3NTHA

Crystal structure of tudor and aubergine [r13(me2s)] complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Maternal protein tudor
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nthA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nthA01
1SSFA 3PMTA 2BIVA 2LTOA 3LGLA 3GOXA 4ZTFA 4QQ6A 4N4GA 5J39A 4BD3A 2EQMA 4QW2A 3OS0A 4E7JA 2WACA 4A4EA 2NLUA 4BE1A 4BDZA 3MP8A 3OB9A 3OYLA 3OYBA 3L2UA 3LH0A 4A4GA 2LVMA 2RI5A 2RHUA 5IN1A 3FLGA 5KH6A 3OYKA 1WGSA 3E9FA 3OYIA 1G5VA 4Z02A 1OI1A 4X34A 3NTHA 3QIIA 3OYNA 3S3OA 2RHZA 4HCZA 4QVZA 2GFUA 3LLRA 2BUDA 3BDLA 2RJCA 2VYTA 4IUQA 3OS2A 3M9QA 2DAQA 2HQEA 2K3YA 3OYDA 3OYJA 4IUTA 3MEAA 3LYIA 2E5QA 2RI3A 3FDRA 4C5HA 3S3NA 4C5IA 4B9XA 4N4IA 3FEOA 3DLMA 5D6XA 2EQUA 4A4FA 2RHYA 2X4YA 3OYAA 5KE3A 1MHNA 4N4HA 3NTKA 2B8AA 3MP1A 2RJDA 4IUPA 4OVAA 4E7KA 1WJQA 2R5AA 4ZTJA 5KCOA 2X4WA 3OMGA 3L2WA 5KE2A 3MEVA 2L89A 4QQGA 3CEYA 2RJEA 3SD4A 2E6NA 3META 3PFSA 3S3MA 4E7LA 4C5GA 4E7HA 5C6SA 2CKKA 4FL6A 2JTFA 2M16A 2O4XB 3E9GA 3QKJA 5J26A 3EAEA 4BDYA 2XK0A 2R57A 4A4HA 2GFAA 1RI0A 4GY5A 2X4XA 2K3XA 3H6ZA 2YRVA 5CIUA 1XNIA 3OYFA 3MP6A 5D6YA 4B9WA 3OMCA 5FRMA 3MO8A 1OZ2A 2MWPA 4NS5A 3S6WA 3OS1A 3LGFA 3MEUA 4PL6A 5D6WA 4E7IA 2EKOA 2RHXA 4QQDA 3P8HA 5KCHA 2LRQA 2BKDN 3LX7A 4IURA 2M1HA 5IAYA 2JZ2A 2P0KA 2LDMA 2RI2A 4FU6A 4C5EA 2RHIA 3L2RA 3OQ5A 3DB4A 3ASKA 4UC4A 3PMIA 3H8ZA 3KUFA 3OYGA 1N27A 4BE2A 1WJRA 2M0OA 2QQSA 2RO0A 3PNWC 2EQJA 3L42A 3O8VA 3NTIA 2DIQA 4EDUA 2X35A 2RJFA 5M9OA 3L2VA 2EQKA 2D9TA 4II1A 3UWNA 2HQXA 2R5MA 3Q1JA 2QQRA 4BACA 2GF7A 4IKFA 4LD6A 3QBYA 1OYXA 5FROA 4CRIA 3OYMA 4IUUA 3OYCA 4Q5WA 3MEWA 2F5KA 3QJ6A 4RG2A 3C4SA 3ME9A 2FHDA 3UT1A 5C0MA 3OY9A 3OA6A 3FC3A 5FRNA 3P8DA 2IG0A 3F70A 2MWOA 2XDPA 2PQWA 3DB3A 2LCCA 4BE0A 2L3RA 2R58A 4PLLA 3OYEA 1H3ZA 4IUVA 3OYHA 4L59A 3ZEHA 4PLIA 2DIGA 2L8DA 2O4XA 2EFIA 1KHCA 1WJSA 1OZ3A 2G3RA 3L2QA
chains in the Genus database with same CATH superfamily
2NWMA 4HCBA 1Z47A 2AKWB 4OGCA 1G91A 4LUZA 4ME5A 3FVQA 1WQWA 4CKBA 1TWGB 4XU0A 2RBMA 1PH3A 1HR0Q 3HOWH 1B4OA 4KT0E 5LJ3f 1VMCA 1QVFP 4UP9A 4OELB 4C3IH 4BXXH 1D2BA 1TY0A 1T3LA 4PJLA 3JCMc 3EIVA 4M8AA 2DTHA 3M3YB 1JJ2P 1PMRA 1NE8A 4BBSB 1RCVD 5GMKh 4DV7Q 2OWOA 3PE0A 2FFKB 4JYAQ 3GV6A 3CRKC 1IYVA 3N52A 3MFGA 4RCNA 4N0AC 1Y71A 4IFDH 2BUDA 4EPCA 5GAOq 2OTLT 2FRWA 2IPOB 1WCMG 4DA2A 4B3TQ 1NZ9A 2DPPB 2NUZA 4J9HA 1YJ9A 3I70A 2HKNA 3OYDA 2ZXPA 4B3ML 3MEAA 2QQAA 4A3GB 2GTOA 3J81i 1K4US 2F4VL 2F0FA 4CBVA 2OAUA 5LJ5g 2L15A 3H0GB 3TS2A 5JJZA 2A68C 4A4FA 2HCKA 4C8QG 1VQ4T 4C0DC 4YHHL 4IIOA 1C0AA 1U4MA 2OTJQ 1T5EA 2N55A 5IYDH 4DBHA 3CCSQ 2CS7A 1PRTB 1QCFA 1FGBD 2SOBA 4K2KA 5CQXA 5KCOA 1B3AA 1I4PA 2YU9B 1M90R 2HIXA 1GUNA 4PJOG 1I5FA 1R4QB 4DK3C 5IODA 4F7UA 4C2MB 4QMGA 1STEA 1KQ1A 4GBQA 1V8QA 4HJ5A 1HNZL 4D6WA 2DXBA 1X3PA 2QDBA 4MZ9A 4B08A 1GCPA 2XDBA 1EYCA 1LABA 2DL8A 1SNQA 2GVAA 5C44B 1GUGA 4A93G 2IY5B 4UHVA 2CP2A 1VQ5Q 4A63B 1P92A 1KG1A 3UA6A 1FVIA 4RKLA 1WFWA 1TIID 2CHBD 2EYQA 2JA8G 4KY5A 2HNIA 4F17A 1MBYA 2EJGC 1NJIR 1KD1R 4B3RQ 5IYBG 1DD2A 2OAWA 4MDXA 4J9EA 3MWYW 1KFZA 4OGQC 5FOBB 1TG0A 5KCHA 5CR2A 1JWMD 1H92A 4HN7A 2LDMA 1UHFA 4M7AF 1RADB 1D5ZC 3NFCA 1PLFA 1SYFA 4K8JA 3PMIA 3KUFA 4LF8L 3C2PA 3DEOA 2KHJA 2C9OA 4JYAL 4LE9A 2Q2IA 3PO3H 4J6YA 4OP0A 3PIPA 2HAXA 1HZBA 1VQEA 4QY7A 5C5MA 4C3IG 1CM9A 2DIQA 3M58A 1TY2A 1TXQA 5COYA 1J5EL 4GLMA 1QCNA 1FWZA 4FXGC 4MDWA 1Q3LA 4HT8A 4PJOE 2NVTH 2DZCA 4B3MQ 1V76A 2FL7A 4PNYA 1MHWC 1JB7A 2R92H 1M90U 1B8AA 4J9IA 1STGA 3KK7A 1XPRA 2LP5A 4O42A 1H9MA 3TQ7P 1JU5C 1KABA 1OQKA 4DU9A 3MEWA 2F5KA 3PUVA 5IH2A 3P75A 4ODGA 5C3EG 1VQNQ 1P8LA 3DB3A 4ORZA 2AQ2B 3K57A 3GTMB 2BCOA 3HRUA 3CCMT 4AYBG 2K5VA 2JTMA 4NL2A 2K50A 1UE6A 1VQ6A 1SBBB 1KHCA 4RA8A 4OWWB 1WX6A 4M78B 4OMPA 1Z9FA 1TWAH 2FMCA 3LGLA 3A8JE 4QF4A 2YDLA 1Y1VG 1IL2A 5HURA 1PWTA 5J39A 2KROA 4BD3A 2EYLA 1QP2A 4S3SA 5EPKA 3Q23A 2SNMA 2KGTA 3GTKB 2CUBA 3REAB 1G8ZD 5L37A 1C7YA 4LF5Q 1XMQL 3G71Q 1CKOA 4HJAA 1BQQT 5GANg 1K83B 1OXTA 2K33A 1ZHIA 5LL6X 3I2ZA 4R9WA 2XRSD 2R93B 2KDSA 3CBMA 2MCNA 3CCVQ 2KUMA 1K0XA 3H9NA 3T51B 3D3RA 2MIOA 3M9QA 1NNXA 2F1LA 3RR6A 3K7AB 2FRYA 2DAQA 3I5RA 4L6V5 3U58A 4DV1Q 4PJOC 1QUQA 5HKCA 2ENMA 1AW7A 4V2SA 4C5IA 2BE9B 3SB2A 4DV2Q 1Y57A 1HH2P 1W6KA 3K0XA 1PKSA 1J5EQ 3OYAA 5M5YB 5HK0A 4FYXB 3NTKA 1ICFB 4F87A 5JVG3 3IQLA 5CKHA 1VQLT 1LT4D 4AFQC 2A3LA 3GLXA 3RDVA 1QNUA 2LXJA 3QR8A 3SXHA 1WPYA 1FNWA 3EG9B 3A74A 1XJWB 2CZ0B 2X4WA 3V7CA 3VYHB 1IGQA 2HL3A 1CSPA 1QJOA 2E3IA 1WCMB 4N9TA 4LF7L 1N32Q 1RHPA 1UFFA 1C1AA 2A5HA 1UGVA 5IYBH 4FL6A 1IBKQ 5LJ5d 3N6RA 5EBDA 4H02A 4BDYA 1N33L 2K5LA 4A4HA 2C06A 2QILA 4ME7A 1RAHB 2L9HA 2CP0A 1IBLL 5IE8A 2O9VA 2DXUA 1CKBA 3QWNA 4OMNA 4A3DH 3EFSA 1I6HB 1GXDC 1QZGA 1LM0A 4LUVA 4C0ZA 4JUVA 2LFNA 1RL2A 4RTTA 1X01A 1M3CA 2KK4A 4J5YA 4H13C 1ZLMA 5CC4A 3I4NH 4WJ3M 4XTXA 3BDOA 4ZK9B 5DM63 3GTGH 3CC2A 4ANJA 4C0FA 1FD7D 2RQWA 3CCVA 2QQSA 2RO0A 2FG0A 4MMLA 5I2MA 3K7UC 3QIAA 3X3MA 3FRNA 1SYDA 5M5XH 4V190 2Q2UA 1YBYA 4OMFB 2KECA 2O01E 4C92D 1GUTA 2A6HD 1IBML 5C3EH 4C3JB 5LJ5j 5KYXB 1G2TA 1VIFA 4YY3L 4CC7A 2AIRB 4E7SA 3LWEA 3HOVH 2AT1B 2JSOA 2XWJB 4XYOA 4A3KB 3CC4T 1M1GA 4CC3A 3BVZA 3MHXA 1AWXA 1WI7A 4A3KG 4DV2L 4BBSH 1D1KA 5KEEA 4X64Q 1S40A 2RA2A 2YUQA 3HP9A 4FT4A 1KDBA 1AP0A 2O9SA 2JXMB 2MWOA 2XDPA 4A3IG 1I0CA 3R3OA 4QJFA 4ZKCB 1JMCA 3S1NB 4BE0A 3MEFA 4PLLA 1SMXA 3H94A 3OYHA 3NE5B 2BE5C 4HJ7A 2RCFA 4K2LA 2O4XA 3EG2A 4Z8AA 1X6GA 1EY6A 5D3DA 3U9OA 2A74C 1MNEA 2D1XA 3EG3A 5C44G 2JA6G 1OO9B 1C9OA 2GBQA 3NELA 3L2ZA 2MPXC 3QZ9B 5LJ3e 1EEID 4ILWA 1YHAA 1UGPB 3H41A 3PO2G 2GTJA 4A3CH 3QOLA 1X43A 1JT8A 2P5ZX 1ET9A 3H6MA 2NYSA 2E64A 3OYLA 3CCEQ 2E5LL 2A69D 2X51A 2HBPA 1WLPB 4M78E 2RI5A 2Q8TA 4JI4L 4B3RL 3A8OB 3STBD 2UU9Q 1SJHD 1TXYA 1D3BB 1MGQA 2ZPEB 1AZEA 4LAAA 1LTAD 2KY9A 2JN4A 3RMQA 3OS2A 1DM0B 1Q82R 3GDEA 4HXJA 2ICEC 3CCJT 3TZDA 2E2IH 2JA5H 3HP3A 3M57A 1QLYA 1SDFA 2J6FA 4ME3A 4R4OA 2NUPA 1FJGQ 5E4XA 1LNXA 2CYZB 4M77D 1B9NA 1HA6A 3Q0AA 4M75C 1D1CA 3OS5A 3G7LA 3QYHB 2YRCA 2K9GA 3K59A 3C3LA 2ESWA 3OMGA 4L5GA 2K4KA 3VR2A 3W2DA 2ZPHB 4C1NK 2E6NA 1JJCB 3W5OA 2JK8A 2ZXOA 4DV5L 4PJOF 4A3MG 5GAN3 3CCST 4A3BG 2GCXA 2A0FB 1NPRA 1HHVA 1YIJT 3OTOQ 1PRTD 1HR0L 5IGBA 1HZCA 3OOCA 3W1BA 4NXMQ 1VQNA 3HRTA 4ZGDB 5KYWA 3OYFA 1QNKA 3MP6A 2XWBB 3L9AX 2A8VA 2RM4A 2EYFA 2LT4A 5GAN4 4WRDA 4IOAA 2MWPA 3SE0A 3MFYA 3LGFA 2ZJPA 3BS1A 1UEBA 4Y92A 1D8LA 3DMUA 1STNA 4OEMB 3S1MB 4L5SA 1NEBA 1ILQA 4HR7B 3JB9H 1DGSA 4DR6L 3I4MG 1FMKA 2DYBA 4DPGA 1ZUUA 3OQ5A 4DFAA 4UC4A 2DRMA 1SRUA 3JB9I 1EQRA 3BVGA 3R2IA 1QZHA 4A3EH 4X3KA 5JEAJ 2ZTCA 2DJFC 2ATCB 4UDUC 3HOXB 5ECAA 3A8KE 4A3DB 2UXCL 2CP7A 2D62A 4BBSG 4J1MA 4KUIA 2K57A 2D9TA 3ZJYC 5FJ8H 4RKBA 5NUCA 3MVVA 5L8RE 3GD7A 4IPGA 2ZAEA 1M5Q1 2PUOB 2GF7A 1XWEA 1VQIA 2QEXA 4HIKA 5FROA 4R4CA 1MJEA 2EJMA 4X64L 2B3GA 2A36A 4RH6A 3RZOH 4JJNK 2OT2A 2A7YA 2F0NA 2L3PA 3DXJC 2KXCA 4DN4M 3EG1A 3FDTA 1XNQQ 1O7IA 2VS1A 4CJ2C 3UT1A 3AQQA 4OXPA 3CMEQ 2FHDA 5KYIA 1WTPA 1GRIA 3CCEA 2N3SA 4C3JG 2VXWA 2O88A 1EQQA 1Z7TA 1ZEQX 1JBMA 4TRDA 3UE0A 3OYEA 1AN8A 4LDXA 1LTBD 1ASYA 4L59A 3CQTA 4PLIA 1VQMA 4K6LA 2EDGA 2X9HA 4KK7A 4DV4L 2G3RA 3M0RA 2XDDA 1Q8KA 1C4QA 2M00A 4BY1G 3T1YL 1Q82C 1CZWA 1SG5A 2E70A 4DAYA 3JAML 4A3IB 3UATA 1YNND 4PJOA 1N33Q 4PMCA 3CCMQ 1B53A 4LDYA 4A3MH 1Y7XA 4QB4A 1U9RA 1ENAA 5A2QE 3KOJA 3HOYH 2HT1A 1YIJQ 1RODA 2MYSA 3CMET 1LTTD 3VYSA 2I5HA 4IJHA 5C0XG 2D0OA 1VUBA 2D0PA 1UHCA 1JWSD 2L3QA 2GVBA 2JS2A 2NWGA 1W2BP 1KRSA 1KIXA 1YJNT 2B2WA 4RHRA 3X26B 3AFQA 3QIIA 4JRQA 2QK0A 1JOKA 4JJDA 1LT6D 2EW3A 4B3SL 1DJ7B 2Y4YA 1A0NB 4A3LG 2HIVA 2OTLQ 4C3HH 4R55A 1TT2A 2D0QB 3A8HB 5KYNA 1BIAA 2E5QA 4KTAA 1QUQB 4G7HC 2QA4Q 3FEOA 5C0XJ 5IOCA 1RLPC 2YTYA 5JOBA 5IGGA 2X4YA 1QVGS 1XTCD 4Y7NH 3MP1A 3CCUT 2KT1A 1FYCA 2RJDA 4E7KA 1MSGA 1NE3A 4KHVA 2K6AA 3HRSA 3TEHB 4DV5Q 2B63B 2DD5A 1CQFA 1HQMC 2BDNA 3CP0A 3F2CA 1AZQA 2N88A 5KE2A 1E0BA 1VDZA 3GTLH 3D0FA 2LKVA 3OTOL 4E7LA 1K8MA 3RN5A 2G6FX 1IYUA 4DQ2A 1U3OA 5AJ3L 5EGTA 3KXTA 3GNFB 5GJVB 3OSOA 4R4QA 2K01A 1TQOA 4C3JH 3RKXA 2Y0SB 2YRVA 1QKXA 4RGTA 1K8GA 4KRTA 4HCCA 1K8OA 4B9WA 3MO8A 3P1HA 4FCYA 5C0XI 1KD1U 3S6WA 4C8QC 3CC4Q 3NP8A 4HKEA 5FO8B 3GP7A 2L0AA 3SWNB 1CTMA 4A54A 4L63B 2MJ8A 3RN2A 4CGYB 3P8HA 2CT3A 2F2WA 3OSVA 3DHQA 4BY1H 1Y1VB 2RQVA 2WKCA 4ZUIA 2P0KA 2RI2A 3RNJA 3L2RA 3I91A 1SYBA 3O13A 4K8IA 2OI3A 2X3XD 3ASKA 2OJ2A 4M77A 1KQ2A 1PDQA 1TUDA 1N27A 1Y07A 1Y8NB 1AVZC 4BY7B 4P2CB 1CK1A 1RAIB 2J06A 5JEAH 4PKCC 3SWNA 4OHJA 1Q81C 1SE4A 3FIFA 3A8GB 1K9AA 4GN5A 4OB3B 4Y52H 3DUZA 4L6TB 4X3SA 5C4ZA 4BUGA 2Q2TA 3A8LB 3M54A 4BBRB 2A08A 3H15A 4B3SQ 3D4WA 2EYWA 4BACA 4GKKQ 2K4YA 1YCSB 2AHOB 3E5SA 4CRIA 4JG2A 1YHQA 4O2DA 3QO3A 2JNGA 5E1FA 2PTKA 3F2BA 1DOMA 2NZHA 3P7JA 2W10A 1GL5A 4OWXB 3U23A 4WFN3 4BI3A 1N32L 3ME9A 2ZJRA 2DD4A 4DUYQ 1I50B 2HKQB 3QDFA 1I94Q 2VVKA 1GUWA 3AB9A 1FGUA 1Y1WB 2VXFA 4K5XA 4EQNA 2FZKB 2NVQH 4K0KQ 2V8IA 1KD1C 3TDQA 2VGNA 3GP8A 2DRKA 3HOVG 1BCMA 4FT2A 2AMCB 2E2IB 1PTOD 4P72A 4QKUA 5IP9H 3JCMW 3GQBA 3CD6A 1X75C 4ZN1A 2QTVA 2JMAA 1PZJD 2D2CC 4XQQA 1SFOH 3E1SA 1NY4A 1DOKA 1PH6A 3D8GA 3GPLA 3HOZG 4QQ6A 3H09A 3OW2P 1KAAA 2QEJC 4PQXA 3QG1A 2WIIB 2GGRA 1FNUA 2NTSA 2MO1A 4FF3A 3TN2A 4XU1A 4R0KA 3MCAB 1Q81U 2NLUA 2B8FA 4JJCA 1ARKA 2E2JH 1NYFA 1YCYA 1EQVA 5CYUA 1SAPA 1I4GA 3E3XA 1HNXL 2RHUA 2L2PA 4LXCA 2Z4IA 4E6RA 1TU0B 2Z6BA 3OYKA 1JJ2S 3M7GA 5GANj 4C0DB 1G5VA 1OI1A 3HOUH 3TSWA 4LF5L 1VMPA 4A75A 1XMQQ 1YWPA 1D6EC 2RHZA 2VGMA 1JEGA 5GMKe 1PH8A 2ZJQA 2RJCA 1YITQ 3URYA 1BI2A 2B2TC 2K05A 1U1TA 1PTOH 4HVUA 3VA5A 2I2LA 2D8HA 2DNEA 3OIPA 4YY3Q 1CA6A 5C4XG 4DAVA 1S1NA 4C92E 2DBMA 4EMKC 5KYYA 4N4IA 4FP5D 4A3JH 2K2MA 1K0RA 1YWOA 1DZ1A 1S5DD 2PCFB 2F03A 2RH2A 4L5RC 3CCJQ 4N4HA 1IO6A 1HRJA 3M55A 1M30A 3N5BB 2ED1A 3FP9A 4IUPA 4YWKA 5C5LA 4CDEC 1UTIA 4XIGS 1TH7A 4DXGA 2GNCA 4IQZA 2CUDA 3JCMP 4KI0A 1U8RA 5HK3A 4RWSC 2WV6D 2VUBA 3AU7A 5FLMH 2RF0A 5D65A 1HNWL 1L2FA 3DEPA 3GTJH 1SE3A 4LF7Q 3ONAB 3CCRQ 4FW2A 2RKSA 2X69A 4TSSA 1B9MA 3EHRA 1E1OA 1Q81R 3H6ZA 3CQZB 2JE6I 5IT9L 3CC2Q 1V43A 4YIJA 3P8BB 3L1AA 1WJJA 4H44C 2RNAA 4JI4Q 3RZOB 4EMKB 4A3BH 3F1ZA 2FZGB 3HEJA 3MEUA 3DM1A 2B2VA 4AFUC 1IZ6A 4E7IA 2EKOA 4PFOA 2RHXA 2I5LX 5IP9G 1GKHA 2J05A 3W3AA 2LRQA 4XTVA 2BKDN 4TQUS 3EGXB 1NR4A 2KCTA 1XPUA 1K1ZA 4A3FH 5IGFA 3GTPH 2Z0SA 5CQYA 4BE2A 5IY0A 1S5FD 4DR6Q 2M0OA 2E1HA 2I5MX 1SPKA 1YEZA 2YTVA 2AKLA 3HKZB 3C1FA 5EPLA 1BBWA 5M9OA 1IKMA 3K6OA 4IPCA 2QQRA 5I6YA 3BZDB 2DL7A 3LW5E 3M4YA 1TWGH 1CSKA 3UDFA 3LH5A 4NW2A 5A0GA 3QJYA 1S5CD 1VQFA 5CORA 4AH6A 4G57A 1UG1A 3VV0A 3OYCA 4O1NA 5GAN2 1J3TA 2KRNA 3OY9A 4DV0L 1WHKA 1UJYA 5CV8A 5C4XH 4Y91A 4YCUA 1JC7A 1QVCA 4A3JG 2K75A 2O5IC 3SHLA 2VASA 2PZUA 2VZAA 1SNOA 2L55A 1EFID 4FO2A 3JCMb 2RN8A 2I0NA 4C92F 1SRLA 4MZPA 2LQ8A 1A3TA 1STHA 2ZXRA 4ZNXA 4KD4A 2CP6A 2FB7A 4KULA 4EX5A 1X9NA 1SKUB 3IAYA 4M7DE 3JCMQ 4YWLA 1Y1WG 2D8JA 1KQSA 4PZ6A 1RABB 4QW2A 4Y28E 2EGCA 5JPNC 5FLMG 4A4EA 3S16B 2NN6I 3G6ET 1TWHH 4PV1C 3FEWX 3V2TA 5FO9B 2MI6A 1FR3A 1UE7A 2I07B 2KHSA 3OWFA 1TUCA 5I4DA 3LH0A 4JDSA 1I5LA 1A3VA 5KNCA 1WTRA 3O5ZA 1OXUA 3EFOB 4XTYA 3ITPA 1V9PA 4X34A 4OX9Q 3S3OA 4ID6A 3AMUA 4M77F 2JT4A 3BDLA 1ZBJA 3BZCA 4JBMA 1ZSZB 2JTEA 1D0YA 1S4ZA 2VUMB 1MMDA 2EY5A 2EVBA 2F3VA 3A98A 2VQEQ 2LX9A 1HK9A 3WOFA 5D6XA 4KN7C 4XU2A 1J6QA 2KHIA 4ZCKA 1Q95G 2ID0A 4GN4B 3VR5A 4C3HG 1M90C 4GKKL 3MA2B 5GADC 2R5AA 1B50A 1YVCA 2PW5A 3OIQA 3A7AB 1PRTF 1DOLA 2BZXA 4IJLA 3CEYA 2CW0C 1OPLA 1N9SA 1SHFA 4HCKA 2F0KA 5GAN8 3E6ZX 5J3BA 1PSFA 2ROLA 3CCLT 2DILA 2MMPA 5C6SA 4LDUA 2M16A 5J26A 3E9GA 2OTLA 2PQAB 4JW0A 5IYDG 4LF6Q 4QCLA 5DAUA 4XTWA 1B07A 2BH2A 3I72A 2VUMG 5HCKA 5KYXA 5GAGC 2KE9A 1D1BA 4BY6C 5AJ3Q 3ULPA 1KC8C 2EBPA 1N9WA 2WFWA 2PNIA 1PZID 4NXML 3CPWA 4XTUA 1AWWA 3I56T 3CCUA 3GTOH 1WTQA 1I50H 3FKIH 2VQFL 4IIMA 4M78G 4OO1I 2IVWA 3VJPA 5IT9c 1Y1WH 1EZ8A 2VY3A 1VQ4Q 3CXCA 1I3QB 3OYGA 3CCLQ 3J80L 1STYA 2MK5A 4DNIA 2ABLA 3G6EQ 1YNXA 1LT5D 2K1BA 1KXLA 3OSSC 1S5ED 3MTSA 3M0PA 2RJFA 2DUDA 2SDFA 4JI2Q 4F88A 5JVH3 1H9SB 2HHHL 3S2HH 5FLXE 5E4WC 3A1PA 1KQSP 5BN3A 1W3SA 3K5MA 3EGDB 1M4ZA 1S3OA 1XXGA 1UGSB 3WXMB 4CC4B 3I4LA 3PT9A 2E65A 4PJJA 3EH2A 2O2OA 2VWFA 1VQGA 2OTJT 1U4RA 3MXGA 3MZ5A 1M1KR 1HFGA 2EY2A 1TR5A 4HJ9A 4L5TA 1B7YB 1Q8IA 2LT1A 2PU9B 4XAXB 4DF7A 5M3MB 1VF7A 1O7ZA 3I4OA 1EFWA 3RMSA 1B3QA 2CZ6B 4KH0B 2L3RA 2F0WA 2MPMA 2LJ0A 1XPOA 3QUIA 2B8GA 4RTUA 2EPDA 3IFTA 3BU2A 3TVTA 1HSQA 1ZSGA 2QGQA 1TS4A 2YUPA 3L2QA 2Q8RE 4LMQD 3W1GA 2LX7A 2PI2A 5FLXc 5GQOA 4LF6L 3EGXA 1JQQA 1VQ5T 5BR8Q 4U68A 2KCCA 3KLWA 3OS0A 1YHQT 4XTCS 2YHTA 1PA6A 1OXSC 4K14A 1SHGA 4M7AD 2BOSA 3NBHB 2L4NA 3MP8A 5DLOA 1DJRD 5A0DA 1VQLA 1NMFA 1W2BA 2XICA 2K5NA 2EYOA 3KBGA 4XYQA 3WWVA 4F7XA 2ZGWA 4J6XA 2Y0SG 1BB9A 1ILPA 2CH4A 4Z02A 1VQAA 3GIBA 4OMQA 2I46A 5M3MG 1BNZA 2BA1A 3CCSA 1BKBA 1UE1A 1VQ6Q 1HTLD 1MMAA 1LTLA 3DWPA 3T53B 4FF1A 3J7AV 4DXFA 2C0OA 3TSZA 3VUZA 2WKDA 4O0AA 4AT1B 3FKIG 3V7SA 1QWYA 1BCOA 1SROA 2NB0A 3RBBB 4RMFA 4YTLA 1LV9A 4RGOS 3DLMA 2AZVA 5DM7R 1M3AA 3JCMe 1YNJD 2Z8LA 3ND9A 3GBQA 2NVYH 2OCEA 3U50C 2HL5C 2F4IA 4ELYC 3EN2A 2QG9B 1JWUD 2E76C 4ULLA 1IBMQ 2Y90A 3K58A 1Q12A 3KF8A 2WSFE 1SNPA 1JB3A 3J81c 3I4NB 1JOQA 1KAWA 1ENCA 5AT1B 5GAMj 1I4RA 4AIMA 4XT3B 5K36G 1F2YA 2L89A 1AE3A 4KN4C 4LFAL 3IL8A 4DV0Q 3CC2T 2PQAA 3I8ZA 2CKKA 3SGIA 1V1CA 3E19A 4PFPA 2A28A 1HTPA 2YLCA 2IHEA 4CHTB 4MNOA 1I4HA 1UEAB 2H4OA 4X65Q 1OEBA 1HNZQ 4M7DA 2DL5A 1PH5A 5KYUB 2QEXT 4G7ZC 1MUZA 1EL0A 3H3VH 1FYNA 3JRZA 2AWOA 5EAYA 2EXDA 3HOXG 4TKOB 3PUWA 4A3GH 1RAFB 3GF5A 3Q6SA 2WINB 2QTXA 5GAMe 1SEBD 1PXUA 1M27C 4JZ4A 3MAQA 3HFNA 4M78A 4RTVA 3JCMX 2EY6A 2VB2X 4V0BA 3TZUA 5A35A 2K52A 2QA4T 2JXBA 2XHCA 2WB1E 1Y96A 3J7YW 1PHTA 2ZPBB 1NBEB 2NVXH 4HAEA 3CW2C 2UU9L 2EGAA 4CKEA 4IPDA 2EJFA 2NBFA 5JAVA 5GAHC 2X3WD 1BBZA 3QB3A 3BE3A 2NUTA 1CKAA 2RQTA 1BI3A 4OB1B 2HQXA 1GD7A 3AFPA 3EFOA 3PVQA 4U673 1IHZA 2ZZDA 4J83A 5FU7C 4IKFA 1PH9A 3X20B 4ZGJB 2DVEA 1E2WA 4A3LH 4DR5L 2LMCB 1EOTA 3QJ6A 1KQSS 1VQLQ 2RB6A 3QOJA 5HGTA 4HA8A 1TS2A 4XXEA 1BCPF 1Q90A 1B7TA 4D8DA 5AFWA 2F52A 4KHPL 4WCIA 3H0GH 2LCCA 1H3ZA 4MHEA 4DUYL 1B1ZA 4JS4A 3SK4A 1AEXA 1BXTA 2KMTA 2AK5A 2BZ8A 2F0EA 1ZYRD 3T1HQ 1S72Q 5K36H 5CBAE 4QUCA 1G3TA 4J7IA 4OO1G 3R8BA 4A4IA 3G7ZA 3NHNA 1VQ4A 2YV5A 1OX8A 2RMOA 5DEHA 1BDOA 2KR3A 1C6VX 2WACA 4JI8Q 2NUCA 5LHY1 4BE1A 2Z0WA 4ZLTF 1PNJA 3BY7A 3JAME 3VR6A 3L2UA 4A4GA 2ATWA 1WTVA 1MMNA 1UGQB 3FLGA 4M7DF 2RA4A 2SEMA 5IHNA 2J6OA 5EJWA 3OYNA 4PK4A 2LJ1A 5GAOp 2MAMA 2GFUA 4M75E 2MHVA 2IPKD 4OX9L 1R9TB 1GFDA 1E1TA 1PV4A 4F16A 1UUPA 1G8XA 1ZSZC 3FDRA 2RHSB 5LMNW 1WTWA 4LNQA 4GLAC 5EBCA 3X24B 2PW7A 2B2UC 3CBOA 3RLOA 3ZFJA 4JI7L 2COYA 1N5ZA 4JRPA 4DV1L 4RKUE 1IW7D 2VW9A 2RQRA 2B2TA 2LXKA 2QI2A 2D9UA 1EIYB 1PFMA 3BG3A 3PO3B 3UI2A 4JI0L 3S1QB 1PD1A 1WJQA 3K0YA 3FJ5A 1A62A 1TWAB 1EIFA 4K5VA 3UPUA 4JI6Q 4I65A 1VQPA 9ATCB 3H91A 5CV9A 1G3YA 1Y96B 2EYMA 1VYUA 1D09B 1TU2B 4PFZA 2EYPA 1OPKA 1PKTA 2DMOA 1C48A 3S2DH 1VA7A 2WSEE 1OU9A 3HOXH 4M7AA 3KDFA 4R56A 4A3GG 1MV3A 4KHPQ 4GNXB 1EUJA 2R57A 2GFAA 1Q86R 1UJ0A 2XTIA 1IBKL 3PUXA 1E3PA 3EFXD 2QKIC 3VR3A 3S14B 2WB1G 3UDCA 3NK9A 5KYWB 1KK7A 5IWAL 3A8IE 1O9SA 3OS1A 4PL6A 2FINB 1KTKA 2V1RA 5BR8L 1KDAA 2DZ9A 2LQNA 2DJZA 2YWWA 4JPBW 2VXEA 3CCET 1X3GA 5M5WH 3HOZH 4ZRZA 5IAYA 2FPDA 1R77A 3VS1A 4PJOB 2CREA 4DR4L 2HBWA 1GFCA 2GA4B 1ZUYA 2HQLA 3K5NA 1WJRA 3VYGA 2B2VC 2EYHA 3VA7A 4DEXA 3R2TA 4M78D 1BCPD 3NTIA 1HJDA 2AUJD 1OV3A 4Q5VA 2DFUA 2JUFA 2HUGA 1SF9A 4C92A 2EQKA 3L2VA 4DR1Q 3PF4A 4KKTA 2H8HA 1SMYC 2XG8D 1S72A 3KFUA 4M75B 1E6GA 3KFVA 3QBYA 3H0GG 1OYXA 4OONA 1WHHA 3J81L 1MD2D 2R93H 3HOYB 5IP7G 5IYCG 3I56A 2J4XA 2OF1A 1QILA 4Q5WA 3JV3A 1WHLA 5I11A 2IW3A 4RG2A 1TUGB 5ELFA 4JI7Q 3C4SA 1V1PA 2HQHA 5CGKA 2IIMA 2JA7G 2E10A 2E2HB 5EG2A 2AQ3B 1KNAA 4JI0Q 4OO1H 1I6HH 2WP8J 1PFSA 2EZVA 3PF5A 1EWCA 1EY4A 3E2UA 1YHQQ 1Q7YR 1K8AR 1PCXA 5GAOl 3KF6A 3OYYA 4HMJA 4C3HB 2UUCL 2MQHA 2L8DA 3GV3A 4G4KA 4DK0A 3SK8A 2F0IA 5ELOA 1WHJA 5CKEA 1X2QA 1VQ9A 3M0TA 3CC7Q 1SJED 1RACB 3GTGB 3M4PA 1EY0A 2CQOA 2ALYB 5FU6B 1U5KA 2KEDA 3BYYB 2FMMA 4OMMA 2XIDA 3GNGA 4KGVB 4M75G 1NMGA 3S17H 2DK3A 1WCMH 4Y7NB 3LX0A 1HUMA 2F0TA 2E6ZA 3I55A 2N8NA 3OB9A 1B44D 5TSSA 3C1EA 3OHXC 2LQKA 2B63H 1Q46A 4JOIA 4GOPA 2HEQA 5IN1A 4JRKA 1GBQA 4HSVA 2J6KA 5KYUA 5EKKA 3VRZA 1X3QA 3TU4K 1MIUA 4OIKA 2YTXA 3BDUA 1N8RU 1X65A 2UUAL 1GCQC 1VQMQ 1GM5A 3HKZE 4GZYC 3CPFA 4HVWA 2DN8A 3E9HA 3S3NA 4JK1C 1ZX6A 4FXDA 4OWTB 2G9DA 3NQTA 1JO8A 1H641 1Q7YC 1K8AC 1I8FA 3I3CA 3JCMf 4DV3Q 1A6XA 1JRIA 1LVKA 2F3WA 3HS0C 3PV0A 4JI5L 4M7DC 4IFDG 1EYDA 4EQOA 2DGYA 2VQEL 1CUKA 1EQTA 1JXMA 1JJ2A 4QVCA 3QO2A 2HSPA 2DTIA 2XSCA 4FXKC 4DOWA 2L11A 4P71A 2H3EB 3AEVA 1CSQA 1T3SA 4OB2B 4DBRA 2JA9A 2NZ1D 3TSSA 3S3MA 4IALA 5GAOm 1MSHA 4EQ5A 4M7AB 4E7HA 4DNTB 2NVXB 2SEBD 2EYYA 3HHTB 3D6CA 2MUYA 4LFAQ 3GTQB 3TP5A 4P75A 3UDXA 3U9SA 1NR2A 5I9OA 4A3KH 2G9HD 2Z1CA 4R4TA 4UP8A 3J81E 2NTTA 3SEBA 3J80c 4F7UF 8ATCB 1B70B 1EWHA 3SVMA 1F2ZA 5FRMA 1CQVA 4I7ZC 4LFBL 1ZA2B 1I4XA 3VS2A 3J80i 2DLPA 5GANh 2LZ6B 1EY9A 3I55Q 1E2VA 3EGUA 1V1PB 2M1HA 3DKMA 4JI8L 4BA1I 1U06A 3G1JA 4J6WA 4J9CA 2QEXQ 3HG9A 1E7ZA 1Y8PB 4J7FA 1I4K1 5CR3A 2GQIA 2YYZA 3QPHA 4WF2A 2QGGA 1WXBA 5CKBA 4DBQA 1LO5D 2OXPA 4QIWB 5D14A 2XI9A 5IYCH 1D0XA 2JEAI 1Z9QA 2HMAA 1K0SA 2J0TD 3M56A 2QDLA 2B63G 2X35A 5FO7B 3G4ST 2PI2E 3HFZB 4LFCL 3UWNA 4C92G 1YZ6A 1M2OA 3VYRA 4DR2L 1YNZA 4QL5A 3VYTA 2L12A 2MGSA 1VS0A 3I4MB 3OW7A 2I0QA 5I2SA 5FK9C 5M3FG 2CKZB 4JI2L 2IWHA 3NBIA 5M3FB 1FL0A 4FF2A 4HSPA 3CBPA 1Y0MA 3S1RB 3FPUB 3WVEB 2JA5B 3H3VI 5ISRA 1WD0A 1X27A 3P8DA 2KVMA 4RGMA 3M4QA 4DR5Q 2JOYA 2YLBA 2FJ2A 2XGTA 4Q0FA 3REBB 1Y8OB 5IHKA 2XD0A 3ZEHA 2K7VA 4KY6A 2HZYA 2PVGB 1YI2Q 3AYHB 2CDTA 2F2VA 1VQPQ 1ASZA 3K8AA 2D0NA 4JV5Q 3JB9G 1EYGA 3R93A 3DLLA 1QVFS 2F3IA 3CMAT 2ZCFB 3LWUA 2PUKB 1WXUA 1WDXA 4DV4Q 1OULA 1D5MC 4DNRB 3T1YQ 1F9QA 4E7JA 1D1IA 2DY7A 4AYBE 3K5OA 3T1HL 1XNRQ 2YXYA 4J15A 1YJ9Q 1X3EA 3S1QH 3JB9F 4H0LC 5CV7A 1NAPA 3Q8DA 3J81j 1KHIA 4J6HA 5CV6A 5FJ8G 1SNMA 2RK2A 3E9FA 3D6WA 4FIBA 4FYWB 1D1AA 1OU8A 2RF4A 1VQOA 1MGSA 1MMGA 1H9KA 3CCLA 2B29A 3EBEA 4KV6A 3U4VA 2FYKA 5GAN5 4LUDA 4WORA 4NOYA 1RD9D 3DWAA 3K81C 2DEUA 4GN3B 3CCQA 1G3WA 5C4JH 3CQZH 3M53A 3S14H 1HJPA 3PIP3 4QIWE 3KUPA 4M77G 4F7UB 3NHHA 5KRUA 1WTOA 2K28A 1T9HA 2CSQA 1N9RA 1FMWA 1X55A 1P16A 1QVGP 1W70A 5GMKm 2F0UA 1WZOA 4EGVA 1BBUA 2YSQA 1NYGA 4ZTJA 4IFDI 2DL3A 3ULRB 4CJ1B 4MIUA 4X9CA 4POGA 2DL4A 1VQJA 1NBWA 2QQBA 1R0BG 4L8JA 2PVDB 3HTRA 4PMBA 3GTPB 4M77E 1QMCA 3SD4A 3HOWB 3META 2KCMA 4FF4A 3HOWG 2Z9HA 4X9DA 5D7UA 2EJGA 2PMZB 2HDAA 1O75A 2JTFA 1I6VC 1L1OC 5C6AA 4G7OC 1Y69U 2AWNA 2P4TA 4LFBQ 4POFA 1X6BA 3M0SA 4DV6Q 2UUCQ 1PH2A 4X66Q 1IGUA 1BU1A 5LL6S 3NSWA 4JV5L 3TCJA 3UA7A 2KQ3A 2LNHB 1ESRA 4NS5A 4X65L 2M2LA 5J1ZA 2JMCA 2MF2A 1N6AA 1MNDA 2DE0X 2CGHA 4JS5A 4QQDA 1LT3D 4NXNQ 1EX4A 3CCRT 2K5FA 4FDBA 1XNRL 4FU6A 2DVJA 1KL9A 2J7IA 3PMFA 5GJWB 3VS4A 4KHZA 1Z9ZA 5HY6A 1D0ZA 5GANf 1VQ7A 1QE6A 4KKUA 4RTWA 1VQOQ 3RD4A 4D8KA 2DXTA 2K79A 2CWPA 2A6EC 2ICIA 1F1BB 5JJKA 2N49A 4UY8C 1U5SA 4O6JA 1O7LA 1PH4A 1KDCA 1M1KC 1ZQ1A 4JCVE 1YJWA 3SR1A 3KYHC 2EYZA 3FJPA 1L1OB 2RVLA 1KRTA 3EQLC 4A3FG 3PGZA 1KNEA 1D7QA 2O31A 5GAOn 3M5AA 1VOMA 1BIBA 1U0LA 1EU4A 2G5DA 4AQYQ 3PSIA 1SN8A 3S17B 3M4OB 2V8KA 1TWHB 1F2LA 2EVRA 5LMNQ 3I35A 1VQ8A 1VQCA 1WHMA 4N8FA 4N8X1 5EKIA 3WDNA 1GHKA 4J9DA 1QP3A 5C0MA 2F0LA 3PCOB 1RDPD 4JBWA 4A93H 4IN3A 2IG0A 5CK9A 2YUOA 2IX1A 3VS5A 2JVVA 1PTOF 3UE1A 1FMVA 4KGZB 1SE2A 3S9WA 2TMPA 1QVFA 2ECZA 1CKNB 3G6JB 2R93G 3EG0A 3STBC 1ICWA 5JJLA 4R8NA 1G2BA 3HPWA 4C92B 3R6NA 2RDGA 3PMTA 4YCVA 3CRLC 1G51A 1WHGA 4M78F 3NGPA 2KQWA 1K9MR 1JE5A 3L2PA 2YU9H 2EQMA 3THKA 5JEAG 4DV7L 4DV6L 2DO3A 2VL6A 1C8CA 3V7RA 4BDZA 1AEYA 3A55A 4M77C 4DBFA 4P73A 2F0MA 4BBRH 1AZPA 2Y4XA 1CT1D 3TP6A 4KD3A 5C44H 4M75D 1BF4A 2JA6H 1VF5C 4C8QB 2K5DA 3KJOA 2MO0A 2VQFQ 2R92G 3LLRA 2QCPX 3CCMA 3BZKA 1PVOA 5T1GA 1SNDA 5GAEC 1BBXC 1YIJA 3EG9A 4IUTA 4AFSC 4C5HA 1W1FA 1X2KA 1VQ9T 1VQNT 3TS0A 1YJWQ 1HXDA 1O78A 3RESA 2EQUA 3SHWA 1PRTC 2JJQA 4KJOA 1R4PB 2P0QA 4IUNA 2M02A 2RSOA 2AZSA 4HT9A 2M9UA 3X3NA 2V4DA 3I55T 1XTDA 1SSHA 1H3HA 3JCMh 3U4ZA 2M9VA 2L5TA 3M4GA 1HXYD 3FRPB 3I90A 4M77B 3S24A 1HA5A 2R3ZA 4JI6L 3T9NA 4OGEA 1VQKQ 4YWMA 1RF2D 4IO9A 2NVTB 1I4QA 2RK1A 3VDYA 2B86A 1TS9A 1AWJA 2DJGC 5GMKl 3EFRA 3VRYA 1J9OA 1K9MC 3CD6Q 3S2HB 3CXCS 1YJWT 4IPHA 3HOUB 1G6PA 3I4MH 4M1UB 1IB8A 1RTNA 2OQKA 2GQVA 1Q82U 5EQ0A 2P4RA 1ZA1B 1E24A 4Z88A 4DAMA 1WYXA 1KIKA 3LNNA 5LJ3j 1GBRA 2SNSA 4K5WA 1G291 4LF8Q 2F0HA 1Y14B 4HJ8A 5IWAQ 1MJCA 1BI1A 3G71A 3LWIA 4IURA 3M0QA 2UUAQ 2JZ2A 2ROTA 4C0GA 1F2MA 4HCSA 1VQBA 2RQXA 2A37A 2E75C 5GAMh 1RIPA 3CHBD 4C8QA 1X32A 2FHTA 4F7UE 2B39A 2R6GA 4X62Q 1TS5A 3L42A 5IT9E 1RAEB 2CFMA 1F9PA 3CD6T 1M1KU 3VS3A 3KBXA 4ABNA 5CO7A 4F8MA 1M1FA 2LC4A 3HOUG 4K11A 4LDVA 3BVMA 5DNFA 2XVSA 3EH1A 1TWFB 4F7UG 5JPMC 2UUBL 2COZA 2UXDL 1OXVA 1YNNC 1NTGA 3M9BA 3K7AH 4B6MA 2K2VA 1VQ9Q 2KRMA 3FC3A 1PTOB 2M51A 1X6OA 3IFDA 5CMDA 2D5DA 1X54A 4KY7A 1N36L 4M7DB 2PZTA 1AFPA 5LJ3d 2VB6A 2P0PA 5GMKj 3CMAQ 2R58A 1WYDA 4ESRA 1K76A 4RG1A 2RPNA 3NWSA 1WJSA 4DKAC 5C4JB 2CP3A 5KYYB 2K04A 4FVMA 4RG8A 4AG2C 2JP1A 5IIFA 2X6GA 2EOTA 5G3LD 3PQIA 1U4LA 2ED0A 3ERQA 4ALPA 5DY9A 4N4GA 4KMUC 4WJ4A 3FHWA 4K6DA 4FYDA 5GAN6 5CAIA 4A76A 1S5BD 2DXCA 2F0GA 1HD3A 1OX9A 2OTJA 2KBNA 2LNVA 4FSXA 2E8GA 2NYZD 3OYBA 1IYJB 4J9FA 4LD9K 4HTHA 4GKJL 2LCLA 4XTZA 2ENBA 1STBA 1W6XA 3NWTA 4RMOA 1GO3E 3EVQA 2EGEA 4RCCA 3UDGA 4A3DG 4NXNL 2JA8B 3VS0A 1ZYRC 1LACA 4TVAB 4IZ8A 4BY7G 2XKOC 4GNXA 4A3BB 1VQMT 4MTKA 5F2DA 2D6FA 1RKNA 3OYJA 2M0YA 2R7ZH 4XQ3A 3LYIA 1TWCB 2RI3A 3RERA 1CHPD 2WAQG 3I4NG 2Q2HA 1H95A 4HIMA 2FPFA 4F14A 1JORA 3BDCA 3C95A 4RCOA 4A3FB 1PH1A 1GCQA 3MHBA 2C35B 4JLIA 2BH8A 4J8OA 1MHNA 2H3JA 4LNPA 5FU7B 1JCKB 3D4RA 3V96A 4EQPA 2JYOA 2LSSA 4C3IB 4DV3L 1N34L 2ES2A 1CFMA 1RAAB 3E0JA 3KF8B 5IGCA 2HDLA 5M5XB 2UUBQ 3M3YH 2CP5A 2E74C 2UXDQ 3CC7T 3K80C 2L3SA 3RNUA 2DA9A 2V8JA 5IXBA 2DY8A 1VQOT 1JQYD 1K73R 5ELCA 4WTOB 5IP7H 1IBLQ 1TOVA 1I1JA 2O4XB 2VC8A 5FW9A 3ERSX 1X3FA 4HEDA 5ELBA 1N36Q 3HOVB 1C0MA 2BTTA 5T1IA 1CZGA 5GROA 5GAOr 3MJXA 2R7DA 2FVUA 5I22A 1XQHA 3AHUA 1N8RC 1KC8U 3M4OH 2PPBC 1XOVA 3S1NH 2XRQD 4GLVB 4CDFC 5D6WA 3HFOA 1WXTA 3C0CA 1M8VA 1QOHA 4X66L 4A93B 4R8IA 2BZYA 3LX7A 4CKCA 4E6IA 4X62L 1TSFA 3I73A 4ZQ3A 1X69A 1ZBXA 3EGDA 2JW4A 3H8ZA 3OW2S 3V8JA 3WOEA 2AUKA 2CWAA 4C2MH 5J22A 4A3CG 3NPFA 1TKWB 4HIDA 3O8VA 3VR4A 1RTOA 4EDUA 4XQNA 1O80A 2DF6A 2X6LA 2B2YA 1PRLC 4C8QD 2MOXA 4OIJA 4KJNA 2XNAC 1BI0A 5IGDA 3RLNA 3MKDA 5LJ5e 5K5PA 4RCBA 5GANd 1QWFA 3PVLA 3KDFB 2HD3A 2JQOA 3OYIA 1GOZA 2E41A 4ZYSA 2VUMH 1M2VA 1QW1A 4MZMA 5FU6C 3F70A 5L23A 3NPPA 1LTID 1QVPA 4FNFA 4QGUA 5LMNL 1RAGB 2DBKA 2PQWA 3A5ZB 4N0AA 1PC0A 4BI4A 1GHJA 3MC0B 3TBIB 5I2YA 4OMOA 3PUZA 3GTOB 1WQ7A 4N9PA 3K5LA 2CSIA 1I5OB 3ZBDA 2IT1A 3UDIA 4HIOA 4XDXA 3GOXA 3NEMA 1UWVA 5FWCA 4BI8B 1M4VA 2RHQB 4ZN3A 4A3EB 1E6HA 5KNBA 3OPOA 2YT6A 4TVRA 5BN5A 3J7AF 2L5QA 1ZXTA 2F0SA 3HGBA 4R4IA 1VQ8T 2PZ1A 4FW1A 2A68D 1E22A 2F1MA 3I9QA 2QXFA 3BJUA 2VV5A 3TEEA 1ML0D 5D3IB 4M7DG 2JJ9A 3PUYA 2K6DA 3SFMA 1VIEA 4AFZC 1LJOA 5A2QL 1AT1B 3S2DB 3INZA 3GTMH 4EMGA 4ZUJA 1Q7YU 1K8AU 4C8QF 2F2XA 2VYTA 3TP7A 3VU3C 3DWQA 2IHFA 4DR4Q 3I56Q 4ELZC 5ELEA 5EC7A 1KLUD 3QDRB 4AQYL 3V8LA 4DA4A 5GAMd 2ASBA 3S1MH 5BN4A 3ZL7C 1EWIA 4B9XA 4PJNA 3FKIB 5I9PA 4IFDJ 2Z6KC 4GLXA 3LWHA 2EE1A 3G48A 2LJ3A 2RHYA 4YCWA 5E7NA 2K3BA 2Q8IB 4DR1L 3HL8A 2B8AA 4RGNA 1VQDA 3GTKH 1DCZA 1T0HA 1M8MA 1HZAA 1TS3A 1XX8A 5DM73 1GUSA 1WI5A 3E9IA 4HVVA 2VNUD 1LTSD 4LW1A 3I7FA 1SSOA 2KOLA 1XMOL 3NQIA 1B34B 4NL3A 4UP7A 3PIO3 1YJNA 4A3MB 2IL8A 4NB3A 3PFSA 3JCMJ 2CH4W 1SYGA 2KYMA 2B2WC 1IHVA 3KLSA 2V26A 1YITA 3HZXA 3V8KA 3JSCA 1NG2A 1YP5A 4FSSA 3BFMA 5I21A 4HCEA 3QKJA 3HOYG 4RAUC 3H0HA 2WAQB 1YJ9T 2XK0A 2HD0A 2PO4A 4JLGA 1ESFA 4AMCA 1AWOA 3WVDB 4M7DD 1D3BA 1HFNA 2QF7A 1S72T 4P74A 1VQ7Q 4X3TA 2LS01 5C4HA 5M3MH 2E5KA 2RQUA 3OMCA 4EMKA 1FNVA 1W2BS 1K9MU 1QB5D 1A8VA 3M7NA 3QHSA 5IXFA 1PM3A 2OX7A 2YRDA 3QWXX 4MZTA 2F0PA 1EFNA 4DGZA 2DERA 1VYTA 3EROA 4C1NI 3S15H 1WFQA 1VQ8Q 5G3LF 4J9GA 5EKLA 2H1EA 5I6WA 5EPJA 3ZYYX 4FYYB 5I2XA 5GAN7 3KLSX 4GOPB 1TTHB 2C0IA 4II1A 4I7AA 2BDOA 4LJZC 1IREB 2JA7B 1NSNS 1XNQL 3TMEA 5CBEE 3RUXA 1NEGA 1IL8A 4E47A 1RLQC 4LUEA 3VKIA 3G6EA 1JOOA 2EY1A 1EZZB 2JM9A 3EHQA 1SE8A 2H5XA 4NDXA 4XQJA 1A2UA 2EYXA 2C5CA 1IXDA 3MXUA 1UUEA 4F04B 3G71T 1EZ6A 2R7FA 1A2TA 2OQ0A 3QZ5B 5ELNA 2RD1A 3FPPA 3IKJA 3HKSA 4IOCA 1BCPB 3CCVT 3PIOA 2EYJA 3EA6A 4PZ7A 3RZDB 2E12A 4JI1Q 3KJPA 1TWCH 2DNUA 1BUVT 1OZ3A 2HCIA 5LMUL 2MP1A 1NPPA 1WOCA 2BIVA 4ZTFA 5C3EB 2NUPB 3RUZA 4JJBA 4PJOD 2QGFB 4DAPA 4M7AG 1GVPA 2C0TA 4CC2A 3ULLA 2O5JC 4JVZA 2W0ZA 4A53A 3CC4A 2ZTEA 3A8MB 1VYVA 1EY7A 2IX3A 3RIRA 1K73U 3L0OA 2X4JA 2HSEB 2QAZA 2PMZE 2QW7A 1YITT 2ZM6L 4BS9A 4IUQA 2Z4HA 2XMFA 1VQ6T 3H0FA 2CW0D 3CKIB 5KGUA 2HQEA 4H7BA 3ICEA 2AHJB 1EEFD 1WA7A 4BY1B 2YUNA 2F0JA 3T56B 2KSSA 4A4KA 2LQWA 2RDFA 2RCNA 1U1SA 4DR2Q 1XMOQ 4BY7H 1YFNA 2JA6B 3PTAA 1Q86C 4EIKA 1D5XC 4LF9L 2LMJA 1IRXA 3AT1B 1OXXK 4KKSA 1TWBA 4JOIC 4GOPC 1KSWA 1GUOA 1ABOA 3MEVA 1X56A 1K3BC 2RJEA 3OBYA 4KGXB 2QA4A 2KBTA 5C3XA 1WIEA 2XU8A 5AYFA 4CI0C 3JCMd 2E2JB 5H1SE 3CU7A 1V1QA 1WNLA 3G4SA 1RI0A 2NZOA 3TRZA 1AH9A 2X4XA 3GO5A 2K3XA 1DYQA 1UAPA 3ND8A 1H9SA 4KLKA 4E7ZA 5CIUA 2VKNA 2EJFC 3JB9D 2F69A 1E2ZA 2IJ0A 3L3OC 1PHJA 4XK8E 3URGA 1OZ2A 2KJXA 3MXNB 3JC66 4AYBB 4A3EG 4C92C 2A6HC 1YI2A 3S1RH 4QUFA 4M4ZA 1JB0E 1II3A 1W4SA 5LJ3g 2BE7D 1K28A 3LGJA 1QQJA 1G2SA 3NXWA 1XJVA 2DTOA 4C5EA 2ZPFB 1H9JA 1LYLA 2K7AA 4M75A 1JJGA 2IX0A 3PNWC 3QSUA 2EQJA 1Q86U 1YHBA 1WTXA 2B2UA 1Z6HA 3F8TA 2KRSA 4BBRG 2ZM6Q 1G83A 2J7ZA 1AOJA 3OW2A 3Q1JA 2BE5D 4DR3L 5KNDA 1GJXA 3CMAA 4LN2A 4LD6A 4WJWA 2KEAA 4J9BA 2QYZA 5LJ5f 1YJNQ 1VQKT 3CCUQ 2F0VA 1I94L 4JBKA 1HCZA 1HR0W 4X6AH 2PNRC 3IRBA 2L0CA 1QVGA 5CKFA 4JZ3A 1V1OA 2AQ1B 2ZTDA 1EIGA 2KEEA 3TREA 1JR0D 1R9TH 4M7AC 6AT1B 2A6ED 1OOTA 1STAA 2FZCB 5GANe 1SNCA 2A69C 1UE9A 2EQIA 3T16A 4M7AE 1UGRB 1SXTA 4VUBA 3H0IA 2CCZA 4BXXG 1N8RR 2DIGA 2UXBL 1VCIA 2V1CC 5M5WB 2EFIA 2EXZA 4OVAA 2E3HA 5C0XH 3CPWP 5HGQA 5LJ3h 1QWEA 1SSFA 1MI2A 2Y0SE 3C94A 1QG7A 1JICA 3M59A 1Q1BA 3KLRA 2LY7A 3ULJA 1ZSZA 2CZ1B 1YN8A 4BWGB 3OWEB 1LCKA 1I81A 4DR7Q 4HMIA 4PNOA 1PFNA 3QWYA 2A19A 1DXMA 4QT7A 2LVMA 5KH6A 1L1OA 4JI3L 3Q22A 2DM1A 1WGSA 4NP5A 3JAMc 3V05A 3NTHA 2BA0A 2EQSA 3A56A 4Z9CB 5FLXL 5FWBA 4HCZA 1NJIU 1HYOA 1BR9A 1ENFA 4X1VA 1ZKOA 1HNXQ 2CQAA 2R61A 3PO2B 3R6OA 2QASA 5C4XB 4AG1C 1RUWA 2K3YA 4CDCC 4QVDA 1GXIE 1L0YB 3G4SQ 2HDMA 2KYBA 4LF4Q 4NMZA 4A3IH 1VQ5A 3HOZB 1BK2A 1HQRD 1CKNA 1JE4A 2FXQA 3MEHA 5IGEA 5E3FA 3J7ZC 1XYIA 4GNXC 1AHJB 3D7SB 1Q1EA 3SK6A 4O5VA 2DNCA 2EWNA 1SYCA 3J80E 1M3BA 4GLKA 2EAYA 7AT1B 3L2WA 1O7YA 2KAFA 4QQGA 5GAMf 4NPSA 4DAYB 1N34Q 3S15B 2K5QA 1A63A 1VQ7T 5CV4A 2EPBA 4DUZL 4PZ8A 1QCOA 3PGGA 3CCJA 2Z6KA 4KBMB 1HPCA 3A54A 4DEYA 1T5XD 2LCSA 5CVIA 1YNJC 3CCQT 3TP8A 1PSEA 4GY5A 3SDZA 2N78A 2P84A 1UNSA 2PYKA 4APVA 2JA7H 1WVLA 1XNIA 3QXEB 4E2FB 3B6YA 2E2HH 1PYWD 1HZ9A 1VQKA 1E7OA 2B2YC 4RFBA 3PO3G 1FX7A 1VQHA 1PRMC 1B2TA 2JA5G 4QQBX 2KVQG 3VS6A 1FXXA 3SK5A 4PJMA 1NCVA 4B3TL 2A1AA 3CPWS 8AT1B 2RHIA 1IKLA 4NKLA 2OEOA 3GTLB 3DB4A 4LK1C 4LDWA 4JI3Q 1PZKD 1SLJA 2COWA 2AKKA 3RMHA 3A5UA 2F4VQ 3RZDH 1OTCA 5C3WA 1MV0B 2NN6H 1AD5A 1ZUKA 4OB0B 3S16H 4Z89A 1LTGD 3X25B 1H9RA 3M0UA 1EU3A 2WAQE 2R5MA 2JN0A 2K03A 2WB1B 3P20A 1G6ZA 4LFCQ 2KA7A 4ZGEB 2K5IA 3GTQH 1EYAA 4UPAA 4IUUA 4LF4L 1AZGB 2SRCA 1ET6A 3DM3A 1EOVA 4RUGA 4P5NA 4L5QA 3RLFA 2R7ZG 3JAMi 4RTYA 3RKYA 1K3RA 1Y1VH 2FPEA 2WSCE 1F77A 5FKAC 2UXBQ 1NLPC 4R1JA 1EIHA 2K32A 1SYEA 5DLQE 4BY6B 3MXPA 3T4AC 2CT4A 4IUVA 3MXNA 3MPUB 3RKWA 1SFOB 2K5WA 2NUTB 2ZPGB 1WTHA 3CF5A 2ZT9C 1V29B 4DUZQ 3E0EA 2LTOA 4JRIA 1I3QH 5CV5A 1I07A 3FB9A 3SWNC 3A0JA 4C56C 3Q24A 5LMUQ 2R92B 2KT8A 1QCBD 2DKGA 2A73B 2F5TX 1PD0A 3UF4A 1BVSA 2F0QA 2DX1A 3CCQQ 1F9RA 5KIXA 1HUNA 1NM7A 3HRZC 2VB3X 4X3UA 3C12A 1MKHA 3CC7A 1DONA 4RTZA 3C46A 1G3SA 3I5SA 4OMLA 2PNHA 4CJ0B 5M3FH 1IXRA 3SEMA 2F0OA 4FYVB 4QVZA 3FMCA 1W6JA 1KJWA 2MNAA 2NVQB 3OBWA 4LUOA 1M9SA 1KC8R 2EJ9A 4ATOA 4LWCA 1FJGL 1R0CB 1LLRD 5CKDA 1LUZA 3CAMA 4JC0A 4PMWA 3D4DA 4DK1A 1SR3A 3EJIA 1ACMB 1CI3M 3QYGB 2EKHA 1CHQD 3X28B 1BYMA 2XN9C 2TSSA 4XT1B 4RTXA 1IHWA 5KE3A 1LTRD 4DR3Q 3J7A5 3HKZG 1UECA 3CMEA 3VS7A 2KENA 2NN6G 3NBHA 3NUCA 4BA2I 1CKMA 2KNBB 4K0KL 4KUDK 3JCMg 2RSNA 4BB7A 2DYIA 3BW1A 1M2VB 2JM8A 5CCAA 1K83H 4JI1L 1A3UA 5GMKi 2DETA 4C5GA 1TVXA 1LOJA 2E4HA 3EAEA 2MFIA 1CA5A 1PYSB 2V1QA 4MMKA 2CVRA 1IW7C 4OF1A 2QQ9A 1L0XB 1EY5A 2K5HA 4MN3A 4MTNA 1B34A 3D31A 3L7ZC 2DJQA 4DK6C 1BCPC 1A0IA 1BOSA 4A3JB 4GS3A 5D6YA 1RI9A 1SEMA 2CZ7B 3RR5A 1TWFH 2GN5A 4J8QA 5ELDA 1L0WA 2FEIA 2EIFA 4M75F 1PFBA 3VYUA 1T0JA 1UB4A 1KLGD 1LPLA 5M5YH 4DOVA 3CXCP 3F2DA 1PYBA 2KXDA 1A15A 3H3VC 1UDLA 4XU3A 2PQEA 1WD1A 1VQPT 1J8IA 4JBJA 2UXCQ 2K14A 1NJIC 2O2LD 1R8OB 3A7LA 3NMZC 4KH1B 4DR7L 2E5LQ 2NVYB 5GAMg 2HHHQ 4GKJQ 1BO0A 4FM4B 3GTJB 2ZPIB 3JCMV 4UAIA 1UE5A 4JI5Q 1PG5B 3T13A 4RHSA 4YHHQ 1PH7A 2KCNA 2KI7A 3JB9J 2PZWA 1NLOC 1PTOC 3NENA 1K73C 5IHIA 4LF9Q 5A0LA 2JS0A 3OYMA 3VUBA 3F2UA 2HCCA 1YI2T 4EVOA 2QDYB 1QKWA 1EY8A 5JJIA 3ER0A 4ZAIA 3OA6A 5FRNA 2F0DA 3TQYA 3CCRA 5LJ5h 3BYTB 1HNWQ 2PVOB 1JXOA 4M78C 1ABQA 1U4PA 4ZKBB 2FO0A 5KYLA 2JA8H 4EMHA 1RJTA 4CDDC 1NUCA 1ONLA 4C8QE 3PO2H 4PG3A 2XIWA 2JEBI 1M8AA 3M85A 1SMYD 1AE2A 3KF6B 4OL7A 2RDHA 2E2DC 2R7ZB 1SRMA 3HSBA 1H8KA 2DEQA 2L1BA 1F9SA
chains in the Genus database with same CATH topology
4HCBA 1Z47A 4OGCA 1G91A 4ME5A 3FVQA 1WQWA 4CKBA 1TWGB 4XU0A 2RBMA 1B4OA 4KT0E 5LJ3f 1VMCA 1D2BA 1TY0A 3JCMc 4M8AA 2DTHA 3M3YB 1PMRA 4BBSB 1NE8A 1RCVD 5GMKh 2FFKB 3GV6A 3CRKC 1IYVA 3N52A 3MFGA 4RCNA 4N0AC 1Y71A 4IFDH 2BUDA 4EPCA 5GAOq 2OTLT 4DA2A 1NZ9A 2DPPB 1YJ9A 3I70A 3OYDA 2ZXPA 4A3GB 3MEAA 2QQAA 2F0FA 4CBVA 2OAUA 5LJ5g 3H0GB 5JJZA 2A68C 4A4FA 4C8QG 1VQ4T 4C0DC 1U4MA 2N55A 1T5EA 2CS7A 1PRTB 1FGBD 2SOBA 4K2KA 5CQXA 5KCOA 1B3AA 1I4PA 2YU9B 1GUNA 4PJOG 1R4QB 5IODA 4F7UA 4C2MB 4QMGA 1STEA 1KQ1A 1V8QA 4D6WA 2DXBA 1X3PA 2QDBA 4B08A 2XDBA 1EYCA 1LABA 1SNQA 5C44B 1GUGA 1P92A 1KG1A 4RKLA 1TIID 2CHBD 2EYQA 4KY5A 2HNIA 1MBYA 2EJGC 1DD2A 4MDXA 3MWYW 4OGQC 5FOBB 5KCHA 5CR2A 1JWMD 4HN7A 2LDMA 4M7AF 1D5ZC 3NFCA 1PLFA 1SYFA 4K8JA 3PMIA 3KUFA 3C2PA 3DEOA 2C9OA 4J6YA 4OP0A 3PIPA 2HAXA 4C3IG 5C5MA 1CM9A 2DIQA 3M58A 1TY2A 5COYA 1FWZA 4FXGC 4MDWA 1Q3LA 4HT8A 4PJOE 2DZCA 2FL7A 4PNYA 1M90U 1STGA 3KK7A 4O42A 1H9MA 1KABA 4DU9A 3MEWA 2F5KA 3PUVA 3P75A 4ODGA 3DB3A 2AQ2B 3K57A 3GTMB 2BCOA 3HRUA 3CCMT 2JTMA 4NL2A 1VQ6A 1SBBB 1KHCA 4RA8A 4M78B 3A8JE 2FMCA 3LGLA 4QF4A 5HURA 5J39A 4BD3A 2EYLA 1QP2A 4S3SA 5EPKA 3Q23A 2SNMA 3GTKB 1G8ZD 1BQQT 5GANg 1K83B 1OXTA 2K33A 1ZHIA 5LL6X 4R9WA 2XRSD 2R93B 2KDSA 3CBMA 2KUMA 3T51B 3D3RA 3M9QA 3K7AB 4L6V5 2DAQA 4PJOC 5HKCA 1AW7A 4V2SA 4C5IA 3SB2A 1W6KA 3OYAA 5M5YB 5HK0A 3NTKA 4F87A 5JVG3 5CKHA 1VQLT 1LT4D 1QNUA 2A3LA 3GLXA 3SXHA 1WPYA 1FNWA 3V7CA 2CZ0B 2X4WA 3VYHB 1QJOA 1WCMB 4N9TA 1RHPA 2A5HA 4FL6A 5LJ5d 3N6RA 5EBDA 4BDYA 2K5LA 4A4HA 2C06A 2QILA 4ME7A 2L9HA 2DXUA 3QWNA 3EFSA 1I6HB 1GXDC 4C0ZA 4JUVA 2LFNA 1RL2A 1X01A 4J5YA 2KK4A 4H13C 5CC4A 4XTXA 3BDOA 4ZK9B 5DM63 3CC2A 4C0FA 1FD7D 3CCVA 2QQSA 2RO0A 5I2MA 4MMLA 3X3MA 3QIAA 3FRNA 1SYDA 4V190 1YBYA 4OMFB 2KECA 2O01E 4C92D 1GUTA 2A6HD 4C3JB 5LJ5j 1G2TA 1VIFA 3LWEA 2XWJB 2JSOA 4XYOA 4A3KB 3CC4T 1M1GA 3BVZA 3MHXA 1D1KA 5KEEA 2RA2A 4FT4A 3HP9A 1AP0A 1KDBA 2JXMB 2MWOA 2XDPA 3R3OA 4ZKCB 3S1NB 4BE0A 4PLLA 3H94A 3OYHA 3NE5B 2BE5C 4K2LA 2O4XA 1EY6A 5D3DA 3U9OA 2A74C 1OO9B 3L2ZA 3QZ9B 1EEID 5LJ3e 4ILWA 1UGPB 3QOLA 1ET9A 3H6MA 2E64A 3OYLA 2A69D 2HBPA 4M78E 2RI5A 2Q8TA 3A8OB 1SJHD 1D3BB 1MGQA 2ZPEB 4LAAA 1LTAD 2KY9A 3RMQA 3OS2A 1DM0B 2ICEC 3CCJT 3TZDA 3HP3A 3M57A 1SDFA 5E4XA 1LNXA 2CYZB 4M77D 1B9NA 1HA6A 3Q0AA 4M75C 3OS5A 3G7LA 3QYHB 3K59A 3C3LA 3OMGA 4L5GA 3VR2A 3W2DA 2ZPHB 4C1NK 2E6NA 2ZXOA 4PJOF 5GAN3 3CCST 2GCXA 1NPRA 1HHVA 1YIJT 1PRTD 5IGBA 3OOCA 1VQNA 3HRTA 4ZGDB 3OYFA 1QNKA 3MP6A 2XWBB 3L9AX 2RM4A 2EYFA 2LT4A 5GAN4 4WRDA 2MWPA 3SE0A 3MFYA 3LGFA 3BS1A 1UEBA 3DMUA 3S1MB 1STNA 1ILQA 4HR7B 3JB9H 3OQ5A 4UC4A 3JB9I 3BVGA 3R2IA 4X3KA 5JEAJ 4A3DB 3HOXB 4UDUC 3A8KE 2D62A 4J1MA 4KUIA 2K57A 2D9TA 4RKBA 5NUCA 3MVVA 5L8RE 3GD7A 1M5Q1 2PUOB 2GF7A 1XWEA 2QEXA 5FROA 2EJMA 4RH6A 4JJNK 2OT2A 2A7YA 2F0NA 3DXJC 4DN4M 3FDTA 4CJ2C 3UT1A 2FHDA 5KYIA 1WTPA 3CCEA 4C3JG 2VXWA 1Z7TA 1ZEQX 1JBMA 4TRDA 3OYEA 1AN8A 4LDXA 1LTBD 4L59A 4PLIA 1VQMA 4K6LA 2EDGA 4KK7A 2G3RA 2XDDA 1C4QA 2M00A 1Q82C 1CZWA 2E70A 4DAYA 3JAML 4A3IB 1YNND 4PJOA 4PMCA 1B53A 4LDYA 1Y7XA 4QB4A 1U9RA 1ENAA 5A2QE 3VYSA 1RODA 3CMET 1LTTD 5C0XG 1VUBA 1JWSD 2NWGA 1YJNT 2B2WA 4RHRA 3X26B 3QIIA 4JRQA 1JOKA 1LT6D 1DJ7B 2Y4YA 4R55A 1TT2A 2D0QB 3A8HB 4KTAA 1BIAA 2E5QA 4G7HC 3FEOA 5C0XJ 5IOCA 5JOBA 5IGGA 2X4YA 1QVGS 1XTCD 3MP1A 3CCUT 1FYCA 2RJDA 4E7KA 1MSGA 4KHVA 2K6AA 3HRSA 2B63B 2DD5A 1CQFA 1HQMC 2BDNA 1AZQA 2N88A 5KE2A 1E0BA 1VDZA 2LKVA 4E7LA 1K8MA 1IYUA 4DQ2A 5EGTA 3KXTA 3GNFB 3OSOA 2K01A 1TQOA 3RKXA 2Y0SB 2YRVA 4RGTA 4HCCA 1K8OA 4B9WA 3MO8A 3P1HA 5C0XI 1KD1U 3S6WA 4C8QC 3NP8A 4HKEA 5FO8B 3GP7A 1CTMA 3SWNB 4L63B 4A54A 2MJ8A 4CGYB 3P8HA 3OSVA 3DHQA 1Y1VB 2WKCA 4ZUIA 2P0KA 2RI2A 3L2RA 3I91A 3O13A 1SYBA 4K8IA 3ASKA 4M77A 1KQ2A 1PDQA 1Y8NB 1Y07A 1N27A 4BY7B 4P2CB 1CK1A 5JEAH 4PKCC 3SWNA 4OHJA 1Q81C 1SE4A 3FIFA 3A8GB 4OB3B 3DUZA 4L6TB 4X3SA 5C4ZA 4BUGA 3A8LB 3M54A 4BBRB 3D4WA 4BACA 2K4YA 3E5SA 4CRIA 1YHQA 3QO3A 2JNGA 5E1FA 1DOMA 3P7JA 4WFN3 4BI3A 3ME9A 2DD4A 1I50B 1GUWA 3AB9A 1Y1WB 2VXFA 4K5XA 4EQNA 2V8IA 1KD1C 3TDQA 2VGNA 3GP8A 4FT2A 2E2IB 1PTOD 3JCMW 3GQBA 3CD6A 1X75C 4ZN1A 2D2CC 1PZJD 4XQQA 3E1SA 1DOKA 3D8GA 3GPLA 4QQ6A 3H09A 1KAAA 4PQXA 2QEJC 3QG1A 2WIIB 1FNUA 4FF3A 2NTSA 3TN2A 4XU1A 3MCAB 1Q81U 2NLUA 2B8FA 1YCYA 1EQVA 5CYUA 1SAPA 1I4GA 2RHUA 2Z4IA 3OYKA 1JJ2S 3M7GA 5GANj 4C0DB 1G5VA 1OI1A 1VMPA 1D6EC 2RHZA 2VGMA 5GMKe 2RJCA 3URYA 1BI2A 2B2TC 2K05A 1U1TA 1PTOH 3VA5A 2I2LA 3OIPA 2DNEA 1CA6A 4DAVA 4C92E 4EMKC 4FP5D 4N4IA 1DZ1A 1S5DD 2PCFB 2F03A 2RH2A 4N4HA 1HRJA 3M55A 3N5BB 5C5LA 4IUPA 4DXGA 4XIGS 1TH7A 4IQZA 3JCMP 4KI0A 1U8RA 5HK3A 4RWSC 2WV6D 2VUBA 3AU7A 5D65A 3DEPA 1SE3A 3ONAB 2RKSA 2X69A 4TSSA 1B9MA 3H6ZA 3CQZB 2JE6I 5IT9L 1V43A 4YIJA 3P8BB 3L1AA 4H44C 3RZOB 4EMKB 3HEJA 3MEUA 3DM1A 2B2VA 4E7IA 1IZ6A 2EKOA 2RHXA 3W3AA 2LRQA 4XTVA 2BKDN 4TQUS 1NR4A 5IGFA 5CQYA 4BE2A 1S5FD 2M0OA 2E1HA 3HKZB 3C1FA 5EPLA 5M9OA 1IKMA 3K6OA 2QQRA 5I6YA 3BZDB 3M4YA 3LW5E 4NW2A 5A0GA 3QJYA 1S5CD 5CORA 4G57A 3VV0A 3OYCA 4O1NA 5GAN2 3OY9A 5CV8A 4Y91A 1JC7A 2O5IC 3SHLA 2PZUA 1SNOA 2L55A 1EFID 4FO2A 3JCMb 4C92F 4MZPA 2LQ8A 1A3TA 1STHA 2ZXRA 4KD4A 2FB7A 3IAYA 4KULA 4M7DE 3JCMQ 1KQSA 4QW2A 4Y28E 5JPNC 4A4EA 3S16B 2NN6I 3G6ET 4PV1C 3FEWX 3V2TA 5FO9B 2MI6A 1FR3A 3OWFA 2I07B 2KHSA 5I4DA 3LH0A 4JDSA 1I5LA 1A3VA 5KNCA 1WTRA 1OXUA 4XTYA 3ITPA 4X34A 3S3OA 4ID6A 3AMUA 4M77F 3BDLA 1S4ZA 2VUMB 2EY5A 2EVBA 2F3VA 2LX9A 1HK9A 3WOFA 5D6XA 4KN7C 4XU2A 2ID0A 3VR5A 4C3HG 1M90C 3MA2B 2R5AA 1B50A 2PW5A 3OIQA 3A7AB 1PRTF 1DOLA 3CEYA 2CW0C 1N9SA 2F0KA 5GAN8 3E6ZX 5J3BA 3CCLT 1PSFA 5C6SA 2MMPA 2OTLA 4LDUA 2M16A 5J26A 3E9GA 4QCLA 5DAUA 4XTWA 3I72A 4BY6C 1KC8C 1PZID 3CPWA 4XTUA 3I56T 3CCUA 1WTQA 4M78G 4OO1I 2IVWA 3VJPA 1EZ8A 3CXCA 1I3QB 3OYGA 3J80L 1STYA 1LT5D 2K1BA 3OSSC 1S5ED 3MTSA 2RJFA 4F88A 2SDFA 5JVH3 1H9SB 5FLXE 5E4WC 5BN3A 3K5MA 1M4ZA 1XXGA 1UGSB 3WXMB 3I4LA 3PT9A 2E65A 2OTJT 1U4RA 3MXGA 3MZ5A 1HFGA 2EY2A 1TR5A 1Q8IA 2LT1A 2PU9B 4XAXB 4DF7A 5M3MB 1VF7A 1O7ZA 3RMSA 2CZ6B 2L3RA 2F0WA 2MPMA 3QUIA 2B8GA 3IFTA 1TS4A 3L2QA 2Q8RE 4LMQD 1VQ5T 4U68A 2KCCA 3OS0A 1YHQT 4XTCS 2YHTA 1OXSC 4K14A 4M7AD 2BOSA 2L4NA 3MP8A 5DLOA 1DJRD 5A0DA 1VQLA 4F7XA 1W2BA 2XICA 4XYQA 2EYOA 3KBGA 2ZGWA 4J6XA 1ILPA 4Z02A 3GIBA 2I46A 1BNZA 2BA1A 3CCSA 1BKBA 1HTLD 3J7AV 3DWPA 3T53B 4FF1A 4DXFA 3VUZA 2WKDA 3V7SA 1QWYA 2NB0A 4YTLA 1LV9A 4RGOS 3DLMA 5DM7R 2Z8LA 3JCMe 1YNJD 4DK1A 3ND9A 2F4IA 4ELYC 4ULLA 2E76C 1JWUD 2Y90A 3K58A 1Q12A 3KF8A 2WSFE 1SNPA 1JB3A 3I4NB 1JOQA 1ENCA 1I4RA 5GAMj 4XT3B 5K36G 1F2YA 2L89A 4KN4C 3IL8A 3CC2T 3I8ZA 2CKKA 1HTPA 3E19A 2YLCA 4CHTB 1I4HA 1UEAB 2H4OA 4M7DA 2QEXT 4G7ZC 1EL0A 3JRZA 2AWOA 4TKOB 3PUWA 3GF5A 3Q6SA 2WINB 2QTXA 5GAMe 1SEBD 1PXUA 3MAQA 3HFNA 4M78A 3JCMX 2EY6A 2VB2X 4V0BA 3TZUA 5A35A 2QA4T 2XHCA 1Y96A 3J7YW 2ZPBB 4HAEA 4CKEA 2EJFA 2NBFA 5JAVA 3QB3A 1BI3A 4OB1B 2HQXA 4U673 1IHZA 2ZZDA 4J83A 5FU7C 4IKFA 3X20B 4ZGJB 2DVEA 1E2WA 2LMCB 1EOTA 3QJ6A 1KQSS 2RB6A 3QOJA 5HGTA 4HA8A 1TS2A 4XXEA 1BCPF 1Q90A 5AFWA 2LCCA 1H3ZA 4MHEA 1B1ZA 4JS4A 3SK4A 1AEXA 1BXTA 2KMTA 2F0EA 1ZYRD 5K36H 5CBAE 4QUCA 1G3TA 4J7IA 4OO1G 3R8BA 3G7ZA 1VQ4A 5DEHA 1BDOA 2WACA 2NUCA 5LHY1 4BE1A 4ZLTF 3BY7A 3JAME 3VR6A 3L2UA 4A4GA 1WTVA 1UGQB 3FLGA 4M7DF 2RA4A 5EJWA 3OYNA 5GAOp 2MAMA 2GFUA 4M75E 2MHVA 2IPKD 1R9TB 1UUPA 1WTWA 3FDRA 5EBCA 3X24B 2PW7A 2B2UC 3CBOA 3ZFJA 4JRPA 4RKUE 1IW7D 2B2TA 2QI2A 2D9UA 1PFMA 3BG3A 3PO3B 3UI2A 3S1QB 1WJQA 3K0YA 1TWAB 4K5VA 1EIFA 3UPUA 4I65A 1VQPA 3H91A 5CV9A 1G3YA 1Y96B 2EYMA 1TU2B 2EYPA 1C48A 2WSEE 4M7AA 4R56A 2R57A 2GFAA 3PUXA 3EFXD 2QKIC 3VR3A 3S14B 3UDCA 3NK9A 3A8IE 1O9SA 3OS1A 4PL6A 2FINB 1KTKA 1KDAA 2DZ9A 2DJZA 3CCET 2VXEA 4ZRZA 5IAYA 4PJOB 2GA4B 3K5NA 1WJRA 3VYGA 2B2VC 2EYHA 3VA7A 3R2TA 4M78D 1BCPD 3NTIA 2AUJD 4Q5VA 2JUFA 2HUGA 4C92A 2EQKA 3L2VA 4KKTA 1SMYC 2XG8D 1S72A 4M75B 3QBYA 1OYXA 3J81L 1MD2D 3HOYB 3I56A 2J4XA 2OF1A 1QILA 4Q5WA 2IW3A 4RG2A 5ELFA 3C4SA 1V1PA 5CGKA 2E10A 2E2HB 5EG2A 2AQ3B 1KNAA 4OO1H 2WP8J 2EZVA 1EWCA 1EY4A 4HMJA 5GAOl 4C3HB 3OYYA 2L8DA 3GV3A 4G4KA 4DK0A 3SK8A 2F0IA 5CKEA 1VQ9A 1SJED 3GTGB 1EY0A 5FU6B 2KEDA 3BYYB 4N9PA 2FMMA 2XIDA 3GNGA 4M75G 2DK3A 4Y7NB 3LX0A 1HUMA 2F0TA 2E6ZA 3I55A 3OB9A 1B44D 5TSSA 3C1EA 3OHXC 2LQKA 5IN1A 4JRKA 4HSVA 5EKKA 1X3QA 3TU4K 4OIKA 3BDUA 1N8RU 4GZYC 3CPFA 2DN8A 3S3NA 4JK1C 4FXDA 2G9DA 3NQTA 1H641 1Q7YC 1K8AC 3I3CA 1I8FA 1A6XA 3JCMf 1JRIA 3PV0A 2F3WA 3HS0C 4IFDG 4M7DC 1EYDA 4EQOA 1EQTA 1JJ2A 4QVCA 3QO2A 2DTIA 2XSCA 4FXKC 4DOWA 2L11A 4OB2B 2NZ1D 3TSSA 3S3MA 4IALA 5GAOm 1MSHA 2NVXB 4M7AB 4E7HA 4DNTB 2SEBD 3HHTB 3D6CA 2MUYA 3GTQB 3TP5A 3U9SA 1NR2A 5I9OA 2G9HD 2Z1CA 3J81E 2NTTA 3SEBA 4F7UF 1EWHA 3SVMA 1F2ZA 5FRMA 1CQVA 4I7ZC 1I4XA 5GANh 1EY9A 1E2VA 1V1PB 2M1HA 3DKMA 4BA1I 4J6WA 3HG9A 1Y8PB 4J7FA 1I4K1 5CR3A 4DFAA 2YYZA 3QPHA 4WF2A 5CKBA 2OXPA 4QIWB 1LO5D 5D14A 2JEAI 2XI9A 2J0TD 3M56A 2X35A 5FO7B 3G4ST 1SFOB 3VYRA 3UWNA 4C92G 3VYTA 2L12A 2MGSA 3I4MB 3OW7A 5I2SA 5FK9C 2IWHA 3NBIA 5M3FB 4FF2A 4HSPA 3CBPA 3S1RB 3FPUB 3WVEB 2JA5B 5ISRA 1WD0A 3P8DA 2KVMA 4RGMA 2JOYA 2YLBA 2FJ2A 4Q0FA 1Y8OB 2XD0A 3ZEHA 2K7VA 4KY6A 2PVGB 3JB9G 3R93A 3DLLA 1QVFS 3CMAT 2ZCFB 3LWUA 2PUKB 1D5MC 4DNRB 1F9QA 4E7JA 1D1IA 2DY7A 3K5OA 3JB9F 4H0LC 5CV7A 1NAPA 1KHIA 4J6HA 5CV6A 1SNMA 2RK2A 3E9FA 3D6WA 4FIBA 1VQOA 1MGSA 1H9KA 3CCLA 4KV6A 2FYKA 5GAN5 4WORA 4NOYA 1RD9D 3DWAA 3CCQA 1G3WA 3M53A 3PIP3 3KUPA 4M77G 4F7UB 3NHHA 5KRUA 1WTOA 2K28A 1N9RA 2F0UA 5GMKm 4EGVA 4ZTJA 4IFDI 4CJ1B 4MIUA 4X9CA 4PMBA 2QQBA 4L8JA 3GTPB 2PVDB 4M77E 3SD4A 3HOWB 3META 4FF4A 4X9DA 2EJGA 2PMZB 2JTFA 1O75A 1I6VC 5C6AA 4G7OC 1Y69U 2AWNA 2P4TA 5LL6S 3NSWA 3TCJA 2KQ3A 1ESRA 4NS5A 2M2LA 5J1ZA 2MF2A 1N6AA 2CGHA 4JS5A 4QQDA 1LT3D 3CCRT 2K5FA 4FU6A 3PMFA 4KHZA 5HY6A 5GANf 1VQ7A 1QE6A 4KKUA 3RD4A 2DXTA 2ICIA 2A6EC 4O6JA 1O7LA 1KDCA 1M1KC 1ZQ1A 1YJWA 3SR1A 3FJPA 2RVLA 3EQLC 1KNEA 5GAOn 3M5AA 1BIBA 3S17B 1EU4A 3M4OB 2V8KA 1TWHB 1F2LA 1VQ8A 1GHKA 5EKIA 3WDNA 1QP3A 5C0MA 2F0LA 4JBWA 1RDPD 4IN3A 2IG0A 5CK9A 2IX1A 2JVVA 1PTOF 1SE2A 3S9WA 2TMPA 1QVFA 3G6JB 1ICWA 4R8NA 3HPWA 4C92B 2RDGA 3PMTA 3CRLC 4M78F 2KQWA 2EQMA 5JEAG 2DO3A 1C8CA 3V7RA 4BDZA 3A55A 4M77C 1AZPA 2F0MA 2Y4XA 1CT1D 3TP6A 4KD3A 1BF4A 4M75D 1VF5C 4C8QB 2K5DA 3LLRA 2QCPX 3CCMA 5T1GA 1SNDA 1BBXC 1YIJA 4IUTA 4C5HA 1VQ9T 1VQNT 1HXDA 1O78A 3RESA 2EQUA 1PRTC 4KJOA 1R4PB 2P0QA 4IUNA 2RSOA 4HT9A 3X3NA 2M9UA 2V4DA 3I55T 1XTDA 3JCMh 2M9VA 2L5TA 3M4GA 1HXYD 3FRPB 3I90A 4M77B 1HA5A 2R3ZA 3T9NA 4OGEA 1RF2D 2NVTB 1I4QA 2RK1A 5GMKl 3EFRA 1J9OA 1K9MC 3S2HB 3CXCS 1YJWT 3HOUB 4M1UB 1RTNA 2GQVA 1Q82U 5EQ0A 3LNNA 5LJ3j 2SNSA 4K5WA 1G291 2F0HA 1BI1A 3G71A 3LWIA 4IURA 2JZ2A 4C0GA 1F2MA 4HCSA 2RQXA 2E75C 3CHBD 5GAMh 4C8QA 1X32A 2FHTA 4F7UE 2B39A 2R6GA 1TS5A 3L42A 5IT9E 1F9PA 3CD6T 1M1KU 3KBXA 4ABNA 5CO7A 4F8MA 1M1FA 2LC4A 4LDVA 3BVMA 5DNFA 2XVSA 1TWFB 4F7UG 5JPMC 1OXVA 1YNNC 2K2VA 1PTOB 3FC3A 1X6OA 3IFDA 5CMDA 2D5DA 4KY7A 4M7DB 2PZTA 1AFPA 5LJ3d 5GMKj 2P0PA 2R58A 3NWSA 1WJSA 5C4JB 2K04A 4FVMA 5IIFA 4RG8A 2JP1A 2X6GA 2EOTA 5G3LD 1U4LA 3ERQA 5DY9A 4N4GA 4KMUC 4K6DA 4FYDA 5GAN6 5CAIA 1S5BD 2DXCA 2F0GA