3NTHA

Crystal structure of tudor and aubergine [r13(me2s)] complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
167
structure length
167
Chain Sequence
b'ELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein tudor
molecule tags Transcription
source organism Drosophila melanogaster
publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
total genus 38
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3nthA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nthA01
2RHYA 3QJ6A 4N4HA 3Q1JA 4BE1A 4E7IA 4E7JA 3OB9A 2IG0A 3OYJA 3LGFA 2M0OA 2BKDN 2O4XB 4BACA 2EQMA 1KHCA 2G3RA 2YRVA 3DB4A 2QQRA 2LCCA 3NTIA 2LRQA 1OYXA 2GFAA 2GFUA 4QQGA 2XDPA 2LDMA 3META 2LTOA 3OS1A 4PLIA 3DB3A 4LD6A 3S3NA 2BIVA 2PQWA 2R57A 5CIUA 4ZTFA 4NS5A 4UC4A 2RO0A 3OS0A 3CEYA 2X35A 2M1HA 2HQXA 2EFIA 4IKFA 4IUUA 3E9GA 4RG2A 3MEVA 2DIQA 3P8DA 2K3YA 1MHNA 1H3ZA 3OYIA 1OI1A 3LLRA 4N4GA 3FDRA 3P8HA 4C5HA 3L2QA 1N27A 3H6ZA 4QQ6A 4B9XA 5KCHA 4BE0A 3L42A 3S3OA 3PMTA 2NLUA 3DLMA 4QQDA 3LGLA 2CKKA 1WJRA 4PL6A 3OA6A 3OYAA 5FRNA 3KUFA 2JTFA 2R58A 5C0MA 2L89A 2EQJA 4C5GA 5IAYA 4E7HA 3MP6A 4A4FA 3MP8A 3ZEHA 5KE2A 3L2RA 2WACA 2DAQA 2EKOA 3C4SA 2E5QA 4X34A 3FC3A 4Q5WA 5M9OA 2L8DA 2R5MA 3LYIA 4QW2A 3OYNA 3H8ZA 3OYBA 2E6NA 3OYCA 2RHUA 4HCZA 2JZ2A 3OYDA 3OYKA 3PFSA 2LVMA 3NTKA 2BUDA 3OQ5A 2RI3A 4QVZA 2RI2A 3FEOA 3LX7A 2X4XA 3O8VA 3OMGA 1XNIA 3MEWA 4II1A 3OYEA 2M16A 5C6SA 4OVAA 3UT1A 1OZ3A 2HQEA 2MWPA 2RHZA 2RJEA 4L59A 5KCOA 2EQKA 3L2UA 2FHDA 5D6YA 4BE2A 4IUPA 4FU6A 1WGSA 3PMIA 3OS2A 4BDYA 4E7LA 4ZTJA 1WJQA 1SSFA 2X4YA 4BD3A 2QQSA 4A4GA 3ME9A 3OYFA 2DIGA 4IURA 4PLLA 2RHXA 3QBYA 3ASKA 3UWNA 4Z02A 4BDZA 5D6WA 1RI0A 4IUVA 5J39A 2RI5A 3QIIA 2GF7A 1WJSA 4A4HA 3FLGA 2RJDA 4FL6A 2XK0A 5KH6A 3GOXA 3BDLA 4GY5A 2X4WA 2RJFA 4E7KA 3L2WA 2B8AA 5KE3A 2P0KA 2K3XA 2EQUA 5FRMA 5IN1A 3S6WA 3L2VA 5FROA 3F70A 3NTHA 4IUTA 2MWOA 3LH0A 1OZ2A 3OMCA 3QKJA 1G5VA 2R5AA 4C5IA 4IUQA 4C5EA 5J26A 3OYGA 3OYMA 2F5KA 3MEUA 5D6XA 4EDUA 3MP1A 3S3MA 2RJCA 3OYLA 3OYHA 3MEAA 3M9QA 2D9TA 4CRIA 3E9FA 2O4XA 3EAEA 3MO8A 3PNWC 4B9WA 3OY9A 4A4EA 2L3RA 2VYTA 3SD4A 4N4IA 2RHIA
chains in the Genus database with same CATH superfamily
3CXCP 1OOTA 4LE9A 1OX9A 2YTXA 2DYIA 1D1IA 3RBBB 4G57A 2JE6I 4DA2A 4DR6L 1WXBA 2ZPHB 2O4XB 4CC7A 1TWBA 2B2TC 3BDCA 3T56B 1SNOA 4AYBG 2EJMA 3RZDH 3Q23A 4BBSG 2DNUA 2FFKB 5M3FG 1UGPB 4HJ7A 2XMFA 1EU4A 2LDMA 1UE6A 4JBJA 2HAXA 4PJJA 1Y1WG 1JQQA 2JOYA 2AK5A 4C3HG 4A3BH 3OS0A 4DV2Q 4FF3A 1A15A 2G9HD 5J3BA 5D3DA 5C4XH 1H641 2UXCQ 4FF1A 3CD6Q 4CDCC 1O9SA 1XJWB 2C0OA 2DIQA 1YJWA 4DBHA 2W10A 4JK1C 4DR7L 4A93B 1A62A 1OO9B 4HMIA 4A3FB 1SROA 4F87A 3I4NH 2JA6B 1YITT 2CDTA 2MO1A 3EHQA 1YNNC 2ECZA 2ZXOA 4EX5A 2CZ7B 4U673 2ES2A 1TWHH 2O5IC 1UGQB 2NVTB 2EYQA 4O0AA 4OWXB 4PL6A 1G6PA 4GBQA 2F0GA 1YI2T 4QY7A 3PO3B 1CZWA 2R58A 5GAHC 1ZLMA 2JM9A 2TMPA 4ATOA 4LUEA 3HFZB 2NUTB 3KJOA 2ZAEA 1VQMT 3C1FA 3I2ZA 3CC4Q 1GUNA 3IL8A 3K8AA 4C0DC 3RMSA 4A3IB 1YJ9A 2E3IA 3QOJA 3PTAA 1A0NB 3HPWA 3CMAT 4QW2A 1KC8C 1GD7A 2WFWA 2XWBB 1MMGA 3E9IA 4C8QF 2NUPB 1YNZA 3DXJC 1JXOA 4A3DG 3FKIH 2L2PA 3PFSA 4DAMA 4EQPA 1IYVA 4AG2C 1Q81R 2RBMA 1VQ9Q 3UDIA 2EYZA 1SSOA 4HIMA 1M1KC 4LD9K 4X62L 1WTQA 3NEMA 2R7ZG 2X4XA 1ENFA 1PH8A 4RKUE 5NUCA 3TS0A 3UT1A 4B3RQ 2LMJA 1IYJB 5I2XA 4JI2L 4NP5A 2RDFA 1HPCA 3U4ZA 3S24A 3UI2A 2K5HA 4GN3B 3S14B 2HKNA 1I4PA 2F0DA 1MV0B 2DA9A 4RFBA 1I8FA 4POFA 4DEYA 1I4RA 2A6HC 5LJ3e 1JORA 1WNLA 4C92C 4DK0A 3ICEA 2DIGA 3R2TA 3ERSX 3A7LA 3SR1A 3OBWA 4D6WA 3EBEA 1QLYA 5GANe 1Q82R 3NBIA 4HVUA 4B08A 2JT4A 2RI5A 1K8MA 2EY5A 1HNZL 3UF4A 3FKIG 3KBXA 3GTLB 4DV4L 4L6TB 3CCEQ 2RJFA 2CUBA 5GAN3 3LWIA 3ZL7C 3CCVT 1F9SA 1GXDC 1WJJA 1SRUA 4XQQA 5JEAH 3S15B 4OXPA 1JB3A 1CSQA 3K6OA 1E7ZA 1WOCA 4LNQA 2K5QA 3A1PA 3PIOA 1SG5A 2PYKA 4X3TA 1L0WA 2YUQA 4R8IA 3E2UA 2SEBD 2SNMA 4KKTA 3QG1A 4IALA 4KKSA 5JPMC 4X3UA 1CT1D 1V1CA 4ESRA 5GJVB 2ED0A 3INZA 2VASA 2RSOA 2KCMA 1LYLA 3MO8A 2A6ED 3RKXA 3WXMB 3DKMA 4A4KA 1EZ6A 1TY0A 4MNOA 5M3MG 1LLRD 4VUBA 3OS2A 1TS5A 4HAEA 2DD5A 5C0XG 2KGTA 3VV0A 3CCSQ 1WTXA 2UXDQ 1B8AA 3BZKA 1K8AC 3CCJT 3K80C 2M2LA 4C2MB 1WQ7A 2GCXA 2E1HA 1S5ED 4CJ1B 4HJ5A 2ED1A 1IBKL 4ZNXA 3KLSX 3JCMW 1QVFP 2EQMA 4N9PA 2RB6A 2FRYA 3CCJQ 1I4GA 2EYJA 3RKWA 5EKLA 1I4HA 4EQOA 4NL3A 1PA6A 3NELA 1VUBA 1KDCA 3GNGA 4Z8AA 1TS2A 1AN8A 1RHPA 3G6JB 1W3SA 1VQLQ 2YT6A 4OP0A 2NVYB 3KDFB 4BBSB 2J6OA 1YJNQ 4N8FA 5JOBA 3UDXA 1G83A 4C3IB 2KOLA 3RD4A 1WHHA 4JYAQ 2J6FA 2WSFE 1FR3A 2PMZE 3ULRB 1FGUA 4MHEA 1K9MC 4Z89A 4B6MA 3H0GG 3V2TA 2VXWA 1BYMA 2X6LA 3CHBD 3GNFB 1FMVA 2EJFC 2KBNA 1K8OA 3OYYA 3VKIA 5EG2A 1CQVA 2QKIC 2H8HA 1XNQL 1EIGA 2AHOB 2KROA 3D4RA 1IXRA 1UEBA 2HSEB 4D8DA 3KYHC 3VYSA 2E2JB 3OIQA 2RA2A 3CPWP 3REBB 3CCET 1LABA 2BCOA 1JWMD 4C92F 1IBKQ 5GAMe 2R3ZA 5GANh 2AKKA 1PZJD 5ELNA 1M90R 4JI4Q 4LF6Q 2XU8A 4JRIA 2K32A 3DWAA 3MCAB 5GROA 3EA6A 4RTZA 2YSQA 3LYIA 4MZTA 3CCLT 3J7AV 2NUTA 2R7FA 1SLJA 4ZUIA 3RLFA 1ZHIA 1JOQA 5AT1B 3VS4A 4QVZA 2FEIA 1WXUA 2O9VA 4DV5Q 2KR3A 3CC7A 3UPUA 3NPPA 1U4RA 3PO3H 1ZUKA 2VUMH 1OX8A 3QHSA 4XT3B 2V4DA 1XNIA 2COWA 2PTKA 1J9OA 1SE4A 4H02A 3R93A 2RQTA 4FW2A 2RHZA 5LMNW 5KCOA 3S1RH 1VQ8A 1TS3A 2NB0A 3G48A 4JW0A 1XMQL 2Z6BA 1WTRA 1LV9A 2K4YA 5IT9L 1Q82U 1TWGB 1BBWA 2E12A 2B3GA 2EQSA 2PW5A 2ZTDA 4F14A 4J9BA 3NENA 1X69A 2QQSA 3KBGA 3ME9A 5KYUA 3R2IA 1FL0A 3CMAQ 2MFIA 3I4LA 4PNYA 1HCZA 5EKKA 3NWSA 4KJOA 1I6VC 4A3GG 4A4HA 3FLGA 1QUQB 2A68C 4P5NA 5IYCG 2X4WA 1CUKA 2RNAA 5LJ5g 3H0HA 1YI2Q 1EY8A 3CBOA 5JJZA 4OMPA 4QKUA 4JS4A 4R0KA 4HSVA 4MZ9A 5CR3A 1AVZC 1JU5C 3LW5E 4FDBA 4KD3A 3K5NA 3DEPA 1N8RR 1FJGL 2DEQA 5IYBH 5M5YH 1FX7A 2F1LA 2XI9A 2JSOA 3K5OA 1N32L 5D6XA 2PU9B 2J05A 3HOVB 1LT5D 2LC4A 2K5NA 3OYHA 1TUDA 4K8JA 4C56C 3E9FA 4M75F 1BCPF 1SNMA 5IXBA 1E24A 1Y07A 2DL3A 3OBYA 2A1AA 3QWNA 1WPYA 1MSHA 1TWAB 4XYQA 4BBRG 2EGEA 3FJ5A 1Q7YC 1YNJC 3Q1JA 1QZHA 3EHRA 1LNXA 3M0TA 4PJOA 3F2UA 2RD1A 2BKDN 5BR8L 4C3HB 2LT4A 4L6V5 1X6GA 1SEMA 1KHCA 5GMKh 4NXMQ 4JRPA 2QGQA 2B2TA 4ODGA 1STHA 2GFAA 3OW2S 1Q3LA 2MPMA 1T0JA 3L7ZC 4TVAB 2CHBD 1VF7A 1CKAA 2VQFL 1O7LA 3OS1A 4POGA 1AEYA 1NMGA 1H9RA 5LL6S 2WAQE 3DM3A 4F88A 1K73R 3HOUG 4HKEA 1PKSA 2LNVA 3CEYA 3QYGB 3CCST 2F3IA 2L5TA 4GZYC 3FRNA 2KI7A 4GLAC 2KY9A 3K0XA 5I2MA 3CQTA 1Z9ZA 4LUOA 1I5OB 4UP8A 3D31A 2DL7A 2LS01 4J8QA 3HFNA 2XIDA 3NMZC 2NWGA 4M7DE 1HTPA 3HOWB 1C4QA 3ND9A 1I6HH 4A3MB 2DTOA 2DUDA 3KJPA 2NN6H 3QR8A 3I91A 2DYBA 4HJ9A 1G8XA 1WTWA 4NXML 3M0QA 2SNSA 2K4KA 2VXFA 1JBMA 1YWOA 3CBPA 4XK8E 2QEXQ 1YJ9T 4DNTB 2KEDA 1B34A 3QOLA 4QCLA 2L4NA 1W2BP 4JJBA 2A6EC 4RCBA 1U06A 1HTLD 1RAIB 1XXGA 2LFNA 2I0QA 1E1OA 3E19A 4PZ7A 2K6DA 3CCVQ 3GTQH 1WTHA 3FC3A 4DA4A 1RAGB 1K8GA 4M77E 5GAOq 1WDXA 4A3JG 5CKHA 1SYGA 3GTPH 2JZ2A 4J9CA 1QVCA 2P0PA 3AYHB 3QPHA 1J3TA 3QJYA 4PJLA 1GXIE 1IBML 1WIEA 2COYA 2VUMG 4M7DG 1ZA2B 4F7XA 1ZKOA 2KVMA 1EYAA 1EYCA 3FDTA 1JR0D 3KOJA 4RHSA 1VA7A 4OVAA 2LCLA 3GV6A 3AFQA 1OZ3A 3CPWA 3U4VA 4BBRB 3CCRT 3NBHA 5CK9A 4MTKA 4RKBA 2NWMA 1VYVA 4IUPA 1GBRA 3CPWS 4NL2A 1R9TH 3GP7A 5EPLA 2X4YA 1Q90A 1B9MA 4BD3A 2WAQG 4C92D 1AWWA 4LUZA 1I6HB 1XYIA 3U23A 4BXXH 2YDLA 1ZSZC 2K57A 3FP9A 1O7YA 1PV4A 4IUVA 3RN5A 1K3RA 1R8OB 1QNKA 1D3BA 2F0IA 5L37A 1A63A 1TU0B 1KXLA 2OAUA 2XK0A 4OWWB 5KYUB 4DR3Q 1WXTA 1PMRA 1DYQA 1TUGB 3CC4T 3GLXA 2ZJPA 1VQMQ 4GN4B 4HR7B 1UE9A 2CSQA 1JEGA 3NSWA 2GTJA 3LWEA 3F70A 1QVFA 3SWNB 4UY8C 3VR6A 5HKCA 1UEAB 1C7YA 1IBLL 4FYWB 1AZEA 1KQSP 2DTHA 4A3JB 3K58A 3HKZB 5JJLA 1CKNB 1YITQ 3KLWA 2MGSA 5GAOl 1IL8A 1EIYB 3HKZE 4KBMB 3SD4A 1G51A 3BVZA 4IUNA 5CBEE 4HVVA 2PI2E 3RZOB 2CQAA 3V7CA 1IHWA 1DOMA 1EEID 5D65A 3J81j 1BNZA 5M3FB 2IG0A 2KRMA 1XNRL 5C5MA 2B8FA 1WLPB 2M0OA 1YNND 1OPKA 1PH6A 5ELEA 4FCYA 1RABB 1S4ZA 2QEJC 3PT9A 3V96A 5TSSA 2NVXB 1PFNA 5M3MH 5H1SE 1M27C 1H95A 1X01A 2LTOA 4ME3A 1VOMA 3MFYA 3TZDA 1K0RA 1X75C 2A5HA 1B3QA 1JOKA 4JI1L 5KNDA 2FO0A 4A3BB 5DAUA 3N5BB 1TY2A 3SHLA 2OQKA 5BN5A 4C8QB 4KK7A 1G3YA 3PVQA 3OWFA 1KD1C 3LWHA 2P5ZX 4ZK9B 1Q86U 3H6ZA 2DK3A 3PO2G 1VQKA 3LH5A 4MDWA 3K59A 5CKFA 3DLLA 5LJ5f 2PO4A 2ZGWA 1UFFA 4I65A 2NVQH 1A3TA 3DWQA 2QXFA 1QW1A 2R92H 2L89A 1TH7A 1SRMA 1SNDA 1UJYA 2ZTCA 1E6HA 4K2KA 2HIXA 2EAYA 1B1ZA 1TUCA 3VU3C 2FYKA 3T9NA 4XQJA 2EKOA 3BYYB 1BIBA 2KXDA 1H8KA 2I0NA 2R5MA 1VQNQ 5FW9A 4K2LA 4BS9A 1B34B 1RUWA 3QZ5B 2ZPGB 2AKWB 5CV4A 1HR0L 3M57A 1I3QH 1T3LA 1SJHD 4A3GH 4O5VA 5FJ8H 1PLFA 1IXDA 4TVRA 3EGXB 4M78C 4M78A 2IWHA 2O88A 3TCJA 3J81E 1K4US 4H13C 2LQ8A 2DZ9A 1NSNS 2Q2HA 4AFSC 2F1MA 2UXBL 1MD2D 3MVVA 4DGZA 1OV3A 3D3RA 3IAYA 2MP1A 4GKJQ 2QQ9A 4GNXB 4BE2A 1G2TA 3CCQQ 3IFDA 2D5DA 5E4WC 1X6OA 1PVOA 2F0EA 3T13A 5LJ3d 4M7AG 1SSFA 2ALYB 4X3KA 4LUDA 3CCEA 1PSFA 4DR4L 3FHWA 2CQOA 2EVBA 1ARKA 1K0SA 4LF9Q 5CQXA 4BY7H 2L3PA 2RHXA 5CV8A 1JOOA 4ANJA 1U4PA 3BG3A 2JVVA 2GF7A 2LQNA 2HBPA 2K7AA 2MK5A 5KH6A 1VIEA 4GY5A 3CCLA 4HIDA 1SMYD 1Y7XA 3L2WA 3VJPA 2JQOA 1PM3A 3RMQA 1BK2A 1EQRA 1CZGA 4KLKA 4ZQ3A 2ATWA 5KYXB 3AU7A 4H44C 5L8RE 4DXFA 1RI9A 4FXKC 4B3SQ 2MUYA 1PTOF 3CCSA 2K1BA 4QIWE 3FB9A 4AFUC 2A3LA 2PZWA 5I2SA 4EDUA 5GAN8 1Q1EA 2X51A 3GQBA 4FNFA 3W5OA 4APVA 2E2HB 2RJCA 4ZGEB 3FEWX 2LZ6B 1B7YB 3PNWC 3CCJA 1EY4A 3U9OA 1HXDA 2F0LA 2KK4A 2EPBA 3G7LA 1YP5A 4N4HA 4M1UB 3C94A 1JJGA 2KE9A 1Q7YR 3RNUA 4M7DF 1ZQ1A 3AQQA 2DXCA 4HA8A 3L0OA 2Z6KC 3J81i 1BU1A 5DY9A 2R92G 2WV6D 3NTIA 4BY1H 1HNWL 1NJIU 1B9NA 2XDPA 5IWAQ 4A3FG 1C48A 1M3AA 1E2ZA 3EFOA 2E10A 4PV1C 4NB3A 3TQ7P 4WRDA 4LDYA 2DNEA 1Y96B 5IE8A 2QF7A 4M8AA 1SF9A 3P8DA 2DY8A 1NJIC 4F17A 2AUKA 1H3ZA 3SK4A 2JN0A 2NUZA 4XTVA 1RAHB 2EY2A 4OMNA 1V1PA 1TXYA 1XPRA 4FIBA 1B3AA 1N33Q 4DK3C 3J7AF 1X3PA 2VB2X 3P20A 1Y1VG 4AFZC 3J7ZC 2F4VL 2P4TA 1Q12A 4CKCA 2EYFA 4LFAQ 3S14H 1AWXA 4OHJA 1WA7A 1Y69U 4A3DB 5LJ5e 3JAML 3M54A 3X26B 4AG1C 1Y1VB 3ZEHA 3HOZH 4BWGB 2DKGA 1UECA 4O1NA 3C4SA 2ZPEB 4U68A 3OSVA 1G3WA 5C3EG 3HOVH 1IGQA 2EWNA 3PF4A 2B2YA 1VQPT 4PJOC 4IZ8A 1L0XB 2YTYA 1MNDA 1NYGA 3BU2A 1SRLA 3OQ5A 2QTVA 4PJOE 5KYWB 5G3LF 3LX7A 3WDNA 4EIKA 4XU3A 2XN9C 2LP5A 1IREB 2EGCA 2HQEA 3V7RA 4OMMA 5GAN7 4HCEA 4LFAL 1SNCA 1VQBA 2WB1G 4CC2A 2CW0C 4C92A 3OW2A 3A5UA 2F4VQ 1EWCA 2WKDA 1C0MA 1WJQA 1F9PA 4R4QA 2M02A 4A3CG 1N32Q 1QUQA 1LCKA 3G6EQ 4Y52H 3I5RA 8AT1B 4GS3A 2KJXA 4KD4A 1RAAB 4ZYSA 4GNXC 1TWCB 2K75A 3S2HB 4A3EH 1MMDA 2XKOC 5GAOn 2OTLA 4PJNA 4ZUJA 1NR4A 5BR8Q 4A93H 1PD0A 4XTUA 1VMPA 2B2VA 2PUKB 4F7UB 3SK5A 2QILA 3JSCA 3EFSA 3RKYA 2J4XA 1K9MR 3CAMA 1E2WA 1S5BD 1V8QA 2I5MX 4C3HH 4A3BG 1DONA 5IGDA 2UXBQ 2OCEA 2LY7A 4PJMA 4CJ0B 3PIP3 4R4TA 3H3VI 3HOYH 1YIJQ 2KQWA 1YVCA 4IUQA 1YJWQ 2HL3A 5J26A 1F9QA 3NE5B 3GTMH 4JV5Q 5CC4A 1YWPA 1EY7A 2DD4A 2AQ1B 3M5AA 2IJ0A 2CFMA 1MIUA 4E2FB 4PJOB 2K5FA 1TIID 1U0LA 3GPLA 2F0FA 4YWMA 4JRQA 2PZUA 4JI5Q 4A4EA 2RK1A 2KA7A 2SDFA 4C0ZA 5GANd 3OHXC 5LMUL 1PKTA 1M9SA 3VYGA 3E9HA 1AOJA 3CKIB 1U4LA 4V0BA 3EG2A 4QVDA 2E2DC 3TSZA 1PXUA 1NJIR 1NNXA 2HSPA 4KT0E 5E3FA 2F2VA 1WHLA 1NE8A 1I0CA 2PVDB 3P75A 2SOBA 2QQAA 4WTOB 2ZPBB 1U9RA 1KIXA 1JMCA 1PTOB 3G71A 1VQ6T 5FO7B 2AWNA 1FGBD 5FWBA 1M8AA 5CIUA 5EJWA 2Q2UA 4M7AD 1CM9A 3PQIA 2CP3A 2QYZA 3WVDB 1LTID 1PYBA 2F0PA 3KF6B 5JVH3 4BBSH 1VQ4Q 3TEHB 3MEVA 4EPCA 3D4WA 2B86A 3EJIA 4QVCA 4J7FA 1N9SA 1LT6D 3J7A5 4JPBW 1G2BA 1PRMC 1VQDA 3TN2A 3H0GH 3GBQA 4C5HA 1N27A 2YRCA 2PUOB 1YHQQ 4M77F 2ICIA 2NVYH 4QL5A 4RAUC 5GAGC 3NQTA 4DR3L 4RCCA 4DR5Q 1S1NA 3LGLA 4BI3A 4F04B 3CC2Q 2HDLA 4IFDI 2J0TD 3M4PA 3H3VH 5CV5A 5EQ0A 2V1QA 1ZYRC 1X6BA 1BBUA 5FLXc 4LFBQ 4M7DD 2RN8A 4XU0A 3MP6A 3KFVA 1XTDA 1K83H 1PZID 2JK8A 1VQ5T 3HGBA 1QCNA 4JJDA 3L2RA 1DOKA 2OTJA 2WACA 1S5FD 3LNNA 4DUZQ 3PO2B 2RF4A 2L11A 1SAPA 4X9DA 1F2ZA 5KNCA 5C3EH 2JA8B 1I50B 1M1GA 1K9AA 2CH4A 1P92A 2N49A 3Q8DA 2EYPA 1UUPA 3H91A 2B63H 4M7DB 2MQHA 3NHHA 4HCZA 5ELOA 2O5JC 1D5XC 1GFCA 4QJFA 3NBHB 3W2DA 2HD0A 3G7ZA 1DJ7B 3FEOA 3UATA 2HZYA 1VQCA 3TMEA 2E2JH 1QCFA 4M75E 3HOUB 4II1A 3CC2A 1GFDA 2IX0A 2ZTEA 2O2OA 4NXNL 4X64L 5A35A 1PZKD 1M90U 1Y1VH 4L63B 1IL2A 4BA2I 3M0PA 1A6XA 1I5LA 2CP5A 3OW7A 2JTMA 1IW7C 5T1IA 3NPFA 2YU9H 1QKWA 3W3AA 2ZJRA 2F0TA 1N5ZA 2QDYB 3VUZA 3ZFJA 4YCUA 1EX4A 3JCMX 1BI2A 5EGTA 4ILWA 4O2DA 2XTIA 3HOXB 1BXTA 3M0SA 1XWEA 2BZYA 2QASA 4Y92A 2A36A 4C92B 4F7UF 5D6WA 3CC4A 5E7NA 2JMCA 3IFTA 2JA7H 4FF4A 1NYFA 3VS6A 2MOXA 1VQOA 1ZSGA 3SWNA 4C92E 2VL6A 4BY7B 2E70A 4DV5L 2A28A 3X3MA 2PQAA 2FL7A 3HRTA 4OB3B 1FYNA 2HHHL 2DN8A 3CCQA 1M8VA 2VS1A 1CKNA 4N9TA 3LH0A 1G5VA 3HP3A 4OB2B 3RDVA 5FLXE 5LJ3g 2IL8A 3MEFA 1IZ6A 1GCQA 3EG3A 3CMET 1A8VA 1MJEA 1NUCA 1JE4A 5JPNC 2E5LQ 4FXGC 3GTJH 3D4DA 1AH9A 3BVGA 2R61A 1WX6A 1QILA 2CUDA 2L3RA 4FSSA 2XD0A 1BI1A 4ZGDB 2EOTA 2B63G 1QVGA 3LX0A 1O7IA 1TSFA 1EEFD 2RHYA 1HQMC 3PUVA 1F2YA 1I94L 1N8RU 3LGFA 1AHJB 1ET6A 4A3IH 3GTQB 3JRZA 1BI3A 2E2IH 2WSEE 3SDZA 2XVSA 1SYBA 1R77A 2KYMA 1KRSA 5GAN6 1IB8A 2QQRA 1MNEA 4FYVB 2KRNA 5GAOr 2RK2A 1D0ZA 2VUBA 5DLOA 3QB3A 1GUOA 3ZBDA 2E5LL 4C92G 2D0PA 4TKOB 5LMUQ 4L5TA 1WCMB 3JCMP 3Q24A 2HIVA 5CYUA 1WTPA 1IGUA 1HH2P 1Z9QA 4LXCA 1KLUD 1C8CA 3LGJA 2I2LA 2YUOA 3WWVA 2QI2A 1SYEA 5ELDA 3CF5A 3I4NG 5C4XB 4O6JA 4L5SA 1VQ8T 3IRBA 2OEOA 1MMNA 2JW4A 2NLUA 4A3IG 1AW7A 4MZPA 1WD1A 3PIO3 3VRYA 3OA6A 1BO0A 4ORZA 3ULLA 2RQVA 2CP7A 2OX7A 5K36H 1G6ZA 4R55A 4LF9L 5IHIA 2D8HA 1SXTA 4EQNA 1NBEB 1K8AR 3T4AC 1T5XD 4FSXA 4EQ5A 1D6EC 1B2TA 1EIFA 2BE7D 2JA8H 5M3FH 1DXMA 1GCPA 2E6NA 4HN7A 3T53B 1TWAH 3E0EA 5C6AA 2FG0A 1YZ6A 4UPAA 2PCFB 3BDOA 1CHPD 2RI3A 1KAAA 2GVAA 4M77B 4ALPA 2DM1A 2Z8LA 3Q0AA 1IYUA 2HDMA 1VQ5Q 2KCNA 4J6YA 1VQAA 2K03A 5I2YA 1WI5A 3CBMA 1RLQC 2PZTA 4RTTA 1VDZA 1QCBD 5CKBA 3R6OA 3X25B 2E5KA 3OSSC 3JCMb 4KMUC 4WORA 4BDYA 3PMIA 5CVIA 3CC2T 3MXNA 2EXZA 2EYOA 3RLOA 3KLRA 5EC7A 1HFNA 8ATCB 2JXBA 3EG0A 1HA6A 4FM4B 2E4HA 1TWCH 3CP0A 3UE1A 4A4GA 3WOFA 4AYBB 5ECAA 1WCMH 4DUZL 2NN6G 4G7ZC 2JXMB 1VS0A 3A7AB 2UUBQ 4LF5L 3ASKA 3C1EA 1JQYD 4BDZA 3HS0C 1Q82C 5FU7B 1WHGA 3LWUA 4UHVA 3J80L 1VQ4T 5GMKi 1NM7A 3S2HH 1BBZA 2CZ6B 2FINB 1KHIA 4GN5A 3STBD 4M78F 3E0JA 4NOYA 3CCRQ 4A3CH 1D5ZC 4J9DA 4J9IA 4XYOA 4RA8A 1PTOC 5JJIA 5FROA 2Z0WA 5IT9c 1CK1A 2OXPA 1IHZA 4DV6Q 2PVOB 4IUTA 4XQ3A 3L1AA 1MHWC 1D1AA 3K7AH 3V8LA 3CCMA 1F9RA 2VQEQ 3JCMh 3U9SA 4F7UG 1UE7A 2D9UA 4DR1L 3QYHB 1PFSA 3M0UA 3A5ZB 2PQAB 3I7FA 2M0YA 3BJUA 2W0ZA 3MP1A 2QW7A 1QWFA 5FLMG 2E3HA 4DV3Q 4RTYA 4LDXA 3GTJB 1N8RC 2F5TX 3M9QA 3ER0A 3EAEA 3OY9A 1KQ2A 2WKCA 2C06A 3AB9A 3HOZB 1N33L 1H9MA 4XTWA 1DM0B 3THKA 2DL8A 2K9GA 4JI0L 2O2LD 2O31A 3M59A 1JJ2A 2C35B 3J81L 4R8NA 1M4ZA 3MJXA 2LX7A 4DAYA 4N0AA 4I7ZC 2QEXT 3FVQA 4OO1G 2A0FB 1HA5A 4XTCS 3A74A 4A3KB 1YIJT 2ASBA 2KT1A 5E1FA 2GBQA 2DBMA 1R0CB 2HDAA 3CCVA 3I72A 3F2BA 2GFUA 2NTTA 2COZA 3VYUA 3P7JA 2KHSA 2Z9HA 2YWWA 1IBLQ 3SWNC 4HXJA 4A3EB 4ULLA 3JCMe 1I4XA 4KH1B 3G4SQ 3UA7A 1PTOD 2NZHA 2HQHA 2L0AA 1YITA 1LTAD 2EW3A 2YUNA 1Y0MA 1ZSZA 2EFIA 4IUUA 1UTIA 4V2SA 4G4KA 4K11A 3HOWG 3STBC 2D0NA 3SB2A 1JRIA 3TRZA 5C0XI 3H94A 2RH2A 4DV3L 4DR5L 1RAEB 4B3TQ 3WVEB 4IPHA 3FDRA 4KUIA 1V1QA 1D0XA 2FZKB 4OEMB 2GQVA 2DTIA 1N9RA 2B29A 1HQRD 3L42A 4B3SL 3A0JA 4XAXB 1J8IA 3K5MA 4S3SA 2DXUA 1BOSA 4DV1L 1KQ1A 1K8AU 5FRNA 4OX9Q 5GAMg 3I55Q 1M8MA 3I56Q 3SK6A 1PDQA 4B3ML 1PFBA 1LO5D 4X64Q 1H9KA 2FPEA 1PYSB 1GCQC 4IIOA 2BZXA 1M90C 5ELFA 1D2BA 4A3MG 2K04A 2KHJA 2DLPA 4OL7A 2E5QA 5KYWA 5IP7G 1VQ4A 1TQOA 1LVKA 4M75A 3UA6A 3AEVA 4OF1A 4QIWB 5J1ZA 1C6VX 2YHTA 4HT8A 5K5PA 3N52A 2FRWA 5IGCA 3L9AX 2R93G 1OQKA 4OGQC 1ABQA 4N8X1 4NDXA 1O80A 1CKBA 2G6FX 4LFCL 4DBRA 2F0WA 2IPKD 1NE3A 3NHNA 2F69A 3ZJYC 3HRUA 3OMGA 3RN2A 2E2HH 5IWAL 1UG1A 4YHHL 4AQYQ 4OMFB 1ESFA 2MWPA 2RJEA 2VC8A 3MTSA 4CDFC 5C5LA 3HOWH 5GMKm 4PJOD 1XQHA 3VS5A 2JN4A 1SJED 1T9HA 1X43A 1U8RA 2GN5A 4K5XA 3VYRA 5JJKA 3PE0A 5T1GA 1GM5A 1TWHB 2NZ1D 2TSSA 2B2UA 1XPOA 3CQZH 3SEMA 4BY6C 5ISRA 1D0YA 3F2CA 2Z0SA 3AT1B 4X65Q 3K5LA 4DR2L 4PNOA 4RH6A 3EROA 1NBWA 3RERA 2A08A 5GAN5 4ELYC 1E3PA 3CW2C 5DM63 2UU9L 4WF2A 1YIJA 4LFCQ 1TTHB 3Q22A 4JBMA 2Z4HA 1LACA 2DBKA 1QQJA 1QVGP 1HHVA 2EQUA 4P75A 1FD7D 4JI8Q 1M1KU 2L5QA 3S1MH 4ZRZA 1D3BB 3D6WA 2K5DA 3QKJA 3W1BA 3HHTB 3VS7A 3JB9F 1JICA 2BA1A 2AT1B 4R9WA 1WD0A 1HNXQ 2A69D 2KENA 4X1VA 1STYA 4LNPA 4A3KH 4JJNK 3EVQA 1E2VA 1UE5A 2IHFA 3MEAA 2J7ZA 2Z1CA 3CMEA 1U5SA 2CH4W 3JCMf 3EFRA 1I3QB 1BQQT 2PW7A 4ZN1A 1VQKT 5JEAJ 4QT7A 2VVKA 4Q0FA 1CKMA 1T3SA 2AUJD 3T1HQ 1F2LA 2NBFA 2NYZD 1TG0A 3BVMA 4PG3A 4ZCKA 2VQEL 2XGTA 1QMCA 3FPPA 3M3YB 5GMKl 4DAVA 3A8KE 2LCCA 4N0AC 1HRJA 4YY3Q 4JI1Q 4DAYB 5IYCH 2AHJB 2ENMA 2GQIA 4LD6A 2Z4IA 3S3NA 3GTOB 1RLPC 5FU6B 3PF5A 1X2QA 2RO0A 4JI0Q 3EH2A 1O75A 4KY6A 1EQQA 4JI6Q 1D1CA 2A69C 5COYA 2FPDA 4M7AB 3E9GA 4RG2A 1VQLT 2CP0A 1MHNA 2HBWA 2K05A 1K1ZA 1XMOL 1KTKA 1H3HA 1OI1A 5GAMf 4M7AE 1PTOH 1X3QA 2MO0A 4CJ2C 1K0XA 3L2QA 3CQZB 4B9XA 2HL5C 2IY5B 1CQFA 2XIWA 1ZA1B 2LQWA 3JB9J 2CKKA 4JI7Q 1TWGH 1OPLA 1Y8NB 3NK9A 4C8QA 1QWEA 2DL5A 3KUFA 5F2DA 5BN4A 1B44D 1JWUD 1ZXTA 1SPKA 1F77A 4OMQA 4C5GA 4ZKCB 3D0FA 1V76A 4C1NK 5EBDA 4RCOA 4ELZC 2BZ8A 4RGNA 4C2MH 4K0KQ 3CD6A 4A3KG 3PMFA 4DQ2A 1MGSA 2CCZA 3H8ZA 2EYYA 2O01E 1HJDA 2D62A 3A54A 3H09A 3VRZA 1YHAA 4A3DH 5EPKA 3CCRA 1J6QA 3F8TA 1SYFA 3CXCA 3UDFA 2IX3A 2LJ1A 2LX9A 1ZBXA 1LOJA 4A4IA 2M16A 1K3BC 6AT1B 3CCUA 2DEUA 3TP5A 4C3JH 2IVWA 2OI3A 3I70A 4JBKA 1L0YB 2QA4A 1V1OA 2CP6A 2KNBB 4OB0B 1OXTA 2I5HA 4KV6A 4LF5Q 1WGSA 2Y0SG 2VZAA 5FO8B 3JCMV 5LJ5d 4M75D 1BCPD 3X20B 4R56A 5IODA 2LJ3A 5LMNL 4DU9A 1QOHA 1YBYA 2IIMA 1X32A 1GUSA 3VR4A 2EGAA 1ZX6A 2WB1B 1PRTC 4DK1A 1TS9A 1M5Q1 3GTPB 4GKKQ 3QIIA 2JA7B 1K28A 1M1KR 4LAAA 3RMHA 4XXEA 1VQ7T 1FNVA 2KT8A 5L23A 1LTSD 2E2IB 2DE0X 3CC7T 1NY4A 1JXMA 2RVLA 3OMCA 3M9BA 1HSQA 1QJOA 2F3VA 4YIJA 3SE0A 3NXWA 4C5IA 3SGIA 4CHTB 1EZZB 1II3A 4WJWA 1Q95G 4PJOF 5ELBA 5IP7H 2VWFA 2L12A 2DGYA 3TP8A 2AZVA 2D9TA 3UDGA 1EFID 4MDXA 4A3JH 4LDUA 4PK4A 1QZGA 3M85A 1HK9A 1STEA 1J5EQ 3QWYA 2DJZA 1KK7A 1K83B 4JDSA 4E6RA 2DO3A 4BI8B 2FZCB 3HOYG 2YTVA 1OU9A 3VA7A 2RHQB 2RSNA 1QCOA 3M53A 1HNWQ 2EYHA 3PO2H 3EQLC 2EIFA 2DRMA 2HMAA 1VQIA 5IYDG 4RHRA 1RL2A 1GUTA 1HNXL 2G3RA 4Y7NB 3I55A 1C1AA 2H1EA 1R4QB 4QUCA 2JS2A 2F3WA 1HFGA 4HJ8A 4PLIA 2E8GA 5C4JB 4DNRB 2R57A 1HZ9A 3CCMT 1SDFA 3KXTA 2MMPA 4UC4A 4KGZB 1EWHA 2LXJA 2OT2A 1NTGA 1GL5A 4DUYL 2Y90A 2QQBA 3AFPA 2HQXA 4YCWA 3I4NB 2RDHA 3TS2A 1YHBA 3T1HL 4PFZA 4C0GA 2DERA 1D1KA 1SHFA 1HJPA 3A8JE 2UUCQ 3M4OH 3VYHB 3PUWA 2E64A 3S3OA 1DGSA 3PMTA 1YN8A 3CC7Q 7AT1B 1F2MA 3EG1A 4DEXA 1UAPA 4E6IA 1AZPA 1Z9FA 2AZSA 4UP9A 5D3IB 4FYDA 4A63B 4ABNA 2EQJA 1UNSA 1VQ7Q 1KLGD 2XRSD 3M7NA 4YHHQ 2K33A 3G71Q 4AQYL 2UUBL 2M9VA 3MP8A 3S16H 2QGGA 2K28A 2OTLQ 4DV4Q 2CSIA 3RZDB 5HGQA 2DXBA 3EGDB 4CI0C 1VQEA 3BE3A 4M77G 1KC8R 1WFWA 1STGA 2A73B 3QDRB 2BE5C 2L1BA 3HEJA 4OIJA 4JI2Q 2E41A 4FYXB 2XSCA 3OYDA 3OYKA 1JJ2S 3MFGA 3K7AB 1WHJA 5FU7C 4K8IA 3TBIB 1D5MC 5C3WA 2R92B 3JAME 1JJCB 1EWIA 1Y1WB 2DJGC 3REAB 4LW1A 2UU9Q 1SSHA 3DUZA 1PH1A 2RDGA 3GF5A 4OB1B 1Q81U 1WVLA 1JO8A 1YJ9Q 2FHDA 2I46A 5CV7A 3RESA 4HEDA 1STNA 4K0KL 1U4MA 1PG5B 2VY3A 3NWTA 4WFN3 1SFOB 2NVTH 1B07A 5GAMh 1N36Q 1PD1A 2EKHA 4X3SA 2OTJQ 1ILQA 4KHPL 4GOPC 1V43A 1NZ9A 2D0OA 1Q86C 5IP9H 5C4XG 2K50A 4XTYA 4DV0Q 4A75A 2J6KA 5CKDA 1KD1U 4M77C 4OMOA 2IT1A 3GTOH 4IFDJ 3J80c 3E6ZX 2BTTA 2M51A 1KFZA 3ULPA 1H9SB 3R8BA 3L2PA 2V1RA 2X4JA 2N3SA 4JZ4A 5HK3A 1OULA 1RJTA 2L3QA 1WI7A 4E7KA 1G2SA 3S1RB 2OTLT 4DR7Q 2HD3A 5KGUA 3G71T 1VQ6A 5IN1A 2H3EB 2NN6I 5M5XH 2EJFA 1X55A 4M4ZA 2OQ0A 2FPFA 1RDPD 3E5SA 5AJ3Q 3DMUA 1UGSB 1W1FA 2KSSA 4DF7A 1KL9A 2EYXA 2Q8IB 4LF7Q 1NLPC 4AH6A 3H15A 2MIOA 4CRIA 5CMDA 3T1YL 4V190 1GOZA 1A3VA 1W4SA 3OSOA 4P2CB 4L8JA 2DX1A 1TU2B 1DOLA 5K36G 4RCNA 1DCZA 3A98A 3C12A 1W6KA 2ZXRA 4DV1Q 3MHBA 2JA5H 4E7IA 3TP7A 4XT1B 3G1JA 1X2KA 1BF4A 3CCMQ 4ID6A 1QVFS 1MGQA 4K5WA 2XDBA 1PWTA 4C8QE 1RIPA 2CWPA 4BACA 2EYLA 1LTRD 3HTRA 3M4QA 1QKXA 2YRVA 3DB4A 1M3BA 1W6XA 2OJ2A 3H9NA 2B39A 4A3EG 5FOBB 2FVUA 4HCSA 2J06A 2CP2A 5DM73 1VQKQ 3META 2JYOA 3QIAA 4MZMA 1I4QA 1GUWA 2BIVA 4ZTFA 3OIPA 1XMOQ 2E75C 3OW2P 1FXXA 2AKLA 1ABOA 1UDLA 5I11A 3O13A 1ASZA 4BY7G 4EMKA 2A19A 4GLKA 1KSWA 1Q86R 2HHHQ 2GNCA 4CDDC 3S1NB 5C3XA 2ATCB 3QO2A 1UHCA 4C3JG 1C9OA 2K3YA 1M2VA 1Z7TA 2B2UC 3KF8A 2FXQA 2H5XA 4K14A 3J80i 3J80E 1XX8A 2MF2A 3LLRA 5AYFA 3A56A 2EBPA 5IHNA 3HG9A 3V8KA 2EY1A 3UDCA 1RACB 3KF6A 3VYTA 4LFBL 2F0UA 4A3LH 4BE0A 4QB4A 3ZYYX 4BA1I 1M30A 1YEZA 1O78A 1WJRA 1JB0E 3EIVA 3OYAA 2ENBA 5IIFA 2O9SA 2QK0A 2BA0A 1K73C 1STBA 2JA7G 2Q2TA 3M55A 4BBRH 1GRIA 1SHGA 5GMKe 4M78E 3R3OA 4A54A 1PC0A 5HY6A 5FJ8G 4ZAIA 4OELB 3E3XA 2JEAI 1TWFH 4KN7C 3RIRA 2DILA 3OYBA 3QSUA 3QUIA 1VQOT 2BDOA 4LDWA 2LQKA 1KIKA 1CKOA 4DBFA 3CCLQ 1E22A 1RKNA 4NXNQ 1AFPA 4E7SA 4KHZA 5M5WH 4GLMA 3EGDA 2CZ1B 1FVIA 5IGBA 1VIFA 5LJ5h 4MN3A 3OYEA 2K2MA 3KK7A 4QQBX 5C6SA 1ESRA 1WCMG 3MZ5A 2EQKA 2PVGB 4MIUA 5LMNQ 5D6YA 2VGNA 4XTXA 2RF0A 3PCOB 2K01A 1YHQA 2X6GA 5DLQE 1CTMA 1RTNA 3VS1A 3GD7A 4C3IG 1A2UA 5JEAG 3A8LB 2B2YC 2RHSB 2DMOA 4R4CA 5FK9C 3S2DB 2EJ9A 1X56A 4UAIA 4B3RL 2KCTA 1S40A 2YLCA 2JJ9A 5FO9B 4DBQA 2VB6A 5I21A 1KRTA 4JC0A 1WQWA 4DFAA 2ZM6Q 1YJNT 4O42A 5GAN2 5KYXA 1SR3A 4MTNA 3HOXG 3I56T 1KNAA 1VQPA 3I55T 5C44G 3H41A 4FF2A 2P0KA 2K3XA 2FHTA 2JA8G 1HYOA 2MCNA 2KBTA 1KQSS 4HT9A 3F2DA 1MJCA 1YCSB 1PNJA 1AWOA 2JA5B 4A3GB 4L5GA 4AIMA 3FKIB 5A2QL 1PH3A 1Y57A 1KQSA 1LT3D 2B2WC 4ZKBB 4KULA 4KHVA 3S3MA 4Y91A 3OYLA 2VGMA 1I94Q 1CSPA 3D8GA 4G7HC 2O4XA 2GA4B 3PUZA 4JI6L 1Q7YU 1ICWA 1E1TA 1LJOA 4JI4L 2JA5G 1N34Q 3QZ9B 4UP7A 3WOEA 1EQTA 3QJ6A 2CT3A 4JI7L 4BE1A 1WZOA 2YXYA 5C3EB 1DJRD 1LUZA 1DD2A 2KYBA 1OXUA 2JMAA 4M78G 2YUPA 4XU2A 1XOVA 3ONAB 5EPJA 4P72A 3EFOB 2DVEA 4RUGA 2LT1A 4C8QC 1WYDA 1TOVA 4BI4A 1B7TA 3JCMQ 1HZBA 2N78A 4RGTA 4R4IA 5FLXL 1OYXA 1Q1BA 3TVTA 2K5IA 3BYTB 4J15A 3MXGA 4P73A 2XHCA 3S1QB 1UHFA 4HSPA 5DEHA 2KUMA 2QAZA 3C0CA 3S9WA 5I9PA 2AQ3B 4M7AC 3MAQA 3S1NH 2F0HA 1UE1A 2X35A 2M1HA 4BXXG 2KVQG 3M0RA 5FU6C 3CRLC 2VV5A 2JA9A 3PV0A 1UJ0A 4J9EA 1BIAA 2MHVA 4KKUA 4DV6L 3OYIA 1PFMA 2MJ8A 1X3GA 2FMMA 2BDNA 4C0FA 4YWKA 2K79A 2F52A 3H3VC 3I90A 4K6LA 4HIKA 4QQDA 2F0SA 2VNUD 1D09B 4J6HA 3KF8B 4IJHA 3D7SB 3MPUB 4PMCA 1KNEA 2PZ1A 5M3MB 1SKUB 4C8QG 4IIMA 3P8BB 5A0DA 4E7HA 4JI3L 1VMCA 3G6EA 2MYSA 1EUJA 2YYZA 1NAPA 3SEBA 2DAQA 4WCIA 4BB7A 4GLVB 2X9HA 1QE6A 1Q8IA 5KYLA 3MWYW 3X28B 1VQ9T 1JE5A 4PQXA 3SFMA 3J7YW 4IOCA 2FZGB 1ENCA 3OYCA 3QO3A 3GTMB 4HCKA 4FVMA 3BFMA 2K5WA 5KRUA 2LVMA 3NTKA 2BUDA 5IXFA 2RI2A 3N6RA 2RQRA 4YY3L 1P8LA 4LF6L 1OXXK 3O8VA 1XTCD 1I4K1 3A8HB 5IP9G 5GAEC 1RCVD 1SE8A 3QDFA 2V26A 3FJPA 2OF1A 4JVZA 3VS2A 4A93G 1ENAA 1GBQA 2PNIA 3JCMg 2P84A 2SRCA 1MUZA 2ZJQA 1AE2A 5A2QE 1MSGA 2WSCE 2K52A 2K5VA 3K81C 2EZVA 1DZ1A 3M4YA 3DHQA 1EQVA 1VQMA 1NMFA 4PLLA 2EQIA 2MPXC 3M4OB 4MMKA 1NEGA 1GUGA 4Z02A 2NTSA 4KGXB 1K9MU 3NQIA 1SBBB 2HKQB 3MXNB 4C1NI 1SFOH 3CD6T 4LF7L 5J39A 5BN3A 3CCUQ 3I35A 3BS1A 3NGPA 3A8MB 4FYYB 1UB4A 1WJSA 1PCXA 2DZCA 2EYMA 3ERQA 3H6MA 3HOXH 5GADC 5CR2A 5GAOp 3P1HA 2EDGA 4J8OA 2BE5D 3ITPA 1M4VA 4H0LC 4D8KA 4DKAC 5KNBA 1V9PA 1I81A 4DV7Q 2UXCL 2RQWA 1AZGB 1VQGA 2PNRC 2EE1A 4FO2A 1G3TA 3A8OB 4M7AF 1MBYA 4HIOA 3HRZC 1B70B 4DOWA 3VR3A 2F0OA 2KAFA 4L5QA 3OYMA 3MEUA 2OAWA 2EYWA 1XNRQ 5GAN4 3PVLA 3GIBA 1GHJA 1MI2A 2WB1E 3GDEA 4RMFA 1QNUA 2DJFC 1RODA 3VR5A 3X3NA 1SN8A 3RUXA 2ICEC 5I6WA 5M5WB 4B9WA 4J9HA 2RA4A 2ZZDA 2P4RA 2F4IA 4IJLA 2FMCA 3FPUB 1D7QA 4PJOG 2C0TA 4E7JA 1RAFB 1I50H 2IHEA 2L0CA 3OYJA 3G4ST 3PUYA 4NKLA 1BDOA 3JV3A 5DM7R 1N6AA 4ME5A 4I7AA 3J81c 2PMZB 4J83A 2WP8J 3IQLA 1FNUA 2R6GA 3HZXA 1NG2A 3C3LA 2FJ2A 5J22A 2LRQA 1Y71A 1NCVA 4A53A 3VA5A 1H92A 4PZ6A 2F2XA 3HP9A 2ZPIB 4J7IA 4YTLA 1VQ9A 1CI3M 5EKIA 1PH7A 3C2PA 2HT1A 1S72A 5KYYA 1LM0A 1IO6A 2V1CC 3S15H 4ME7A 3KUPA 1N34L 1MV3A 2C5CA 5GQOA 5A0LA 1AT1B 3I4OA 3RR5A 4IKFA 4JI8L 3M4GA 5E4XA 1A0IA 1A2TA 1CFMA 1P16A 2YLBA 2ZCFB 2B8GA 1SYDA 3VUBA 5A0GA 4A3LG 1G291 4X62Q 2V8IA 3P8HA 5IHKA 1PRLC 2NZOA 4B3MQ 5JVG3 4QQ6A 2IW3A 4R4OA 4X66Q 3DLMA 1VQ5A 1L1OA 2MNAA 1HZAA 2OWOA 3HKSA 1X54A 2JTFA 1EY6A 3TSSA 1W70A 2F0QA 3TZUA 1NR2A 5IAYA 2RMOA 1PRTB 1X3EA 1T5EA 1BB9A 2CKZB 2RM4A 5D14A 4CBVA 4FT4A 2AQ2B 1YFNA 3FIFA 5M9OA 4XU1A 3OYNA 1G3SA 3EG9B 1LTTD 4JG2A 5IGFA 2UUAL 5HK0A 5ELCA 2RHUA 2BH8A 5I9OA 1CA5A 4GKJL 4RMOA 2N88A 4CDEC 3RNJA 2DETA 1ICFB 3JAMc 1WHMA 3BY7A 1KC8U 2NUCA 2KCCA 1AE3A 1Y8PB 5KIXA 1K76A 1SMYC 4DPGA 4LK1C 4OGEA 4L59A 1UWVA 1EOVA 1Q46A 5CQYA 3EGXA 1JC7A 5G3LD 1VQNA 3CPFA 3S1QH 1XJVA 4FU6A 1SMXA 4E7LA 1OTCA 4AT1B 3MEHA 1EYGA 1E0BA 1GKHA 4PMWA 5C44H 4A3MH 4KTAA 4LF4L 5I4DA 1WFQA 1JB7A 5EAYA 1W6JA 4NPSA 3QBYA 1E6GA 5KYNA 3PIPA 3OOCA 3JB9I 4CC4B 4GOPB 3GTGB 2Y0SB 2LSSA 4DR1Q 1EOTA 1RF2D 1UGRB 1ILPA 5CBAE 3BDLA 2KEEA 1HXYD 3GP8A 4AMCA 4F8MA 1VYTA 2Y0SE 3ULJA 3M3YH 5LHY1 3PGZA 4F16A 3L2VA 3TU4K 2Z6KA 2D1XA 3NTHA 1RD9D 2F0JA 2LJ0A 1G91A 5CO7A 1S72Q 1PHJA 4KI0A 1EIHA 4CKBA 2EPDA 5C0XH 1Y8OB 1T0HA 2F5KA 1QP3A 4DAPA 1VQ8Q 2M9UA 1GO3E 4CC3A 5LJ3h 4EMKC 1D8LA 5FWCA 3TREA 1TT2A 4N4IA 4GLXA 3K0YA 1TR5A 2HNIA 4KUDK 4ZGJB 3BZCA 2A7YA 1IKLA 5FKAC 4JBWA 5LL6X 3K57A 3JCMc 1JT8A 3O5ZA 2DVJA 2X3WD 4K6DA 2A37A 4BUGA 2FB7A 1Q8KA 3EFXD 3DEOA 4FP5D 4MMLA 5IGEA 2CREA 4EMKB 5GAMd 3F1ZA 2JA6H 4OMLA 4KHPQ 4A3FH 2NVQB 1M2VB 5CV6A 3DB3A 3U50C 2PQWA 4C8QD 1W2BA 3KFUA 2JTEA 1BBXC 2N8NA 2D8JA 2X3XD 3EH1A 4KY7A 3URGA 4OO1I 4JJCA 5LJ3j 1XMQQ 1OU8A 1A3UA 2SEMA 1F1BB 4YCVA 5C44B 3MHXA 4HVWA 3OTOL 5HCKA 3GTGH 1ACMB 4KGVB 5D7UA 2J7IA 2E76C 1LPLA 2KEAA 4N4GA 4DR6Q 2P0QA 2QA4Q 1H9JA 4KN4C 4PKCC 2PNHA 3CXCS 3PO3G 4A76A 3HOYB 4FXDA 1SYCA 2ID0A 3CMEQ 1Y96A 1U3OA 1R9TB 1HNZQ 2HCCA 4NMZA 2A6HD 3S17B 5C0MA 4BY1B 4DN4M 1EU3A 3KLSA 2B2VC 1VCIA 2I5LX 4TQUS 1YI2A 1BR9A 4M77A 2VUMB 2D0QB 4X34A 2RKSA 4Q5WA 2ROTA 2K3BA 4XTZA 3URYA 2L8DA 2IX1A 3G6ET 3QXEB 2DXTA 4M78D 3JB9H 4Z88A 1GVPA 1BVSA 4EMHA 2K14A 4UDUC 2R93H 1QB5D 4DV2L 3SHWA 1SNPA 4JV5L 2B2WA 3RUZA 1R4PB 3EG9A 3AMUA 1L2FA 3HRSA 3HL8A 2NUPA 1IRXA 3OWEB 1LTBD 4FW1A 4AFQC 3L2UA 4P74A 3DM1A 4JI5L 3MXPA 4CGYB 3S16B 3BZDB 1CA6A 1HR0W 1EY9A 2L15A 3TDQA 5IGGA 2HCIA 4OGCA 3K7UC 1BKBA 3CCUT 4HTHA 4HJAA 1VQPQ 1VQJA 4J6WA 2Y4XA 3VS0A 5CAIA 4B3TL 1SNQA 2ABLA 4RGMA 2GVBA 1M3CA 4XQNA 1EFNA 4E7ZA 1BI0A 2HUGA 2UUAQ 1PH9A 1R0BG 2H3JA 4NW2A 2RQUA 2XDDA 3MA2B 1X27A 4LJZC 4DOVA 1AWJA 4C3JB 2Y4YA 3TP6A 2B8AA 3L3OC 5C0XJ 2DPPB 2ZPFB 4HCCA 1EYDA 1L1OC 3PSIA 3S6WA 4OWTB 4GOPA 2CYZB 4WJ4A 3I4MB 3HKZG 4DK6C 2MWOA 5IT9E 2E65A 4F7UA 3R6NA 2XICA 1I1JA 1GHKA 2VQFQ 2R93B 4PFPA 1KD1R 4P71A 3HOUH 1YHQT 5IOCA 1FMKA 3TSWA 2RCFA 1LT4D 2VW9A 4F7UE 3I73A 4OO1H 1D1BA 2DFUA 2JEBI 2PI2A 4LWCA 5IY0A 1GJXA 3JB9G 3D6CA 2QEXA 4QGUA 3IKJA 3TQYA 1EY5A 3SVMA 2JS0A 2IPOB 1K73U 4FT2A 2K2VA 4RTXA 3VR2A 2X69A 4XDXA 1N36L 1ASYA 3CU7A 1HD3A 1X3FA 1I07A 5FLMH 1Z6HA 2XWJB 3I56A 3E1SA 1VQ6Q 1LTGD 1HUMA 1O7ZA 1YNJD 3JAMi 4DUYQ 2WAQB 3VDYA 1ZSZB 2EXDA 2F0NA 4J1MA 4CKEA 4IN3A 2GTOA 3I9QA 1CHQD 2L55A 2VKNA 4JLIA 2A74C 2LXKA 1PH2A 3UE0A 4JLGA 4NS5A 2ZM6L 3U58A 4Z9CB 2PQEA 1IHVA 2KMTA 4KJNA 2Q8TA 4J5YA 3T1YQ 2QTXA 1YNXA 1OXSC 5CCAA 2I07B 4JCVE 2C0IA 2UXDL 3SXHA 3I3CA 3KDFA 3QWXX 4RGOS 2H4OA 1EZ8A 2LKVA 5KCHA 1VQLA 1YJWT 1ML0D 2RCNA 2Q2IA 2JJQA 2A68D 1XPUA 1VYUA 1VQFA 2JA6G 3HOVG 4DXGA 4QF4A 2DY7A 2EY6A 4M75B 1ZBJA 1BCPB 2KHIA 2PPBC 3M7GA 4J6XA 2JM8A 3CRKC 1FYCA 3GV3A 4K5VA 3V05A 1SEBD 2F0KA 3HOZG 1NPRA 2B63B 4LF8L 2XNAC 5I6YA 5GANj 3OTOQ 4KRTA 4M78B 3DWPA 4E47A 1AD5A 1ZUUA 2LCSA 1TS4A 1S5CD 3AHUA 2RPNA 4RTWA 4Q5VA 1AZQA 2F0MA 5AFWA 2A8VA 1CSKA 4J9FA 4WJ3M 2EVRA 1KAWA 2L9HA 2JP1A 1SE3A 4GNXA 5GAOm 3CMAA 3PGGA 3CCQT 4QMGA 2QDBA 3S17H 1N9WA 2EJGA 4JUVA 4KH0B 1S3OA 2CWAA 3MXUA 2XG8D 5CV9A 3MEWA 2QGFB 3JB9D 2LMCB 1HR0Q 4M7DA 1MMAA 1B50A 1NEBA 1STAA 2VXEA 2KXCA 4RTVA 2D2CC 1OXVA 4QUFA 1LTLA 4DV7L 4GKKL 4JOIA 1M1FA 1QG7A 3S1MB 4ZTJA 2AWOA 4JZ3A 1VQHA 2CT4A 4R1JA 5HGTA 2L3SA 1PYWD 1QP2A 2MI6A 5GAMj 2QA4T 2KQ3A 5I22A 3OYFA 4JS5A 1VQNT 4G7OC 4M75C 1VQ7A 1BCPC 4IPCA 3NP8A 3UWNA 5M5YB 1IKMA 3HSBA 2V8JA 3JC66 4OIKA 4ZN3A 1RI0A 1IW7D 4BY6B 4EGVA 4DR4Q 3C95A 2ROLA 2KDSA 2RJDA 4FL6A 4RG8A 4TSSA 1S5DD 1Q81C 2WINB 2LNHB 5KYIA 3S2DH 4PFOA 3JCMJ 4JI3Q 5CKEA 4LDVA 3A8GB 4IFDH 2BH2A 2G9DA 1BCOA 1HZCA 4X65L 4DR2Q 1H9SA 2F03A 5KEEA 2G5DA 1HUNA 1OZ2A 4LUVA 1TKWB 3OS5A 4XIGS 2YV5A 2NVXH 3RZOH 1EL0A 2Q8RE 2DJQA 2JNGA 5M5XB 1QVPA 4OONA 1VQOQ 3GTKB 4L5RC 4RG1A 5HURA 2DRKA 3G4SA 4IQZA 4M75G 2K7VA 2RHIA 1U1SA 4X66L 2DNCA 1C0AA 2N55A 3OB9A 1Z47A 3I4MH 2MAMA 3L2ZA 1TWFB 2CVRA 5KYYB 3C46A 2HQLA 1BUVT 2CGHA 2QDLA 2KRSA 3RR6A 3MKDA 5LJ5j 1S72T 4IFDG 1JWSD 3I5SA 1FJGQ 1FNWA 5CGKA 3V7SA 1IBMQ 2NYSA 4QQGA 4M7AA 2UUCL 4LN2A 2C9OA 1M2OA 1FWZA 3A8IE 1V1PB 1B4OA 3M58A 3W1GA 3GTLH 2F0VA 3A55A 3X24B 1L1OB 1G8ZD 1BCMA 2E74C 2YU9B 1PH4A 1VF5C 4C3IH 3T51B 1SE2A 1UGVA 3JCMd 1X65A 3H0FA 1WTOA 4Y7NH 3OPOA 4DNIA 4J9GA 3HFOA 1QWYA 2DL4A 1KDBA 1RADB 4JYAL 5C4JH 1RTOA 3V8JA 2CS7A 2ZT9C 9ATCB 4H7BA 4KY5A 3I8ZA 4JRKA 3BDUA 2D6FA 1FMWA 4LF4Q 1ONLA 2V8KA 4M77D 5IYBG 4A4FA 5JAVA 5KE2A 4HCBA 1J5EL 2AMCB 1MKHA 1E7OA 4IPGA 2R7ZB 1PH5A 2YRDA 5C4ZA 1I5FA 1WHKA 1X9NA 4RKLA 1YJNA 3FMCA 1OEBA 2BE9B 1KG1A 5GJWB 1KABA 5EBCA 1XNQQ 4IOAA 1ZEQX 3RLNA 4X6AH 2E6ZA 4IPDA 5IH2A 1PRTD 2QG9B 1JJ2P 2DF6A 5LJ3f 3SK8A 3Q6SA 4EVOA 2R7ZH 1JCKB 1AP0A 4DV0L 3EN2A 1NLOC 2EJGC 1PRTF 2RQXA 1KDAA 4LF8Q 4PZ8A 4RTUA 5GANg 4M7DC 1EFWA 1U1TA 1PHTA 1PSEA 3TEEA 5GANf 4ZLTF 4X9CA 1W2BS 4JOIC 2KECA 3ND8A 3H0GB 4YWLA 1WYXA 4IURA 3T16A 1KJWA 2OTJT 4PMBA 4HMJA 3NFCA 2CW0D 1EY0A 1YCYA 1WTVA 2JUFA 3MC0B 1QVGS 5C4HA 2AIRB 2HEQA 3VS3A 1V29B 5AJ3L 3GOXA 1Y14B 4LMQD 3BW1A 3PUXA 3I4MG 1ZUYA 3H0IA 2ZXPA 5KE3A 2WIIB 5DNFA 5FRMA 4C0DB 5GMKj 1TXQA 4IO9A 2K5LA 4AYBE 2GGRA 2HCKA 1UUEA 3M56A 4TRDA 4EMGA 1NPPA 2R5AA 5CORA 2M00A 3GO5A 3NUCA 2R7DA 1ZYRD 4C5EA 3OYGA 2CZ0B 3EGUA 4Y28E 1B53A 5IYDH 2QCPX 1Y1WH 2F2WA 3GTKH 2XRQD 3B6YA 1ET9A 2K6AA 2VYTA 1AEXA 3FRPB 2BOSA 1TVXA 2VB3X 4RWSC 4BY1G 4OX9L 2ESWA 1U5KA
chains in the Genus database with same CATH topology
1D1IA 4G57A 2JE6I 4DA2A 2ZPHB 2O4XB 2B2TC 3T56B 3BDCA 1SNOA 2EJMA 3Q23A 2FFKB 1UGPB 1EU4A 2LDMA 2HAXA 2JOYA 4C3HG 3OS0A 4FF3A 1A15A 2G9HD 5J3BA 5D3DA 1H641 4FF1A 1O9SA 1YJWA 2DIQA 4A93B 4JK1C 1OO9B 4HMIA 4A3FB 4F87A 2JA6B 1YITT 2ZXOA 1YNNC 4U673 2CZ7B 2O5IC 1UGQB 2NVTB 2EYQA 4PL6A 2F0GA 1YI2T 3PO3B 1CZWA 2R58A 2TMPA 4ATOA 1VQMT 3C1FA 1GUNA 3IL8A 4C0DC 3RMSA 4A3IB 1YJ9A 3QOJA 3PTAA 3HPWA 3CMAT 4QW2A 1KC8C 2XWBB 4C8QF 3DXJC 3PFSA 1IYVA 4EQPA 2RBMA 1SSOA 1M1KC 4LD9K 1WTQA 2X4XA 1ENFA 4RKUE 5NUCA 3UT1A 5I2XA 4NP5A 2RDFA 1HPCA 3UI2A 3S14B 1I4PA 2F0DA 4RFBA 1I8FA 1I4RA 2A6HC 5LJ3e 1JORA 1WNLA 4C92C 4DK0A 2DIGA 3R2TA 3A7LA 3SR1A 3OBWA 4D6WA 5GANe 4B08A 3NBIA 2RI5A 1K8MA 2EY5A 3KBXA 3GTLB 4L6TB 2RJFA 5GAN3 3LWIA 3CCVT 1F9SA 1GXDC 4XQQA 5JEAH 3S15B 1JB3A 3K6OA 2K5QA 3PIOA 2PYKA 4X3TA 4R8IA 2SEBD 2SNMA 4KKTA 3QG1A 4IALA 4KKSA 5JPMC 4X3UA 1CT1D 3INZA 2RSOA 3MO8A 2A6ED 3RKXA 3WXMB 3DKMA 4A4KA 1EZ6A 1TY0A 1LLRD 4VUBA 3OS2A 1TS5A 4HAEA 2DD5A 5C0XG 3VV0A 1WTXA 1K8AC 3CCJT 4C2MB 2M2LA 1WQ7A 2GCXA 2E1HA 1S5ED 4CJ1B 3KLSX 3JCMW 2EQMA 4N9PA 2RB6A 2EYJA 1I4GA 3RKWA 5EKLA 1I4HA 4EQOA 4NL3A 1VUBA 1KDCA 3GNGA 1TS2A 1AN8A 1RHPA 3G6JB 4OP0A 2NVYB 4BBSB 5JOBA 4C3IB 2KOLA 3RD4A 2WSFE 1FR3A 4MHEA 1K9MC 3V2TA 2VXWA 1BYMA 2X6LA 3CHBD 3GNFB 1K8OA 2EJFC 3OYYA 3VKIA 5EG2A 1CQVA 2QKIC 1EIGA 3D4RA 1UEBA 2E2JB 3VYSA 3OIQA 2RA2A 3CCET 1LABA 2BCOA 1JWMD 4C92F 5GAMe 2R3ZA 5GANh 1PZJD 2XU8A 4JRIA 2K32A 3DWAA 3MCAB 3EA6A 4MZTA 3LYIA 3CCLT 3J7AV 4ZUIA 3RLFA 1ZHIA 1JOQA 4QVZA 3UPUA 3CC7A 3NPPA 1U4RA 3QHSA 4XT3B 2V4DA 1XNIA 1J9OA 1SE4A 1WD0A 3R93A 2RHZA 5KCOA 1VQ8A 1TS3A 2NB0A 1WTRA 1LV9A 2K4YA 5IT9L 1Q82U 1TWGB 2E12A 2PW5A 2QQSA 3KBGA 3ME9A 3R2IA 3I4LA 4PNYA 1HCZA 5EKKA 3NWSA 4KJOA 1I6VC 4A4HA 3FLGA 2A68C 4P5NA 2X4WA 5LJ5g 1EY8A 3CBOA 5JJZA 4JS4A 4HSVA 5CR3A 4KD3A 3LW5E 3K5NA 3DEPA 2DEQA 1FX7A 2JSOA 2XI9A 3K5OA 5D6XA 2PU9B 3HOVB 1LT5D 2LC4A 3OYHA 4K8JA 4C56C 3E9FA 4M75F 1BCPF 1SNMA 1Y07A 3OBYA 3QWNA 4XYQA 1WPYA 1MSHA 1TWAB 1Q7YC 1YNJC 3Q1JA 1LNXA 4PJOA 3F2UA 2RD1A 2BKDN 4C3HB 2LT4A 4L6V5 1KHCA 5GMKh 4JRPA 2B2TA 4ODGA 1STHA 2GFAA 3OW2S 1Q3LA 2MPMA 3L7ZC 2CHBD 1VF7A 1O7LA 3OS1A 1H9RA 5LL6S 4F88A 4HKEA 2LNVA 3CEYA 3QYGB 3CCST 2L5TA 4GZYC 3FRNA 2KY9A 5I2MA 3D31A 2LS01 4J8QA 3HFNA 2XIDA 2NWGA 4M7DE 1HTPA 3HOWB 1C4QA 3ND9A 4A3MB 2DTOA 2NN6H 3I91A 1WTWA 2SNSA 2VXFA 1JBMA 4DNTB 3CBPA 4XK8E 1YJ9T 2KEDA 1B34A 3QOLA 4QCLA 2L4NA 2A6EC 4RCBA 1HTLD 1XXGA 2LFNA 3E19A 3FC3A 4DA4A 4M77E 5GAOq 5CKHA 1SYGA 2JZ2A 2P0PA 3QPHA 3QJYA 1GXIE 4M7DG 4F7XA 1ZKOA 2KVMA 1EYAA 1EYCA 3FDTA 1JR0D 4RHSA 4OVAA 2LCLA 3GV6A 1OZ3A 3CPWA 4BBRB 3CCRT 3NBHA 5CK9A 4RKBA 4IUPA 3CPWS 4NL2A 3GP7A 5EPLA 1Q90A 2X4YA 1B9MA 4BD3A 4C92D 1I6HB 1XYIA 2K57A 1O7YA 4IUVA 1R8OB 1QNKA 1D3BA 2F0IA 2OAUA 2XK0A 1PMRA 1DYQA 3CC4T 3GLXA 4HR7B 3NSWA 3LWEA 3F70A 1QVFA 3SWNB 3VR6A 5HKCA 1UEAB 2DTHA 4A3JB 3K58A 3HKZB 2MGSA 5GAOl 1IL8A 4KBMB 3SD4A 3BVZA 4IUNA 5CBEE 3RZOB 2CQAA 3V7CA 1BNZA 1DOMA 1EEID 5D65A 5M3FB 2IG0A 5C5MA 2B8FA 2M0OA 1YNND 5ELEA 1S4ZA 2QEJC 3PT9A 3V96A 5TSSA 2NVXB 1PFNA 1X01A 2LTOA 3MFYA 3TZDA 1X75C 2A5HA 1JOKA 5KNDA 4A3BB 5DAUA 3N5BB 1TY2A 3SHLA 5BN5A 4C8QB 4KK7A 1G3YA 3OWFA 1KD1C 3LWHA 4ZK9B 1Q86U 3H6ZA 2DK3A 1VQKA 4MDWA 3K59A 5CKFA 3DLLA 5LJ5f 2PO4A 2ZGWA 4I65A 1A3TA 3DWQA 2QXFA 1QW1A 2L89A 1TH7A 1SNDA 4K2KA 2EAYA 1B1ZA 3VU3C 2FYKA 3T9NA 4XQJA 2EKOA 3BYYB 1BIBA 2R5MA 4BS9A 4K2LA 1B34B 3QZ5B 2ZPGB 5CV4A 3M57A 1SJHD 4O5VA 1PLFA 4TVRA 4M78C 4M78A 2IWHA 3TCJA 3J81E 4H13C 2LQ8A 2DZ9A 1NSNS 2F1MA 1MD2D 3MVVA 4DGZA 3IAYA 3D3RA 2MP1A 2QQ9A 4BE2A 1G2TA 5E4WC 3IFDA 2D5DA 1X6OA 2F0EA 3T13A 5LJ3d 4M7AG 1SSFA 4X3KA 3CCEA 1PSFA 2EVBA 5CQXA 2RHXA 5CV8A 1JOOA 3BG3A 1U4PA 2JVVA 2GF7A 2HBPA 5KH6A 3CCLA 1VIEA 4GY5A 1SMYD 1Y7XA 3L2WA 3VJPA 3RMQA 1CZGA 4ZQ3A 3AU7A 4H44C 4DXFA 5L8RE 4FXKC 2MUYA 1PTOF 3CCSA 2K1BA 3FB9A 2A3LA 2PZWA 5I2SA 4EDUA 5GAN8 1Q1EA 3GQBA 4FNFA 2E2HB 2RJCA 4ZGEB 3FEWX 3PNWC 3CCJA 1EY4A 3U9OA 1HXDA 2F0LA 2KK4A 2EPBA 3G7LA 4N4HA 4M1UB 3C94A 4M7DF 1ZQ1A 2DXCA 4HA8A 5DY9A 2WV6D 3NTIA 1NJIU 1B9NA 2XDPA 1C48A 1E2ZA 2E10A 4PV1C 4WRDA 4LDYA 2DNEA 1Y96B 2QF7A 4M8AA 3P8DA 2DY8A 1NJIC 2AUKA 1H3ZA 3SK4A 2JN0A 4XTVA 2EY2A 1V1PA 4FIBA 1B3AA 3J7AF 1X3PA 2VB2X 3P20A 2P4TA 1Q12A 4CKCA 2EYFA 4OHJA 1Y69U 4A3DB 5LJ5e 3JAML 3M54A 3X26B 1Y1VB 3ZEHA 4BWGB 2DKGA 4O1NA 3C4SA 2ZPEB 4U68A 3OSVA 1G3WA 2EWNA 2B2YA 1VQPT 4PJOC 4IZ8A 1L0XB 3OQ5A 4PJOE 5G3LF 3LX7A 3WDNA 4XU3A 2XN9C 1IREB 2HQEA 3V7RA 5GAN7 4HCEA 1SNCA 2CW0C 4C92A 3OW2A 1EWCA 2WKDA 1WJQA 1F9PA 4ZYSA 2KJXA 4KD4A 1TWCB 3S2HB 2XKOC 5GAOn 2OTLA 4ZUJA 1NR4A 4XTUA 1VMPA 2B2VA 2PUKB 4F7UB 3SK5A 2QILA 3JSCA 3EFSA 3RKYA 2J4XA 1E2WA 1S5BD 1V8QA 1DONA 5IGDA 2LY7A 3PIP3 4CJ0B 2KQWA 4IUQA 1F9QA 5J26A 3NE5B 5CC4A 1EY7A 2DD4A 2AQ1B 3M5AA 2IJ0A 4PJOB 2K5FA 1TIID 3GPLA 2F0FA 4JRQA 2PZUA 4A4EA 2RK1A 2KA7A 2SDFA 4C0ZA 5GANd 3OHXC 3VYGA 1M9SA 3CKIB 1U4LA 4V0BA 4QVDA 2E2DC 1PXUA 5E3FA 4KT0E 2PVDB 1NE8A 3P75A 2SOBA 2QQAA 2ZPBB 1U9RA 1PTOB 3G71A 1VQ6T 5FO7B 2AWNA 1FGBD 1M8AA 5CIUA 5EJWA 4M7AD 1CM9A 3WVDB 1LTID 5JVH3 2F0PA 3MEVA 4EPCA 3D4WA 3EJIA 4QVCA 4J7FA 1N9SA 1LT6D 4C5HA 1N27A 2PUOB 2ICIA 4M77F 4RAUC 3NQTA 4RCCA 3LGLA 4BI3A 4IFDI 2HDLA 2J0TD 5CV5A 5EQ0A 1ZYRC 4M7DD 4XU0A 3MP6A 1PZID 1XTDA 3HGBA 1VQ5T 3L2RA 1DOKA 2OTJA 2WACA 1S5FD 3LNNA 3PO2B 2L11A 1SAPA 4X9DA 1F2ZA 5KNCA 2JA8B 1I50B 1M1GA 1P92A 2EYPA 1UUPA 3H91A 4M7DB 3NHHA 4HCZA 2O5JC 1D5XC 3W2DA 2HD0A 3G7ZA 1DJ7B 3FEOA 3TMEA 4M75E 3HOUB 4II1A 3CC2A 2IX0A 5A35A 1PZKD 1M90U 4BA2I 4L63B 1A6XA 1I5LA 3OW7A 2JTMA 1IW7C 5T1IA 3W3AA 2F0TA 2QDYB 3VUZA 3ZFJA 5EGTA 3JCMX 1BI2A 4ILWA 3HOXB 1BXTA 1XWEA 4C92B 4F7UF 5D6WA 3CC4A 3IFTA 4FF4A 1VQOA 3SWNA 4C92E 4BY7B 2E70A 3X3MA 2FL7A 3HRTA 4OB3B 2DN8A 3CCQA 1M8VA 4N9TA 3LH0A 1G5VA 3HP3A 4OB2B 5FLXE 5LJ3g 2IL8A 1IZ6A 3CMET 1NUCA 1JE4A 5JPNC 4FXGC 3D4DA 3BVGA 2R61A 1QILA 2L3RA 2XD0A 1BI1A 4ZGDB 2EOTA 1QVGA 3LX0A 1EEFD 2RHYA 1HQMC 3PUVA 1F2YA 1N8RU 3LGFA 1AHJB 1ET6A 3GTQB 3JRZA 1BI3A 2WSEE 3SDZA 2XVSA 1SYBA 5GAN6 2QQRA 5GAOr 3QB3A 2RK2A 5DLOA 2VUBA 1GUOA 3ZBDA 4C92G 4TKOB 1WCMB 3JCMP 3Q24A 5CYUA 1WTPA 1KLUD 1C8CA 2I2LA 5C4XB 2QI2A 1SYEA 5ELDA 4O6JA 1VQ8T 2OEOA 2NLUA 1AW7A 4MZPA 1WD1A 3PIO3 1BO0A 3OA6A 5K36H 4R55A 1SXTA 4EQNA 3T4AC 1T5XD 4FSXA 1B2TA 1D6EC 1EIFA 1DXMA 2E6NA 4HN7A 3T53B 5C6AA 5M5YB 2PCFB 3BDOA 1CHPD 2RI3A 1KAAA 4M77B 2Z8LA 3Q0AA 1IYUA 2HDMA 2KCNA 4J6YA 2K03A 5I2YA 3CBMA 2PZTA 1VDZA 1QCBD 5CKBA 3R6OA 3X25B 3OSSC 4WORA 3JCMb 4KMUC 4BDYA 3PMIA 5CVIA 3CC2T 3MXNA 2EXZA 2EYOA 1HFNA 3KLRA 1HA6A 4FM4B 3WOFA 4A4GA 4AYBB 4G7ZC 2NN6G 2JXMB 3A7AB 3ASKA 3C1EA 1JQYD 4BDZA 3HS0C 1Q82C 5FU7B 3LWUA 3J80L 1VQ4T 5GMKi 2FINB 2CZ6B 1KHIA 4M78F 3E0JA 4NOYA 1D5ZC 4XYOA 4RA8A 1PTOC 5FROA 1CK1A 2OXPA 1IHZA 2PVOB 4IUTA 4XQ3A 3L1AA 3V8LA 3CCMA 1F9RA 3JCMh 3U9SA 4F7UG 2D9UA 3QYHB 3A5ZB 3MP1A 4LDXA 3GTJB 1N8RC 2F5TX 3M9QA 3ER0A 3EAEA 3OY9A 1KQ2A 2WKCA 2C06A 3AB9A 3HOZB 1H9MA 4XTWA 1DM0B 2O2LD 1JJ2A 3M59A 3J81L 4R8NA 1M4ZA 4DAYA 4N0AA 4I7ZC 2QEXT 3FVQA 4OO1G 4XTCS 1HA5A 4A3KB 1YIJT 5E1FA 3CCVA 3I72A 2GFUA 2NTTA 3VYUA 3P7JA 2KHSA 3SWNC 4A3EB 4ULLA 3JCMe 1I4XA 1PTOD 1YITA 1LTAD 4V2SA 2EFIA 4G4KA 4IUUA 3SB2A 1JRIA 5C0XI 3H94A 2RH2A 3WVEB 3FDRA 4KUIA 2GQVA 2DTIA 1N9RA 1HQRD 3L42A 1J8IA 4XAXB 3K5MA 4S3SA 2DXUA 1BOSA 1KQ1A 1K8AU 5FRNA 5GAMg 3SK6A 1PDQA 1PFBA 1LO5D 1H9KA 1M90C 5ELFA 1D2BA 2K04A 4OL7A 2E5QA 1VQ4A 1TQOA 4M75A 4OF1A 4QIWB 5J1ZA 2YHTA 4HT8A 5K5PA 3N52A 5IGCA 3L9AX 4OGQC 4NDXA 1O80A 2F0WA 2IPKD 2F69A 3HRUA 3OMGA 4OMFB 1ESFA 2MWPA 2RJEA 2VC8A 3MTSA 5C5LA 5GMKm 4PJOD 1XQHA 1SJED 1U8RA 4K5XA 3VYRA 5T1GA 1TWHB 2NZ1D 2TSSA 2B2UA 4BY6C 5ISRA 3K5LA 4PNOA 4RH6A 3EROA 3RERA 5DM63 5GAN5 4ELYC 4WF2A 1YIJA 3Q22A 2Z4HA 1LACA 1HHVA 2EQUA 1FD7D 1M1KU 2L5QA 4ZRZA 1D3BB 3D6WA 2K5DA 3QKJA 3HHTB 1JICA 3JB9F 2BA1A 4R9WA 2A69D 1STYA 4JJNK 3EVQA 1E2VA 3MEAA 2J7ZA 2Z1CA 3CMEA 3JCMf 1I3QB 3EFRA 1BQQT 2PW7A 4ZN1A 1VQKT 5JEAJ 4Q0FA 2AUJD 1F2LA 2NBFA 2NYZD 3BVMA 3FPPA 3M3YB 5GMKl 4DAVA 3A8KE 2LCCA 4N0AC 1HRJA 2AHJB 4LD6A 2Z4IA 3S3NA 3GTOB 5FU6B 2RO0A 1O75A 4KY6A 2A69C 5COYA 4M7AB 3E9GA 4RG2A 1VQLT 1MHNA 2K05A 1KTKA 1OI1A 5GAMf 4M7AE 1PTOH 1X3QA 4CJ2C 3L2QA 3CQZB 4B9XA 1CQFA 2XIWA 3JB9J 2CKKA 1Y8NB 3NK9A 4C8QA 3KUFA 5F2DA 5BN4A 1B44D 1JWUD 1ZXTA 1F77A 4C5GA 4ZKCB 4C1NK 5EBDA 4RCOA 4ELZC 4RGNA 3CD6A 3PMFA 4DQ2A 1MGSA 3H8ZA 2O01E 2D62A 3A54A 3H09A 5EPKA 3CCRA 1SYFA 3CXCA 2IX3A 2LX9A 1ZBXA 1LOJA 2M16A 3CCUA 3TP5A 2IVWA 3I70A 1L0YB 2QA4A 1V1OA 1OXTA 4OB0B 4KV6A 1WGSA 5FO8B 3JCMV 5LJ5d 4M75D 1BCPD 3X20B 4R56A 5IODA 4DU9A 1QOHA 1YBYA 1X32A 1GUSA 3VR4A 2WB1B 1PRTC 4DK1A 3GTPB 1M5Q1 3QIIA 2JA7B 4XXEA 4LAAA 3RMHA 1VQ7T 1FNVA 1LTSD 2E2IB 3CC7T 2RVLA 3OMCA 1QJOA 2F3VA 4YIJA 3SE0A 3NXWA 4C5IA 4CHTB 1II3A 4WJWA 4PJOF 5ELBA 2L12A 3TP8A 2D9TA 1EFID 4MDXA 4LDUA 3M85A 1HK9A 1STEA 2DJZA 1K83B 4JDSA 2DO3A 4BI8B 3VA7A 2RSNA 3M53A 2EYHA 3EQLC 2EIFA 4RHRA 1GUTA 1RL2A 2G3RA 4Y7NB 3I55A 2H1EA 1R4QB 4QUCA 2F3WA 1HFGA 4PLIA 5C4JB 4DNRB 2R57A 1SDFA 3CCMT 3KXTA 2MMPA 4UC4A 2OT2A 1EWHA 2Y90A 2QQBA 2HQXA 3I4NB 2RDHA 4C0GA 1D1KA 3A8JE 3VYHB 3PUWA 2E64A 3S3OA 3PMTA 1F2MA 4E6IA 1UAPA 1AZPA 4FYDA 5D3IB 4ABNA 2EQJA 1UNSA 2XRSD 1KLGD 3M7NA 2K33A 2M9VA 3MP8A 2K28A 3RZDB 2DXBA 4CI0C 4M77G 3HEJA 1STGA 2A73B 2BE5C 3QDRB 2L1BA 4OIJA 2E41A 2XSCA 3OYDA 3OYKA 1JJ2S 3MFGA 3K7AB 3TBIB 5FU7C 4K8IA 5C3WA 1D5MC 2R92B 3JAME 1Y1WB 3DUZA 2RDGA 3GF5A 4OB1B 1Q81U 1WVLA 2FHDA 2I46A 5CV7A 3RESA 4HEDA 1STNA 1U4MA 3NWTA 4WFN3 1SFOB 5GAMh 4X3SA 1ILQA 1V43A 1NZ9A 1Q86C 4XTYA 5CKDA 1KD1U 4M77C 2IT1A 4IFDJ 3E6ZX 1H9SB 3R8BA 2X4JA 5HK3A 1RJTA 4E7KA 1G2SA 3S1RB 2OTLT 5KGUA 3G71T 1VQ6A 5IN1A 2NN6I 2EJFA 1RDPD 3E5SA 3DMUA 1UGSB 2KSSA 4DF7A 2Q8IB 4CRIA 5CMDA 4V190 1GOZA 1A3VA 1W4SA 3OSOA 4P2CB 4L8JA 1TU2B 1DOLA 5K36G 4RCNA 1DCZA 3C12A 1W6KA 2ZXRA 3MHBA 4E7IA 3TP7A 4XT1B 1BF4A 4ID6A 1QVFS 1MGQA 4K5WA 2XDBA 2EYLA 4C8QE 4BACA 1LTRD 2B39A 2YRVA 3DB4A 5FOBB 2FVUA 4HCSA 5DM73 3META 2JYOA 3QIAA 4MZMA 1I4QA 1GUWA 2BIVA 4ZTFA 3OIPA 2E75C 1FXXA 3O13A 4EMKA 3S1NB 4GLKA 5C3XA 3QO2A 4C3JG 2K3YA 1Z7TA 2B2UC 3KF8A 4K14A 3J80E 1XX8A 2MF2A 3LLRA 5AYFA 3A56A 3HG9A 3VYTA 3V8KA 2EY1A 3UDCA 2F0UA 4BE0A 4QB4A 3ZYYX 4BA1I 1O78A 1WJRA 1JB0E 3OYAA 2ENBA 5IIFA 2BA0A 1K73C 1STBA 3M55A 5GMKe 3R3OA 4M78E 4A54A 5HY6A 4ZAIA 2JEAI 4KN7C 3RIRA 3OYBA 3QSUA 3QUIA 1VQOT 2BDOA 4LDWA 2LQKA 1RKNA 1AFPA 4KHZA 2CZ1B 5IGBA 1VIFA 5LJ5h 4MN3A 3OYEA 3KK7A 5C6SA 1ESRA 3MZ5A 2EQKA 2PVGB 4MIUA 5D6YA 2VGNA 4XTXA 2K01A 1YHQA 2X6GA 5DLQE 1CTMA 1RTNA 3GD7A 4C3IG 1A2UA 5JEAG 3A8LB 2B2YC 5FK9C 3S2DB 2EJ9A 4UAIA 2YLCA 5FO9B 5I21A 1WQWA 4DFAA 1YJNT 4O42A 5GAN2 3I56T 1KNAA 1VQPA 3I55T 4FF2A 2P0KA 2K3XA 2FHTA 1KQSS 4HT9A 2JA5B 4A3GB 4L5GA 3FKIB 5A2QL 1KQSA 1LT3D 2B2WC 4ZKBB 4KULA 4KHVA 3S3MA 4Y91A 3OYLA 2VGMA 3D8GA 4G7HC 2O4XA 2GA4B 3PUZA 1Q7YU 1ICWA 1LJOA 3QZ9B 3WOEA 1EQTA 3QJ6A 4BE1A 5C3EB 1DJRD 1DD2A 1OXUA 4M78G 4XU2A 1XOVA 3ONAB 5EPJA 2DVEA 2LT1A 4C8QC 4RGTA 4BI4A 3TN2A 3JCMQ 3HOYB 5FLXL 1OYXA 1Q1BA 2K5IA 3BYTB 3MXGA 2XHCA 5DEHA 4HSPA 2KUMA 3S9WA 5I9PA 2AQ3B 4M7AC 3MAQA 2F0HA 2X35A