3NTKA

Crystal structure of tudor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
169
Chain Sequence
b'AELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein tudor
molecule tags Transcription
source organism Drosophila melanogaster
publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
total genus 43
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntkA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntkA01
4C5EA 3H6ZA 2LDMA 2PQWA 4C5HA 4IUTA 2L89A 4BDYA 4BE1A 4A4EA 5IAYA 2EQUA 3ME9A 5M9OA 4E7KA 1RI0A 2XK0A 3DLMA 3L2QA 1OZ2A 2EQKA 3C4SA 5C0MA 3S3MA 2IG0A 4E7IA 2F5KA 2K3YA 2DAQA 4NS5A 2R5MA 2CKKA 4QW2A 1OZ3A 2BIVA 5J39A 3LGLA 2MWPA 3GOXA 3OYHA 2LVMA 3FEOA 2YRVA 3S3OA 4Q5WA 3OYIA 4L59A 4E7HA 3ASKA 2K3XA 4BDZA 4B9XA 3PNWC 3OYGA 2MWOA 3M9QA 3MEAA 5KE3A 3OYKA 3OA6A 3DB4A 4IUUA 1N27A 3LH0A 3L2VA 4PLIA 3FC3A 3MEWA 2X35A 5CIUA 4IUVA 1OYXA 2M1HA 2WACA 3OMGA 4EDUA 2P0KA 2O4XA 3LGFA 4GY5A 3LYIA 3NTIA 2JTFA 2GFAA 4C5GA 4QQGA 2M16A 2RJEA 3MO8A 5KCOA 3OS1A 1KHCA 3CEYA 3E9GA 4IKFA 5KCHA 2JZ2A 1H3ZA 3L2RA 4N4GA 2EKOA 2RI2A 3OYBA 2X4WA 3MP8A 4N4HA 3F70A 3OS0A 3META 4A4GA 2RJCA 1SSFA 5FRMA 2DIQA 4ZTJA 3SD4A 3ZEHA 5KH6A 4UC4A 3L2UA 3OYDA 2LTOA 2BUDA 2L3RA 3KUFA 3P8HA 2G3RA 2R58A 2B8AA 4IUPA 3OYNA 4BACA 2RO0A 4BE0A 5FROA 3NTKA 3PMTA 4HCZA 3QBYA 2XDPA 3PMIA 3S6WA 2RI5A 3FLGA 3OB9A 4ZTFA 1WJQA 1MHNA 2RJFA 3FDRA 4FL6A 5IN1A 4E7JA 4PLLA 3QKJA 2RI3A 2R5AA 4RG2A 2QQSA 1WJSA 2HQXA 4A4FA 3OYAA 3OYLA 2QQRA 4IUQA 5FRNA 4OVAA 3BDLA 2LRQA 2RHXA 4X34A 1WJRA 2EQMA 4Z02A 3OYFA 2RJDA 2R57A 5D6XA 4BD3A 5C6SA 3S3NA 4LD6A 3PFSA 2RHZA 2GFUA 5KE2A 1G5VA 3P8DA 1XNIA 3LX7A 3OS2A 2O4XB 4PL6A 3LLRA 3QJ6A 4IURA 3UWNA 3O8VA 3DB3A 3OYEA 2LCCA 2NLUA 4C5IA 3E9FA 4A4HA 3L2WA 4E7LA 2DIGA 2GF7A 4QVZA 2BKDN 5D6WA 4CRIA 3OYMA 3Q1JA 2FHDA 3OY9A 3MEUA 2X4YA 3UT1A 4N4IA 5J26A 4FU6A 3OYJA 2M0OA 2EQJA 3OQ5A 4II1A 4QQDA 3EAEA 2X4XA 3OMCA 1OI1A 2HQEA 2D9TA 3MEVA 2RHUA 2L8DA 3QIIA 1WGSA 3H8ZA 4B9WA 2RHYA 2E5QA 4BE2A 3L42A 3MP1A 2E6NA 2EFIA 3MP6A 3NTHA 4QQ6A 2VYTA 3OYCA 5D6YA 2RHIA
chains in the Genus database with same CATH superfamily
2K9GA 2K52A 1HR0W 4DR6L 1MSGA 3GDEA 4GKJQ 2KBNA 1Q86R 3J7YW 1XQHA 2C9OA 2R6GA 1RAGB 2ICEC 4JI7Q 4XU2A 4OL7A 3QYGB 3KF8B 2O31A 2CSIA 4CKBA 4A3FG 2V8IA 1K9MR 4X3TA 1HXDA 4NOYA 3ER0A 1AEXA 2JA9A 3DEPA 4A3GB 3NQIA 2F5TX 4JG2A 4FO2A 2Q8IB 5LHY1 1RLPC 1E0BA 4KY6A 2QYZA 5LMUQ 1NUCA 1DJ7B 2XTIA 1RTOA 3K5LA 4EMHA 4Q5WA 3E1SA 1S1NA 1E1OA 1Y96A 4CC3A 1MGSA 3EG2A 1I3QB 2NUTA 3CCMQ 4DGZA 5AT1B 1I4PA 2R7ZG 1KNAA 4XTVA 3QWNA 2AQ1B 3MXUA 4HSVA 4J8QA 2JP1A 3PE0A 4F16A 4RMFA 4OB1B 3JCMc 4OMMA 1SXTA 4RGNA 3OMGA 2X4JA 4A3LH 2DTHA 4M75E 2KYBA 3FRNA 1C48A 1VQ6A 3S17H 1H92A 4IIMA 3RUZA 1RACB 1UUEA 5I6WA 3GP8A 5K5PA 3SR1A 2HSPA 2F0LA 1Y8OB 1AVZC 1Y69U 2E10A 1YIJA 1EZ6A 1VQPT 2JS2A 3EGXB 1K3BC 2MUYA 2RF0A 2ZPGB 3GTMH 6AT1B 1SSFA 1G8XA 3KUPA 3OIPA 3VR3A 2JMCA 2P0PA 3RNJA 4HCEA 1EUJA 3CAMA 1ZSZA 2ALYB 4M75C 3DKMA 3CRKC 1GM5A 4M7AF 5C4JH 2F2XA 3M4GA 4OX9L 3I7FA 1L0WA 1YHAA 1UJ0A 2QAZA 2VC8A 5CKEA 3X26B 5A0DA 1ZA1B 3J80c 4HCZA 2E1HA 4LF7Q 5BN4A 1E6GA 5ELEA 3QWYA 1SEMA 2DL7A 3JV3A 3QO3A 1A8VA 1EY5A 5GMKm 4KKSA 5FLXL 4FSXA 4J7FA 3OSVA 3GTJH 3EFOA 4QUCA 1WA7A 3X20B 3ZBDA 2RI3A 1K3RA 5FWBA 4LXCA 1IO6A 2VB2X 3A5UA 1VQ7T 3OYLA 3SWNC 1NLPC 1Z7TA 2RBMA 3A7AB 4M78A 3HOZH 1AW7A 3K5MA 1PH7A 3CXCP 1YIJQ 1SE2A 2UU9L 3CMAA 2EQMA 4J9BA 2BCOA 1EOTA 2R57A 3G4SQ 3BZDB 3SE0A 1MJEA 3C1EA 2PVOB 1OV3A 2NVYH 2ZXOA 2FPFA 2M9UA 2L4NA 5C0XG 4A3MB 1YHQQ 3WOFA 3FJPA 2DXTA 3GTLH 4QF4A 4KJOA 4L6TB 1DJRD 4M7DG 1Y1VB 1OO9B 5IT9c 3Q23A 2ATWA 2BKDN 2EYZA 1ZUYA 1B7YB 4C2MH 4FW1A 4JRIA 1B53A 2X4YA 5LL6X 4N4IA 1UHCA 3L3OC 2H3EB 2D0QB 3OQ5A 4C1NK 1GHKA 2JS0A 4M7AG 5C4ZA 3OBYA 3SEBA 1W3SA 2DGYA 2FMMA 1BOSA 1SSHA 1VQKQ 2RSOA 1W2BS 3RLFA 1IKMA 3IFTA 4R4TA 2RQTA 1MMAA 2K79A 4FT4A 3EGXA 5LJ3g 2PW7A 3QZ9B 5DNFA 1C0MA 1YJWQ 2A5HA 2RHIA 1K73R 1AE3A 1BXTA 4R4OA 5AFWA 1PMRA 2JOYA 2PQWA 3NBIA 1OX8A 3VKIA 4ZGDB 1N36Q 1JMCA 2R7ZH 1I94Q 3M4OB 2ESWA 3ME9A 4GLKA 1X3GA 2JA7B 1O7IA 1D0YA 1STNA 5CV4A 4JJCA 2Z6BA 3C4SA 1WFQA 3TN2A 1OTCA 1Q1BA 5C4XG 5FU6B 2L1BA 2FZCB 1M9SA 5GQOA 2KVQG 2NUZA 2A19A 5GMKl 4RG1A 1HK9A 4BY1H 3U23A 5HCKA 1U5KA 1YITT 3HOUB 2A08A 2VY3A 1NLOC 3FEOA 5GMKh 3G4SA 4PMCA 4CJ0B 1D1AA 2QGQA 2RB6A 4B9XA 4NMZA 1AFPA 2KXDA 2E5KA 3M9QA 1Z9ZA 2MWOA 2RNAA 3OS5A 4LUDA 3FKIG 4XQQA 3UE1A 3S17B 4JYAL 1L1OB 3TBIB 1VQOA 1VQKA 5GADC 4M78B 3MEWA 2K5HA 2DRKA 1U4MA 5EPKA 2I0QA 1V1PB 1O7ZA 2A37A 4LUOA 4K0KL 3JB9H 4OXPA 4DNTB 1PH5A 4NXML 4KN4C 1HTLD 3KOJA 3RKWA 4C0GA 1T0JA 5BN3A 5JEAG 1AZGB 4NL2A 5IGCA 4DR3Q 1SFOH 3I35A 2CWAA 1LUZA 1XMQQ 4J9FA 3GD7A 5FRMA 1WXBA 2XIWA 4ZKCB 1QQJA 2ZJRA 1H8KA 1UE1A 4JI0Q 3TSZA 2GVAA 4MNOA 3TZDA 1IKLA 2K3BA 3P8HA 3UDGA 4JBKA 4BACA 1SNDA 1DOKA 2DETA 1L1OC 2J7ZA 4L6V5 3VRZA 3CCJT 3NTKA 5C4HA 4PNOA 3D4RA 2Z0SA 4KY7A 1OEBA 3WXMB 2XRQD 1YNXA 1MBYA 2YU9H 2F4VL 4C92D 1OU9A 1N33L 1MHNA 1CHPD 3O5ZA 1TOVA 2SEMA 4PLLA 3K0XA 2LJ3A 1X43A 2HSEB 4IFDJ 4E7ZA 3A54A 4CKCA 1BIAA 4K11A 5A2QL 3J80L 1K9MC 3W1BA 2FPEA 4A93H 4CC7A 4IPDA 2BH2A 2L9HA 1GBQA 3VS0A 4IFDH 1QB5D 4BXXH 4RCOA 5LMNW 1PWTA 2DKGA 4A3KB 2EKHA 4HN7A 4A3CH 4CC2A 1D2BA 3BU2A 2ASBA 3QOJA 5ELDA 4A3BB 2BE5C 4DR1L 3Q6SA 1U4RA 1C4QA 3S1RB 1WCMH 3C46A 2A1AA 4KTAA 5FLXc 5EBDA 2KCCA 1VQNQ 1OQKA 3ERSX 4F7UE 3ND9A 3TP8A 5I4DA 5M3FH 1V43A 4FVMA 3T56B 4JI3Q 4CRIA 1L1OA 3GLXA 1OX9A 5LJ3j 4QUFA 1PV4A 3OY9A 1GUOA 2BDNA 4HCBA 4A93B 3I2ZA 4P2CB 4A3IG 1Y1WH 3VYRA 2HHHL 5CV9A 3DM3A 5BR8Q 4AYBG 4JI6Q 1Q7YR 1BBZA 1U06A 5CK9A 2ROTA 4P71A 4LF4L 1Y1WB 4Q5VA 5DLQE 5LJ3d 2DJZA 1YJWT 2YU9B 2E6NA 2YDLA 1F2MA 4V2SA 4MDXA 4MTKA 5KIXA 1ICFB 1BVSA 2LQWA 1VDZA 2FRYA 1B1ZA 4FM4B 4FSSA 4F7UB 1NMFA 4CDFC 4LDWA 1KFZA 1XXGA 3K0YA 2FO0A 3UATA 4DR4L 4FYXB 2DEUA 4R0KA 2CT4A 1OULA 2J06A 3L2QA 1GFDA 2ATCB 1MGQA 3J80E 2JA7G 4DEXA 3DM1A 1TH7A 2CP6A 2F5KA 1PZJD 2X9HA 2RVLA 1B3AA 2WB1E 4PJOA 5JJZA 1W4SA 1UFFA 2PCFB 4DUYL 1CKMA 1NR4A 2PZUA 1EQRA 1HTPA 1K0SA 2XU8A 1TU2B 3EA6A 4ANJA 4BDZA 4IJLA 4XU1A 1STEA 3OYGA 3CBPA 5C3EH 3QJYA 4LUEA 3S14B 4QKUA 4DR5L 4B3TL 4IIOA 3JCMP 3H41A 5GAMd 3L2PA 5J3BA 1PYBA 5CKDA 2ZAEA 3REAB 1Q7YU 4EDUA 1CUKA 2O4XA 2GN5A 2SEBD 1FVIA 2A6ED 1ZSZB 2JN0A 2M16A 4BA2I 1C1AA 2J7IA 1DGSA 2E76C 3AT1B 4HIOA 3VS4A 2Z4IA 2DA9A 3UA6A 3CCUA 4FXGC 4DNIA 5GAOq 1IBKL 4K6LA 2F4VQ 1EYGA 3HOUH 3FKIB 4GN5A 1BI1A 1N6AA 1E2ZA 1QZGA 2XD0A 4A3EH 2OT2A 4M7DC 5EBCA 5J1ZA 1YVCA 3H3VC 3M54A 1HD3A 1K1ZA 2RN8A 1O7LA 2KCNA 2OF1A 5KH6A 5M3MH 3SDZA 2HZYA 4E6IA 1ZHIA 3VR2A 4RUGA 3I4MH 2A68D 2F0VA 2JA7H 1VQ9Q 2JA6G 2E5LL 3D0FA 4KRTA 3A8MB 4LW1A 3CXCA 1EIYB 1JJGA 2G9DA 2MO1A 1XMQL 2CVRA 4P5NA 1CKBA 2VQEQ 2RQUA 1PH9A 5GMKe 4WF2A 1UB4A 1B34B 2J0TD 3H0IA 3GQBA 4FF1A 4BBSB 4E7JA 4F7UA 1QVGA 5GANg 1TWAB 3JAML 3NWSA 2R5AA 2F1LA 5I2MA 2K03A 1QVCA 1VQIA 1TY2A 2A74C 1PFMA 3T16A 2VUMB 5DM63 3QO2A 2VXFA 2ECZA 1M90U 4KLKA 5FO7B 4A3JB 2DL3A 3OW2S 5A35A 4RTVA 2OQKA 2LRQA 2HCIA 1NEBA 1WJRA 5GAN6 4PJOB 4ODGA 1ILQA 5IOCA 3JSCA 2KHIA 3EN2A 1T3SA 3UA7A 3Q22A 2FMCA 4HJAA 1QCBD 4H7BA 4PZ6A 2E4HA 2GFUA 3NPFA 4E47A 2CT3A 3OIQA 4BY7B 2KGTA 2L0AA 1PTOC 2B39A 3H0HA 1M3AA 2VASA 5GAMf 1BBUA 4XQJA 3M4OH 2DD5A 1J3TA 2P0QA 1VQ9A 4TKOB 4CDDC 5EGTA 2RM4A 5CBEE 3IRBA 3CMAQ 4UY8C 2R92H 2EYJA 2N8NA 2VW9A 2D0OA 2FHDA 3R2TA 3I4MG 5LL6S 5CV8A 3HKZB 2K6AA 1RAEB 3BDOA 5KNBA 1J5EL 3I56T 4BY1G 1YHQA 4A3IB 2DYBA 4HKEA 5GAN8 3CC2T 3CKIB 4YIJA 1YJNT 4RFBA 4LF8L 2DZCA 1GUTA 2E5QA 3T51B 2F0UA 1N32Q 4A63B 1TIID 1SAPA 1HNZL 3VJPA 5J22A 1F9SA 1TWGB 4C5EA 5KYWB 1VMPA 3D3RA 1CKOA 5IYBH 4X64L 5D7UA 1EY0A 3HGBA 5LMUL 1RCVD 4MDWA 1U9RA 1JJ2A 5CYUA 8ATCB 1HQRD 2VGNA 5C5LA 2CFMA 5IAYA 4C3HG 1DZ1A 1OU8A 1SNCA 4DU9A 2NVQB 3REBB 4E7IA 2X6GA 4ZGEB 2QG9B 4BBRB 4HJ7A 4FF4A 3KF8A 1I0CA 3M0PA 1CSQA 3KDFA 2KRMA 1Q46A 3QOLA 3V2TA 4JI8L 3JCMd 4GLXA 4M4ZA 4J5YA 2E3HA 3GTKH 2LVMA 3QHSA 5E3FA 1QKWA 4U68A 3K58A 5GAOr 2UUAQ 2VUBA 2ZPHB 2BTTA 3HZXA 1SKUB 2JJ9A 3I4MB 3CCRQ 3MEAA 4G4KA 3OA6A 4EVOA 2HCCA 4WJ3M 3PF4A 4PJOF 4A4KA 4PG3A 2AQ2B 2UUCQ 2DXBA 3EFSA 1Q86C 5HKCA 3W3AA 2GCXA 2PNIA 1HNWQ 4FW2A 4M8AA 3H0GG 4ZCKA 1A6XA 4JOIC 4M78F 1STHA 3LYIA 3E5SA 5JOBA 5C44B 1TKWB 3NELA 2A68C 3CEYA 3M4YA 4C92F 5EC7A 5D65A 1K9MU 3CCLQ 1ABOA 4ZNXA 4FDBA 1G291 2NVQH 1AZEA 2E2DC 5EPLA 4C3IG 2EPDA 1YITA 4DR4Q 2KR3A 3UDXA 4A3GH 1B2TA 2DPPB 4AH6A 1HA5A 2UXBQ 1BYMA 1MV3A 4HT8A 1KIKA 3S1MH 1B9MA 1SYEA 2RPNA 2JA5H 4XTWA 2QW7A 4RTXA 4BBRG 4ILWA 2R3ZA 1PRTB 4DV7L 4AFZC 3CCRA 3CRLC 2FVUA 2G3RA 5AJ3L 1VQDA 1S40A 5JVH3 4ORZA 5TSSA 2CUDA 2QEXT 3CMEA 2RA2A 3JCMf 2A3LA 3RUXA 4Z89A 3CCJQ 3CCVT 2LXKA 3KXTA 4BI8B 1PDQA 1WCMG 2BDOA 4K5XA 1QG7A 4ZKBB 5K36H 5JJIA 2RD1A 1LPLA 2DTOA 4HIKA 2MMPA 3OB9A 3P20A 1HCZA 5KYWA 1PC0A 2RJFA 1IL8A 3S1QH 3CCLA 3SK6A 1R8OB 3QDFA 2YUOA 3CC4Q 1BDOA 4XTCS 5C3XA 4DR1Q 2CZ0B 4OMFB 1I94L 4RG2A 2ZTEA 3RIRA 3OYAA 1JO8A 1OPLA 3RERA 1EQVA 3BY7A 3MXPA 2QA4T 4B3TQ 2QGFB 4LF7L 3CCUT 4X64Q 2DXUA 4TVAB 4JI2Q 2F2VA 3CCEA 1IHWA 3MHBA 1G5VA 1L2FA 2BA1A 4K14A 1SF9A 2E74C 1NPPA 3IQLA 2V4DA 1S3OA 3DEOA 1JOKA 4LK1C 1BBXC 4VUBA 2CW0C 1G8ZD 2K5QA 4C0ZA 1K8AR 4RWSC 4X66L 1O80A 4DV4Q 4BBSH 3MEUA 1SMXA 2UUBQ 5CR2A 3CCMT 2M0OA 4CJ2C 5GAMg 1QVFA 3RKYA 2B2UC 1WCMB 1M2OA 5KYYB 4MMKA 1NSNS 4C3IB 1A0NB 1PRMC 4A53A 1PVOA 1YNJC 2IPKD 4BY7G 3D4DA 1XTCD 2HQLA 4PK4A 2RHYA 3CC4A 2D1XA 4F8MA 4LF5L 2C35B 3F1ZA 2DL5A 1TUCA 3NUCA 3RR5A 1MHWC 4RTZA 1JE5A 3R6OA 1VF7A 1PA6A 1M2VB 4IUTA 5IHNA 2ZTCA 4JZ3A 1VQ8T 2YUQA 1U5SA 1ZEQX 2PMZE 3X3NA 4E7KA 4JRQA 4M77A 4GNXC 2YV5A 3FKIH 3M0UA 1YEZA 3RDVA 4FYWB 1O7YA 2JSOA 3KJOA 3RZDB 2GTOA 3GF5A 4HMJA 3JAMc 3MCAB 1Y8PB 2BIVA 1MJCA 4OIJA 2IPOB 2MWPA 4C3JH 4OWWB 2ZZDA 3BZCA 3OYIA 4E7HA 2K3XA 2FINB 1GCQA 2OTJQ 3U9SA 2QQBA 1VQ6T 3OYKA 1ZBJA 3DB4A 1Q81R 1KD1U 3U4VA 3I73A 3ULLA 3VS1A 2Y4XA 3LNNA 1QNUA 4JI8Q 4XAXB 2HBWA 4R4CA 2HDLA 3VR6A 1SPKA 2B86A 1OOTA 2OAWA 1SFOB 1AHJB 3NTIA 1JCKB 1M1GA 1WI5A 4GNXB 1KL9A 3TS0A 1IBKQ 3J80i 2DBMA 1X01A 2O2OA 5FJ8G 1I1JA 4PKCC 1D8LA 1QVGS 2EPBA 3ULPA 5IGBA 4KKUA 3A74A 5EQ0A 1PSEA 3JB9J 2F3VA 1PD1A 2RJCA 4XTXA 1U1SA 3SEMA 1NE3A 1AWWA 1PHTA 1Y8NB 2YTXA 1ICWA 2Z6KA 1Z9FA 3CP0A 4K5VA 2KRSA 1SROA 3M4PA 4Y28E 1G3SA 1B34A 1W1FA 2DRMA 4X9CA 3V8JA 2F0IA 2KA7A 2CQAA 1HA6A 1NYFA 2Y0SB 1EWCA 3KF6B 4FP5D 4IUPA 1EIFA 2LP5A 3CF5A 4JDSA 2RO0A 5CR3A 3VUBA 5FROA 3EJIA 2SOBA 4XXEA 3J81L 2UXBL 4IALA 3K80C 1I6HH 3AYHB 4GOPA 2L5TA 1VQOQ 4KH1B 2K75A 4RGMA 4HVWA 2CP5A 1JOQA 2D5DA 4X3KA 3HRTA 2V1QA 2XG8D 2H8HA 5GAN3 1EZ8A 3KBGA 1PFNA 4L5QA 4X3UA 2VQEL 2D2CC 3SHLA 1R77A 1CTMA 1VQAA 2COZA 3QR8A 3STBD 1STYA 5HK3A 4PJMA 1SYFA 1B3QA 1W6KA 5KYXA 1N8RU 5FRNA 2MQHA 3DWQA 2Z8LA 1LTLA 3CQZB 1PTOH 4M78G 4XYOA 5H1SE 2ZJQA 2VWFA 1S5DD 2AMCB 2E2JH 1WTRA 2RHZA 3V8KA 2OTLQ 2XDBA 5GAN7 3JB9D 2A6HD 3P75A 4L8JA 1BCPF 4X62L 3UE0A 2RDFA 2NVXH 4DV3Q 3BFMA 3CCET 1BUVT 1ZQ1A 3OYMA 3QZ5B 3KYHC 3K81C 2UXCL 3OYJA 3GTLB 3AFPA 1X2QA 1LTTD 2WAQG 4A3MH 1X54A 4AG1C 3PO3B 1SG5A 4KUIA 2L8DA 1YWOA 4J9GA 3E19A 1ENAA 5C6AA 2EFIA 4FIBA 2EYFA 5KGUA 2ENBA 1SHGA 3KDFB 3NENA 3HOWB 4ZUIA 2R7ZB 4H02A 5ISRA 4M77C 1NJIC 1RI9A 2NTSA 4WRDA 2QEXA 3RNUA 4XYQA 2EQUA 2R7DA 4IPHA 4O1NA 2AKWB 2J05A 1EWHA 1LT5D 1RLQC 4JLGA 4M77G 5ECAA 2DAQA 4NL3A 2F0HA 3HEJA 3P1HA 4OGQC 4QW2A 1QUQB 2HT1A 1ARKA 1X3QA 5GANf 4LF9L 4PJLA 1DYQA 2K7AA 1T5EA 5EPJA 5IP7G 4HT9A 3CHBD 4TQUS 2OTLA 1QWYA 3E9IA 2NVTH 1PYWD 5EJWA 4JS5A 4XQNA 1CQVA 1G3YA 1AE2A 2L11A 4OWTB 1N32L 3T1YQ 4B3SQ 1TS2A 1OYXA 2CH4A 2JJQA 3ZL7C 2E41A 2P0KA 3STBC 3X28B 4DBFA 2K5FA 3I90A 1LV9A 2IWHA 1E7ZA 1SYGA 3H09A 5IIFA 1LT6D 3JB9F 2RQRA 2ABLA 3C95A 4GLAC 3U4ZA 2H5XA 1VQGA 1CK1A 3GPLA 2XGTA 3META 1H3HA 1RAHB 2QK0A 4K8IA 1HR0L 4JI5L 1TWGH 2IT1A 3DXJC 4GKKL 3VA7A 4OWXB 1G2BA 3TRZA 3CPWS 4RH6A 1W6XA 1HQMC 2XSCA 3ULJA 4YY3Q 1PNJA 2B2UA 4FF3A 5I22A 2E70A 3JCMe 1SE3A 2MGSA 2XWJB 1GBRA 2E2JB 4AFQC 4KN7C 1PH4A 2FYKA 1FNWA 1YNZA 4J7IA 1W6JA 1I5LA 1WJQA 3UPUA 2L0CA 3M0RA 4YCUA 1IBLL 2LC4A 1YJNA 3OTOL 3HOVH 4KGXB 3X25B 1Y1VH 2K4KA 4PV1C 3CCQA 3CD6Q 3HFNA 3GTGH 1CT1D 2EYWA 1ZYRD 2SDFA 3CCSA 2I2LA 1J9OA 1DCZA 4DK1A 4ZLTF 3CCQT 4DR7L 2LY7A 5ELNA 1VUBA 1EY7A 4X34A 3TP5A 2EJFA 2L2PA 2EE1A 1I81A 1Q86U 3EFRA 1TUDA 4Y92A 1BCOA 4JI2L 2PMZB 3UDCA 1Q1EA 5IYCH 2K5IA 3P8DA 5LJ5e 4EQPA 3J7A5 3U58A 2LT4A 4DR3L 3JCMX 3OOCA 3D4WA 3PIPA 3OYEA 3I55T 4WJ4A 2KT1A 3QWXX 4QVZA 2VV5A 1SR3A 2K6DA 1QNKA 2MAMA 3UT1A 4DR2L 3VDYA 4LNQA 2WSFE 4L5TA 2F2WA 3H0FA 4XTYA 1PH1A 1SYDA 2O5JC 3RMSA 1J6QA 4Y7NH 2I5HA 2D9TA 1I3QH 5COYA 2L12A 5M5WH 1PRLC 4B9WA 5CKFA 3SFMA 4LF5Q 3S2DH 2IJ0A 4BE2A 4Z9CB 4RCCA 1IYJB 3NTHA 3OYCA 3U50C 3TCJA 1WD0A 5DM73 3BJUA 4AQYQ 2LCLA 3FPUB 5GAN5 5E4WC 4BI4A 1X75C 3G71A 2BE5D 3K5OA 1KQ1A 3A0JA 3D8GA 1VYTA 2YT6A 3UDIA 4C0FA 2ENMA 2EY2A 3RKXA 4NXMQ 3OW2P 2K3YA 3I8ZA 2R5MA 1D5XC 2OTLT 1RJTA 4ZAIA 3TMEA 4YWKA 2K32A 4IFDI 3WDNA 2DXCA 4CBVA 4EGVA 1KIXA 4XIGS 5KNDA 1AOJA 1F2ZA 3CCMA 4YTLA 4KH0B 1Q82R 3S3OA 4UP9A 1JOOA 2WSCE 1U4PA 3EGDA 4IUUA 4N0AC 3PUVA 1VQ4T 1T9HA 2LSSA 2ROLA 2Q2UA 2J6FA 1VCIA 5CIUA 1YITQ 2NWMA 1AWOA 4C3HH 1KHIA 4PJOD 2WB1B 2NN6G 4DOWA 3LGFA 4LDYA 2QDBA 4LD9K 4IOAA 1M3CA 1ABQA 3RESA 4ZN1A 5EKIA 2XDDA 4RMOA 2L3QA 1M90C 1BQQT 4M78D 2X3XD 3CQZH 2YWWA 4DA4A 4MMLA 1PH8A 3QDRB 4M77E 4M7DA 1NBWA 2QA4A 5IGEA 3L2RA 1AP0A 2X4WA 1ASYA 3OS0A 2CS7A 2EGAA 4XTUA 2PI2A 5T1IA 3VS6A 3SXHA 5GAOm 3J81c 5JJLA 1Q3LA 4H13C 1WJJA 4LFAQ 4ZK9B 2E2HH 3PVLA 1TWFH 3SD4A 1D3BA 1NEGA 3J81i 3L2UA 1GUGA 5CQYA 1EYCA 4M75F 1IW7D 2F0DA 1VQ4Q 2E2HB 1ZX6A 1ASZA 4BE0A 5IGFA 1EU4A 4FCYA 3EVQA 1JWSD 1FR3A 1BCPD 5E7NA 4A76A 1XJVA 2VNUD 1JR0D 4JRKA 1RD9D 3VUZA 3CC7Q 1BCMA 3CBOA 1G3TA 1NG2A 4QVCA 1JWUD 1NYGA 1V1QA 3L0OA 5BN5A 1X3FA 2X6LA 2OWOA 3V7CA 3PO2G 4JI7L 1VIFA 1VQ6Q 1I4XA 2RMOA 1IBML 2Z6KC 2V1RA 3S1RH 5IWAQ 1D0ZA 3T1YL 1AT1B 4BY6C 1N5ZA 5CV7A 3V7SA 3GTQB 2O2LD 3MXNA 4UHVA 1TWHB 4HVVA 3J7AV 2GBQA 2KT8A 3QSUA 3BYYB 2UU9Q 4H44C 2XICA 4DV6L 3I4OA 2HDMA 3LX7A 1QKXA 1M90R 4A3BG 3A98A 2CZ7B 3QJ6A 4LN2A 3PVQA 2CW0D 3RZOH 1JRIA 3M4QA 2DIGA 1I6VC 3GTOB 4GN3B 5L8RE 1EEFD 3JCMb 3GV3A 2EQJA 1RF2D 1FMVA 3EAEA 1HPCA 3EHQA 2CKZB 3VR4A 4NXNQ 3CBMA 1TUGB 3H0GB 1IL2A 3K8AA 4ELZC 3MP1A 5IT9L 5C44G 2JA8H 2BE7D 1WD1A 2AT1B 1XMOQ 1IXDA 2Z0WA 2O01E 5L23A 1GO3E 5GANh 1PRTF 2L55A 5FLXE 2JNGA 4KMUC 1QVPA 2E2IH 2IX1A 7AT1B 4DR7Q 3CCJA 2VL6A 2QASA 4XT1B 1STAA 3DWPA 1F9QA 3EFXD 1MD2D 3IAYA 3G48A 2UXCQ 2EY5A 2XWBB 2K5LA 4M7AE 1EFNA 3GIBA 1L0YB 2JN4A 2NBFA 3E0EA 2ZTDA 1JB7A 1JXMA 1UGSB 3PGGA 1VQEA 1VYUA 2DZ9A 4IO9A 1YHQT 1WYXA 4M7AD 1JB3A 5ELOA 5KNCA 1SNOA 2DE0X 1NTGA 4AIMA 5J39A 4C3IH 3LGLA 4DV2Q 3OYHA 2F0WA 2F52A 2FXQA 3D6CA 4PFOA 1YBYA 4NPSA 1ZLMA 3J81E 2EXZA 3NSWA 3BVGA 5JVG3 4APVA 4FYDA 1QJOA 2IL8A 4JI0L 5DM7R 3M9BA 4A3FB 1VOMA 1M8MA 3TQ7P 1HZ9A 2PTKA 1WOCA 1U1TA 3CXCS 4OIKA 3MXNB 4A54A 1C8CA 2E75C 4DUYQ 5IHKA 1ILPA 3HOVB 1Q81C 3AU7A 2RJEA 3KLSA 3I5SA 5HY6A 3S1MB 1TY0A 4UAIA 2LX7A 2HBPA 1WNLA 2F0FA 1O9SA 2RI2A 3ND8A 2GA4B 1AH9A 1C0AA 4J9IA 1PXUA 1TU0B 2C0TA 3GTKB 2DIQA 3NE5B 1JC7A 1FYNA 3NQTA 2DVJA 4K6DA 2KY9A 4C8QE 2OAUA 2EQSA 3KLRA 4BY6B 1RIPA 1BNZA 2RQVA 2LT1A 2R58A 3ZFJA 2KAFA 4PFPA 2XVSA 3HOUG 3C0CA 4JPBW 1LT4D 2D0NA 5EG2A 2DMOA 4PFZA 1WI7A 1WDXA 3QBYA 2QDLA 3CW2C 3S6WA 1WQ7A 1EY6A 5LJ3e 2A69C 2ZPBB 2B2VA 4R1JA 1MNEA 4LUVA 1KQSP 1IYUA 1WHMA 2DM1A 5E4XA 2CH4W 3JCMg 4JRPA 2CDTA 4GLVB 4BBSG 1LCKA 1SRLA 2COWA 3MFGA 5D14A 4LFCQ 1QMCA 4OMLA 5FU6C 2KEAA 1H9RA 4RTYA 3JAME 4BBRH 4C56C 1XPRA 2BE9B 1F2YA 4ZYSA 1TWAH 2PUOB 3H91A 4Z02A 2F0GA 3CCLT 2X69A 5D3IB 4C92E 4KGVB 4NP5A 1MUZA 3F2DA 1GCQC 5D6XA 3S3NA 1KD1C 2EOTA 3BYTB 3V7RA 3TP7A 4DOVA 5C44H 4DV0Q 1PM3A 1WTVA 1BBWA 1FJGQ 4L5SA 3EGUA 3CCVA 5K36G 4EMKC 1CHQD 1LO5D 2O4XB 2VUMG 4GN4B 1LTGD 2CWPA 4MIUA 2DX1A 2M00A 2E64A 4RCBA 1KD1R 1UUPA 4OELB 2LMJA 1CZGA 1P8LA 1II3A 5ELFA 4FYYB 2K5DA 1XYIA 1U0LA 2JT4A 4KULA 2LFNA 4UP7A 4R56A 4X62Q 3I5RA 4P75A 1D5MC 2F0TA 2KEEA 3QIIA 3EBEA 4KJNA 3HOWH 2JUFA 2HAXA 2VUMH 4A3FH 2Z1CA 4ALPA 1SNPA 4OONA 1WFWA 4M7AC 1K8MA 3MA2B 3HS0C 1HR0Q 2YLBA 4DA2A 5GAHC 1IREB 3QXEB 1F2LA 1JQYD 1GFCA 2IX0A 3VYSA 2CHBD 2B2TC 2NYZD 5LMNL 2XK0A 3BG3A 3GTOH 1OZ2A 5C0MA 1A2UA 2I07B 2EBPA 1YJWA 3PGZA 5CGKA 1UGPB 5FOBB 2IHFA 5GAN2 1WX6A 3PMFA 1NNXA 1M1KU 5M3MB 1HNWL 2F69A 1VQ7Q 5DLOA 2DL4A 2HKQB 4DAPA 4DR6Q 1N9RA 2Q8TA 5IGDA 1UEBA 2CP7A 3HOXB 5GAOn 1IYVA 2CYZB 5IGGA 2L3SA 3PCOB 5M5XH 1KJWA 4C0DB 1GRIA 1JU5C 5DY9A 3SWNA 3GTQH 4ESRA 1KDBA 1LYLA 2F3IA 3NMZC 4PMBA 4IUVA 4DV2L 2M9VA 4N9TA 1PH3A 4O6JA 1SBBB 4E7SA 1A15A 3MEHA 1AZPA 1FD7D 2Y0SE 3RMQA 1HH2P 2EY6A 1M3BA 1M8AA 2J4XA 2N88A 3MZ5A 3JB9I 1R0CB 3A7LA 4OEMB 5CORA 2P4RA 4M75D 1S5BD 1H9SB 4LDXA 2B8FA 3W5OA 2JZ2A 1WTHA 1VIEA 3GTPH 2EKOA 3QIAA 3EG0A 4N4HA 4HJ9A 8AT1B 2F0QA 3I56A 4A3JH 5CV6A 1MMNA 1Q90A 1AZQA 3HFOA 1N9WA 2KMTA 2OQ0A 3R2IA 2NUPA 3IL8A 5GAOp 4JJDA 1SRUA 1TXYA 4E6RA 3HOVG 1HYOA 2DTIA 4G7ZC 3ITPA 2GQIA 3SB2A 3PQIA 4JBJA 3URYA 1GCPA 2IX3A 1I50B 1Z9QA 4JK1C 1X69A 1U8RA 3B6YA 3I91A 3S14H 2XDPA 2SRCA 2YUPA 4OP0A 3A8LB 3JB9G 4CKEA 3HOYG 4NB3A 3S16H 4A3BH 3IFDA 1WIEA 2RDGA 1DM0B 2RK1A 2FG0A 2JA5G 4JI4Q 3SK4A 1E2VA 5CMDA 4HIMA 2PPBC 1GOZA 4JLIA 4E2FB 4J6XA 2FHTA 5CKBA 4DXGA 1WXUA 4RTWA 2QQAA 1SMYD 1ET9A 4QJFA 4A3EB 3CQTA 2HQHA 2EGCA 2UUCL 2AZVA 2NYSA 3MEFA 4A3LG 4RAUC 4OVAA 4DV1L 3F2UA 3EG1A 3MJXA 5AYFA 1LTRD 2RF4A 3INZA 3VYGA 2AWNA 1ONLA 1UWVA 3VRYA 4I65A 1L0XB 1PRTD 4B08A 4Z88A 4POFA 2JEAI 2K2MA 3PIP3 1VQ8A 4PJJA 5L37A 1ACMB 3CCUQ 2WSEE 4C8QC 2AHJB 3DB3A 4Z8AA 2F0PA 3VYUA 1SE8A 2B8GA 4KD4A 1B70B 5D6WA 1S72T 1TS3A 4CGYB 2D0PA 5CVIA 2CP0A 3G6EA 1VS0A 5GROA 3A8KE 1BR9A 2X4XA 2MI6A 2DEQA 2YUNA 1YJ9T 1VQNA 3WOEA 3CPFA 2A6EC 2R7FA 4DAVA 3MEVA 1DOMA 1SJED 5IY0A 2KOLA 3HOYH 2WKDA 1HNXQ 2BH8A 4OMPA 3THKA 2QKIC 2VYTA 1GJXA 3CD6T 2EYXA 4QGUA 1P16A 4CDEC 1STGA 1HHVA 5C0XI 3E9HA 5IH2A 3TZUA 4LFAL 5HGTA 4C5HA 3H94A 1F77A 4C0DC 3M56A 2UXDL 2O88A 2LXJA 3I55Q 2EAYA 3A8OB 3DLMA 4EMGA 2QA4Q 1HRJA 1UE5A 1K76A 1NPRA 1Y1WG 1D1BA 5LJ3f 1WZOA 2C0OA 4NS5A 3CU7A 2KXCA 1OXVA 5JAVA 2PW5A 1X55A 1SHFA 4LAAA 3GOXA 1XPUA 1AEYA 2R93B 2EVRA 2JTMA 2BZXA 5IXFA 2F3WA 1SLJA 1ESFA 2PQAB 3NGPA 2N49A 2QGGA 4V190 2KBTA 3FIFA 1TWFB 2GGRA 5DEHA 3RLOA 2YRCA 5IWAL 1HZAA 4PJOC 1OXUA 1HFGA 4HAEA 1FWZA 4DNRB 2AKKA 4QY7A 2WACA 1NBEB 4MZTA 3CMET 1GXIE 2L3PA 2JTFA 2EQIA 3MO8A 2F0KA 4QMGA 4B3RL 3S1QB 5KCHA 2B2YC 3GNFB 2KROA 4BI3A 1YCYA 1HUMA 4RHRA 1QLYA 2K5NA 2VB3X 2JXMB 1M27C 3FPPA 3P8BB 2XI9A 1EIGA 2HCKA 3LWUA 3NWTA 2MFIA 5CC4A 1TVXA 2PZTA 4LDVA 1UGRB 1QOHA 4BY1B 3FRPB 1X3EA 4EPCA 5GAOl 1T5XD 4M78E 4JS4A 2RDHA 4RGTA 3ZJYC 2B8AA 4DV1Q 5IHIA 2EYYA 3I55A 1KAAA 4JI6L 1M2VA 5HURA 5GANd 1ENCA 5JPNC 3GO5A 3QYHB 2UUBL 1YI2Q 4DAYA 3M58A 1R0BG 2ICIA 5T1GA 1S5ED 4KV6A 1I4RA 1BK2A 4FL6A 3FDRA 2C0IA 2MIOA 3VS7A 4X6AH 4A3EG 1M8VA 1EU3A 2QQSA 3CC2Q 2PZWA 3ONAB 4A4FA 2B63B 2ZXPA 1RAFB 4M75G 1KNEA 2LJ0A 2VXEA 1YIJT 2KHJA 3A5ZB 4LJZC 3HL8A 1UECA 4MZ9A 4U673 1X65A 2VXWA 4DV7Q 1C9OA 1SRMA 2XN9C 2FPDA 4OHJA 1HNXL 2RJDA 5CQXA 1GL5A 1XOVA 3C12A 4X1VA 4LD6A 1S5FD 2WB1G 4K8JA 2RCNA 5JEAH 3NHHA 4N0AA 4C8QA 3OYYA 3PO3G 2V8KA 1TXQA 4AT1B 1FL0A 3PT9A 4ELYC 4PL6A 4ATOA 3LLRA 4MHEA 1A63A 2JE6I 3O8VA 1K73U 2LCCA 1IXRA 4EQ5A 2K5VA 1D7QA 4E7LA 5JEAJ 2DILA 3GNGA 1IB8A 2FL7A 1VQMA 1VQ5T 3H15A 4J9EA 3KLSX 5LJ5j 2EVBA 2MHVA 4CDCC 1LTBD 3E6ZX 5IE8A 3PIOA 4KHVA 2C06A 2NN6I 3CC2A 4DBHA 3R8BA 2ZM6L 3VR5A 1T0HA 1CI3M 3JAMi 1ZYRC 1B8AA 1JQQA 1WGSA 2RQWA 3OPOA 4IQZA 4F7XA 2F0SA 2CUBA 2F0JA 4G7HC 1EL0A 2P4TA 4LF6Q 3S15B 1QWEA 3KF6A 5IYCG 3M85A 2KCMA 1ZKOA 1EX4A 3KK7A 2B63G 2NVYB 1FMWA 4M75B 1CQFA 1K28A 3T1HL 4A3IH 5BR8L 4DKAC 1HSQA 1CKNA 2Z9HA 1VQOT 2JEBI 1NAPA 3W2DA 4YHHQ 3S3MA 1KTKA 2VZAA 3K57A 2OXPA 1WLPB 3C94A 3TVTA 3IKJA 2NZ1D 2R92B 3SWNB 1K8OA 1QW1A 2SNSA 3SHWA 2ZT9C 4O42A 4K0KQ 3DUZA 2CKKA 2MP1A 5JPMC 1QVFS 3PSIA 4O2DA 2K57A 2K5WA 4BS9A 1QP3A 5LJ5d 2HNIA 4BY7H 4KHPL 4JZ4A 1UE9A 5GAMj 2YRVA 1PH2A 4A4IA 2F0EA 1WVLA 1G91A 2Y90A 4C2MB 3FVQA 3CCEQ 2MK5A 2KJXA 1N27A 1CSKA 2G5DA 3KJPA 1CSPA 1GD7A 4KK7A 2X35A 2HD3A 3PV0A 1Q12A 4B3ML 2COYA 1FX7A 2EWNA 2QILA 2DY7A 2LNVA 1Y7XA 2NUPB 2DJFC 1JXOA 1PFBA 1KHCA 4JI1Q 3M7NA 4HIDA 3R3OA 1R9TH 4XDXA 2R93H 1LOJA 2YRDA 1D1CA 4K2KA 3HOZB 5HK0A 3I4LA 3AQQA 4C3JG 1D1IA 3K7UC 3RN2A 2SNMA 4DFAA 5FO9B 1S4ZA 3VU3C 2LCSA 4DUZL 5LJ5g 3HPWA 1X9NA 4DAMA 4LMQD 5C0XJ 3M5AA 4ME3A 1VQLT 1NY4A 2E3IA 3OYNA 4OB0B 2D6FA 2YTVA 4C92G 1J5EQ 3JCMQ 4M7DD 3GBQA 4LUZA 1JE4A 2E8GA 5C0XH 3OBWA 1K73C 5C4XB 1VQ4A 1EYAA 2DY8A 4DK0A 3EH2A 1PFSA 3DHQA 4ULLA 1MKHA 5IN1A 1KK7A 4RGOS 3PF5A 4J8OA 5KYNA 2FB7A 2PVDB 4TRDA 3GTMB 4B3SL 3WWVA 1UEAB 1Y57A 4EIKA 2DJGC 2QI2A 1B44D 1RHPA 1WHHA 3MTSA 4YWMA 4K2LA 3MVVA 4DBRA 1EZZB 5AJ3Q 1VQ5A 3H6MA 4IPGA 1RL2A 4QL5A 1IHZA 1ZSGA 1I4GA 4KT0E 2D8JA 2XHCA 1IW7C 2NUCA 5KYIA 2DVEA 4LF9Q 2Y4YA 1SJHD 2RH2A 2B3GA 2DLPA 5G3LF 4FXDA 4J6WA 1WPYA 2R61A 4IN3A 3G71T 1IGQA 1WQWA 2ZPIB 5FK9C 1BCPC 5I6YA 1X6GA 4C5IA 4DV4L 4M78C 4A4HA 1AD5A 2VB6A 2GF7A 2N3SA 1U3OA 3G6JB 2EDGA 3PO2H 1JWMD 5DAUA 4MZMA 2PNHA 3JCMV 4XU0A 4D8KA 1K4US 1TS4A 2HL5C 3OMCA 2ZXRA 1C7YA 1MV0B 3MFYA 2HQEA 4WORA 3BS1A 4DR5Q 2CREA 1SNQA 2IIMA 1CM9A 3HG9A 1N34L 2KQ3A 3MWYW 4F04B 1VQBA 4GS3A 4QB4A 3TEHB 3S16B 3DWAA 3TP6A 3AHUA 2O9VA 4DF7A 2LQ8A 2EYPA 3H6ZA 1YJ9Q 2L89A 4NDXA 5IYDH 2RSNA 1CA5A 1QCOA 3CPWP 1EY9A 1E1TA 1BCPB 2PQAA 3T9NA 2EQKA 3BVMA 1RABB 5CAIA 1JB0E 2KUMA 2YTYA 3EFOB 1KQSS 5IODA 3I3CA 2JA8G 1BI2A 4HXJA 1JJCB 1TWHH 4RG8A 1GKHA 5EAYA 4JUVA 2J6KA 1VQFA 2I5MX 4BA1I 3NBHB 1ESRA 2E65A 5IYDG 5GMKi 2EIFA 2O5IC 4L59A 2D62A 1XMOL 2E6ZA 1LNXA 2NZOA 3L1AA 5C5MA 5KE3A 1NJIR 4OO1H 2E12A 2X51A 4M7AB 1PHJA 3UI2A 4X9DA 1Q82U 1BO0A 4P73A 4HVUA 2LZ6B 3OSSC 4KHPQ 4EMKA 4RKUE 1PZKD 2GVBA 5M5XB 1I4QA 4YCVA 3HOXH 2WV6D 2KE9A 2DUDA 2M51A 5IP9G 3I4NH 4CHTB 4JC0A 2LKVA 1ZXTA 1G6PA 1A3TA 1RADB 1WTOA 3CC4T 1HUNA 1CZWA 1ENFA 3MKDA 2A6HC 3MP8A 3OW7A 1V9PA 4R8IA 3F2BA 5GANj 3LWEA 3ZEHA 2NN6H 3JCMJ 2NWGA 1X6BA 2BUDA 2KDSA 5FU7B 4R4IA 4A75A 2L3RA 4J83A 1A2TA 2V26A 5IP9H 3I4NG 1NMGA 2LNHB 1SNMA 1FGBD 1FNVA 1QCNA 3HOZG 3DLLA 1JEGA 3NXWA 4LNPA 2HHHQ 1DONA 3RZDH 4C92B 4J6YA 1A3UA 2EJ9A 3CCQQ 3CD6A 1WTWA 2KRNA 2QCPX 3GV6A 2HMAA 4JI3L 3PO2B 3HHTB 2NB0A 2EZVA 3ICEA 1A0IA 1NZ9A 4B6MA 1KC8U 4DBQA 3Q24A 1K0XA 4IPCA 5M5WB 2UXDQ 2A7YA 3S2HB 2ED1A 4C8QG 1OXXK 1XTDA 2A36A 2OEOA 3VV0A 2KENA 1KDAA 2YLCA 2DJQA 2W10A 3BDLA 2B29A 3S15H 4ME5A 4LF8Q 3EGDB 1B9NA 1D5ZC 4JI5Q 2HEQA 2DF6A 5KE2A 4MN3A 4FNFA 1UE6A 3V05A 3G71Q 4PZ7A 4QQBX 3MHXA 1YWPA 1AN8A 1WHGA 1NM7A 1EOVA 4IURA 4RKLA 3RD4A 1KSWA 4C92C 3JCMW 4N8FA 1IBLQ 3PUYA 4L63B 5D3DA 3FMCA 4ZQ3A 3SK8A 1NCVA 3Q1JA 1QVGP 2KEDA 5M5YH 4YHHL 4GZYC 4WTOB 1PKSA 4M7DB 5J26A 1KDCA 1Y1VG 4D6WA 3NEMA 3NPPA 1EFID 1D1KA 3GTGB 2IY5B 3F2CA 1VF5C 1AWXA 2LS01 1D3BB 3UF4A 1Q8IA 2K4YA 1EEID 3MP6A 1JICA 1QCFA 2K2VA 2M2LA 2MNAA 4LFBL 3SK5A 3CCSQ 5NUCA 4LF4Q 1VQPQ 5I2YA 2LDMA 2FEIA 1TSFA 1OPKA 4XK8E 1BI0A 3MPUB 1IBMQ 2QTVA 2A69D 1BU1A 1RI0A 4JV5L 1HZCA 4JI4L 2BZYA 2X3WD 3EIVA 4X66Q 2M02A 2MYSA 1SSOA 3S1NB 3CMAT 4ZGJB 1JJ2P 2AUKA 2Q2IA 3I72A 3JC66 1LJOA 1R9TB 3QG1A 4DN4M 5I9OA 1HJPA 3RR6A 1VQJA 3GP7A 2Q2TA 3R6NA 3BVZA 3D31A 3HOWG 2JA8B 1R4QB 2RHSB 4LWCA 2E5LQ 5LJ3h 1SEBD 1GVPA 1PTOD 1WXTA 4HMIA 4IZ8A 4QT7A 1IGUA 5A0LA 2Q8RE 5KYUB 2VQFL 3R93A 1MSHA 1Q8KA 4A3DH 2JA5B 2P84A 2EYHA 4F88A 1ZUKA 3SVMA 3LH0A 3M55A 1M4ZA 5FU7C 2AK5A 1LM0A 1ZUUA 2HD0A 4I7ZC 4YCWA 3D6WA 2M1HA 1N8RC 2EJGA 4GY5A 1PYSB 2GFAA 1MNDA 4A3CG 4O0AA 3GTJB 3E9GA 4AMCA 3HKZG 3O13A 1NJIU 5FLMG 3HRUA 1TT2A 1QWFA 1LABA 3T4AC 1KC8C 4KGZB 2EYMA 2K01A 3HTRA 4IOCA 3MAQA 4N4GA 3QUIA 4M7DF 2WINB 3KLWA 2QDYB 2GNCA 2KYMA 3PUWA 4PJOE 3OW2A 5M3FG 4ZTJA 3OWEB 3UDFA 1VQPA 4OMNA 2NTTA 2VQFQ 2LTOA 3V8LA 3M57A 4HR7B 1MMGA 3NFCA 1X27A 2J6OA 1BIBA 1VQ9T 5I11A 1K8GA 3K7AH 1RDPD 1YP5A 2WP8J 5FO8B 1KXLA 4M77F 4IFDG 2DNEA 5JJKA 2ZPEB 4PZ8A 1XWEA 4OMQA 1AWJA 4JJNK 5KEEA 2XNAC 4R4QA 4DAYB 2EYOA 5I9PA 1VMCA 3EROA 3PO3H 5FWCA 2QEJC 4HSPA 2B2WA 4J15A 5GAMe 9ATCB 4JCVE 2VGMA 3SGIA 3M7GA 2MOXA 2ID0A 5ELCA 2QQRA 3RLNA 4LFBQ 3H3VI 1UDLA 1PSFA 5LJ5h 4UPAA 3VA5A 4GLMA 3RZOB 2PVGB 3TEEA 1KLUD 3VS5A 1G2SA 3QB3A 2F03A 1X32A 4DUZQ 4BD3A 1IRXA 2DL8A 1MIUA 1KAWA 3BZKA 4OB3B 3NP8A 4AYBB 3T13A 1PTOF 2EXDA 3VYHB 3LX0A 1Y71A 4HJ5A 2XIDA 3AB9A 1I4K1 2KSSA 4C8QB 3BDUA 5A2QE 3FP9A 1Q95G 3A55A 4DR2Q 5GMKj 2ZGWA 4LE9A 1YI2A 5GJWB 1KQSA 1G2TA 4FU6A 4LDUA 2MO0A 2IVWA 1UAPA 3HP3A 1PCXA 2CCZA 4A93G 4L5RC 5GJVB 1IHVA 1VYVA 3M53A 1SE4A 3D7SB 2FJ2A 4OGCA 1VQLQ 3P7JA 3OWFA 2BOSA 2AHOB 2PO4A 1H641 2TSSA 1WHKA 5D6YA 2LQKA 1X3PA 2YSQA 4KD3A 4PNYA 3TQYA 4PQXA 3AMUA 4M1UB 1EFWA 1PRTC 2PZ1A 1YFNA 5FKAC 2EY1A 4A4EA 2FRWA 2HL3A 3URGA 1Q81U 2CZ6B 4PJOG 4RA8A 3M59A 5C3EG 1N33Q 2D8HA 4AFSC 2I5LX 1PG5B 2G9HD 1Q82C 2QF7A 2H3JA 4S3SA 4B3MQ 5FJ8H 1OZ3A 1YJ9A 1VQNT 1SMYC 4AFUC 2WFWA 2HUGA 1XPOA 2F0OA 2C5CA 3M3YB 3G6ET 3J7ZC 1DOLA 1HZBA 2DBKA 3Q0AA 4HEDA 1PH6A 3WVEB 1YI2T 2KHSA 2QXFA 3E2UA 2CP3A 2RCFA 2AIRB 2FZGB 3PNWC 1XX8A 4AG2C 1W70A 1LTSD 3RMHA 3I9QA 3L2ZA 1UHFA 3LWIA 1N34Q 1BF4A 1S5CD 1KRSA 2EJMA 1DXMA 3FC3A 1SN8A 5IT9E 3N6RA 5M3MG 3NHNA 3EG9B 3N52A 3AFQA 1YNJD 2AZSA 2DYIA 5KCOA 4K5WA 4QQGA 4WFN3 4XTZA 2Y0SG 1WTQA 4H0LC 3CCRT 1TWCH 2DERA 2LMCB 2IHEA 3JCMh 3L7ZC 2JW4A 3OYBA 5FW9A 5M3FB 3HFZB 1V1OA 4A4GA 1VA7A 1SYBA 4C92A 4EQNA 4JOIA 1SDFA 4LF6L 2DD4A 1WTXA 2LX9A 5I21A 4J9HA 1CFMA 3KUFA 4A3KH 1EQQA 2K14A 1G51A 1Y14B 4MTNA 4ZN3A 1N8RR 1K0RA 3HOYB 4G57A 3PMTA 1KABA 2JMAA 3HKZE 1EY8A 4KBMB 1H9MA 4M7DE 3MXGA 3FLGA 4ZTFA 3BDCA 3OSOA 2LJ1A 1S72Q 4JBWA 1K8AU 4XQ3A 5CCAA 3LWHA 3T53B 3M3YH 4Y7NB 2ZPFB 3M0TA 3QKJA 1C6VX 2PNRC 4FT2A 3F8TA 3FB9A 2MF2A 2Z4HA 1MMDA 4CI0C 1MI2A 2W0ZA 4CJ1B 1UNSA 1LTID 2LQNA 4R9WA 1A62A 3TREA 4IUQA 1W2BA 1TWBA 4ID6A 3RN5A 1FJGL 1Q7YC 1N9SA 3OYFA 2RHXA 3FDTA 1TQOA 3S24A 5GAGC 1VQMQ 1TWCB 5C6SA 3J7AF 1OXSC 2GQVA 3ZYYX 4ME7A 1V76A 1H9KA 3OS2A 1Y07A 4HCCA 4NXNL 2K28A 2XMFA 4RKBA 3FJ5A 1GXDC 4ZRZA 3BE3A 3UWNA 4A3JG 5IXBA 1ML0D 5C3WA 2ED0A 2YXYA 3E9FA 2YYZA 4B3RQ 1D09B 1H9SA 5KRUA 4Q0FA 5LMNQ 3LH5A 5C4XH 1XNQL 3E3XA 2DNCA 3TSWA 1YZ6A 1Z47A 5GANe 4KUDK 2QEXQ 1F1BB 3BW1A 4DV6Q 3H8ZA 1HJDA 3KBXA 1YHBA 4J9DA 5IP7H 1LTAD 4HJ8A 2DO3A 4RTUA 4WCIA 2EYQA 4J1MA 4A3DG 3K59A 4RCNA 4XU3A 1TS5A 1B7TA 1HXYD 1VQKT 3A1PA 1YNNC 2KI7A 4ABNA 1TTHB 2A0FB 4NW2A 5I2SA 3GTPB 3K7AB 3OHXC 1P92A 2O9SA 4OO1G 2IG0A 2HIXA 1JT8A 3G4ST 4KI0A 4J6HA 3S9WA 3I56Q 4G7OC 2JXBA 2K50A 2CP2A 2AQ3B 5EKLA 2KK4A 1O78A 2K1BA 3C3LA 1D0XA 3NBHA 1G3WA 1F9RA 1UE7A 4N9PA 3LGJA 1ZBXA 1DD2A 2MPXC 4NKLA 1OXTA 3M0QA 4DPGA 3HRZC 4A3KG 1I8FA 2F0NA 3L2VA 1WTPA 4PLIA 2KNBB 1RKNA 1NR2A 1B50A 1J8IA 1GHJA 2F4IA 4M7AA 4P72A 3FHWA 2GTJA 2ZCFB 2KVMA 3PTAA 2NVTB 4C5GA 3VS3A 3OS1A 4EMKB 3NK9A 2OTJT 4J9CA 4F87A 4A3DB 4P74A 4POGA 4L5GA 1H3ZA 1FYCA 2V1CC 2RA4A 3F70A 1BKBA 4M77D 1QE6A 5KYYA 2JQOA 4JJBA 4UDUC 4EX5A 1N36L 2EW3A 2CSQA 4HTHA 2AWOA 4UC4A 1QZHA 3OYDA 1RODA 2D9UA 4AYBE 2CGHA 2XRSD 3M0SA 2OTJA 3A8HB 3G1JA 3S1NH 1PZID 1IZ6A 1XJWB 1RAAB 3J81j 2RK2A 3G7ZA 1M5Q1 3U9OA 5LJ5f 1VQ8Q 1XNRL 2N55A 3RBBB 1GUWA 2I46A 3HOXG 4F7UG 2IW3A 1Y0MA 3C1FA 2RI5A 2QTXA 1V1CA 4M77B 2B2TA 2EJFC 2JTEA 2K7VA 2RKSA 1VQ5Q 4R55A 4CC4B 2WKCA 5KYLA 2K05A 1YCSB 1W2BP 1PD0A 2KCTA 1YN8A 1FMKA 5CO7A 2P5ZX 1QP2A 3ULRB 3A8IE 2AUJD 1QVFP 1WJSA 1I4HA 3K6OA 3L9AX 1LACA 2ES2A 1O75A 2EGEA 1VQ7A 3I70A 4AQYL 4HA8A 2HDAA 1EQTA 2JK8A 1EIHA 1VQMT 4BWGB 2RHQB 2NVXB 5C4JB 5M5YB 3X3MA 4FYVB 2BZ8A 1M30A 4DXFA 3PFSA 4DQ2A 4GKKQ 3PUZA 2ZM6Q 1Z6HA 2AKLA 2B63H 1UJYA 1E2WA 2JYOA 4XT3B 1PTOB 5CV5A 1H95A 2I0NA 4OF1A 4GNXA 4C8QF 3PUXA 3H3VH 1X56A 3EG3A 4F14A 2ZJPA 2A8VA 4QQDA 5CKHA 3CCST 3CCVQ 1JORA 1B07A 3EQLC 4RTTA 3K5NA 5GAEC 4DV5Q 1OI1A 2MCNA 4BB7A 3X24B 1R4PB 1H9JA 2HKNA 2QQ9A 1EWIA 1YNND 4KY5A 4QCLA 2RHUA 4HCSA 1RAIB 2OX7A 3S2HH 4DK6C 2OJ2A 2NZHA 2VVKA 4DV0L 3L42A 3I4NB 4Y91A 5E1FA 2K33A 4QQ6A 2M0YA 1WHLA 5G3LD 4F17A 3DMUA 3VS2A 2UUAL 1KLGD 1V29B 4D8DA 2VKNA 4WJWA 4TVRA 3HP9A 4BE1A 3QPHA 4BDYA 4DV5L 2WIIB 3VYTA 4OMOA 5M9OA 5HGQA 1K83B 4GOPB 2R92G 1ZSZC 1A3VA 4X3SA 1F9PA 1UG1A 2MPMA 2K04A 1TG0A 4BXXG 2N78A 3HKSA 1VQCA 1E22A 2DN8A 4JVZA 4ZUJA 4JI1L 4OGEA 1D6EC 2B2VC 5ELBA 2JM9A 2A73B 4YY3L 3EG9A 4A3GG 2H4OA 5CBAE 1G6ZA 3EH1A 3ERQA 2YHTA 1KC8R 2PI2E 1SYCA 3G6EQ 5FLMH 3ASKA 5KYXB 3C2PA 1LT3D 3CPWA 4FXKC 1X2KA 1KG1A 4JBMA 5KYUA 1X6OA 2JM8A 1M4VA 2JA6H 4DEYA 5EKKA 1TR5A 1I5OB 1I6HB 1XNQQ 3LW5E 2A28A 4DK3C 1STBA 4N8X1 4GOPC 1FGUA 2B2WC 2DNUA 2RQXA 1FNUA 3TDQA 1JBMA 4IKFA 4R8NA 1E7OA 4C3JB 3WVDB 3MC0B 3TSSA 1M1FA 2KQWA 2MJ8A 2VS1A 4DV3L 1EYDA 4C3HB 2XKOC 1LVKA 3TS2A 1K9AA 3T1HQ 2F1MA 4C8QD 3G7LA 3Q8DA 1V1PA 1PKTA 4OX9Q 2E2IB 1M1KR 3HRSA 4C1NI 2JVVA 3CC7A 1EY4A 1I5FA 1ET6A 4QIWB 1RUWA 4M75A 3H9NA 3H0GH 2R93G 1HFNA 1G83A 1CKNB 1I07A 1NE8A 2FZKB 2OI3A 1U4LA 1VQHA 3PMIA 4BUGA 1VQLA 5F2DA 3V96A 4EQOA 1QILA 2HIVA 1ZA2B 4V0BA 1GUNA 3A8JE 1RTNA 3E0JA 4X65Q 2BA0A 1TS9A 5C3EB 4Y52H 2PUKB 4KKTA 4JW0A 1Y96B 1B4OA 1E3PA 2KECA 4RHSA 4TSSA 1FXXA 3CMEQ 2H1EA 2NUTB 1QUQA 2HQXA 4IUNA 3AEVA 1XNRQ 1GUSA 1YJNQ 4I7AA 4HCKA 2TMPA 4OO1I 4QIWE 1CA6A 3KFUA 1BB9A 5A0GA 4O5VA 1S72A 3FEWX 2EYLA 1HNZQ 2WAQE 3KFVA 5GAMh 4UP8A 4YWLA 2PU9B 4GBQA 2CQOA 4FF2A 4A3MG 3S2DB 3HSBA 1E6HA 3TU4K 3W1GA 1XNIA 3EHRA 1WHJA 1K8AC 1V8QA 4LFCL 1JJ2S 5IYBG 4IJHA 1UGVA 3A8GB 4MZPA 4PJNA 3JRZA 4QVDA 2PYKA 2NLUA 2EJGC 2PQEA 3OTOQ 3L2WA 1UTIA 1UGQB 1LLRD 1KRTA 4X65L 3CC7T 1PLFA 1M1KC 3PIO3 4JV5Q 1K83H 2G6FX 4PMWA 2B2YA 4II1A 1CKAA 4GKJL 1I50H 2V8JA 2DK3A 4JYAQ 1BI3A 3N5BB 5GAN4 2CZ1B 2WAQB 4KHZA 2JA6B 3A56A 4OB2B 1KQ2A 2F0MA 1E24A 5I2XA 2DFUA 2OCEA 2FFKB 1T3LA 2L15A 4F7UF 2L5QA 2Q2HA 1WYDA
chains in the Genus database with same CATH topology
1MSGA 3J7YW 1XQHA 2C9OA 2R6GA 2ICEC 4XU2A 4OL7A 3QYGB 4CKBA 2V8IA 4X3TA 1HXDA 4NOYA 3ER0A 1AEXA 3DEPA 4A3GB 3NQIA 2F5TX 4FO2A 2Q8IB 5LHY1 1E0BA 4KY6A 1NUCA 1DJ7B 1RTOA 3K5LA 4EMHA 4Q5WA 3E1SA 1Y96A 1MGSA 1I3QB 4DGZA 1I4PA 1KNAA 4XTVA 3QWNA 2AQ1B 3MXUA 4HSVA 4J8QA 2JP1A 4OB1B 3JCMc 1SXTA 4RGNA 3OMGA 2X4JA 2DTHA 4M75E 3FRNA 1C48A 1VQ6A 3RUZA 5I6WA 3GP8A 5K5PA 3SR1A 2F0LA 1Y8OB 1Y69U 2E10A 1YIJA 1EZ6A 1VQPT 2MUYA 2ZPGB 1SSFA 3KUPA 3OIPA 3VR3A 2P0PA 4HCEA 4M75C 3DKMA 3CRKC 4M7AF 3M4GA 5CKEA 2VC8A 3X26B 5A0DA 4HCZA 2E1HA 5BN4A 5ELEA 5FLXL 3QO3A 4KKSA 1EY5A 5GMKm 4FSXA 4J7FA 3OSVA 4QUCA 3X20B 3ZBDA 2RI3A 2VB2X 1VQ7T 3OYLA 3SWNC 1Z7TA 2RBMA 3A7AB 4M78A 1AW7A 3K5MA 1SE2A 3CMAA 2EQMA 2BCOA 1EOTA 2R57A 3BZDB 3SE0A 3C1EA 2PVOB 2ZXOA 2M9UA 2L4NA 5C0XG 4A3MB 3WOFA 3FJPA 2DXTA 4QF4A 4KJOA 4L6TB 1DJRD 4M7DG 1Y1VB 1OO9B 3Q23A 2BKDN 4JRIA 1B53A 2X4YA 5LL6X 4N4IA 3L3OC 2D0QB 3OQ5A 4C1NK 1GHKA 4M7AG 5C4ZA 3OBYA 3SEBA 2FMMA 1BOSA 2RSOA 1W2BS 3RLFA 1IKMA 3IFTA 4FT4A 5LJ3g 2PW7A 3QZ9B 5DNFA 2A5HA 2RHIA 1BXTA 5AFWA 1PMRA 2JOYA 2PQWA 3NBIA 3VKIA 4ZGDB 3M4OB 3ME9A 4GLKA 2JA7B 1STNA 5CV4A 3C4SA 3TN2A 1Q1BA 5FU6B 2L1BA 1M9SA 2KVQG 5GMKl 1HK9A 1YITT 3HOUB 3FEOA 5GMKh 3G4SA 4PMCA 4CJ0B 4NMZA 2RB6A 4B9XA 1AFPA 2MWOA 3M9QA 3OS5A 3S17B 4XQQA 3TBIB 1VQOA 1VQKA 4M78B 3MEWA 1U4MA 5EPKA 1V1PB 1O7ZA 3JB9H 4DNTB 4KN4C 1HTLD 3RKWA 4C0GA 5BN3A 5JEAG 4NL2A 5IGCA 3GD7A 5FRMA 2XIWA 4ZKCB 3TZDA 1IKLA 3P8HA 4BACA 1SNDA 1DOKA 2J7ZA 4L6V5 3CCJT 3NTKA 5C4HA 4PNOA 3D4RA 4KY7A 3WXMB 2XRQD 1MBYA 4C92D 1MHNA 1CHPD 4PLLA 4IFDJ 3A54A 4CKCA 1BIAA 5A2QL 3J80L 1K9MC 2L9HA 4IFDH 1QB5D 4RCOA 2DKGA 4A3KB 4HN7A 1D2BA 3QOJA 5ELDA 4A3BB 2BE5C 3S1RB 3Q6SA 1U4RA 1C4QA 3C46A 4KTAA 5EBDA 2KCCA 3ND9A 4F7UE 3TP8A 5I4DA 1V43A 4FVMA 3T56B 4CRIA 3GLXA 5LJ3j 4QUFA 3OY9A 1GUOA 2BDNA 4HCBA 4A93B 4P2CB 3VYRA 5CV9A 5CK9A 1Y1WB 4Q5VA 5DLQE 5LJ3d 2DJZA 1YJWT 2YU9B 2E6NA 1F2MA 4V2SA 4MDXA 5KIXA 1VDZA 1B1ZA 4FM4B 4F7UB 4LDWA 1XXGA 3K0YA 3L2QA 1MGQA 3J80E 3DM1A 1TH7A 2F5KA 1PZJD 2RVLA 1B3AA 4PJOA 5JJZA 1W4SA 2PCFB 1NR4A 2PZUA 1HTPA 2XU8A 1TU2B 3EA6A 4BDZA 4XU1A 1STEA 3OYGA 3CBPA 3QJYA 3S14B 3JCMP 5GAMd 5J3BA 5CKDA 1Q7YU 4EDUA 2O4XA 2SEBD 2A6ED 2JN0A 2M16A 4BA2I 2E76C 2Z4IA 3CCUA 4FXGC 5GAOq 4K6LA 3FKIB 1BI1A 1E2ZA 1N6AA 2XD0A 2OT2A 4M7DC 5EBCA 5J1ZA 3H3VC 3M54A 1O7LA 2OF1A 2KCNA 5KH6A 3SDZA 4E6IA 1ZHIA 3VR2A 2A68D 2F0VA 3A8MB 3CXCA 2G9DA 2CVRA 4P5NA 5GMKe 4WF2A 1UB4A 1B34B 2J0TD 3GQBA 4FF1A 4BBSB 4E7JA 4F7UA 1QVGA 5GANg 1TWAB 3JAML 3NWSA 2R5AA 3T16A 5I2MA 2K03A 2A74C 1TY2A 2VUMB 1PFMA 5DM63 3QO2A 2VXFA 1M90U 5FO7B 4A3JB 3OW2S 5A35A 2LRQA 2HCIA 1WJRA 5GAN6 4PJOB 4ODGA 1ILQA 5IOCA 3JSCA 3Q22A 2FMCA 1QCBD 4H7BA 2GFUA 4E47A 3OIQA 4BY7B 4XQJA 1PTOC 2B39A 2R7ZB 5GAMf 2DD5A 4TKOB 2P0QA 1VQ9A 5EGTA 2RM4A 5CBEE 2EYJA 2FHDA 3R2TA 5LL6S 5CV8A 3HKZB 2K6AA 3BDOA 5KNBA 3I56T 4A3IB 1YHQA 4HKEA 5GAN8 3CC2T 3CKIB 4YIJA 1YJNT 4RFBA 2DZCA 1GUTA 2E5QA 3T51B 2F0UA 1TIID 1SAPA 3VJPA 5J22A 1F9SA 1TWGB 4C5EA 1VMPA 3D3RA 1EY0A 3HGBA 1RCVD 4MDWA 1U9RA 1JJ2A 5CYUA 1HQRD 2VGNA 5C5LA 5IAYA 4C3HG 1DZ1A 1SNCA 4DU9A 2NVQB 4E7IA 4BBRB 2X6GA 4ZGEB 4FF4A 3KF8A 3QOLA 3V2TA 3JCMd 4J5YA 2LVMA 3QHSA 5E3FA 4U68A 3K58A 5GAOr 2VUBA 2ZPHB 3HZXA 3I4MB 3MEAA 4G4KA 3OA6A 4EVOA 2HCCA 4PJOF 4A4KA 2AQ2B 2DXBA 3EFSA 1Q86C 5HKCA 3W3AA 2GCXA 4M8AA 1A6XA 4M78F 1STHA 3LYIA 3E5SA 5JOBA 5C44B 1TKWB 2A68C 3CEYA 3M4YA 4C92F 5D65A 1K9MU 1G291 2E2DC 5EPLA 4C3IG 1YITA 1B2TA 2DPPB 1HA5A 1BYMA 4HT8A 1B9MA 1SYEA 4XTWA 4ILWA 2R3ZA 1PRTB 3CCRA 3CRLC 2FVUA 2G3RA 5JVH3 5TSSA 2QEXT 3CMEA 2RA2A 3JCMf 2A3LA 3RUXA 3CCVT 4K5XA 3KXTA 1PDQA 4BI8B 2BDOA 4ZKBB 5K36H 1QG7A 2RD1A 2DTOA 2MMPA 3OB9A 3P20A 1HCZA 2RJFA 1IL8A 3CCLA 3SK6A 1R8OB 1BDOA 4XTCS 5C3XA 2CZ0B 4OMFB 4RG2A 3RIRA 3OYAA 3RERA 1EQVA 3MXPA 3BY7A 2QA4T 3CCUT 2DXUA 3CCEA 3MHBA 1G5VA 2BA1A 4K14A 2E74C 1NPPA 2V4DA 3DEOA 4LK1C 1JOKA 4VUBA 2CW0C 1G8ZD 2K5QA 4C0ZA 4RWSC 1O80A 3MEUA 5CR2A 3CCMT 2M0OA 4CJ2C 5GAMg 1QVFA 3RKYA 2B2UC 1WCMB 1NSNS 4MMKA 4C3IB 4A53A 1YNJC 2IPKD 3D4DA 1XTCD 2RHYA 3CC4A 4F8MA 3NUCA 1VF7A 3R6OA 4IUTA 1VQ8T 3X3NA 1ZEQX 4E7KA 4JRQA 4M77A 1O7YA 2JSOA 3RZDB 3GF5A 4HMJA 3MCAB 1Y8PB 2BIVA 4OIJA 2MWPA 2ZZDA 3OYIA 4E7HA 2K3XA 2FINB 3U9SA 2QQBA 1VQ6T 3OYKA 3DB4A 1KD1U 3I73A 3LNNA 2Y4XA 1QNUA 4XAXB 2HDLA 3VR6A 1SFOB 1AHJB 3NTIA 1JCKB 1M1GA 1X01A 4PKCC 1QVGS 2EPBA 5IGBA 4KKUA 5EQ0A 1PSEA 3JB9J 2F3VA 2RJCA 4XTXA 1U1SA 1Y8NB 1ICWA 4K5VA 4Y28E 1G3SA 1B34A 4X9CA 3V8JA 2F0IA 2KA7A 1HA6A 2CQAA 2Y0SB 1EWCA 4FP5D 4IUPA 1EIFA 4JDSA 2RO0A 5CR3A 3VUBA 5FROA 3EJIA 2SOBA 4XXEA 3J81L 4IALA 2L5TA 4RGMA 1JOQA 2D5DA 4X3KA 3HRTA 2XG8D 5GAN3 1EZ8A 3KBGA 1PFNA 4X3UA 2D2CC 3SHLA 1CTMA 1STYA 5HK3A 1SYFA 1W6KA 1N8RU 5FRNA 3DWQA 2Z8LA 3CQZB 1PTOH 4M78G 4XYOA 1S5DD 1WTRA 2RHZA 3V8KA 2XDBA 5GAN7 3JB9D 2A6HD 3P75A 4L8JA 1BCPF 2RDFA 3BFMA 3CCET 1BUVT 1ZQ1A 3OYMA 3QZ5B 3OYJA 3GTLB 1LTTD 3PO3B 4KUIA 2L8DA 3E19A 1ENAA 5C6AA 2EFIA 4FIBA 2EYFA 5KGUA 2ENBA 3HOWB 4ZUIA 5ISRA 4M77C 1NJIC 2NTSA 4WRDA 2QEXA 4XYQA 2EQUA 4O1NA 1EWHA 1LT5D 4JLGA 4M77G 4NL3A 3HEJA 2DAQA 2F0HA 4OGQC 3P1HA 4QW2A 1X3QA 5GANf 1DYQA 1T5EA 5EPJA 4HT9A 3CHBD 4TQUS 2OTLA 1QWYA 1PYWD 5EJWA 4JS5A 4XQNA 1CQVA 1G3YA 2L11A 1TS2A 1OYXA 2E41A 2P0KA 3X28B 2K5FA 3I90A 1LV9A 2IWHA 1SYGA 3H09A 5IIFA 1LT6D 3JB9F 3C95A 1CK1A 3GPLA 3META 4K8IA 2IT1A 3DXJC 3VA7A 3CPWS 4RH6A 1HQMC 2XSCA 2B2UA 4FF3A 2E70A 3JCMe 1SE3A 2MGSA 2XWJB 2E2JB 4KN7C 2FYKA 1FNWA 4J7IA 1W6JA 1I5LA 1WJQA 3UPUA 2L0CA 2LC4A 1YJNA 3X25B 4PV1C 3CCQA 3HFNA 1CT1D 1ZYRD 2SDFA 3CCSA 2I2LA 1J9OA 1DCZA 4DK1A 4ZLTF 3CCQT 2LY7A 1VUBA 1EY7A 4X34A 3TP5A 2EJFA 2EE1A 1I81A 1Q86U 3EFRA 2PMZB 3UDCA 1Q1EA 2K5IA 3P8DA 5LJ5e 4EQPA 2LT4A 3JCMX 3OOCA 3D4WA 3PIPA 3OYEA 3I55T 4QVZA 2VV5A 1QNKA 2MAMA 3UT1A 2WSFE 4XTYA 2O5JC 1SYDA 3RMSA 2D9TA 5COYA 2L12A 4B9WA 5CKFA 3SFMA 2IJ0A 4BE2A 4Z9CB 4RCCA 3NTHA 3OYCA 3TCJA 1WD0A 5DM73 2LCLA 3FPUB 5GAN5 5E4WC 4BI4A 1X75C 3G71A 2BE5D 3K5OA 1KQ1A 3D8GA 4C0FA 2EY2A 3RKXA 2K3YA 3I8ZA 2R5MA 1D5XC 2OTLT 1RJTA 4ZAIA 3TMEA 2K32A 4IFDI 3WDNA 2DXCA 4CBVA 4EGVA 4XIGS 5KNDA 1F2ZA 3CCMA 4YTLA 3S3OA 1JOOA 2WSCE 1U4PA 4IUUA 4N0AC 3PUVA 1VQ4T 1VCIA 5CIUA 1KHIA 4PJOD 2WB1B 2NN6G 4DOWA 3LGFA 4LDYA 2QDBA 4LD9K 4ZN1A 3RESA 5EKIA 2XDDA 4RMOA 1M90C 1BQQT 4M78D 4DA4A 4MMLA 3QDRB 4M77E 4M7DA 2QA4A 5IGEA 3L2RA 1AP0A 2X4WA 3OS0A 2CS7A 4XTUA 5T1IA 3SXHA 5GAOm 1Q3LA 4H13C 4ZK9B 3SD4A 1D3BA 3L2UA 1GUGA 5CQYA 1EYCA 4M75F 1IW7D 2F0DA 2E2HB 4BE0A 5IGFA 1EU4A 3EVQA 1JWSD 1FR3A 1BCPD 2VNUD 1JR0D 4JRKA 1RD9D 3VUZA 3CBOA 1G3TA 4QVCA 1JWUD 5BN5A 2X6LA 3V7CA 1VIFA 1I4XA 3GTQB 4BY6C 5CV7A 3V7SA 2O2LD 3MXNA 1TWHB 3J7AV 3QSUA 3BYYB 4H44C 2XICA 2HDMA 3LX7A 2CZ7B 3QJ6A 2CW0D 1JRIA 2DIGA 1I6VC 3GTOB 5L8RE 1EEFD 3JCMb 3GV3A 2EQJA 1RF2D 1HPCA 3EAEA 3VR4A 3CBMA 3H0GB 4ELZC 3MP1A 5IT9L 1WD1A 4KMUC 2O01E 2L55A 2IX1A 5GANh 1PRTF 5FLXE 2JNGA 1QVPA 3CCJA 4XT1B 1STAA 3DWPA 1F9QA 3EFXD 1MD2D 3IAYA 2EY5A 2XWBB 2K5LA 4M7AE 3GIBA 1L0YB 2NBFA 1UGSB 3PGGA 2DZ9A 1YHQT 4M7AD 1JB3A 5KNCA 1SNOA 5J39A 3LGLA 3OYHA 2F0WA 3D6CA 1YBYA 3J81E 2EXZA 3NSWA 3BVGA 5JVG3 4FYDA 1QJOA 2IL8A 5DM7R 4A3FB 1U1TA 3CXCS 4OIKA 4A54A 1C8CA 2E75C 1ILPA 3HOVB 1Q81C 3AU7A 2RJEA 3KLSA 5HY6A 3S1MB 1TY0A 4UAIA 2HBPA 1WNLA 2F0FA 1O9SA 2RI2A 3ND8A 2GA4B 1PXUA 3GTKB 2DIQA 3NE5B 1JC7A 3NQTA 4K6DA 4C8QE 2KY9A 2OAUA 3KLRA 1BNZA 4BY6B 2LT1A 2R58A 3ZFJA 2KAFA 2XVSA 1LT4D 5EG2A 3QBYA 3S6WA 1WQ7A 1EY6A 5LJ3e 2A69C 2ZPBB 2B2VA 1IYUA 5E4XA 3JCMg 4JRPA 5D14A 3MFGA 5FU6C 1H9RA 3JAME 4C56C 1F2YA 4ZYSA 2PUOB 3H91A 4Z02A 2F0GA 3CCLT 2X69A 5D3IB 4C92E 4NP5A 5D6XA 3S3NA 2EOTA 1KD1C 3BYTB 3TP7A 3V7RA 1WTVA 4DOVA 3CCVA 5K36G 4EMKC 1CHQD 1LO5D 2O4XB 1LTGD 4MIUA 2M00A 2E64A 4RCBA 1UUPA 1CZGA 5ELFA 1II3A 2K5DA 1XYIA 4KULA 2LFNA 4R56A 1D5MC 2F0TA 2KEEA 3QIIA 4KJNA 2JUFA 2HAXA 2Z1CA 1SNPA 4M7AC 1K8MA 3MA2B 3HS0C 2YLBA 4DA2A 1IREB 3QXEB 1F2LA 1JQYD 2IX0A 3VYSA 2CHBD 2B2TC 2NYZD 2XK0A 3BG3A 1OZ2A 5C0MA 1A2UA 2I07B 1YJWA 5CGKA 1UGPB 5FOBB 5GAN2 3PMFA 1M1KU 5M3MB 2F69A 5DLOA 4DAPA 1N9RA 2Q8TA 5IGDA 1UEBA 3HOXB 5GAOn 1IYVA 2CYZB 5IGGA 4C0DB 3SWNA 5DY9A 1KDBA 4PMBA 4IUVA 2M9VA 4N9TA 4O6JA 1SBBB 1A15A 3MEHA 1AZPA 1FD7D 3RMQA 2EY6A 2N88A 3MZ5A 1M8AA 2J4XA 3JB9I 3A7LA 5CORA 4M75D 1S5BD 1H9SB 4LDXA 2B8FA 2JZ2A 1VIEA 2EKOA 3QIAA 4N4HA 2F0QA 3I56A 5CV6A 1Q90A 1AZQA 3HFOA 3R2IA 2KMTA 3IL8A 5GAOp 2DTIA 4G7ZC 3ITPA 3SB2A 3URYA 2IX3A 1I50B 4JK1C 3I91A 1U8RA 2XDPA 4CKEA 3JB9G 4OP0A 3A8LB 3IFDA 2RDGA 1DM0B 2RK1A 3SK4A 1E2VA 5CMDA 2PPBC 1GOZA 4JLIA 2FHTA 4J6XA 5CKBA 4DXGA 2QQAA 1SMYD 1ET9A 4A3EB 4RAUC 4OVAA 3F2UA 1LTRD 5AYFA 3INZA 3VYGA 2AWNA 1ONLA 4I65A 1L0XB 1PRTD 4B08A 2JEAI 3PIP3 1VQ8A 2WSEE 4C8QC 2AHJB 3DB3A 2F0PA 3VYUA 2B8GA 4KD4A 4CGYB 5D6WA 1S72T 1TS3A 5CVIA 3G6EA 3A8KE 1BR9A 2X4XA 2MI6A 2DEQA 1YJ9T 1VQNA 3WOEA 3CPFA 2A6EC 4DAVA 3MEVA 1DOMA 1SJED 2KOLA 2WKDA 2QKIC 2VYTA 1GJXA 3CD6T 1STGA 1HHVA 5C0XI 3TZUA 5HGTA 4C5HA 3H94A 1F77A 4C0DC 3M56A 2EAYA 3A8OB 3DLMA 4EMGA 1HRJA 1NPRA 5LJ3f 4NS5A 3CU7A 1OXVA 5JAVA 2PW5A 4LAAA 3GOXA 2R93B 2JTMA 2F3WA 1ESFA 4V190 3FIFA 5DEHA 1TWFB 4PJOC 1OXUA 1HFGA 4HAEA 1FWZA 4DNRB 2WACA 4MZTA 3CMET 1GXIE 2JTFA 3MO8A 2F0KA 4QMGA 3S1QB 5KCHA 2B2YC 3GNFB 4BI3A 1YCYA 1HUMA 4RHRA 2VB3X 2JXMB 3FPPA 3P8BB 2XI9A 1EIGA 3LWUA 3NWTA 5CC4A 1TVXA 2PZTA 4LDVA 1UGRB 1QOHA 4BY1B 3FRPB 4EPCA 5GAOl 1T5XD 4M78E 4JS4A 2RDHA 4RGTA 2B8AA 3I55A 1KAAA 5HURA 5GANd 1ENCA 5JPNC 3GO5A 3QYHB 4DAYA 3M58A 2ICIA 5T1GA 1S5ED 4KV6A 1I4RA 4FL6A 3FDRA 1M8VA 1EU3A 2QQSA 3ONAB 2PZWA 4A4FA 2B63B 2ZXPA 4M75G 1KNEA 2VXEA 1YIJT 4LJZC 3A5ZB 3HL8A 4U673 2VXWA 2XN9C 4OHJA 2RJDA 5CQXA 1XOVA 3C12A 4LD6A 1S5FD 4K8JA 5JEAH 3NHHA 4N0AA 4C8QA 3OYYA 2V8KA 3PT9A 4ELYC 4PL6A 4ATOA 3LLRA 4MHEA 2JE6I 3O8VA 1K73U 2LCCA 4E7LA 5JEAJ 1VQ5T 3GNGA 2FL7A 1VQMA 3KLSX 5LJ5j 2EVBA 2MHVA 1LTBD 3E6ZX 3PIOA 4KHVA 2C06A 2NN6I 3CC2A 3R8BA 3VR5A 1CI3M 1ZYRC 1WGSA 3OPOA 4IQZA 4F7XA 2F0SA 2F0JA 4G7HC 1EL0A 2P4TA 3S15B 3M85A 1ZKOA 3KK7A 2NVYB 4M75B 1CQFA 1VQOT 2JEBI 1NAPA 3W2DA 3S3MA 1KTKA 3K57A 2OXPA 1K8OA 3C94A 3IKJA 2R92B 2NZ1D 3SWNB 1QW1A 2SNSA 2ZT9C 4O42A 3DUZA 2CKKA 2MP1A 5JPMC 1QVFS 2K57A 2K5WA 4BS9A 1QP3A 5LJ5d 2HNIA 5GAMj 2YRVA 2F0EA 1WVLA 1G91A 2Y90A 4C2MB 3FVQA 2KJXA 1N27A 4KK7A 2X35A 3PV0A 1Q12A 2EWNA 1FX7A 2QILA 2DY7A 2LNVA 1Y7XA 1PFBA 1KHCA 3M7NA 3R3OA 4XDXA 1LOJA 4K2KA 3HOZB 5HK0A 3I4LA 4C3JG 1D1IA 2SNMA 4DFAA 5FO9B 1S4ZA 3VU3C 5LJ5g 3HPWA 4LMQD 5C0XJ 3M5AA 1VQLT 3OYNA 4OB0B 2D6FA 4C92G 3JCMQ 4M7DD 1JE4A 5C0XH 3OBWA 1K73C 5C4XB 1VQ4A 1EYAA 2DY8A 4DK0A 3DHQA 4ULLA 5IN1A 4RGOS 4J8OA 2FB7A 2PVDB 4TRDA 3GTMB 1UEAB 3MTSA 2QI2A 1B44D 1RHPA 4K2LA 3MVVA 1VQ5A 3H6MA 1RL2A 1IHZA 1I4GA 4KT0E 2XHCA 1IW7C 2NUCA 5KYIA 2DVEA 2Y4YA 1SJHD 2RH2A 5G3LF 4FXDA 4J6WA 1WPYA 2R61A 4IN3A 3G71T 1WQWA 2ZPIB 5FK9C 1BCPC 5I6YA 4C5IA 4M78C 4A4HA 2GF7A 3G6JB 2EDGA 1JWMD 5DAUA 4MZMA 3JCMV 4XU0A 1TS4A 3OMCA 2ZXRA 3MFYA 2HQEA 4WORA 3BS1A 3HG9A 1SNQA 1CM9A 2KQ3A 3MWYW 4QB4A 3S16B 3DWAA 3TP6A 3AHUA 4DF7A 2LQ8A 2EYPA 3H6ZA 2L89A 4NDXA 2RSNA 1CA5A 1EY9A 1BCPB 3T9NA 2EQKA 3BVMA 5CAIA 1JB0E 2KUMA 1KQSS