 2DCQA 4APNA 2WP9A 1ZKQA 2W0HA 1AOGA 2XCGA 3HWIA 5J7XA 1Y0PA 2JAEA 1ZMDA 3UTHA 2YLRA 1VEEA 2GR1A 3V3NA 3QVPA 4YT0A 2B7RA 3M0OA 4HA6A 1E1MA 3GD3A 3GDNA 2OALA 4Y4LA 1VRQB 4MJWA 1TDFA 3AD9B 3E1TA 4JDRA 3H8IA 2TPRA 3FG2P 4JQ9A 3CPIG 2YLTA 3AEDA 4UP3A 3GDPA 5C2TA 1UKVG 4ICYA 1YMLA 3NNEA 4K8DA 4XXGA 2BRAA 3ALLA 3QVRA 1T3KA 2E5VA 4LA1A 1F6MA 3T2ZA 1GN0A 1F3PA 2WU2A 2Z5YA 4NTCA 4U8OA 4GAPA 4RG4A 1PBEA 1B8SA 3FNJA 2ZBWA 2CDUA 1DNCA 1VQWA 2BA9A 4G6HA 4GDEA 1LTXR 2QA1A 3SZCA 5LAOA 3G5JA 1DODA 1TRBA 3HYVA 3BHFA 1TDKA 2C3CA 2QA2A 4DGKA 2CVJA 1FEBA 3SYIA 4H2RA 2BK3A 4DNAA 3DK8A 3O0HA 5HY5A 3GWDA 4B65A 4BK2A 4EMJA 2C64A 2VVLG 4H2QA 4Z2TA 4CY6A 2XVJA 4E0VA 2XLTA 4FX9A 3KKJA 5BRTA 3RNMA 2WLXA 1LPFA 1F8SA 2XLSA 3SQPA 5KOWA 2XVFA 4AOXA 3DMEA 2VZ2A 4U8PA 2E4GA 3DGZA 1CC2A 2BACA 3AEEA 3G5SA 1KNPA 2GVCA 4IVOB 4O5UA 2DKIA 4B1BA 4WH7A 1CC4A 3ABVA 1GRGA 2H88A 4B68A 1CWTA 4TM1A 4U8LA 3AXBA 3GRSA 3GK5A 3AE1A 4K22A 2VVLA 3CN8A 1JU2A 3AE6A 5EOWA 1DOCA 3G5QA 4I59A 2BYBA 1URHA 1GSNA 1NHSA 2WPEA 3UOZA 5U25A 2V3BA 2VRLA 3KPKA 2JTRA 1EL8A 2C67A 1IUTA 2GMHA 1EL7A 1S2QA 4II2A 3I6DA 3IHMA 1P2HA 2OA1A 2ARDA 2YVFA 4P9SA 3DK4A 5EB5A 4BURA 2YLXA 4H4YA 1O95A 2BC1A 1IUWA 3IWAA 2IVDA 2OUCA 3IHGA 3C96A 5BULA 2WDQA 1GRHA 4GCMA 3EPTA 3AD8B 3D1CA 2GF3A 3P4SA 1BOHA 1H7XA 4JNAA 1H7WA 4IVMB 3ITJA 3IC9A 5HBOA 3D8XA 2ZZCA 3DJEA 4UDQA 5JCIA 1YT8A 2R4EA 4JY2A 3UKHA 1YM9A 5KOXA 4GUVA 5FS8A 2GWFA 4H4UA 3SXIA 4DSGA 2VRMA 3NN6X 3ZYXA 1ZX9A 4A7AA 2X8HA 4CCQA 3TG3A 3CNPA 4CNJA 4BK1A 1OJAA 5EBKA 2GR0A 2MOIA 2Q0KA 2QAEA 3AEBA 4TM4A 2YLWA 2JTQA 2OAMA 3O3WA 1VDCA 2WLRA 3K7TA 3OC4A 3SFEA 2TMDA 2EG4A 1GERA 2IIDA 4LU6A 4FDCB 4EIQA 2X8CA 4KPRA 1L9CA 2A2KA 2WDVA 2GAHB 3ADAB 3NK2X 2GRTA 1DJQA 2PHHA 2WHDA 2YR4A 2C70A 4A6NA 2BRYA 1VG0A 3UP4A 4U8KA 4EM3A 4TLXA 4H4RA 3KLJA 1RYIA 3KU9A 5HBPA 2YVGA 5KMRA 3V76A 3OLHA 2ZZBA 3ATQA 4FK1C 3LXDA 4AP3A 3VRBA 1H86A 3SM8A 2IFDA 3BNMA 3UTEA 4EQWA 1CF3A 5KVHA 1ONFA 2YM2A 3K7MX 3JSKA 4II3A 1B5QA 1K4QA 3FMWA 3GRTA 3IF9A 1K0JA 3SZFA 1YMDA 2YLZA 1CWRA 3L1RA 4J57A 4YSHA
chains in the Genus database with same CATH topology
4JGTA 2XVHA 4UDRA 1BKWA 3AE7A 2MRMA 1OJCA 4BV6A 2GQFA 5CQFA 2O9ZA 2R9ZA 1GTEA 3UKFA 3T14A 3UOXA 4BJZA 1JRXA 4Z2UA 4USQA 1RSGA 3AYIA 1ZOYA 5IQ4A 2JBVA 4C77A 3UCLA 1D4CA 3PO7A 4EMWA 2XFPA 3UP5A 1ORBA 5U1OA 2Q0LA 2R46A 1BOIA 2EQ8A 4TM3A 5L46A 2V60A 1H4MX 3DJDA 5KVIA 1GRFA 3EF6A 2RGJA 2QCUA 3HZLA 3I2VA 4IA6A 1LQTA 3AE3A 2WEUA 1NG3A 3I3LA 1BWCA 2APGA 1KSSA 4IV9A 1YQ4A 1FL2A 1L9DA 1V59A 2BCPA 3DJGX 2YG3A 3NYFA 5FS9A 3AEFA 4B63A 4YSXA 2R4JA 3GWFA 4H7UA 4XWZA 3VRDB 3KA7A 2C7GA 4G9KA 4PAAA 4WCTA 4EQSA 2R0GA 1JEHA 1GPEA 3R2UA 1NPXA 1FCDA 3AE8A 2WP6A 5KXJA 4UDPA 1GRTA 1PHHA 4OPGA 5KWFA 1D4DA 2XLPA 4HB9A 1IJHA 3LADA 1PXCA 4K7ZA 2EG3A 3II4A 3UOYA 4I58A 5KRQA 3NTAA 4CNKA 1H84A 2B76A 3AEGA 1IUSA 1IUXA 2Y6QA 3Q9TA 1Q9IA 3TG1B 4H50A 2EG4B 3ICSA 1CJ4A 2OLNA 2YVJA 4NTEA 3AAXA 1YKJA 4IA5A 2VOUA 2VQBA 1K0LA 3GYIA 1QB0A 2Z5XA 5KMPA 4A6NB 2R0PA 1NDAA 4H4WA 4Z25A 2VVMA 1N4VA 3CPJG 3C4NA 1PS9A 4CBQA 1P2EA 3UTNX 2JB1A 4PABA 4EQXA 2BXRA 3DH9A 3UTGA 4YSYA 2V3AA 3WE0A 4GF7A 2A89A 3QFAA 4H4QA 3NKSA 3GYJA 4D03A 5CKUA 3HIXA 2I0ZA 1S3BA 3G5RA 4H2NA 3VRAA 1PJ5A 3FS5A 1GT8A 2OLOA 1E39A 5HXIA 3UTFA 5KMSA 3I3UA 4XWRA 2YLSA 2YR6A 3NIXA 5FS6A 3NTDA 2BS3A 2V61A 2XLUA 4U2LA 5LAMA 3NK1X 4U8MA 1GALA 3NN0X 1D4EA 3P9UA 1GRAA 2WDRA 4EIPA 4U2TA 1H4KX 3RHAA 2BS2A 4H4TA 4AT0A 1XHCA 4GDPA 3HZUA 4H4ZA 1S3EA 3H4KA 1QJDA 3GYXA 1E1KA 1TDEA 3NH3X 2DKHA 4GAVA 1S2YA 3NGCX 1OJDA 2EQ7A 1L0VA 3BI5A 1D5TA 3FIMB 1E6EA 3T31A 4A99A 4BJYA 3QSSA 1DP2A 1Y56A 2GB0A 3OZ2A 4ADWA 1NAAA 3SGLA 3UKLA 1E0CA 2WOVA 1JOAA 2WP5A 1ZK7A 2RGOA 2UZQA 3EANA 1D7YA 4Z43A 2WESA 2C72A 1YY5A 2WOWA 2WOIA 5DBJA 1RHDA 4REKA 3REDA 2YWLA 4EM4A 5HYMA 1L9EA 1F8RA 4YTPA 1GOSA 1B37A 3MZZA 2JB2A 2YG7A 4EQRA 1MXTA 1DXLA 1XANA 3CPHG 3P4RA 4OPLA 3SX6A 1K0IA 2HQMA 2C3DA 2JTSA 1UARA 3UOVA 1H82A 4RG3A 1RHSA 4A65A 1GRBA 4M52A 4O5QA 5GSNA 2YG4A 5LV9A 3ILMA 1SEZA 1ZOVA 2XLRA 3GD4A 1PN0A 1PBCA 1OJTA 5KNLA 3AAYA 2R0CA 1GREA 1YS0A 3QJ4A 4JY3A 2Y6RA 3FLHA 3QFBA 1CWSA 2BXSA 1H6VA 3GMCA 3LJPA 2XVIA 2XYOA 3IWHA 2H89A 1XPQA 5GRTA 3F4AA 1CC6A 2GR3A 4NEWA 1QXNA 4Z26A 4J36A 2RGHA 3CTYA 3DA1A 3HYXA 4U8IA 3LOVA 3M12A 3ISHA 3Q6JA 3AE9A 2CULA 2WU5A 3AYJA 4NWZA 4OPDA 4NZHA 4NTDA 3DGHA 3UKQA 1BGNA 2IVEA 2C73A 2XFOA 3AE5A 3C4AA 3M13A 1M6IA 3P4QA 3PVCA 1LV0A 2B9WA 1KFYA 2FJBA 3ATRA 3DJJA 3KD9A 4GR1A 4YKGA 4G73A 4JN9A 5IQ1A 2XDOA 3AWIA 3AD7B 3CIRA 2AQJA 5JCMA 4GRTA 2AR8A 5JCNA 4N9XA 1XDIA 1F8WA 1NHPA 3BHKA 3NYCA 5JCKA 5IPYA 4YSZA 1E1NA 2B7SA 1GNDA 1DOEA 1E7PA 4H4PA 3IPPA 3IPOA 1LQUA 2ACZA 2CFYA 2JK6A 4K5SA 2JB3A 4B67A 3NT6A 5BVAA 3UKKA 3RP7A 1X31B 2B9XA 2B9YA 4Y4MA 4WX1A 1Y56B 3BI2A 3NG7X 4ECHA 2XFNA 2YG5A 3PS9A 3QSMA 4OPTA 2BCGG 1KNRA 1CBOA 4C3YA 2YQUA 4C74A 1D7LA 3CNDA 4F67A 1DOBA 4YXDA 5HPAA 4ZCDA 3F8PA 1ZP0A 1LJ1A 1KF6A 3CNSA 3CGDA 2HHGA 1Z6LA 2K0ZA 4YTMA 4CRTA 2XFUA 4G6GA 3V3OA 2ORAA 3GMBA 5FMHA 1GTHA 1PBDA 1C25A 1FEAA 4BK3A 5M10A 1TYPA 2ZZ0A 3LZWA 1N1PA 1O5WA 4FK1A 4H4VA 5ER0A 1MOKA 4Y4NA 1M64A 3SFDA 1B4VA 2XFQA 1ZMCA 4NEVA 2X99A 3K9RA 4TLZA 3FBSA 2NVKX 1PDHA 4Z24A 1YMKA 2BK4A 4OPIA 4RSLA 1LVLA 3K30A 3CNTA 4AP1A 4Z44A 1Q1WA 4D04A 5HBQA 1GESA 2YG6A 4OVIA 3ICRA 4C3XA 5KMQA 1W4XA 3CMMA 1TDNA 4A5LA 3B3RA 3ZDNA 3TP9A 1COYA 3NK0X 3NHVA 1EBDA 1TDOA 3LZXA 2WBAA 3T2KA 3FOJA 4C5OA 3SZWA 1BZLA 3P1WA 3GSIA 1EL9A 1FECA 2XVEA 1JRYA 2GH5A 4J33A 2YR5A 3SZ0A 2V5ZA 2J6PA 1H83A 4YWOA 4X9NA 3F8DA 1CJ2A 3COXA 1EL5A 2BS4A 2YAUA 1DJNA 1WV9A 4B69A 1OJ9A 1PJ7A 3S5WA 3CGBA 3F8RA 1ZY8A 2Q6UA 2R45A 3AB1A 3NLCA 4OPCA 1JNZA 1QLBA 2RABA 1CL0A 2C65A 2FSXA 1VG9A 2J3NA 1NG4A 4YKFA 4AT2A 3AE4A 2A87A 2C66A 4KX6A 4AOSA 4J31A 2GMJA 1NEKA 3ALMA 2WPFA 4J34A 1H81A 1KSUA 4TM0A 3FPZA 1ZDLA 2WPCA 1OKGA 2X8GA 2GR2A 3VQRA 2KL3A 1NENA 1E1LA 1GETA 3CGEA 1JRZA 3UKAA 1BGJA 2EQ9A 2GAGB 4J2WA 4USRA 2C76A 3SY4A 5U63A 1WHBA 1Q1RA 3DK9A 4X9MA 3CNJA 2YM1A 4A9WA 3NYEA 4OCGA 4B66A 2FJAA 3AECA 4B64A 1CJ3A 2BK5A 1TYTA 1N4WA 1NHQA 2BABA 3AYLA 4G74A 4U8JA 5TR3A 3RP6A 3URHA 4YTNA 2FBWA 2Q7VA 1QO8A 4J56A 4X4JA 5BUKA 3OP3A 2F5ZA 3ICTA 1JNRA 4CY8A 5HBLA 3T2YA 3EAOA 4EMIA 3BI4A 4Z2RA 4H4XA 3D1PA 3NRNA 3KVEA 3QSEA 3VR9A 1IUVA 2GQWA 2GV8A 3KPFA 2C4CA 2JKCA 4JNQA 1HZMA 1PBBA 1YQZA 2PYXA 3HYWA 1ELIA 2VQ7A 3BNUA 3CGCA 3P4PA 2FJEA 1GV4A 2IFVA 1PXBA 3S61A 1HYUA 4NNJA 5HHFA 1TQ1A 4H4SA 2BC0A 3K7QX 3AE2A 1YQ3A 3L8KA 3LB8A 3NHOX 4ZN0A 1PBFA 4OPUA 3T0KA 1IUUA 4WH9A 1PJ6A 2WS3A 3UKPA 1NHRA 1CJCA 5EB4A 2UZZA 4A79A 2X3NA 5M0ZA 3RP8A 2C75A 1O94A 2MOLA 3VR8A 2NPXA 4CCRA 3T37A 2GEWA 1REOA 1PXAA 2E1MA 1RP0A 2VSWA 2V6OA 3P3AA 5J60A 2X50A 3AEAA 3R9UA 1GEUA 2WETA 5FS7A 3H8LA 1BF3A 1CHUA 1GXFA 1N4UA 4K5RA 1MO9A 4ZCCA 4K2XA 3B6DA 1GMXA 2EQ6A 4U2SA 2FJDA 4DSHA 3ALJA 1FOHA 4LIIA 1KDGA 2A8XA 5JCLA 2AAQA 4U8NA 5C3JA 2WQYA 4H2PA 2DCQA 4APNA 2WP9A 1ZKQA 2W0HA 1AOGA 2XCGA 3HWIA 5J7XA 1Y0PA 2JAEA 1ZMDA 3UTHA 2YLRA 1VEEA 2GR1A 3V3NA 3QVPA 4YT0A 2B7RA 3M0OA 4HA6A 1E1MA 3GD3A 3GDNA 2OALA 4Y4LA 1VRQB 4MJWA 1TDFA 3AD9B 3E1TA 4JDRA 3H8IA 2TPRA 3FG2P 4JQ9A 3CPIG 2YLTA 3AEDA 4UP3A 3GDPA 5C2TA 1UKVG 4ICYA 1YMLA 3NNEA 4K8DA 4XXGA 2BRAA 3ALLA 3QVRA 1T3KA 2E5VA 4LA1A 1F6MA 3T2ZA 1GN0A 1F3PA 2WU2A 2Z5YA 4NTCA 4U8OA 4GAPA 4RG4A 1PBEA 1B8SA 3FNJA 2ZBWA 2CDUA 1DNCA 1VQWA 2BA9A 4G6HA 4GDEA 1LTXR 2QA1A 3SZCA 5LAOA 3G5JA 1DODA 1TRBA 3HYVA 3BHFA 1TDKA 2C3CA 2QA2A 4DGKA 2CVJA 1FEBA 3SYIA 4H2RA 2BK3A 4DNAA 3DK8A 3O0HA 5HY5A 3GWDA 4B65A 4BK2A 4EMJA 2C64A 2VVLG 4H2QA 4Z2TA 4CY6A 2XVJA 4E0VA 2XLTA 4FX9A 3KKJA 5BRTA 3RNMA 2WLXA 1LPFA 1F8SA 2XLSA 3SQPA 5KOWA 2XVFA 4AOXA 3DMEA 2VZ2A 4U8PA 2E4GA 3DGZA 1CC2A 2BACA 3AEEA 3G5SA 1KNPA 2GVCA 4IVOB 4O5UA 2DKIA 4B1BA 4WH7A 1CC4A 3ABVA 1GRGA 2H88A 4B68A 1CWTA 4TM1A 4U8LA 3AXBA 3GRSA 3GK5A 3AE1A 4K22A 2VVLA 3CN8A 1JU2A 3AE6A 5EOWA 1DOCA 3G5QA 4I59A 2BYBA 1URHA 1GSNA 1NHSA 2WPEA 3UOZA 5U25A 2V3BA 2VRLA 3KPKA 2JTRA 1EL8A 2C67A 1IUTA 2GMHA 1EL7A 1S2QA 4II2A 3I6DA 3IHMA 1P2HA 2OA1A 2ARDA 2YVFA 4P9SA 3DK4A 5EB5A 4BURA 2YLXA 4H4YA 1O95A 2BC1A 1IUWA 3IWAA 2IVDA 2OUCA 3IHGA 3C96A 5BULA 2WDQA 1GRHA 4GCMA 3EPTA 3AD8B 3D1CA 2GF3A 3P4SA 1BOHA 1H7XA 4JNAA 1H7WA 4IVMB 3ITJA 3IC9A 5HBOA 3D8XA 2ZZCA 3DJEA 4UDQA 5JCIA 1YT8A 2R4EA 4JY2A 3UKHA 1YM9A 5KOXA 4GUVA 5FS8A 2GWFA 4H4UA 3SXIA 4DSGA 2VRMA 3NN6X 3ZYXA 1ZX9A 4A7AA 2X8HA 4CCQA 3TG3A 3CNPA 4CNJA 4BK1A 1OJAA 5EBKA 2GR0A 2MOIA 2Q0KA 2QAEA 3AEBA 4TM4A 2YLWA 2JTQA 2OAMA 3O3WA 1VDCA 2WLRA 3K7TA 3OC4A 3SFEA 2TMDA 2EG4A 1GERA 2IIDA 4LU6A 4FDCB 4EIQA 2X8CA 4KPRA 1L9CA 2A2KA 2WDVA 2GAHB 3ADAB 3NK2X 2GRTA 1DJQA 2PHHA 2WHDA 2YR4A 2C70A 4A6NA 2BRYA 1VG0A 3UP4A 4U8KA 4EM3A 4TLXA 4H4RA 3KLJA 1RYIA 3KU9A 5HBPA 2YVGA 5KMRA 3V76A 3OLHA 2ZZBA 3ATQA 4FK1C 3LXDA 4AP3A 3VRBA 1H86A 3SM8A 2IFDA 3BNMA 3UTEA 4EQWA 1CF3A 5KVHA 1ONFA 2YM2A 3K7MX 3JSKA 4II3A 1B5QA 1K4QA 3FMWA 3GRTA 3IF9A 1K0JA 3SZFA 1YMDA 2YLZA 1CWRA 3L1RA 4J57A 4YSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGT A;  2XVH A;  4UDR A;  1BKW A;  3AE7 A;  2MRM A;  1OJC A;  4BV6 A;  2GQF A;  5CQF A;  2O9Z A;  2R9Z A;  1GTE A;  3UKF A;  3UOX A;  4BJZ A;  1JRX A;  4Z2U A;  4USQ A;  1RSG A;  3AYI A;  1ZOY A;  5IQ4 A;  2JBV A;  4C77 A;  3UCL A;  1D4C A;  3PO7 A;  4EMW A;  2XFP A;  3UP5 A;  1ORB A;  5U1O A;  2Q0L A;  2R46 A;  1BOI A;  2EQ8 A;  4TM3 A;  5L46 A;  2V60 A;  1H4M X;  3DJD A;  5KVI A;  1GRF A;  3EF6 A;  2RGJ A;  2QCU A;  3HZL A;  3I2V A;  4IA6 A;  1LQT A;  3AE3 A;  2WEU A;  1NG3 A;  3I3L A;  1BWC A;  2APG A;  1KSS A;  4IV9 A;  1YQ4 A;  1FL2 A;  1L9D A;  1V59 A;  2BCP A;  3DJG X;  2YG3 A;  3NYF A;  5FS9 A;  3AEF A;  4B63 A;  4YSX A;  2R4J A;  3GWF A;  4H7U A;  4XWZ A;  3VRD B;  3KA7 A;  2C7G A;  4PAA A;  4WCT A;  4EQS A;  2R0G A;  1JEH A;  1GPE A;  3R2U A;  1NPX A;  1FCD A;  3AE8 A;  2WP6 A;  5KXJ A;  4UDP A;  1GRT A;  1PHH A;  4OPG A;  5KWF A;  1D4D A;  2XLP A;  4HB9 A;  1IJH A;  3LAD A;  1PXC A;  4K7Z A;  2EG3 A;  3II4 A;  3UOY A;  4I58 A;  5KRQ A;  3NTA A;  4CNK A;  1H84 A;  2B76 A;  3AEG A;  1IUS A;  1IUX A;  2Y6Q A;  3Q9T A;  1Q9I A;  3TG1 B;  4H50 A;  2EG4 B;  3ICS A;  1CJ4 A;  2OLN A;  2YVJ A;  4NTE A;  3AAX A;  1YKJ A;  4IA5 A;  2VOU A;  2VQB A;  1K0L A;  3GYI A;  1QB0 A;  2Z5X A;  4A6N B;  2R0P A;  1NDA A;  4H4W A;  4Z25 A;  2VVM A;  1N4V A;  3CPJ G;  3C4N A;  1PS9 A;  4CBQ A;  1P2E A;  3UTN X;  2JB1 A;  4PAB A;  4EQX A;  2BXR A;  3DH9 A;  3UTG A;  4YSY A;  2V3A A;  3WE0 A;  4GF7 A;  2A89 A;  3QFA A;  4H4Q A;  3NKS A;  3GYJ A;  4D03 A;  5CKU A;  3HIX A;  2I0Z A;  1S3B A;  3G5R A;  4H2N A;  3VRA A;  1PJ5 A;  3FS5 A;  1GT8 A;  2OLO A;  1E39 A;  5HXI A;  3UTF A;  3I3U A;  4XWR A;  2YLS A;  2YR6 A;  3NIX A;  5FS6 A;  3NTD A;  2BS3 A;  2V61 A;  2XLU A;  4U2L A;  5LAM A;  3NK1 X;  4U8M A;  1GAL A;  3NN0 X;  1D4E A;  3P9U A;  1GRA A;  2WDR A;  4EIP A;  4U2T A;  1H4K X;  3RHA A;  2BS2 A;  4H4T A;  4AT0 A;  1XHC A;  4GDP A;  3HZU A;  4H4Z A;  1S3E A;  3H4K A;  1QJD A;  3NH3 X;  1E1K A;  1TDE A;  2DKH A;  1S2Y A;  3NGC X;  1OJD A;  2EQ7 A;  1L0V A;  3BI5 A;  1D5T A;  3FIM B;  1E6E A;  4A99 A;  4BJY A;  3QSS A;  1DP2 A;  1Y56 A;  2GB0 A;  3OZ2 A;  4ADW A;  1NAA A;  3SGL A;  3UKL A;  1E0C A;  2WOV A;  1JOA A;  2WP5 A;  1ZK7 A;  2RGO A;  2UZQ A;  3EAN A;  1D7Y A;  4Z43 A;  2WES A;  2C72 A;  1YY5 A;  2WOW A;  2WOI A;  5DBJ A;  1RHD A;  4REK A;  3RED A;  2YWL A;  4EM4 A;  5HYM A;  1L9E A;  1F8R A;  4YTP A;  1GOS A;  1B37 A;  3MZZ A;  2JB2 A;  2YG7 A;  4EQR A;  1MXT A;  1DXL A;  1XAN A;  3CPH G;  3P4R A;  4OPL A;  1K0I A;  2HQM A;  2C3D A;  2JTS A;  1UAR A;  3UOV A;  1H82 A;  4RG3 A;  1RHS A;  4A65 A;  1GRB A;  4M52 A;  4O5Q A;  5GSN A;  2YG4 A;  5LV9 A;  3ILM A;  1SEZ A;  1ZOV A;  2XLR A;  3GD4 A;  1PN0 A;  1PBC A;  1OJT A;  3AAY A;  2R0C A;  1GRE A;  1YS0 A;  3QJ4 A;  4JY3 A;  2Y6R A;  3FLH A;  3QFB A;  1CWS A;  2BXS A;  1H6V A;  3GMC A;  3LJP A;  2XVI A;  2XYO A;  3IWH A;  2H89 A;  1XPQ A;  5GRT A;  3F4A A;  1CC6 A;  2GR3 A;  4NEW A;  1QXN A;  4Z26 A;  4J36 A;  2RGH A;  3CTY A;  3DA1 A;  4U8I A;  3LOV A;  3M12 A;  3ISH A;  3Q6J A;  3AE9 A;  2CUL A;  2WU5 A;  3AYJ A;  4OPD A;  4NZH A;  4NTD A;  3DGH A;  3UKQ A;  1BGN A;  2IVE A;  2C73 A;  2XFO A;  3AE5 A;  3C4A A;  3M13 A;  1M6I A;  3P4Q A;  3PVC A;  1LV0 A;  2B9W A;  1KFY A;  2FJB A;  3ATR A;  3DJJ A;  3KD9 A;  4GR1 A;  4YKG A;  5HY5 A;  4JN9 A;  5IQ1 A;  2XDO A;  3AWI A;  3AD7 B;  3CIR A;  2AQJ A;  5JCM A;  4GRT A;  2AR8 A;  5JCN A;  4N9X A;  1XDI A;  1F8W A;  1NHP A;  3BHK A;  3NYC A;  5JCK A;  5IPY A;  4YSZ A;  1E1N A;  2B7S A;  1GND A;  1DOE A;  1E7P A;  4H4P A;  3IPP A;  3IPO A;  1LQU A;  2ACZ A;  2CFY A;  2JK6 A;  4K5S A;  2JB3 A;  4B67 A;  3NT6 A;  5BVA A;  3UKK A;  3RP7 A;  1X31 B;  2B9X A;  2B9Y A;  4Y4M A;  4WX1 A;  1Y56 B;  3BI2 A;  3NG7 X;  4ECH A;  2XFN A;  2YG5 A;  3PS9 A;  3QSM A;  4OPT A;  2BCG G;  1KNR A;  1CBO A;  4C3Y A;  2YQU A;  4C74 A;  1D7L A;  3CND A;  4F67 A;  1DOB A;  4YXD A;  5HPA A;  4ZCD A;  3F8P A;  1ZP0 A;  1LJ1 A;  1KF6 A;  3CNS A;  3CGD A;  2HHG A;  1Z6L A;  2K0Z A;  4YTM A;  4CRT A;  2XFU A;  3V3O A;  2ORA A;  3GMB A;  5FMH A;  1GTH A;  1PBD A;  1C25 A;  1FEA A;  4BK3 A;  5M10 A;  1TYP A;  2ZZ0 A;  3LZW A;  1N1P A;  1O5W A;  4FK1 A;  4H4V A;  5ER0 A;  1MOK A;  4Y4N A;  1M64 A;  3SFD A;  1B4V A;  2XFQ A;  1ZMC A;  4NEV A;  2X99 A;  3K9R A;  4TLZ A;  3FBS A;  2NVK X;  1PDH A;  4Z24 A;  1YMK A;  2BK4 A;  4OPI A;  4RSL A;  1LVL A;  3K30 A;  3CNT A;  4AP1 A;  4Z44 A;  1Q1W A;  4D04 A;  5HBQ A;  1GES A;  2YG6 A;  4OVI A;  3ICR A;  4C3X A;  1W4X A;  1TDN A;  4A5L A;  3B3R A;  3ZDN A;  3TP9 A;  1COY A;  3NK0 X;  3NHV A;  1EBD A;  1TDO A;  3LZX A;  2WBA A;  3FOJ A;  4C5O A;  1BZL A;  3P1W A;  3GSI A;  1EL9 A;  1FEC A;  2XVE A;  1JRY A;  2GH5 A;  4J33 A;  2YR5 A;  2V5Z A;  2J6P A;  1H83 A;  4YWO A;  4X9N A;  3F8D A;  1CJ2 A;  3COX A;  1EL5 A;  2BS4 A;  2YAU A;  1DJN A;  1WV9 A;  4B69 A;  1OJ9 A;  1PJ7 A;  3S5W A;  3CGB A;  3F8R A;  1ZY8 A;  2Q6U A;  2R45 A;  3AB1 A;  3NLC A;  4OPC A;  1JNZ A;  1QLB A;  2RAB A;  1CL0 A;  2C65 A;  2FSX A;  1VG9 A;  2J3N A;  1NG4 A;  4YKF A;  4AT2 A;  3AE4 A;  2A87 A;  2C66 A;  4KX6 A;  4AOS A;  4J31 A;  2GMJ A;  1NEK A;  3ALM A;  2WPF A;  4J34 A;  1H81 A;  1KSU A;  4TM0 A;  3FPZ A;  1ZDL A;  2WPC A;  1OKG A;  2X8G A;  2GR2 A;  3VQR A;  2KL3 A;  1NEN A;  1E1L A;  1GET A;  3CGE A;  1JRZ A;  3UKA A;  1BGJ A;  2EQ9 A;  2GAG B;  4J2W A;  4USR A;  2C76 A;  5U63 A;  1WHB A;  1Q1R A;  3DK9 A;  4X9M A;  3CNJ A;  2YM1 A;  4A9W A;  3NYE A;  4OCG A;  4B66 A;  2FJA A;  3AEC A;  4B64 A;  1CJ3 A;  2BK5 A;  1TYT A;  1N4W A;  1NHQ A;  2BAB A;  3AYL A;  4U8J A;  5TR3 A;  3RP6 A;  3URH A;  4YTN A;  2FBW A;  2Q7V A;  1QO8 A;  4J56 A;  4X4J A;  5BUK A;  3OP3 A;  2F5Z A;  3ICT A;  1JNR A;  4CY8 A;  5HBL A;  3EAO A;  4EMI A;  3BI4 A;  4Z2R A;  4H4X A;  3D1P A;  3NRN A;  3KVE A;  3QSE A;  3VR9 A;  1IUV A;  2GQW A;  2GV8 A;  3KPF A;  2JKC A;  4JNQ A;  1HZM A;  1PBB A;  1YQZ A;  2PYX A;  1ELI A;  2VQ7 A;  3BNU A;  3CGC A;  3P4P A;  2FJE A;  1GV4 A;  2IFV A;  1PXB A;  3S61 A;  1HYU A;  5HHF A;  1TQ1 A;  4H4S A;  2BC0 A;  3K7Q X;  3AE2 A;  1YQ3 A;  3L8K A;  3LB8 A;  3NHO X;  4ZN0 A;  1PBF A;  4OPU A;  1IUU A;  4WH9 A;  1PJ6 A;  2WS3 A;  3UKP A;  1NHR A;  1CJC A;  5EB4 A;  2UZZ A;  4A79 A;  2X3N A;  5M0Z A;  3RP8 A;  2C75 A;  1O94 A;  2MOL A;  3VR8 A;  2NPX A;  4CCR A;  3T37 A;  2GEW A;  1REO A;  1PXA A;  2E1M A;  1RP0 A;  2VSW A;  2V6O A;  3P3A A;  5J60 A;  2X50 A;  3AEA A;  3R9U A;  1GEU A;  2WET A;  5FS7 A;  3H8L A;  1BF3 A;  1CHU A;  1GXF A;  1N4U A;  4K5R A;  1MO9 A;  4ZCC A;  4K2X A;  3B6D A;  1GMX A;  2EQ6 A;  4U2S A;  2FJD A;  4DSH A;  3ALJ A;  1FOH A;  4LII A;  1KDG A;  2A8X A;  5JCL A;  2AAQ A;  4U8N A;  5C3J A;  2WQY A;  4H2P A;  2DCQ A;  4APN A;  2WP9 A;  1ZKQ A;  2W0H A;  1AOG A;  2XCG A;  3HWI A;  5J7X A;  1Y0P A;  2JAE A;  1ZMD A;  3UTH A;  2YLR A;  1VEE A;  2GR1 A;  3V3N A;  3QVP A;  4YT0 A;  2B7R A;  3M0O A;  4HA6 A;  1E1M A;  3GD3 A;  3GDN A;  2OAL A;  4Y4L A;  1VRQ B;  4MJW A;  1TDF A;  3AD9 B;  3E1T A;  4JDR A;  3H8I A;  2TPR A;  3FG2 P;  4JQ9 A;  3CPI G;  2YLT A;  3AED A;  4UP3 A;  3GDP A;  5C2T A;  1UKV G;  4ICY A;  1YML A;  3NNE A;  4K8D A;  4XXG A;  3QVR A;  3ALL A;  1T3K A;  2E5V A;  4LA1 A;  1F6M A;  1GN0 A;  1F3P A;  2WU2 A;  2Z5Y A;  4NTC A;  4U8O A;  4RG4 A;  1PBE A;  1B8S A;  3FNJ A;  2ZBW A;  2CDU A;  1DNC A;  1VQW A;  2BA9 A;  4GDE A;  1LTX R;  2QA1 A;  5LAO A;  3G5J A;  1DOD A;  1TRB A;  3BHF A;  1TDK A;  2C3C A;  2QA2 A;  4DGK A;  2CVJ A;  1FEB A;  4H2R A;  2BK3 A;  4DNA A;  3DK8 A;  3O0H A;  3GWD A;  4B65 A;  4BK2 A;  4EMJ A;  2C64 A;  2VVL G;  4H2Q A;  4Z2T A;  4CY6 A;  2XVJ A;  4E0V A;  2XLT A;  4FX9 A;  3KKJ A;  5BRT A;  3RNM A;  2WLX A;  1LPF A;  1F8S A;  2XLS A;  3SQP A;  5KOW A;  2XVF A;  4AOX A;  3DME A;  2VZ2 A;  4U8P A;  2E4G A;  3DGZ A;  1CC2 A;  2BAC A;  3AEE A;  3G5S A;  1KNP A;  2GVC A;  4IVO B;  4O5U A;  2DKI A;  4B1B A;  4WH7 A;  1CC4 A;  3ABV A;  1GRG A;  2H88 A;  4B68 A;  1CWT A;  4TM1 A;  4U8L A;  3AXB A;  3GRS A;  3GK5 A;  3AE1 A;  4K22 A;  2VVL A;  3CN8 A;  1JU2 A;  3AE6 A;  5EOW A;  1DOC A;  3G5Q A;  4I59 A;  2BYB A;  1URH A;  1GSN A;  1NHS A;  2WPE A;  3UOZ A;  5U25 A;  2V3B A;  2VRL A;  2JTR A;  1EL8 A;  2C67 A;  1IUT A;  2GMH A;  1EL7 A;  1S2Q A;  3I6D A;  3IHM A;  1P2H A;  2OA1 A;  2ARD A;  2YVF A;  4P9S A;  3DK4 A;  5EB5 A;  4BUR A;  2YLX A;  4H4Y A;  1O95 A;  2BC1 A;  1IUW A;  3IWA A;  2IVD A;  2OUC A;  3IHG A;  3C96 A;  5BUL A;  2WDQ A;  1GRH A;  4GCM A;  3EPT A;  3AD8 B;  3D1C A;  2GF3 A;  3P4S A;  1BOH A;  1H7X A;  4JNA A;  1H7W A;  4IVM B;  3ITJ A;  3IC9 A;  5HBO A;  3D8X A;  2ZZC A;  3DJE A;  4UDQ A;  5JCI A;  1YT8 A;  2R4E A;  4JY2 A;  3UKH A;  1YM9 A;  5KOX A;  4GUV A;  5FS8 A;  2GWF A;  4H4U A;  4DSG A;  2VRM A;  3NN6 X;  3ZYX A;  1ZX9 A;  4A7A A;  2X8H A;  4CCQ A;  3TG3 A;  3CNP A;  4CNJ A;  4BK1 A;  1OJA A;  5EBK A;  2GR0 A;  2MOI A;  2Q0K A;  2QAE A;  3AEB A;  4TM4 A;  2YLW A;  2JTQ A;  2OAM A;  3O3W A;  1VDC A;  2WLR A;  3K7T A;  3OC4 A;  3SFE A;  2TMD A;  2EG4 A;  1GER A;  2IID A;  4LU6 A;  4FDC B;  4EIQ A;  2X8C A;  4KPR A;  1L9C A;  2A2K A;  2WDV A;  2GAH B;  3ADA B;  3NK2 X;  2GRT A;  1DJQ A;  2PHH A;  2WHD A;  2YR4 A;  2C70 A;  4A6N A;  3UP4 A;  1VG0 A;  4EM3 A;  4U8K A;  4TLX A;  4H4R A;  3KLJ A;  1RYI A;  3KU9 A;  5HBP A;  2YVG A;  3V76 A;  3OLH A;  2ZZB A;  3ATQ A;  4FK1 C;  3LXD A;  4AP3 A;  3VRB A;  1H86 A;  3SM8 A;  2IFD A;  3BNM A;  3UTE A;  4EQW A;  1CF3 A;  5KVH A;  1ONF A;  2YM2 A;  3K7M X;  3JSK A;  1B5Q A;  1K4Q A;  3FMW A;  3GRT A;  3IF9 A;  1K0J A;  1YMD A;  2YLZ A;  1CWR A;  3L1R A;  4J57 A;  4YSH A; 
#chains in the Genus database with same CATH topology
 4JGT A;  2XVH A;  4UDR A;  1BKW A;  3AE7 A;  2MRM A;  1OJC A;  4BV6 A;  2GQF A;  5CQF A;  2O9Z A;  2Q82 A;  1GTE A;  2R9Z A;  3T14 A;  3UKF A;  3UOX A;  4BJZ A;  1JRX A;  4Z2U A;  4USQ A;  1RSG A;  3AYI A;  1ZOY A;  5IQ4 A;  2JBV A;  4C77 A;  3UCL A;  1D4C A;  3PO7 A;  4EMW A;  2XFP A;  3UP5 A;  1ORB A;  5U1O A;  2Q0L A;  2R46 A;  1BOI A;  2EQ8 A;  4TM3 A;  5L46 A;  2V60 A;  1H4M X;  3DJD A;  5KVI A;  1GRF A;  3EF6 A;  2RGJ A;  2QCU A;  3HZL A;  3I2V A;  4IA6 A;  1LQT A;  3AE3 A;  2WEU A;  1NG3 A;  3I3L A;  1BWC A;  2APG A;  1KSS A;  4IV9 A;  1YQ4 A;  1FL2 A;  1L9D A;  1V59 A;  2BCP A;  3DJG X;  2YG3 A;  3NYF A;  5FS9 A;  3AEF A;  4B63 A;  4YSX A;  2R4J A;  3GWF A;  4H7U A;  4XWZ A;  3VRD B;  3KA7 A;  2C7G A;  4G9K A;  4PAA A;  4WCT A;  4EQS A;  2R0G A;  1JEH A;  1GPE A;  3R2U A;  1NPX A;  1FCD A;  3AE8 A;  2WP6 A;  5KXJ A;  4UDP A;  1GRT A;  1PHH A;  4OPG A;  5KWF A;  1D4D A;  2XLP A;  4HB9 A;  1IJH A;  3LAD A;  1PXC A;  4K7Z A;  2EG3 A;  3II4 A;  3UOY A;  4I58 A;  5KRQ A;  3NTA A;  4CNK A;  1H84 A;  2B76 A;  3AEG A;  1IUS A;  1IUX A;  2Y6Q A;  3Q9T A;  1Q9I A;  3TG1 B;  4H50 A;  2EG4 B;  3ICS A;  1CJ4 A;  2OLN A;  2YVJ A;  4NTE A;  3AAX A;  1YKJ A;  4IA5 A;  2VOU A;  2VQB A;  1K0L A;  3GYI A;  1QB0 A;  2Z5X A;  5KMP A;  4A6N B;  2R0P A;  1NDA A;  4H4W A;  4Z25 A;  2VVM A;  1N4V A;  3CPJ G;  3C4N A;  1PS9 A;  4CBQ A;  1P2E A;  3UTN X;  2JB1 A;  4PAB A;  4EQX A;  2BXR A;  3DH9 A;  3UTG A;  4YSY A;  2V3A A;  3WE0 A;  4GF7 A;  2A89 A;  3QFA A;  4H4Q A;  3NKS A;  3GYJ A;  4D03 A;  5CKU A;  3HIX A;  2I0Z A;  1S3B A;  3G5R A;  4H2N A;  3VRA A;  1PJ5 A;  3FS5 A;  1GT8 A;  2OLO A;  1E39 A;  5HXI A;  3UTF A;  5KMS A;  3I3U A;  4XWR A;  2YLS A;  2YR6 A;  3NIX A;  5FS6 A;  3NTD A;  2BS3 A;  2V61 A;  2XLU A;  4U2L A;  5LAM A;  3NK1 X;  4U8M A;  1GAL A;  3NN0 X;  1D4E A;  3P9U A;  1GRA A;  2WDR A;  4EIP A;  4U2T A;  1H4K X;  3RHA A;  2BS2 A;  4H4T A;  4AT0 A;  1XHC A;  4GDP A;  3HZU A;  4H4Z A;  1S3E A;  3H4K A;  1QJD A;  3GYX A;  1E1K A;  1TDE A;  3NH3 X;  2DKH A;  4GAV A;  1S2Y A;  3NGC X;  1OJD A;  2EQ7 A;  1L0V A;  3BI5 A;  1D5T A;  3FIM B;  1E6E A;  3T31 A;  4A99 A;  4BJY A;  3QSS A;  1DP2 A;  1Y56 A;  2GB0 A;  3OZ2 A;  4ADW A;  1NAA A;  3SGL A;  3UKL A;  1E0C A;  2WOV A;  1JOA A;  2WP5 A;  1ZK7 A;  2RGO A;  2UZQ A;  3EAN A;  1D7Y A;  4Z43 A;  2WES A;  2C72 A;  1YY5 A;  2WOW A;  2WOI A;  5DBJ A;  1RHD A;  4REK A;  3RED A;  2YWL A;  4EM4 A;  5HYM A;  1L9E A;  1F8R A;  4YTP A;  1GOS A;  1B37 A;  3MZZ A;  2JB2 A;  2YG7 A;  4EQR A;  1MXT A;  1DXL A;  1XAN A;  3CPH G;  3P4R A;  4OPL A;  3SX6 A;  1K0I A;  2HQM A;  2C3D A;  2JTS A;  1UAR A;  3UOV A;  1H82 A;  4RG3 A;  1RHS A;  4A65 A;  1GRB A;  4M52 A;  4O5Q A;  5GSN A;  2YG4 A;  5LV9 A;  3ILM A;  1SEZ A;  1ZOV A;  2XLR A;  3GD4 A;  1PN0 A;  1PBC A;  1OJT A;  5KNL A;  3AAY A;  2R0C A;  1GRE A;  1YS0 A;  3QJ4 A;  4JY3 A;  2Y6R A;  3FLH A;  3QFB A;  1CWS A;  2BXS A;  1H6V A;  3GMC A;  3LJP A;  2XVI A;  2XYO A;  3IWH A;  2H89 A;  1XPQ A;  5GRT A;  3F4A A;  1CC6 A;  2GR3 A;  4NEW A;  1QXN A;  4Z26 A;  4J36 A;  2RGH A;  3CTY A;  3DA1 A;  3HYX A;  4U8I A;  3LOV A;  3M12 A;  3ISH A;  3Q6J A;  3AE9 A;  2CUL A;  2WU5 A;  3AYJ A;  4NWZ A;  4OPD A;  4NZH A;  4NTD A;  3DGH A;  3UKQ A;  1BGN A;  2IVE A;  2C73 A;  2XFO A;  3AE5 A;  3C4A A;  3M13 A;  1M6I A;  3P4Q A;  3PVC A;  1LV0 A;  2B9W A;  1KFY A;  2FJB A;  3ATR A;  3DJJ A;  3KD9 A;  4GR1 A;  4YKG A;  4G73 A;  4JN9 A;  5IQ1 A;  2XDO A;  3AWI A;  3AD7 B;  3CIR A;  2AQJ A;  5JCM A;  4GRT A;  2AR8 A;  5JCN A;  4N9X A;  1XDI A;  1F8W A;  1NHP A;  3BHK A;  3NYC A;  5JCK A;  5IPY A;  4YSZ A;  1E1N A;  2B7S A;  1GND A;  1DOE A;  1E7P A;  4H4P A;  3IPP A;  3IPO A;  1LQU A;  2ACZ A;  2CFY A;  2JK6 A;  4K5S A;  2JB3 A;  4B67 A;  3NT6 A;  5BVA A;  3UKK A;  3RP7 A;  1X31 B;  2B9X A;  2B9Y A;  4Y4M A;  4WX1 A;  1Y56 B;  3BI2 A;  3NG7 X;  4ECH A;  2XFN A;  2YG5 A;  3PS9 A;  3QSM A;  4OPT A;  2BCG G;  1KNR A;  1CBO A;  4C3Y A;  2YQU A;  4C74 A;  1D7L A;  3CND A;  4F67 A;  1DOB A;  4YXD A;  5HPA A;  4ZCD A;  3F8P A;  1ZP0 A;  1LJ1 A;  1KF6 A;  3CNS A;  3CGD A;  2HHG A;  1Z6L A;  2K0Z A;  4YTM A;  4CRT A;  2XFU A;  4G6G A;  3V3O A;  2ORA A;  3GMB A;  5FMH A;  1GTH A;  1PBD A;  1C25 A;  1FEA A;  4BK3 A;  5M10 A;  1TYP A;  2ZZ0 A;  3LZW A;  1N1P A;  1O5W A;  4FK1 A;  4H4V A;  5ER0 A;  1MOK A;  4Y4N A;  1M64 A;  3SFD A;  1B4V A;  2XFQ A;  1ZMC A;  4NEV A;  2X99 A;  3K9R A;  4TLZ A;  3FBS A;  2NVK X;  1PDH A;  4Z24 A;  1YMK A;  2BK4 A;  4OPI A;  4RSL A;  1LVL A;  3K30 A;  3CNT A;  4AP1 A;  4Z44 A;  1Q1W A;  4D04 A;  5HBQ A;  1GES A;  2YG6 A;  4OVI A;  3ICR A;  4C3X A;  5KMQ A;  1W4X A;  3CMM A;  1TDN A;  4A5L A;  3B3R A;  3ZDN A;  3TP9 A;  1COY A;  3NK0 X;  3NHV A;  1EBD A;  1TDO A;  3LZX A;  2WBA A;  3T2K A;  3FOJ A;  4C5O A;  3SZW A;  1BZL A;  3P1W A;  3GSI A;  1EL9 A;  1FEC A;  2XVE A;  1JRY A;  2GH5 A;  4J33 A;  2YR5 A;  3SZ0 A;  2V5Z A;  2J6P A;  1H83 A;  4YWO A;  4X9N A;  3F8D A;  1CJ2 A;  3COX A;  1EL5 A;  2BS4 A;  2YAU A;  1DJN A;  1WV9 A;  4B69 A;  1OJ9 A;  1PJ7 A;  3S5W A;  3CGB A;  3F8R A;  1ZY8 A;  2Q6U A;  2R45 A;  3AB1 A;  3NLC A;  4OPC A;  1JNZ A;  1QLB A;  2RAB A;  1CL0 A;  2C65 A;  2FSX A;  1VG9 A;  2J3N A;  1NG4 A;  4YKF A;  4AT2 A;  3AE4 A;  2A87 A;  2C66 A;  4KX6 A;  4AOS A;  4J31 A;  2GMJ A;  1NEK A;  3ALM A;  2WPF A;  4J34 A;  1H81 A;  1KSU A;  4TM0 A;  3FPZ A;  1ZDL A;  2WPC A;  1OKG A;  2X8G A;  2GR2 A;  3VQR A;  2KL3 A;  1NEN A;  1E1L A;  1GET A;  3CGE A;  1JRZ A;  3UKA A;  1BGJ A;  2EQ9 A;  2GAG B;  4J2W A;  4USR A;  2C76 A;  3SY4 A;  5U63 A;  1WHB A;  1Q1R A;  3DK9 A;  4X9M A;  3CNJ A;  2YM1 A;  4A9W A;  3NYE A;  4OCG A;  4B66 A;  2FJA A;  3AEC A;  4B64 A;  1CJ3 A;  2BK5 A;  1TYT A;  1N4W A;  1NHQ A;  2BAB A;  3AYL A;  4G74 A;  4U8J A;  5TR3 A;  3RP6 A;  3URH A;  4YTN A;  2FBW A;  2Q7V A;  1QO8 A;  4J56 A;  4X4J A;  5BUK A;  3OP3 A;  2F5Z A;  3ICT A;  1JNR A;  4CY8 A;  5HBL A;  3T2Y A;  3EAO A;  4EMI A;  3BI4 A;  4Z2R A;  4H4X A;  3D1P A;  3NRN A;  3KVE A;  3QSE A;  3VR9 A;  1IUV A;  2GQW A;  2GV8 A;  3KPF A;  2C4C A;  2JKC A;  4JNQ A;  1HZM A;  1PBB A;  1YQZ A;  2PYX A;  3HYW A;  1ELI A;  2VQ7 A;  3BNU A;  3CGC A;  3P4P A;  2FJE A;  1GV4 A;  2IFV A;  1PXB A;  3S61 A;  1HYU A;  4NNJ A;  5HHF A;  1TQ1 A;  4H4S A;  2BC0 A;  3K7Q X;  3AE2 A;  1YQ3 A;  3L8K A;  3LB8 A;  3NHO X;  4ZN0 A;  1PBF A;  4OPU A;  3T0K A;  1IUU A;  4WH9 A;  1PJ6 A;  2WS3 A;  3UKP A;  1NHR A;  1CJC A;  5EB4 A;  2UZZ A;  4A79 A;  2X3N A;  5M0Z A;  3RP8 A;  2C75 A;  1O94 A;  2MOL A;  3VR8 A;  2NPX A;  4CCR A;  3T37 A;  2GEW A;  1REO A;  1PXA A;  2E1M A;  1RP0 A;  2VSW A;  2V6O A;  3P3A A;  5J60 A;  2X50 A;  3AEA A;  3R9U A;  1GEU A;  2WET A;  5FS7 A;  3H8L A;  1BF3 A;  1CHU A;  1GXF A;  1N4U A;  4K5R A;  1MO9 A;  4ZCC A;  4K2X A;  3B6D A;  1GMX A;  2EQ6 A;  4U2S A;  2FJD A;  4DSH A;  3ALJ A;  1FOH A;  4LII A;  1KDG A;  2A8X A;  5JCL A;  2AAQ A;  4U8N A;  5C3J A;  2WQY A;  4H2P A;  2DCQ A;  4APN A;  2WP9 A;  1ZKQ A;  2W0H A;  1AOG A;  2XCG A;  3HWI A;  5J7X A;  1Y0P A;  2JAE A;  1ZMD A;  3UTH A;  2YLR A;  1VEE A;  2GR1 A;  3V3N A;  3QVP A;  4YT0 A;  2B7R A;  3M0O A;  4HA6 A;  1E1M A;  3GD3 A;  3GDN A;  2OAL A;  4Y4L A;  1VRQ B;  4MJW A;  1TDF A;  3AD9 B;  3E1T A;  4JDR A;  3H8I A;  2TPR A;  3FG2 P;  4JQ9 A;  3CPI G;  2YLT A;  3AED A;  4UP3 A;  3GDP A;  5C2T A;  1UKV G;  4ICY A;  1YML A;  3NNE A;  4K8D A;  4XXG A;  2BRA A;  3ALL A;  3QVR A;  1T3K A;  2E5V A;  4LA1 A;  1F6M A;  3T2Z A;  1GN0 A;  1F3P A;  2WU2 A;  2Z5Y A;  4NTC A;  4U8O A;  4GAP A;  4RG4 A;  1PBE A;  1B8S A;  3FNJ A;  2ZBW A;  2CDU A;  1DNC A;  1VQW A;  2BA9 A;  4G6H A;  4GDE A;  1LTX R;  2QA1 A;  3SZC A;  5LAO A;  3G5J A;  1DOD A;  1TRB A;  3HYV A;  3BHF A;  1TDK A;  2C3C A;  2QA2 A;  4DGK A;  2CVJ A;  1FEB A;  3SYI A;  4H2R A;  2BK3 A;  4DNA A;  3DK8 A;  3O0H A;  5HY5 A;  3GWD A;  4B65 A;  4BK2 A;  4EMJ A;  2C64 A;  2VVL G;  4H2Q A;  4Z2T A;  4CY6 A;  2XVJ A;  4E0V A;  2XLT A;  4FX9 A;  3KKJ A;  5BRT A;  3RNM A;  2WLX A;  1LPF A;  1F8S A;  2XLS A;  3SQP A;  5KOW A;  2XVF A;  4AOX A;  3DME A;  2VZ2 A;  4U8P A;  2E4G A;  3DGZ A;  1CC2 A;  2BAC A;  3AEE A;  3G5S A;  1KNP A;  2GVC A;  4IVO B;  4O5U A;  2DKI A;  4B1B A;  4WH7 A;  1CC4 A;  3ABV A;  1GRG A;  2H88 A;  4B68 A;  1CWT A;  4TM1 A;  4U8L A;  3AXB A;  3GRS A;  3GK5 A;  3AE1 A;  4K22 A;  2VVL A;  3CN8 A;  1JU2 A;  3AE6 A;  5EOW A;  1DOC A;  3G5Q A;  4I59 A;  2BYB A;  1URH A;  1GSN A;  1NHS A;  2WPE A;  3UOZ A;  5U25 A;  2V3B A;  2VRL A;  3KPK A;  2JTR A;  1EL8 A;  2C67 A;  1IUT A;  2GMH A;  1EL7 A;  1S2Q A;  4II2 A;  3I6D A;  3IHM A;  1P2H A;  2OA1 A;  2ARD A;  2YVF A;  4P9S A;  3DK4 A;  5EB5 A;  4BUR A;  2YLX A;  4H4Y A;  1O95 A;  2BC1 A;  1IUW A;  3IWA A;  2IVD A;  2OUC A;  3IHG A;  3C96 A;  5BUL A;  2WDQ A;  1GRH A;  4GCM A;  3EPT A;  3AD8 B;  3D1C A;  2GF3 A;  3P4S A;  1BOH A;  1H7X A;  4JNA A;  1H7W A;  4IVM B;  3ITJ A;  3IC9 A;  5HBO A;  3D8X A;  2ZZC A;  3DJE A;  4UDQ A;  5JCI A;  1YT8 A;  2R4E A;  4JY2 A;  3UKH A;  1YM9 A;  5KOX A;  4GUV A;  5FS8 A;  2GWF A;  4H4U A;  3SXI A;  4DSG A;  2VRM A;  3NN6 X;  3ZYX A;  1ZX9 A;  4A7A A;  2X8H A;  4CCQ A;  3TG3 A;  3CNP A;  4CNJ A;  4BK1 A;  1OJA A;  5EBK A;  2GR0 A;  2MOI A;  2Q0K A;  2QAE A;  3AEB A;  4TM4 A;  2YLW A;  2JTQ A;  2OAM A;  3O3W A;  1VDC A;  2WLR A;  3K7T A;  3OC4 A;  3SFE A;  2TMD A;  2EG4 A;  1GER A;  2IID A;  4LU6 A;  4FDC B;  4EIQ A;  2X8C A;  4KPR A;  1L9C A;  2A2K A;  2WDV A;  2GAH B;  3ADA B;  3NK2 X;  2GRT A;  1DJQ A;  2PHH A;  2WHD A;  2YR4 A;  2C70 A;  4A6N A;  2BRY A;  1VG0 A;  3UP4 A;  4U8K A;  4EM3 A;  4TLX A;  4H4R A;  3KLJ A;  1RYI A;  3KU9 A;  5HBP A;  2YVG A;  5KMR A;  3V76 A;  3OLH A;  2ZZB A;  3ATQ A;  4FK1 C;  3LXD A;  4AP3 A;  3VRB A;  1H86 A;  3SM8 A;  2IFD A;  3BNM A;  3UTE A;  4EQW A;  1CF3 A;  5KVH A;  1ONF A;  2YM2 A;  3K7M X;  3JSK A;  4II3 A;  1B5Q A;  1K4Q A;  3FMW A;  3GRT A;  3IF9 A;  1K0J A;  3SZF A;  1YMD A;  2YLZ A;  1CWR A;  3L1R A;  4J57 A;  4YSH A; 
#chains in the Genus database with same CATH homology
 4JGT A;  2XVH A;  4UDR A;  1BKW A;  3AE7 A;  2MRM A;  1OJC A;  4BV6 A;  2GQF A;  5CQF A;  2O9Z A;  2R9Z A;  1GTE A;  3UKF A;  3T14 A;  3UOX A;  4BJZ A;  1JRX A;  4Z2U A;  4USQ A;  1RSG A;  3AYI A;  1ZOY A;  5IQ4 A;  2JBV A;  4C77 A;  3UCL A;  1D4C A;  3PO7 A;  4EMW A;  2XFP A;  3UP5 A;  1ORB A;  5U1O A;  2Q0L A;  2R46 A;  1BOI A;  2EQ8 A;  4TM3 A;  5L46 A;  2V60 A;  1H4M X;  3DJD A;  5KVI A;  1GRF A;  3EF6 A;  2RGJ A;  2QCU A;  3HZL A;  3I2V A;  4IA6 A;  1LQT A;  3AE3 A;  2WEU A;  1NG3 A;  3I3L A;  1BWC A;  2APG A;  1KSS A;  4IV9 A;  1YQ4 A;  1FL2 A;  1L9D A;  1V59 A;  2BCP A;  3DJG X;  2YG3 A;  3NYF A;  5FS9 A;  3AEF A;  4B63 A;  4YSX A;  2R4J A;  3GWF A;  4H7U A;  4XWZ A;  3VRD B;  3KA7 A;  2C7G A;  4G9K A;  4PAA A;  4WCT A;  4EQS A;  2R0G A;  1JEH A;  1GPE A;  3R2U A;  1NPX A;  1FCD A;  3AE8 A;  2WP6 A;  5KXJ A;  4UDP A;  1GRT A;  1PHH A;  4OPG A;  5KWF A;  1D4D A;  2XLP A;  4HB9 A;  1IJH A;  3LAD A;  1PXC A;  4K7Z A;  2EG3 A;  3II4 A;  3UOY A;  4I58 A;  5KRQ A;  3NTA A;  4CNK A;  1H84 A;  2B76 A;  3AEG A;  1IUS A;  1IUX A;  2Y6Q A;  3Q9T A;  1Q9I A;  3TG1 B;  4H50 A;  2EG4 B;  3ICS A;  1CJ4 A;  2OLN A;  2YVJ A;  4NTE A;  3AAX A;  1YKJ A;  4IA5 A;  2VOU A;  2VQB A;  1K0L A;  3GYI A;  1QB0 A;  2Z5X A;  5KMP A;  4A6N B;  2R0P A;  1NDA A;  4H4W A;  4Z25 A;  2VVM A;  1N4V A;  3CPJ G;  3C4N A;  1PS9 A;  4CBQ A;  1P2E A;  3UTN X;  2JB1 A;  4PAB A;  4EQX A;  2BXR A;  3DH9 A;  3UTG A;  4YSY A;  2V3A A;  3WE0 A;  4GF7 A;  2A89 A;  3QFA A;  4H4Q A;  3NKS A;  3GYJ A;  4D03 A;  5CKU A;  3HIX A;  2I0Z A;  1S3B A;  3G5R A;  4H2N A;  3VRA A;  1PJ5 A;  3FS5 A;  1GT8 A;  2OLO A;  1E39 A;  5HXI A;  3UTF A;  5KMS A;  3I3U A;  4XWR A;  2YLS A;  2YR6 A;  3NIX A;  5FS6 A;  3NTD A;  2BS3 A;  2V61 A;  2XLU A;  4U2L A;  5LAM A;  3NK1 X;  4U8M A;  1GAL A;  3NN0 X;  1D4E A;  3P9U A;  1GRA A;  2WDR A;  4EIP A;  4U2T A;  1H4K X;  3RHA A;  2BS2 A;  4H4T A;  4AT0 A;  1XHC A;  4GDP A;  3HZU A;  4H4Z A;  1S3E A;  3H4K A;  1QJD A;  3GYX A;  1E1K A;  1TDE A;  3NH3 X;  2DKH A;  4GAV A;  1S2Y A;  3NGC X;  1OJD A;  2EQ7 A;  1L0V A;  3BI5 A;  1D5T A;  3FIM B;  1E6E A;  3T31 A;  4A99 A;  4BJY A;  3QSS A;  1DP2 A;  1Y56 A;  2GB0 A;  3OZ2 A;  4ADW A;  1NAA A;  3SGL A;  3UKL A;  1E0C A;  2WOV A;  1JOA A;  2WP5 A;  1ZK7 A;  2RGO A;  2UZQ A;  3EAN A;  1D7Y A;  4Z43 A;  2WES A;  2C72 A;  1YY5 A;  2WOW A;  2WOI A;  5DBJ A;  1RHD A;  4REK A;  3RED A;  2YWL A;  4EM4 A;  5HYM A;  1L9E A;  1F8R A;  4YTP A;  1GOS A;  1B37 A;  3MZZ A;  2JB2 A;  2YG7 A;  4EQR A;  1MXT A;  1DXL A;  1XAN A;  3CPH G;  3P4R A;  4OPL A;  3SX6 A;  1K0I A;  2HQM A;  2C3D A;  2JTS A;  1UAR A;  3UOV A;  1H82 A;  4RG3 A;  1RHS A;  4A65 A;  1GRB A;  4M52 A;  4O5Q A;  5GSN A;  2YG4 A;  5LV9 A;  3ILM A;  1SEZ A;  1ZOV A;  2XLR A;  3GD4 A;  1PN0 A;  1PBC A;  1OJT A;  5KNL A;  3AAY A;  2R0C A;  1GRE A;  1YS0 A;  3QJ4 A;  4JY3 A;  2Y6R A;  3FLH A;  3QFB A;  1CWS A;  2BXS A;  1H6V A;  3GMC A;  3LJP A;  2XVI A;  2XYO A;  3IWH A;  2H89 A;  1XPQ A;  5GRT A;  3F4A A;  1CC6 A;  2GR3 A;  4NEW A;  1QXN A;  4Z26 A;  4J36 A;  2RGH A;  3CTY A;  3DA1 A;  3HYX A;  4U8I A;  3LOV A;  3M12 A;  3ISH A;  3Q6J A;  3AE9 A;  2CUL A;  2WU5 A;  3AYJ A;  4NWZ A;  4OPD A;  4NZH A;  4NTD A;  3DGH A;  3UKQ A;  1BGN A;  2IVE A;  2C73 A;  2XFO A;  3AE5 A;  3C4A A;  3M13 A;  1M6I A;  3P4Q A;  3PVC A;  1LV0 A;  2B9W A;  1KFY A;  2FJB A;  3ATR A;  3DJJ A;  3KD9 A;  4GR1 A;  4YKG A;  4G73 A;  4JN9 A;  5IQ1 A;  2XDO A;  3AWI A;  3AD7 B;  3CIR A;  2AQJ A;  5JCM A;  4GRT A;  2AR8 A;  5JCN A;  4N9X A;  1XDI A;  1F8W A;  1NHP A;  3BHK A;  3NYC A;  5JCK A;  5IPY A;  4YSZ A;  1E1N A;  2B7S A;  1GND A;  1DOE A;  1E7P A;  4H4P A;  3IPP A;  3IPO A;  1LQU A;  2ACZ A;  2CFY A;  2JK6 A;  4K5S A;  2JB3 A;  4B67 A;  3NT6 A;  5BVA A;  3UKK A;  3RP7 A;  1X31 B;  2B9X A;  2B9Y A;  4Y4M A;  4WX1 A;  1Y56 B;  3BI2 A;  3NG7 X;  4ECH A;  2XFN A;  2YG5 A;  3PS9 A;  3QSM A;  4OPT A;  2BCG G;  1KNR A;  1CBO A;  4C3Y A;  2YQU A;  4C74 A;  1D7L A;  3CND A;  4F67 A;  1DOB A;  4YXD A;  5HPA A;  4ZCD A;  3F8P A;  1ZP0 A;  1LJ1 A;  1KF6 A;  3CNS A;  3CGD A;  2HHG A;  1Z6L A;  2K0Z A;  4YTM A;  4CRT A;  2XFU A;  4G6G A;  3V3O A;  2ORA A;  3GMB A;  5FMH A;  1GTH A;  1PBD A;  1C25 A;  1FEA A;  4BK3 A;  5M10 A;  1TYP A;  2ZZ0 A;  3LZW A;  1N1P A;  1O5W A;  4FK1 A;  4H4V A;  5ER0 A;  1MOK A;  4Y4N A;  1M64 A;  3SFD A;  1B4V A;  2XFQ A;  1ZMC A;  4NEV A;  2X99 A;  3K9R A;  4TLZ A;  3FBS A;  2NVK X;  1PDH A;  4Z24 A;  1YMK A;  2BK4 A;  4OPI A;  4RSL A;  1LVL A;  3K30 A;  3CNT A;  4AP1 A;  4Z44 A;  1Q1W A;  4D04 A;  5HBQ A;  1GES A;  2YG6 A;  4OVI A;  3ICR A;  4C3X A;  5KMQ A;  1W4X A;  3CMM A;  1TDN A;  4A5L A;  3B3R A;  3ZDN A;  3TP9 A;  1COY A;  3NK0 X;  3NHV A;  1EBD A;  1TDO A;  3LZX A;  2WBA A;  3T2K A;  3FOJ A;  4C5O A;  3SZW A;  1BZL A;  3P1W A;  3GSI A;  1EL9 A;  1FEC A;  2XVE A;  1JRY A;  2GH5 A;  4J33 A;  2YR5 A;  3SZ0 A;  2V5Z A;  2J6P A;  1H83 A;  4YWO A;  4X9N A;  3F8D A;  1CJ2 A;  3COX A;  1EL5 A;  2BS4 A;  2YAU A;  1DJN A;  1WV9 A;  4B69 A;  1OJ9 A;  1PJ7 A;  3S5W A;  3CGB A;  3F8R A;  1ZY8 A;  2Q6U A;  2R45 A;  3AB1 A;  3NLC A;  4OPC A;  1JNZ A;  1QLB A;  2RAB A;  1CL0 A;  2C65 A;  2FSX A;  1VG9 A;  2J3N A;  1NG4 A;  4YKF A;  4AT2 A;  3AE4 A;  2A87 A;  2C66 A;  4KX6 A;  4AOS A;  4J31 A;  2GMJ A;  1NEK A;  3ALM A;  2WPF A;  4J34 A;  1H81 A;  1KSU A;  4TM0 A;  3FPZ A;  1ZDL A;  2WPC A;  1OKG A;  2X8G A;  2GR2 A;  3VQR A;  2KL3 A;  1NEN A;  1E1L A;  1GET A;  3CGE A;  1JRZ A;  3UKA A;  1BGJ A;  2EQ9 A;  2GAG B;  4J2W A;  4USR A;  2C76 A;  3SY4 A;  5U63 A;  1WHB A;  1Q1R A;  3DK9 A;  4X9M A;  3CNJ A;  2YM1 A;  4A9W A;  3NYE A;  4OCG A;  4B66 A;  2FJA A;  3AEC A;  4B64 A;  1CJ3 A;  2BK5 A;  1TYT A;  1N4W A;  1NHQ A;  2BAB A;  3AYL A;  4G74 A;  4U8J A;  5TR3 A;  3RP6 A;  3URH A;  4YTN A;  2FBW A;  2Q7V A;  1QO8 A;  4J56 A;  4X4J A;  5BUK A;  3OP3 A;  2F5Z A;  3ICT A;  1JNR A;  4CY8 A;  5HBL A;  3T2Y A;  3EAO A;  4EMI A;  3BI4 A;  4Z2R A;  4H4X A;  3D1P A;  3NRN A;  3KVE A;  3QSE A;  3VR9 A;  1IUV A;  2GQW A;  2GV8 A;  3KPF A;  2C4C A;  2JKC A;  4JNQ A;  1HZM A;  1PBB A;  1YQZ A;  2PYX A;  3HYW A;  1ELI A;  2VQ7 A;  3BNU A;  3CGC A;  3P4P A;  2FJE A;  1GV4 A;  2IFV A;  1PXB A;  3S61 A;  1HYU A;  4NNJ A;  5HHF A;  1TQ1 A;  4H4S A;  2BC0 A;  3K7Q X;  3AE2 A;  1YQ3 A;  3L8K A;  3LB8 A;  3NHO X;  4ZN0 A;  1PBF A;  4OPU A;  3T0K A;  1IUU A;  4WH9 A;  1PJ6 A;  2WS3 A;  3UKP A;  1NHR A;  1CJC A;  5EB4 A;  2UZZ A;  4A79 A;  2X3N A;  5M0Z A;  3RP8 A;  2C75 A;  1O94 A;  2MOL A;  3VR8 A;  2NPX A;  4CCR A;  3T37 A;  2GEW A;  1REO A;  1PXA A;  2E1M A;  1RP0 A;  2VSW A;  2V6O A;  3P3A A;  5J60 A;  2X50 A;  3AEA A;  3R9U A;  1GEU A;  2WET A;  5FS7 A;  3H8L A;  1BF3 A;  1CHU A;  1GXF A;  1N4U A;  4K5R A;  1MO9 A;  4ZCC A;  4K2X A;  3B6D A;  1GMX A;  2EQ6 A;  4U2S A;  2FJD A;  4DSH A;  3ALJ A;  1FOH A;  4LII A;  1KDG A;  2A8X A;  5JCL A;  2AAQ A;  4U8N A;  5C3J A;  2WQY A;  4H2P A;  2DCQ A;  4APN A;  2WP9 A;  1ZKQ A;  2W0H A;  1AOG A;  2XCG A;  3HWI A;  5J7X A;  1Y0P A;  2JAE A;  1ZMD A;  3UTH A;  2YLR A;  1VEE A;  2GR1 A;  3V3N A;  3QVP A;  4YT0 A;  2B7R A;  3M0O A;  4HA6 A;  1E1M A;  3GD3 A;  3GDN A;  2OAL A;  4Y4L A;  1VRQ B;  4MJW A;  1TDF A;  3AD9 B;  3E1T A;  4JDR A;  3H8I A;  2TPR A;  3FG2 P;  4JQ9 A;  3CPI G;  2YLT A;  3AED A;  4UP3 A;  3GDP A;  5C2T A;  1UKV G;  4ICY A;  1YML A;  3NNE A;  4K8D A;  4XXG A;  2BRA A;  3ALL A;  3QVR A;  1T3K A;  2E5V A;  4LA1 A;  1F6M A;  3T2Z A;  1GN0 A;  1F3P A;  2WU2 A;  2Z5Y A;  4NTC A;  4U8O A;  4GAP A;  4RG4 A;  1PBE A;  1B8S A;  3FNJ A;  2ZBW A;  2CDU A;  1DNC A;  1VQW A;  2BA9 A;  4G6H A;  4GDE A;  1LTX R;  2QA1 A;  3SZC A;  5LAO A;  3G5J A;  1DOD A;  1TRB A;  3HYV A;  3BHF A;  1TDK A;  2C3C A;  2QA2 A;  4DGK A;  2CVJ A;  1FEB A;  3SYI A;  4H2R A;  2BK3 A;  4DNA A;  3DK8 A;  3O0H A;  5HY5 A;  3GWD A;  4B65 A;  4BK2 A;  4EMJ A;  2C64 A;  2VVL G;  4H2Q A;  4Z2T A;  4CY6 A;  2XVJ A;  4E0V A;  2XLT A;  4FX9 A;  3KKJ A;  5BRT A;  3RNM A;  2WLX A;  1LPF A;  1F8S A;  2XLS A;  3SQP A;  5KOW A;  2XVF A;  4AOX A;  3DME A;  2VZ2 A;  4U8P A;  2E4G A;  3DGZ A;  1CC2 A;  2BAC A;  3AEE A;  3G5S A;  1KNP A;  2GVC A;  4IVO B;  4O5U A;  2DKI A;  4B1B A;  4WH7 A;  1CC4 A;  3ABV A;  1GRG A;  2H88 A;  4B68 A;  1CWT A;  4TM1 A;  4U8L A;  3AXB A;  3GRS A;  3GK5 A;  3AE1 A;  4K22 A;  2VVL A;  3CN8 A;  1JU2 A;  3AE6 A;  5EOW A;  1DOC A;  3G5Q A;  4I59 A;  2BYB A;  1URH A;  1GSN A;  1NHS A;  2WPE A;  3UOZ A;  5U25 A;  2V3B A;  2VRL A;  3KPK A;  2JTR A;  1EL8 A;  2C67 A;  1IUT A;  2GMH A;  1EL7 A;  1S2Q A;  4II2 A;  3I6D A;  3IHM A;  1P2H A;  2OA1 A;  2ARD A;  2YVF A;  4P9S A;  3DK4 A;  5EB5 A;  4BUR A;  2YLX A;  4H4Y A;  1O95 A;  2BC1 A;  1IUW A;  3IWA A;  2IVD A;  2OUC A;  3IHG A;  3C96 A;  5BUL A;  2WDQ A;  1GRH A;  4GCM A;  3EPT A;  3AD8 B;  3D1C A;  2GF3 A;  3P4S A;  1BOH A;  1H7X A;  4JNA A;  1H7W A;  4IVM B;  3ITJ A;  3IC9 A;  5HBO A;  3D8X A;  2ZZC A;  3DJE A;  4UDQ A;  5JCI A;  1YT8 A;  2R4E A;  4JY2 A;  3UKH A;  1YM9 A;  5KOX A;  4GUV A;  5FS8 A;  2GWF A;  4H4U A;  3SXI A;  4DSG A;  2VRM A;  3NN6 X;  3ZYX A;  1ZX9 A;  4A7A A;  2X8H A;  4CCQ A;  3TG3 A;  3CNP A;  4CNJ A;  4BK1 A;  1OJA A;  5EBK A;  2GR0 A;  2MOI A;  2Q0K A;  2QAE A;  3AEB A;  4TM4 A;  2YLW A;  2JTQ A;  2OAM A;  3O3W A;  1VDC A;  2WLR A;  3K7T A;  3OC4 A;  3SFE A;  2TMD A;  2EG4 A;  1GER A;  2IID A;  4LU6 A;  4FDC B;  4EIQ A;  2X8C A;  4KPR A;  1L9C A;  2A2K A;  2WDV A;  2GAH B;  3ADA B;  3NK2 X;  2GRT A;  1DJQ A;  2PHH A;  2WHD A;  2YR4 A;  2C70 A;  4A6N A;  2BRY A;  1VG0 A;  3UP4 A;  4U8K A;  4EM3 A;  4TLX A;  4H4R A;  3KLJ A;  1RYI A;  3KU9 A;  5HBP A;  2YVG A;  5KMR A;  3V76 A;  3OLH A;  2ZZB A;  3ATQ A;  4FK1 C;  3LXD A;  4AP3 A;  3VRB A;  1H86 A;  3SM8 A;  2IFD A;  3BNM A;  3UTE A;  4EQW A;  1CF3 A;  5KVH A;  1ONF A;  2YM2 A;  3K7M X;  3JSK A;  4II3 A;  1B5Q A;  1K4Q A;  3FMW A;  3GRT A;  3IF9 A;  1K0J A;  3SZF A;  1YMD A;  2YLZ A;  1CWR A;  3L1R A;  4J57 A;  4YSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...