3NTKA

Crystal structure of tudor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
169
structure length
169
Chain Sequence
AELHNCVVVQFDGPMSFYVQMESDVPALEQMTDKLLDAEQDLPAFSDLKEGALCVAQFPEDEVFYRAQIRKVLDDGKCEVHFIDFGNNAVTQQFRQLPEELAKPARYSRHCELDASTISKCDAALLQSFIDTRFSETFQVEILATKGTGTHVVRLFYQSKNISEKLQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for methylarginine-dependent recognition of Aubergine by Tudor
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Maternal protein tudor
total genus 43
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ntkA02
2.40.50.790 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ntkA01
3FLGA 2HQXA 4II1A 3P8DA 2M1HA 5D6XA 3OYEA 2EQJA 1KHCA 3MEUA 2BIVA 4QW2A 2RO0A 2RHZA 4C5GA 4IUQA 4LD6A 2DAQA 2HQEA 5IAYA 5KH6A 2P0KA 4IUVA 4PL6A 2QQSA 2EQMA 3DB3A 3LGLA 5KE3A 4Z02A 4HCZA 4RG2A 3DB4A 3OYHA 3MP1A 3OYAA 3CEYA 5KCHA 3M9QA 4N4GA 3PNWC 5C6SA 3ASKA 4UC4A 1RI0A 3KUFA 5FRNA 3OYLA 2EFIA 3MEVA 3QBYA 4L59A 3C4SA 4C5IA 2RHIA 3H6ZA 3BDLA 1N27A 2XK0A 4A4GA 4BE0A 2RI2A 2GFAA 2BKDN 2L3RA 1XNIA 2L89A 2QQRA 3EAEA 2E6NA 3O8VA 2JTFA 2CKKA 4N4HA 3OS1A 3L2VA 2WACA 3MEAA 4E7JA 2X4YA 2GF7A 4ZTFA 3MEWA 2YRVA 2LTOA 5J39A 3L2RA 2DIQA 1OZ3A 2RJFA 4B9XA 4BE2A 3LLRA 4GY5A 3PMIA 3L2UA 2K3YA 3S3NA 4BACA 2BUDA 3OMCA 4N4IA 1OYXA 2RJCA 4BDYA 4IKFA 2K3XA 1SSFA 3ZEHA 2EKOA 4E7KA 2E5QA 3PFSA 4NS5A 4ZTJA 4IURA 5D6YA 3S3MA 4X34A 1WJQA 5M9OA 1OI1A 2X4WA 4Q5WA 5FROA 2LVMA 3NTKA 1OZ2A 2F5KA 3L42A 3META 2DIGA 3H8ZA 4A4HA 2JZ2A 3OYCA 2LDMA 3UWNA 5KE2A 3DLMA 4OVAA 3OY9A 1WJSA 2RJEA 3OA6A 5C0MA 4C5HA 2R57A 4A4EA 2RJDA 5KCOA 3FDRA 3OS2A 3OYNA 2PQWA 3OYGA 2EQUA 4E7IA 3E9FA 4B9WA 3F70A 3MP6A 3OS0A 1H3ZA 2M16A 4FL6A 3QIIA 4CRIA 3FC3A 3S3OA 2NLUA 4QQGA 3LH0A 3OB9A 4IUTA 2FHDA 5J26A 2EQKA 3PMTA 2O4XB 2XDPA 3OYJA 2R5AA 2GFUA 4QQDA 2R5MA 3OYBA 3E9GA 5D6WA 2RI5A 4BDZA 2RI3A 4PLLA 4QVZA 4E7LA 4IUPA 2X35A 3LX7A 4PLIA 3OYKA 1MHNA 4BE1A 2M0OA 3ME9A 3OYIA 2VYTA 3Q1JA 3SD4A 2MWOA 3OYMA 4E7HA 1WGSA 2LCCA 3LGFA 4EDUA 3UT1A 2LRQA 2RHUA 5FRMA 3QJ6A 4BD3A 3MP8A 3OYFA 4A4FA 3QKJA 3S6WA 1WJRA 3OQ5A 4C5EA 3NTIA 2G3RA 2B8AA 5IN1A 3L2QA 3P8HA 3OYDA 3MO8A 3GOXA 2X4XA 3NTHA 2RHXA 4FU6A 1G5VA 2IG0A 3LYIA 3OMGA 2D9TA 3L2WA 2L8DA 4IUUA 2R58A 2RHYA 3FEOA 5CIUA 4QQ6A 2MWPA 2O4XA
chains in the Genus database with same CATH superfamily
1H9SB 4QIWB 2I0QA 3R6NA 2DXTA 4JI7L 5IHKA 3PT9A 1C4QA 1I4XA 5IP9G 3JB9I 1PDQA 4JLIA 1U0LA 4E6IA 4YCVA 3KUPA 4X62Q 2KAFA 4RAUC 2QQSA 4KY7A 2HT1A 1QKWA 4JV5L 2O01E 4HCZA 2K7VA 5EPJA 5D3DA 1RLQC 2SRCA 2AZSA 4YHHQ 4ULLA 4AYBE 2PQAB 2VXFA 5CAIA 5EG2A 3X20B 2VUBA 2E2HH 1KTKA 3ONAB 1VQDA 3VKIA 4M75C 3PVLA 1OXVA 1N8RU 4LF7L 3QBYA 4HMIA 1PRTB 2DYIA 2YRCA 2GQIA 4OB2B 2CT4A 4A4GA 4D8KA 2H1EA 1Z9ZA 2BZYA 2L89A 1UEBA 2C0OA 2JTFA 1EZ6A 1Y1VB 4RMOA 2WB1G 1X6BA 2KRMA 1I94L 1GJXA 2GF7A 1PRTD 2NVYH 3EFXD 1KNEA 1NR2A 4PKCC 2X6LA 2HSPA 2RQUA 1A0NB 4PZ7A 1HQMC 5H1SE 3A8GB 2WB1B 4BBSB 1WD1A 5AYFA 1ZBXA 1PZJD 1Y96A 1W2BS 3OMCA 1QVFS 1AE3A 2K33A 2ID0A 5C44H 4P73A 2RQRA 1JWUD 5M5WB 4BDYA 3PO3G 2XU8A 1ENFA 1EL0A 2DNEA 2EOTA 2DLPA 4AG2C 4HTHA 2EKOA 4PJLA 3OBWA 5TSSA 1RODA 4M78G 2X4WA 4XTUA 1HTPA 2KCTA 1ET9A 3CMET 1PYWD 2CH4A 4K14A 4QCLA 3H8ZA 1CSPA 4BY7B 3CBOA 1K3BC 5JJLA 4OIKA 2B8GA 3SWNC 5C0MA 4G4KA 4C5HA 1WHMA 2Y4YA 2GVAA 3OIPA 3BVGA 4RCCA 4DV5Q 2PUKB 4PJNA 1A3VA 4M77E 1KRSA 1SYDA 4IFDI 4B08A 1NEBA 4JYAQ 3EN2A 5IT9L 4U673 3T1HL 4A3GB 3GTPB 2R92B 3KLSA 2N78A 1R0BG 2M16A 1YNZA 5GAMe 4K0KL 5D7UA 1TS2A 3BVMA 5M3FH 2JT4A 1UGRB 3URYA 1J3TA 1AEXA 4K5WA 2IWHA 5I2XA 3A56A 3OYJA 2Z9HA 4AYBG 1OXSC 2JA6H 3BZCA 4PJOD 2BE9B 5D6WA 2CW0C 2RI5A 4POFA 3C12A 4JI1Q 3CCVT 3SGIA 1YWPA 3J80E 2X35A 2L4NA 2DMOA 4XT3B 3S14B 3VJPA 3NQIA 4KV6A 4LNQA 5CORA 4CBVA 3JCMW 1IHVA 4KJNA 3LW5E 1CSQA 4A3EB 3OYMA 3K57A 2DNCA 1BI2A 2V1RA 3SK8A 3LGFA 1LM0A 3UT1A 4JG2A 2E10A 3MP8A 3EG9B 4DUZQ 1Q7YC 1QWFA 1ZUKA 1W6XA 1TWFB 2F03A 2UXCL 3J81j 3WOFA 3L2PA 3E19A 3EG0A 3GTQH 4Y28E 3M54A 4OGEA 1OOTA 3M0SA 3LX0A 4XQQA 1V8QA 3EG2A 1VQBA 1QJOA 1EIFA 1GCQA 1PRMC 1CHQD 3EJIA 5KYYA 2ZTEA 2MWPA 1XYIA 5FWBA 5KYWB 1YJ9Q 4LUEA 4JI2Q 3S9WA 1Y1WH 3QZ5B 3MEUA 1QE6A 3S2DB 2E2JH 1MUZA 4IFDH 1VOMA 1U8RA 2MGSA 3K58A 3M4OB 3EG1A 4M77F 3PGZA 1PTOH 1UUPA 1U5KA 1FNUA 4K6DA 4KBMB 2JA7H 2E65A 2M00A 2PMZB 1TWAH 3T56B 3D7SB 3QWXX 3N52A 2AQ3B 1YJWQ 2EYMA 2K28A 4KHPL 2PVOB 1MJEA 4A3DB 1X3GA 4HR7B 4ZCKA 1KLUD 3PIOA 1IW7C 1YHQA 1AZEA 5JEAH 2BKDN 3ZBDA 1XNIA 4DEYA 2ECZA 1K73C 2E6NA 4M7DF 1SBBB 2AHJB 2IT1A 3CXCA 1I4K1 4HCCA 2PNIA 4B9XA 4EIKA 1DCZA 3AEVA 1IRXA 4MZTA 1Y8OB 2BUDA 4OMMA 4J6YA 2QGFB 2I5LX 4NPSA 2K5QA 5LJ5h 5CQXA 4E6RA 1YHAA 2YTVA 2B63G 5K36H 2AIRB 3H15A 3TCJA 1X3EA 4LFBQ 2VGMA 2JEAI 3M7NA 1TOVA 1X69A 2LVMA 2EYYA 1NR4A 1C7YA 3H94A 1OZ2A 2ASBA 4QUCA 1FR3A 2BOSA 2PCFB 2K57A 1K8AR 2E2DC 2KQWA 2DE0X 2LFNA 1Z7TA 4R4IA 2ESWA 3AFPA 2EJFA 1X3FA 3H0GH 3KBXA 3STBD 3JCMh 3T1HQ 3T1YL 2A28A 2B2YC 1SNCA 5I6WA 1N32Q 2OCEA 2AHOB 1D1CA 2QASA 1W70A 3BYTB 1JB3A 4LDUA 1UJ0A 5CO7A 3OS2A 4YY3L 1TU2B 1BXTA 1J6QA 1M9SA 5KYXA 1VQOA 1P92A 2HDAA 2RB6A 3M55A 1LPLA 2GN5A 3ND9A 4L5SA 3A74A 5HGTA 2CZ1B 1QZHA 1A3TA 3LH0A 1UG1A 3NMZC 2XDDA 1J9OA 1GUTA 1TIID 5DEHA 4BBRG 2OTLT 3U9OA 1MMGA 1GBRA 4QMGA 5AJ3L 3AU7A 1D2BA 3R3OA 4C0GA 1PH1A 3MXNB 1YP5A 3PIPA 4A3IG 3PUVA 2CZ6B 3PF4A 2CP7A 3V7CA 3PUWA 5M3MH 2SNSA 1VQHA 2LJ0A 2K5VA 2I0NA 1NY4A 4E7HA 4ODGA 2UXCQ 4LUDA 3CCLT 1HPCA 2I5HA 3NXWA 4ZUIA 1ZSZC 1SFOB 3BZKA 4BD3A 1X65A 3UDXA 3CCVQ 1RD9D 2Y0SG 1RAGB 2W0ZA 2BA0A 2K32A 1TG0A 1EOTA 2DYBA 1D1BA 3GV3A 2F0JA 4XYOA 2XIWA 1GUOA 1N34Q 3L2WA 1VQMA 2CS7A 3RN2A 2R7ZH 2YYZA 5LJ3g 3CCMA 1ML0D 2OAUA 1D8LA 2IW3A 2MNAA 3KJPA 1XMQQ 2HQXA 1PLFA 5CV9A 1TWBA 1GM5A 2ZT9C 4HCKA 3G6ET 2P0QA 1II3A 1STNA 3H3VI 2HEQA 4IJLA 4GZYC 2P0KA 4J6WA 3A8JE 1CKAA 2EPDA 1MBYA 4GN5A 5EPLA 3TSSA 4XU3A 1BK2A 3RKWA 1TWCB 1N9WA 3SK6A 5FOBB 1GHKA 1KC8U 2MIOA 4Y92A 2AKLA 1TKWB 1S72Q 3NBIA 1TY2A 3HOVH 3HOZH 1UAPA 5J22A 2KUMA 1EY7A 5IGBA 2JW4A 2B2WC 2L0AA 4HJ8A 2OTLA 4ZK9B 1H3HA 3K5MA 1G91A 1O75A 1EQRA 2PMZE 2NN6H 2QDBA 1K0XA 4A3MB 2K2VA 3VR4A 1VQ5A 4L6TB 1I4QA 1T3SA 2D8JA 2QQRA 2L3SA 4ME7A 4H13C 5KYNA 4NKLA 1EYCA 1KABA 3OW2A 1E22A 1JJCB 1H9SA 3UDFA 2X3XD 4GY5A 3QB3A 2EVRA 4R8NA 1PH5A 4GLXA 5JJKA 2XRQD 1NMGA 1I94Q 4JI2L 2JA5H 3G4SA 1BYMA 3KDFB 2XRSD 1F2MA 2D5DA 5C0XH 3J7YW 4M75G 1ILQA 1RDPD 3HP9A 3PFSA 1PWTA 2LKVA 2YUOA 5KNDA 3NSWA 2D1XA 2NWGA 3P20A 2PW7A 1YNXA 4ZNXA 1V76A 2Z0SA 4HMJA 1RI9A 4M75A 3DLLA 5J1ZA 2JMAA 4JBMA 3JAML 1AOJA 2NUTB 2VQEL 2PI2A 4JK1C 4JRKA 5HGQA 4DGZA 1K0SA 2UUAL 3SK5A 4HJ5A 4LFBL 2A73B 1FMKA 5LJ3h 2HNIA 3CCST 2Z6BA 3LWEA 3O13A 2SDFA 3K0YA 1V1PA 4OF1A 4CC7A 2LCLA 2GBQA 3O5ZA 5HK0A 3EGDB 3VS3A 4LF5Q 2NN6G 1YCYA 2VWFA 3F70A 1QILA 2OXPA 1J5EQ 5GAN7 3GF5A 3I91A 4B3SQ 1VIEA 1SMYD 5JPNC 1WCMH 4Q0FA 1QVPA 1HJDA 3BVZA 5J26A 5BN3A 4ZUJA 4C0FA 5GMKe 3AFQA 3QZ9B 2EYQA 2E5LL 4FCYA 4DR7Q 1SYFA 4LF5L 3GTJH 4J9DA 2KDSA 2V8IA 2WINB 4QL5A 3Q8DA 1Q95G 2F0NA 1Y14B 4M77A 1NJIU 3RESA 1EY9A 1LABA 3CMEA 2FB7A 2K5HA 3CC4T 2NVXH 4C92C 1B7YB 2NUZA 3CC2T 2RHUA 2LNHB 4CKBA 2XSCA 4DV3Q 3H41A 1PH7A 2EYOA 2LCSA 1X2QA 2JA8H 3PO2H 3NTIA 1XMOQ 3CPWA 3P8HA 1RABB 2FFKB 4JDSA 3GTLB 1XTCD 5ECAA 2GQVA 3CCLQ 3K81C 4GLVB 5L37A 5M3FG 5ELBA 5DY9A 1G3WA 1SNDA 3I73A 1EYDA 2LT1A 4II1A 3K7AB 1D0ZA 1YITT 4KN4C 4ELZC 4C1NK 1YN8A 2RMOA 5CKDA 4JJCA 1HR0L 3S1MH 5LJ3j 1LTLA 4PK4A 3CXCP 1VQ7T 1X6GA 4DNRB 2HIVA 2LJ1A 5CGKA 1PTOD 4AFQC 4DUZL 1LOJA 2RKSA 5FO7B 1WTWA 2D8HA 3DB3A 3I4NB 4DV3L 4JV5Q 4C8QE 1XWEA 4QUFA 3MP1A 5KCHA 1S5ED 1ICFB 3I4NG 2XI9A 3EFRA 3VS2A 3G6EQ 4C8QC 5FLXc 3MEFA 3CCRA 3S2HH 4CJ0B 3S16B 5FRNA 4PZ6A 1C1AA 2VW9A 5CKFA 4MTKA 5JAVA 3SEBA 1OX9A 4KKUA 2EXZA 1GCQC 4ZTJA 3S3MA 2CCZA 1B44D 2D62A 3FB9A 3MEAA 2A6EC 1CKNA 4M7AG 2BH8A 2CWAA 2N49A 4RGTA 1VQ7A 1YVCA 3S3NA 3FKIG 1R4PB 3C46A 1TWHB 1I8FA 3U4VA 2CW0D 1SSOA 5A0GA 5C6AA 2FZCB 2WKDA 4DK0A 1CZWA 3QWYA 1Q3LA 2CKZB 3ZEHA 3Q6SA 3VA7A 4NB3A 2E5QA 1PH4A 3VYSA 3RZDH 2J6KA 1HA5A 1G2TA 3QSUA 1D0YA 3X24B 2YV5A 3I9QA 2Z4HA 1D7QA 2PI2E 1E2VA 3JB9D 3QOJA 4RHRA 4AH6A 4CDFC 3X28B 5LMNL 4BBSG 3QUIA 2FEIA 1FVIA 2L55A 4M75E 1ZQ1A 1WJJA 3X3NA 4LN2A 2LDMA 4PJOF 5KE2A 1WHGA 1HZCA 2E8GA 4LMQD 5IGDA 4OVAA 4BBRB 4WFN3 2PQAA 4P5NA 1CA5A 3M0RA 4RTVA 5KYIA 3FMCA 4M75D 4HAEA 2X51A 3THKA 4OB1B 4OMQA 2R6GA 4FL6A 3QG1A 1XJVA 2L3QA 1SKUB 4PFPA 5FU6C 3I5RA 1KIKA 2QGQA 4J7IA 4ZLTF 3RERA 2OJ2A 4B3RL 5CYUA 1D1IA 3ZYYX 4LE9A 3TS2A 1NTGA 1SJED 1U4RA 3TSWA 3HRTA 3SB2A 3TBIB 1AE2A 2EYFA 1E2WA 2MP1A 2E5KA 3E9GA 1KQSS 1BF4A 5EKKA 1UB4A 5CQYA 2D0QB 4MZPA 2D0PA 1TWGB 4MZMA 2IPOB 4YY3Q 4TVRA 4QJFA 3EGDA 2NWMA 1LLRD 1AVZC 2MWOA 3AQQA 1N32L 1U4MA 4MN3A 2DF6A 2QXFA 3CCMQ 5GMKj 4FT4A 1WLPB 4M77B 5GANh 3OYFA 5C4JH 2XNAC 3NK9A 2EYPA 4UDUC 4LFCL 4DK1A 3GD7A 2JNGA 4C8QG 2XG8D 4M77G 4OP0A 1ESRA 2ICIA 2N88A 2HCCA 2GCXA 3K59A 2E75C 4DV6L 4HEDA 3LYIA 2Y0SE 2CP0A 1ESFA 3J7ZC 3OIQA 2MYSA 1T5XD 2WFWA 1EWHA 2EZVA 2HQEA 3E0JA 4RFBA 5D6XA 4X66Q 1S72T 4KD4A 1T9HA 2F0WA 5EGTA 4F7XA 1WDXA 4YWKA 5KEEA 1QKXA 2YXYA 5EKIA 4A3EH 2RO0A 4KH0B 2I5MX 1QCFA 2R93H 4A3MG 1UE7A 3VYGA 4M7DG 2EQMA 4XTYA 2QF7A 2FMMA 4KULA 2F0MA 1I5FA 4DA4A 3CC7T 1YITQ 3RKXA 4A3LH 1M5Q1 1HUNA 4PJOG 3I56T 4IPGA 1FYCA 2KVMA 3ASKA 3DKMA 3S15B 3S24A 3TEEA 4QF4A 2A69D 4EMHA 5HCKA 2TSSA 3A5UA 1H9RA 3W5OA 3HRSA 2RHIA 3H6ZA 4DAVA 5CV8A 4I7AA 2RHSB 1CFMA 4XDXA 2F1MA 4NL3A 4ILWA 1WFQA 4N4HA 4MTNA 2RQXA 1PMRA 5DNFA 2X4YA 1E6GA 1C48A 3CKIB 1BKBA 2VZAA 3HFOA 4JS4A 2A3LA 2KEAA 1F9PA 2R7DA 5ISRA 1LTRD 1KQSA 4UHVA 1Y71A 3VYUA 4DA2A 1JT8A 3SEMA 1X54A 4IIOA 4ORZA 4DBRA 1VQLT 3FPPA 3KJOA 5LMUL 1CSKA 3G7ZA 3J80L 2F5TX 5D6YA 5LJ5g 1G6ZA 2BE5D 4FVMA 1CA6A 2PNRC 1K8AC 2EVBA 3DWPA 4RGMA 4XT1B 3D31A 1UE1A 2F0KA 4ZN1A 2W10A 1AFPA 1QNUA 3OHXC 2RK1A 2RJEA 3OA6A 1JWSD 3U50C 1WTXA 4YWLA 1TWHH 2J4XA 5GAMf 1EY6A 4KT0E 2VB6A 3M57A 1F77A 2XIDA 4ZAIA 4DR6L 2RF0A 3G4ST 1FYNA 2GGRA 2HAXA 1KXLA 2EIFA 1STYA 5GAN5 4GKKQ 3X26B 4MZ9A 4ANJA 2QQBA 1N34L 3HRUA 4OMOA 4QQGA 3T51B 1UECA 1QZGA 3A8OB 4ZGEB 1D0XA 1BUVT 1E1OA 4G7ZC 2EQKA 1ENCA 4TKOB 3TU4K 3S16H 5GAN2 3GTKH 4HXJA 1XTDA 4M78D 3CC4Q 4XU1A 1Q46A 4X3UA 4HIMA 2EGAA 2KVQG 2V8KA 2L5QA 5I2SA 2VVKA 3S1NB 5IHNA 4K0KQ 4R9WA 1SXTA 1GUGA 3A98A 4K8JA 1SG5A 1AW7A 3ERQA 3OW2S 3N6RA 4X65L 3OYKA 1KL9A 3DXJC 4D8DA 1DJRD 5IGEA 2NUTA 4FYXB 3X25B 4FSSA 5C3EB 3BG3A 4UP9A 1EQQA 1ASZA 1C6VX 1G6PA 4J9FA 1PHTA 4LXCA 3QJ6A 4DBQA 1M1GA 2VGNA 3K80C 7AT1B 1SYGA 3TMEA 1UHCA 1WHLA 4XTCS 3OQ5A 4C3JG 4UPAA 1JQQA 2DFUA 2WSEE 2XWJB 3Q23A 2WSFE 3OYDA 3MO8A 2E3IA 2SNMA 1VQ7Q 1LTAD 4PFZA 1RF2D 2RCNA 3E0EA 1FD7D 4JBWA 4FYYB 4X6AH 4C3HH 2DNUA 1HH2P 4LF6Q 1RHPA 2M1HA 1D3BA 2VL6A 1TVXA 3IQLA 1V1QA 2R7ZG 3H0FA 2DRKA 5D14A 4LD6A 1ZA1B 1YNNC 4KK7A 1I4RA 1TWGH 1NMFA 4OMLA 3TN2A 3OTOQ 3REBB 2UUBQ 4ZKCB 1EOVA 3MKDA 1MGQA 1A2UA 5GAN3 3OYHA 2A37A 5HKCA 1VQ8A 3RNUA 3ZL7C 3M0TA 4JI3Q 4N4GA 3EBEA 4PG3A 2E70A 4CDDC 4UC4A 1XJWB 1M1KU 3OYLA 5IIFA 2DK3A 5C4HA 5FJ8G 1KD1C 1LYLA 2WAQG 1IZ6A 3KLSX 3U23A 1NPRA 2EJGA 2K05A 2GFAA 4E7KA 4J5YA 3CMAA 3QPHA 4M7DC 3HRZC 2BH2A 4K11A 2JA5G 1TSFA 5CVIA 1Y8PB 4O0AA 4A3JB 2NUPA 4FF3A 3TEHB 3L2RA 4EMKA 4K5XA 4Z8AA 4DR1Q 1CQFA 2RDFA 3M4QA 3FJPA 2VY3A 3D4DA 1UDLA 4LF4Q 1A2TA 1UHFA 4DBFA 3JCMe 5GANj 1WXUA 1ZA2B 1AEYA 2JJQA 4XIGS 3J7AV 3M85A 4M78B 3CMAQ 1M8MA 5A2QE 3ULJA 2FPFA 3TQ7P 2A6ED 3MVVA 3VR3A 5IY0A 3M3YB 2KENA 1RUWA 5M5XB 2DZCA 1OI1A 5FROA 1JRIA 3M0QA 2B2YA 1LVKA 1WTHA 4C3JH 4AQYQ 2VUMH 4OONA 3TP8A 2UUCQ 2HD0A 2BCOA 4C8QD 2OAWA 2MFIA 4WORA 2VNUD 3OBYA 4JI5L 1ZSGA 1MGSA 1Q86U 1O7ZA 4A3BH 2DTHA 4MMKA 5C0XG 3RLFA 1SMXA 4GOPB 1PG5B 4FYVB 1I6VC 1MNDA 4A3LG 3OYNA 1PFNA 2L1BA 2L11A 2MJ8A 4IPHA 2SOBA 1PZKD 1STHA 4E7IA 4PZ8A 3JC66 3PQIA 5LJ5j 4JW0A 1S5FD 1FWZA 2H5XA 3OTOL 2DN8A 1HUMA 4IUTA 1Q12A 2I46A 3FVQA 1LUZA 4X3TA 1IYVA 4LDWA 4VUBA 4IZ8A 2WSCE 4FF2A 2J0TD 3RBBB 2R5AA 4BUGA 1KNAA 1YHQT 3RMSA 3F2DA 5CBEE 4X9DA 2EXDA 2O31A 4KI0A 1RADB 1QVGP 3GTGH 1MV3A 3A8KE 2ENBA 1BQQT 1GCPA 1SE4A 1KK7A 2PZUA 1B34B 1UE6A 2M0OA 3OYIA 1IHWA 3CXCS 3S1MB 4UP7A 3CD6A 4R4QA 4B6MA 2LCCA 3NBHA 2AUJD 2DPPB 1AD5A 1VQAA 3EQLC 5NUCA 4JI5Q 2AT1B 3G71Q 5DM7R 2CSQA 3QKJA 4C0DB 1QLYA 1SYBA 1PHJA 2IX1A 2EYXA 1E1TA 2B3GA 4X62L 4PMCA 1LT3D 3GTLH 2Q2IA 1B9MA 3CD6Q 3FHWA 1XMQL 5CIUA 3CRLC 4QQ6A 4ZN3A 2KK4A 1X56A 4HIOA 4A76A 1VQOT 1G8ZD 1N33Q 1SFOH 3S1QH 4GS3A 2A8VA 2V26A 4J9IA 1KHCA 3CC7Q 3MXPA 2NVXB 4QW2A 4L5TA 2HBPA 3W3AA 2Q2UA 3RZOB 2DKGA 3VUZA 2HUGA 2DAQA 2B2WA 1QUQB 1XQHA 5M3MB 4O5VA 3ULLA 3QO3A 2DY7A 2CSIA 3HOWH 4M7AD 3GTGB 3ZFJA 1V9PA 2IX0A 3MA2B 5M3MG 3MJXA 3PE0A 3J81i 5EC7A 3P7JA 3I3CA 3CEYA 4UAIA 1KJWA 2ZXOA 3KF6B 5KGUA 1VQIA 3TQYA 3I4MG 1PNJA 4BI8B 4DV5L 1NJIC 1GO3E 4ZKBB 3M53A 2B86A 1XNQL 3HOUG 4M7AE 3BU2A 3I4MB 2CFMA 3JSCA 3CU7A 3BDLA 3VS7A 3VYRA 4ID6A 8AT1B 2K6DA 2B63B 3ND8A 1R9TB 5KIXA 5C5LA 1QOHA 2DGYA 3HP3A 3URGA 4K5VA 4BE2A 2XVSA 2K04A 3S2HB 1JEGA 4IUNA 4M75F 1VQMQ 3H6MA 5GAN6 2BE7D 2RH2A 4KY6A 2KGTA 2QEJC 1HK9A 3I55T 3CCUQ 4A3BB 2E2IB 1YI2Q 2K3XA 4JRPA 1IBLQ 2O2LD 5CKHA 1B3AA 1AZGB 2HBWA 3SDZA 1M3CA 5GANg 1GUWA 2NZHA 3VS1A 1N36Q 1VDZA 2F5KA 4R4CA 1V1CA 3S1QB 1SN8A 3G4SQ 2Q2HA 3E2UA 1IYUA 1STBA 2CUDA 1PM3A 2RQVA 2K75A 1D1KA 4EMKB 1SSHA 2DTOA 4C2MB 1SNPA 3I56A 1SMYC 2JN4A 4F87A 2KSSA 5KCOA 4LF8Q 1SEBD 4OB3B 1QW1A 4J83A 3CC4A 2RVLA 2WB1E 3HG9A 1SF9A 2XKOC 3E6ZX 1VQ5Q 3T13A 4WTOB 5GAN4 1EWIA 3S3OA 2EWNA 3PCOB 2R7FA 2WP8J 2E41A 1UE9A 4J6XA 4GNXB 3F1ZA 3HOXG 1ACMB 3CCQT 4OHJA 1Q86R 1JJGA 4F7UA 4MMLA 3EROA 5GAMj 3E1SA 4DF7A 3K5LA 4LFCQ 1TR5A 1TWAB 2N8NA 4QB4A 3MC0B 2R5MA 1GOZA 1IKLA 1G51A 2COYA 1ZBJA 1YWOA 3VV0A 4JRQA 4BDZA 1Z9QA 1JQYD 2BE5C 4IOCA 5C4XB 4E7LA 4DQ2A 1WCMG 2QI2A 4OIJA 3OWFA 2E4HA 3M4OH 2HKQB 4FYDA 1WCMB 2VYTA 3CCET 1B4OA 2NZOA 3NPPA 3ER0A 1MD2D 5GJVB 4XQNA 4DV0Q 4HJAA 4L6V5 2FYKA 4P75A 3I7FA 4BB7A 2KCCA 4C3IG 1BBXC 3AYHB 4QIWE 1BCPD 4JI4Q 5GAN8 1B9NA 2A1AA 1WHJA 3PIP3 1PRTC 1EIYB 3SWNB 1TT2A 2L2PA 4PQXA 1OQKA 1F9QA 1TXYA 1WQWA 2RHXA 1VQJA 2MF2A 2AQ1B 4C2MH 3J81c 4IUUA 4A3EG 1Q90A 4M77D 2R58A 3VR2A 3TRZA 5LJ5d 1H8KA 3UDGA 1AH9A 1KC8C 1M1KR 2A68C 2KHJA 1ZUUA 1QVCA 3A7AB 4ATOA 3CHBD 1B34A 4JS5A 1GUSA 1CK1A 3ULPA 2EQJA 1EU3A 2OQ0A 1DZ1A 2VUMB 5GAOn 4KHZA 2RHZA 3VYTA 1WI7A 1I5LA 2A0FB 2QQAA 1NLPC 4C92F 1BCMA 1MSHA 1SNQA 3CBPA 3F8TA 2EYLA 3NBHB 4ABNA 3I5SA 4WRDA 1P16A 4LNPA 1STEA 3G1JA 4POGA 1QCOA 3VS5A 4TSSA 2JA5B 5I6YA 1K76A 2MI6A 1BCPF 2JA6B 4H44C 4FYWB 2OWOA 3BW1A 3M0PA 1F9RA 4L5GA 1SNOA 1SRLA 1FGBD 2MO1A 4DR3Q 2E6ZA 4OO1G 1R9TH 1GUNA 4KLKA 2UXDQ 9ATCB 2DL8A 3DHQA 4N9TA 1W2BP 1YIJA 1QVFP 3NWTA 4DUYL 1NAPA 3VRYA 1L0XB 4RTWA 2AK5A 2JS2A 2LX9A 1GVPA 2FJ2A 2CKKA 3I4MH 2PZWA 3WOEA 4JI6L 2WAQE 1SHGA 2RQTA 4HVVA 2MMPA 1P8LA 3VRZA 1CM9A 1PCXA 1OZ3A 2YUPA 2ZPFB 3EGXA 3LWHA 1WQ7A 3LH5A 2RF4A 3A7LA 1TXQA 3FIFA 3HOZB 4A93G 1AHJB 1J5EL 2F1LA 2JS0A 2K6AA 1MNEA 4L63B 1E3PA 4OEMB 4EQOA 3GQBA 3I4LA 1EYAA 3BDCA 3EFOA 4KRTA 2CGHA 1WJQA 4X34A 3RZOH 2Q8RE 4JC0A 3GLXA 1BIAA 4IIMA 4RWSC 3VYHB 1DONA 1WPYA 4RCOA 1PKTA 3NPFA 3V8JA 3L42A 2P0PA 2RM4A 5L23A 1WTPA 3EIVA 3GIBA 2R3ZA 1UUEA 1OU8A 1JR0D 3RD4A 1D3BB 1U1TA 1WJSA 4FM4B 3K5NA 4L8JA 1G8XA 1XXGA 1K9AA 2J6FA 4EPCA 2LS01 3TZDA 4XAXB 1EZ8A 3C1EA 3PGGA 4BBSH 1PVOA 3CF5A 3CCEA 3KFVA 1YNJC 2DL3A 5CV4A 1Y96B 5CV7A 3MHBA 4OB0B 4A3FG 1RLPC 2KRSA 1YHQQ 1Y1VH 1BB9A 1HQRD 1IREB 1PRTF 1LTGD 3HPWA 1B07A 4BY6C 4R4TA 1LTTD 1ZLMA 1F2YA 2ED1A 3A1PA 4EGVA 2K5LA 1K8AU 4EX5A 4JUVA 4FO2A 1GXDC 4QQDA 3OYBA 1LT4D 4F7UB 1ILPA 4Z9CB 4AFUC 3OOCA 3G71T 2YHTA 2JQOA 1PTOB 4IUPA 1O80A 4PJMA 4J15A 4YWMA 3CCQQ 2X6GA 5LJ3f 2B2UA 4S3SA 4Y52H 1VQPQ 1FNWA 4PMBA 2RN8A 1SE3A 2SEBD 3IKJA 4IPCA 2L0CA 1S1NA 2JE6I 1MMNA 1SAPA 1EY5A 3E9IA 2LXKA 1IO6A 4PJOE 2K79A 1YJ9T 1KAAA 4C5EA 4O1NA 2F0SA 2HDMA 5IYDG 5LHY1 5IN1A 1HJPA 1LACA 2B39A 3NUCA 1SYEA 3NWSA 1SROA 2K1BA 4FW1A 1ASYA 3SHLA 1S4ZA 3UA7A 1JBMA 2O9VA 4NP5A 3J80c 5C3EG 1TWFH 3NP8A 1K8MA 5IGGA 1AZPA 3EGUA 3CBMA 1U4LA 2H4OA 2AKKA 2DZ9A 4HJ9A 2E5LQ 4DUYQ 1UFFA 1VQ8T 1QQJA 4C92G 2J7ZA 1VQ9T 3A55A 1MHWC 2Y0SB 4LF4L 4GNXA 4M7DD 4B3TQ 5ELOA 2OQKA 4QT7A 2JM9A 4KY5A 5JJIA 3CPWP 3A8MB 1L0WA 3S14H 2F0HA 3A5ZB 2E3HA 4XK8E 1DOKA 1W6JA 1HFNA 2Z8LA 4O2DA 4NMZA 1N6AA 2UXDL 6AT1B 4DXFA 3MXGA 3A8IE 3STBC 5C44G 4IO9A 1EFNA 1PKSA 2DXUA 1JC7A 5GAOm 1HCZA 2PNHA 3IL8A 4HSPA 1XPUA 2PW5A 2PQEA 2ZPIB 1JB0E 1TY0A 1OULA 1CUKA 4L59A 2Z6KA 2DILA 3CCLA 4A3KH 1ABQA 1M3BA 2Z0WA 4M7AB 2KYBA 2L3RA 1X43A 1C9OA 2M51A 2ROLA 3OS1A 2IHEA 3L2VA 4E7JA 2TMPA 3JCMf 4C56C 2G9HD 1JJ2S 3EFSA 3QXEB 1UE5A 4LF9Q 1Y1VG 4P71A 1HR0Q 3VS6A 2XDBA 3E3XA 1BIBA 1CZGA 3M7GA 2ATWA 2VXEA 1PH9A 2F0FA 5FKAC 1F9SA 4BY7H 1LNXA 1X6OA 4BI4A 5COYA 4EQNA 3M4YA 2AWOA 2A6HC 2FRWA 2OI3A 2R93B 1U5SA 1LTSD 5EAYA 3NEMA 5GAOl 4A3JG 2IJ0A 4PNOA 2QDLA 3S2DH 2HCIA 5GQOA 4BY7G 1QCNA 4WJWA 3WVDB 2LQWA 4RGOS 4DR2Q 2ZPHB 4FF4A 1W3SA 1E6HA 3DWQA 1R4QB 3OYCA 3UWNA 4NDXA 2GTJA 1S72A 1KAWA 1WI5A 1EQTA 4JJDA 1NEGA 1CKNB 1U3OA 4IQZA 4CI0C 1JXMA 2RJDA 1Y57A 1YHBA 1FGUA 2CP6A 3HKZE 1F2ZA 1HNXQ 2L15A 1H9JA 1L1OC 2YTXA 2SEMA 1JJ2P 3PV0A 1IHZA 2CREA 1VQKT 3E9FA 2ALYB 2IVWA 5GAOp 1N33L 3U4ZA 4HIKA 4F14A 1JOOA 2R92G 1CT1D 1I50B 4RG8A 2F52A 4IALA 1NYGA 4CC2A 5IP7G 2EW3A 2FZKB 1D09B 3DEOA 5BN4A 2CT3A 2O4XB 4LD9K 4WF2A 4GBQA 3RUXA 1GFDA 2KOLA 4RG1A 1V1PB 4FNFA 3D3RA 1B2TA 4MIUA 3I4NH 1RKNA 3M5AA 4JI8L 1RTOA 2NVQH 4BE1A 2KA7A 2XHCA 1X3PA 1MIUA 4FIBA 5I9OA 3G6JB 5EBCA 5I22A 3BE3A 1GRIA 1WGSA 2QTXA 3OSVA 3RN5A 5FRMA 2XWBB 4BXXG 3KYHC 1VQFA 1KFZA 4A3GH 4P72A 2UUBL 1O7IA 2DEQA 2B8AA 1OU9A 3D4RA 1BR9A 2X9HA 4KHPQ 1G5VA 3JB9G 4M7DB 3W1BA 2NTSA 1YIJT 3LNNA 2JA8B 3PO2B 2M9UA 1YEZA 1Y8NB 4PFOA 3M58A 2JA6G 3FLGA 2HQLA 4PJOB 3U58A 2ED0A 3GO5A 4XU0A 2RSOA 4DEXA 3KF8A 2YUNA 2F4VL 4IN3A 2QGGA 3RIRA 3SHWA 4LAAA 1TH7A 4CHTB 3REAB 5CR2A 2K03A 5GMKm 1OPLA 1NE8A 5GANf 4LF6L 1QMCA 3DB4A 1NNXA 1Q8IA 3JCMQ 3M9QA 3GNFB 2XN9C 3BZDB 4HIDA 1MMAA 3MEVA 1Q82C 4EMKC 1KLGD 4PNYA 4BE0A 2PO4A 3I55A 1I4GA 3EAEA 2OT2A 1KQ2A 1WFWA 1HD3A 2WACA 3GPLA 4C0ZA 1L1OA 2P4TA 3FPUB 4ME5A 1UJYA 5GAHC 1JE5A 1W2BA 1QVFA 5KYWA 2EJMA 3LLRA 3CCSA 4MNOA 1M90C 3VDYA 2QTVA 4IFDJ 1Z47A 2MQHA 2DM1A 3PO3H 4GN4B 2CYZB 1NJIR 4RKUE 4N4IA 3EVQA 3EHRA 3HFNA 1E2ZA 2YSQA 1ZUYA 4M78F 4IKFA 1IXRA 4X3SA 5GANd 1FNVA 2FL7A 4JYAL 3BFMA 4ALPA 4HT8A 1S3OA 5I11A 1ZHIA 1KDCA 4LUOA 4X3KA 1H9MA 1VQKA 1Y69U 2A7YA 2DIGA 4ZQ3A 5EQ0A 1MKHA 4A3KG 1NZ9A 2IHFA 5CK9A 1AWWA 1UGQB 1E24A 1A63A 2QCPX 5LJ3d 1VQNA 1HSQA 2DERA 1PFBA 1Q8KA 3H0IA 1YJWA 1S5DD 2JM8A 2UU9Q 3FEWX 3OS5A 1EX4A 3I2ZA 4YIJA 4FSXA 1VQPA 1KD1R 3I72A 3UDIA 3TZUA 4JBKA 1I5OB 5IGCA 1PYBA 1RL2A 5C4JB 3H3VH 5K36G 1T3LA 1RAHB 5LJ5f 4H7BA 4NL2A 4JOIA 2C9OA 4DR4L 4DKAC 2CZ7B 1EWCA 3OB9A 1S5BD 5DM63 2CQOA 2QKIC 3PMTA 3CP0A 1YNJD 4XXEA 1VQPT 3CRKC 3V8KA 3GTJB 4LUZA 2IL8A 3VUBA 1IL8A 1JXOA 2QA4A 3HOVB 3CC2Q 3RLOA 1G291 1HXYD 3RDVA 3EH2A 4HVWA 4QKUA 1K8GA 1LCKA 2F2XA 1EQVA 4TVAB 3JAMi 2JUFA 2L9HA 4KMUC 4N0AC 1U1SA 1EY0A 5C4XG 1ABOA 2CH4W 2MAMA 1PSEA 4LF9L 4C0DC 1Y7XA 2JEBI 2RD1A 1ZYRC 2KMTA 1K28A 3FRPB 5C4ZA 4OWXB 4CC4B 2XTIA 2F0VA 3HHTB 4A4FA 1GBQA 1VQ8Q 1ARKA 1K83B 4FDBA 3P8BB 2JN0A 3HOYG 2UXBL 2R7ZB 1KSWA 2PTKA 3CCRQ 5FLMH 2KRNA 2Q8IB 1FXXA 4EMGA 2C35B 4M8AA 1R0CB 4BBRH 3CQZB 1GXIE 4MDXA 5A0DA 2PPBC 1JORA 4GN3B 1C0AA 1OV3A 1DOLA 2ROTA 1PYSB 3JV3A 1VQCA 1EY4A 3KLRA 1A6XA 2BIVA 3P75A 1YJNA 4D6WA 1KC8R 3U9SA 5K5PA 4M78C 1DM0B 4IUQA 1IGUA 2K4YA 3JCMP 3H91A 1OXTA 5EJWA 4BWGB 4XTVA 1JCKB 4H0LC 2K14A 4GKKL 3TREA 1WYXA 1NPPA 2YUQA 2L3PA 1D5MC 4XQJA 2ZM6Q 2RQWA 3EG3A 3JCMc 2DVJA 3CCQA 1G2SA 5CV5A 5C6SA 4DAYA 1QB5D 4JI0L 1AWOA 2VUMG 4LDYA 3MTSA 1Q81R 2B63H 1QP3A 4F7UF 1SPKA 2LSSA 1M1FA 2JP1A 1AWXA 3KFUA 4C5GA 2FMCA 1WHKA 1EIGA 1SRMA 1SJHD 2PVDB 3I56Q 5DLOA 1IXDA 1M4ZA 2HQHA 2KT1A 1YJWT 4R8IA 2BZXA 3FP9A 5E1FA 1ZSZA 4OGQC 4M77C 1UGSB 3MFYA 4A3DH 2KEDA 2OTJA 4X1VA 3HOWB 4G7OC 2YTYA 1PH2A 2CWPA 2KXCA 4M7DE 5G3LF 2AZVA 2HL3A 3HOWG 5M9OA 2O9SA 1JMCA 1PV4A 5C5MA 3BDOA 2VB3X 1M3AA 1GKHA 3K7AH 2ZJRA 2LC4A 2DXCA 2B2VC 1H92A 2F69A 2RDGA 4CKEA 4FP5D 2ZJPA 3DLMA 3OW2P 2RA2A 1K9MC 2Z6KC 3OY9A 2RA4A 1VQ4A 3A0JA 5D3IB 3JCMd 4Z89A 1K9MR 1A3UA 1M4VA 1SE8A 1M2OA 3HTRA 1WTRA 4V190 3HSBA 2RK2A 2G5DA 1KHIA 3SR1A 3SWNA 3IAYA 2ZPEB 2D2CC 3Q0AA 5I2YA 4J9BA 3V8LA 1A15A 1ICWA 1VF5C 1STAA 1JU5C 3JB9H 3CAMA 4DV2L 4LUVA 4DU9A 2LT4A 4ME3A 3S1RB 2A36A 2MOXA 2EE1A 3QYGB 4R55A 4JI7Q 1PD0A 3QDFA 3CCJQ 4X64L 2YWWA 2KE9A 3HKSA 4FF1A 1VMCA 4QGUA 3H3VC 2RI3A 1YJ9A 3INZA 1RJTA 2VC8A 4F04B 2HL5C 4PLIA 3GP7A 1JWMD 4F7UG 3HKZB 2C0TA 5I2MA 1BO0A 4RKBA 5LMUQ 2COWA 1D5ZC 5LL6S 1OTCA 2JA8G 3AMUA 3PO2G 1I07A 2LRQA 5FU7C 3J81E 1FMVA 1ZXTA 2D0OA 1PA6A 1WYDA 3DMUA 1ENAA 2M2LA 5JOBA 4JPBW 2VS1A 3H9NA 5ELFA 1T0JA 4JZ3A 3HOYH 3NTHA 5KYYB 1JB7A 1E7ZA 4OL7A 3GTQB 2EAYA 1SRUA 2M9VA 1VYUA 5IXFA 2KBTA 1HNWL 2CDTA 2IPKD 2KQ3A 1RAFB 3A8HB 4V0BA 3QHSA 2XMFA 5LJ3e 2JXBA 2O4XA 1M2VA 4RH6A 2ZPBB 2FO0A 2D9UA 1V43A 2DD4A 4C3JB 1K73R 2I07B 3MFGA 4A3IH 4HVUA 4C92B 2KY9A 1B1ZA 5M5XH 4CDCC 4DK3C 2HHHL 2E1HA 4CKCA 1M27C 3HGBA 3NFCA 4XYQA 4JI4L 2X4JA 1X3QA 3CCJA 5KE3A 4ZYSA 3CCUA 4E2FB 2C06A 3TDQA 2WIIB 1OO9B 1PRLC 2OEOA 2EJGC 3M59A 5CV6A 5LMNQ 3DUZA 4DV0L 2RCFA 5IYBH 2D6FA 2F0QA 1AP0A 4KTAA 4MHEA 3C4SA 2QK0A 1BVSA 4DBHA 1WOCA 2ZTCA 2V1CC 4APVA 1A0IA 5A35A 1A62A 1VQ9A 2KI7A 1VQLQ 1VQ6A 2AMCB 4LJZC 4ESRA 5FK9C 4DR5L 2DJGC 2LJ3A 2JJ9A 5GAMd 4EVOA 2MCNA 2DIQA 1HHVA 3L2UA 4A3BG 1EIHA 2FG0A 4HT9A 2HCKA 1E7OA 1CKOA 4BS9A 4EQPA 4C8QF 2DBMA 3FKIB 4CJ1B 1OYXA 2OTJT 2RNAA 4XQ3A 4NXMQ 1MV0B 2DL4A 3QR8A 1JICA 2P84A 1EUJA 4J1MA 2N3SA 4DV1L 4LF8L 1LV9A 8ATCB 1CQVA 2GNCA 4Q5WA 5GANe 4RA8A 4HA8A 4DV2Q 4DPGA 1G3TA 1G3YA 1Y1WB 1UTIA 4JI6Q 5EPKA 1U06A 1TTHB 1CI3M 3WDNA 4A3JH 1BOSA 5M5WH 5FWCA 4PJOA 1GL5A 1HR0W 3PO3B 1WA7A 3HOXB 3M9BA 2F0DA 4GKJL 4B3RQ 3MAQA 3HOUH 5CBAE 2R93G 3NQTA 5HURA 4XTZA 3PTAA 4KJOA 1EYGA 4BA2I 2KNBB 3RMHA 3HOVG 2KT8A 1TQOA 2IX3A 1XPOA 3KLWA 4B9WA 2EJFC 3OS0A 3ERSX 2V8JA 5JPMC 1VA7A 3BYYB 3ULRB 1IB8A 1RAIB 4N8FA 5C3EH 5G3LD 1S5CD 1G2BA 3MZ5A 3CCSQ 1CKMA 4GKJQ 5A0LA 4DR4Q 3JCMJ 1QG7A 1QWYA 3PVQA 2QW7A 4ELYC 3S1NH 3JCMV 4A53A 4PLLA 4KGVB 3CCVA 1PTOF 2G9DA 2KROA 2JXMB 3I8ZA 1LT5D 5IT9c 4KUDK 1AT1B 3GTKB 1QCBD 5FU6B 3CCRT 2O5IC 1YJNQ 4DK6C 2PZTA 3ME9A 1UNSA 4I65A 4DV1Q 3SD4A 2DJQA 2DETA 1TS5A 1SR3A 2J05A 4YHHL 3EHQA 4C92E 2KEEA 2BTTA 2FXQA 3T1YQ 3AT1B 4EDUA 4AYBB 4FXKC 3CCJT 2EY1A 3UE0A 3V2TA 1EY8A 2R92H 3GTPH 5AT1B 1JOQA 1AN8A 3IRBA 3S6WA 2AUKA 2VQFQ 1PFMA 2A19A 3L2QA 5D65A 2ZPGB 3C2PA 3EG9A 2KXDA 4IOAA 3S17B 1KQ1A 4G7HC 3LWIA 4KKSA 5BN5A 4PJJA 2K50A 2EYZA 5FLXE 1N8RR 4NXML 4NXNQ 2RHYA 4RTZA 3GP8A 2DUDA 3A8LB 4DR7L 1VYTA 1OXXK 2ZM6L 5IYDH 1IGQA 2QEXQ 2Z1CA 3HFZB 4DV6Q 4LFAL 3LGJA 2KYMA 3KDFA 4E47A 2VQFL 4DR1L 4N0AA 5IAYA 4ZGDB 5T1IA 4PL6A 5E4WC 3NHHA 3QYHB 1I4PA 3W1GA 3PUYA 2QQ9A 4Z02A 4RG2A 4HCSA 3G71A 4RCNA 3UI2A 1M8AA 3PF5A 5I9PA 2F2VA 1N36L 2PVGB 3E9HA 1XPRA 1E0BA 1I3QH 4Q5VA 2ZAEA 2BZ8A 1Q82U 1QNKA 1FX7A 2NUCA 2NN6I 1X01A 2NVYB 5KNBA 5JEAG 2CP5A 4DV4L 5IHIA 1LTID 1I50H 3IFTA 4BY1B 4C5IA 2XK0A 5FJ8H 4OWWB 1B7TA 3GTOB 4BA1I 3FC3A 4MDWA 3OYAA 1TUGB 3PMFA 5JJZA 4C8QA 2A6HD 1TS3A 2EYWA 2EY2A 4HKEA 1VQNQ 1X2KA 2LTOA 3L1AA 2EYHA 4CGYB 3S15H 2ZCFB 2F3VA 4F8MA 2E2HB 4A3FH 2F2WA 3HOUB 2EDGA 4DAPA 1YCSB 5E4XA 3HOXH 2OF1A 5IOCA 3H09A 4DNIA 4B3ML 3R6OA 1IL2A 2RJCA 2COZA 2I2LA 2JTEA 3SK4A 1PH8A 2Y90A 3BJUA 2KCNA 5IE8A 1SSFA 1RTNA 2KBNA 1TU0B 5C3WA 5IWAL 2F4IA 3H0HA 1BBWA 1HFGA 1BI0A 2E2JB 2GA4B 3NTKA 3TS0A 2V4DA 2K5FA 1OXUA 2KJXA 4FXDA 5FW9A 3AB9A 3META 4LW1A 4X64Q 2EBPA 2JZ2A 1M90R 5F2DA 2J6OA 1RAAB 5KYUA 3SFMA 3I55Q 3CCUT 2OTJQ 2A69C 2L5TA 3OPOA 4IPDA 5KYLA 2QILA 1N9SA 2PZ1A 1RCVD 2PYKA 3MEHA 4DV7L 1WTOA 4A3FB 1K8OA 4AQYL 3JRZA 4ZRZA 4BXXH 3K8AA 1IBMQ 1PD1A 2UU9L 3UA6A 3M4PA 3FJ5A 1EZZB 3NE5B 3OYGA 5GAEC 2KR3A 4M78E 2DTIA 3TP7A 3ICEA 1K1ZA 2YLBA 3I35A 2QAZA 4XU2A 4I7ZC 4A3KB 3R2TA 2DBKA 1I4HA 3OSOA 5LMNW 5BR8Q 1SEMA 3MXNA 4HJ7A 1R77A 2DA9A 1I3QB 3HS0C 4F7UE 2B2TC 5IGFA 1WXTA 4OO1H 2UXBQ 2FPEA 1VQ5T 2LY7A 2HZYA 2CZ0B 1X27A 1WIEA 1R8OB 2QDYB 3L9AX 4K8IA 4ZGJB 4C3HG 1Z9FA 3LWUA 5ELCA 1LJOA 4RTYA 1MHNA 5GAMh 2WV6D 3SE0A 1IKMA 4A3IB 3Q1JA 1BBZA 1BCOA 3CD6T 2UUAQ 2ICEC 5AFWA 2CHBD 4QVDA 4TRDA 3UE1A 4OWTB 4BI3A 2E12A 1TUDA 3TP6A 5GMKl 1VQOQ 4RKLA 5JVG3 2K7AA 5JVH3 3N5BB 1KRTA 1X9NA 1XNRQ 2O5JC 4A75A 1YJNT 4KKTA 2QG9B 3CPFA 2JOYA 2X4XA 3GOXA 2LP5A 1GHJA 3S17H 3HOYB 3OMGA 4L5RC 3VA5A 1ZEQX 4FXGC 4PV1C 2L8DA 3VU3C 2LQ8A 3CCMT 1U4PA 1X55A 4JI3L 2E2IH 3TP5A 4FT2A 3KF8B 5T1GA 3M56A 5GROA 2X69A 2Q8TA 2NYSA 1B53A 1VQLA 1VQ6Q 4L5QA 4C3IH 5CC4A 1BI1A 4J9CA 4F88A 1NYFA 5GADC 1PC0A 3VS4A 3RZDB 1XMOL 5KH6A 4YCUA 1XNRL 5KRUA 4IUVA 4WCIA 2EGEA 2HMAA 4CC3A 2GTOA 2AQ2B 1SLJA 3LGLA 5C44B 5FO8B 1KDAA 2F3IA 3C3LA 4K2LA 1HZAA 2QEXT 2CUBA 3IFDA 2NBFA 4JCVE 1B70B 2Z4IA 5EKLA 1S40A 4GLKA 1OX8A 1TS9A 1M1KC 4NW2A 2WAQB 3S1RH 1XNQQ 1JO8A 1YZ6A 3KUFA 2EFIA 4M7AA 1Q81C 1SYCA 4JI0Q 1F2LA 1W1FA 2E76C 2ENMA 4JLGA 4XTXA 1VQEA 4CDEC 1UEAB 2BDNA 3OSSC 2JYOA 3NELA 5LL6X 1YI2T 1PXUA 4RMFA 4Z88A 2VB2X 2CQAA 2YRDA 4DXGA 4CJ2C 1CKBA 4BY1H 2FRYA 3MEWA 2YRVA 1VCIA 5J39A 3NENA 1I0CA 1M2VB 2RJFA 2HDLA 1J8IA 5GAGC 1SDFA 1Y1WG 2JMCA 5IT9E 2JSOA 2VXWA 2EGCA 2N55A 1Q1EA 2RDHA 3BY7A 1LO5D 2DO3A 2D0NA 4KH1B 4C92A 1NCVA 2DVEA 1VMPA 2EYJA 4JI1L 4DFAA 3EFOB 1MMDA 4J9GA 2DEUA 2B2VA 4AIMA 3EH1A 1L2FA 3J81L 4NS5A 1M8VA 1VQNT 1EEFD 1HRJA 3NGPA 5IODA 4M75B 3PIO3 4OGCA 2NTTA 5DM73 2F0PA 4A3GG 1MI2A 1HXDA 1QUQA 2DX1A 1D5XC 3D0FA 4EQ5A 3PSIA 3HOZG 4A93B 2ZXPA 2AWNA 5AJ3Q 2F0GA 2AKWB 1IBKL 4JOIC 4DR2L 4A4EA 1GD7A 2DRMA 2O2OA 4A63B 1W4SA 5KYUB 5LJ5e 4OXPA 4F17A 4RTUA 1CHPD 2RSNA 4N9PA 4Y91A 1GFCA 2V1QA 2F4VQ 3JAME 1STGA 2K5NA 4A54A 5C3XA 2YDLA 3TSZA 1H3ZA 1X32A 2F3WA 2Y4XA 3WWVA 2YU9B 3J7A5 2EKHA 3GNGA 4N8X1 1Q7YR 3TVTA 2H3EB 1IBKQ 3CCEQ 4U68A 1C0MA 3T4AC 2GFUA 3JCMb 2G6FX 4JJBA 1MSGA 4NOYA 1T5EA 2B8FA 4M7DA 2LZ6B 3UF4A 4JVZA 1B50A 5JEAJ 2UUCL 4QVZA 1EEID 3C95A 4GLAC 3DEPA 1L0YB 4C8QB 1V29B 1VQ4Q 4V2SA 2KCMA 1TUCA 2PU9B 4R56A 2K9GA 1VS0A 3HZXA 4KHVA 2R61A 3F2BA 3Q24A 4X65Q 3GDEA 5FLXL 2HD3A 5DLQE 4JI8Q 2JVVA 5GAMg 3J80i 4HN7A 3QIAA 1Y0MA 4RCBA 5HK3A 3L2ZA 3SXHA 1W6KA 2ZTDA 2G3RA 2FPDA 4DOWA 1Q1BA 2RBMA 3CQZH 5M5YH 3MWYW 4LF7Q 1I6HB 4Y7NB 5CKEA 5CR3A 2F0TA 4RUGA 2IG0A 1PH3A 4QQBX 3RR6A 2MPMA 3FEOA 3CC2A 1K83H 1O7YA 4IJHA 1D1AA 4KUIA 4PMWA 4X66L 4DAMA 1X75C 1NE3A 2NVTH 1ZKOA 4RHSA 4OMNA 1K3RA 1PZID 2J06A 3C0CA 2YT6A 2FHTA 1KQSP 2LMJA 2K2MA 3R2IA 2DJFC 1HNXL 1T0HA 4AFSC 3G7LA 1HYOA 1M30A 1WD0A 3F2CA 2MPXC 5FU7B 3GTMB 2YLCA 1N9RA 3JCMg 3FKIH 4R0KA 2EPBA 1K73U 2A08A 5C4XH 4DAYB 3C94A 3HEJA 2QEXA 4GOPA 1VQ6T 4J7FA 3GV6A 4DR6Q 1B3QA 3PNWC 4YCWA 2VASA 1KDBA 2C5CA 2DL7A 1HZ9A 4C92D 2RHQB 3NHNA 1DD2A 2HSEB 4RGNA 2OX7A 2MK5A 1N5ZA 2LQKA 2RI2A 3M4GA 4OMFB 2B29A 1VQGA 1PFSA 5IYBG 4B3MQ 4A3MH 1H641 2IY5B 2XGTA 2FZGB 2P4RA 4J9HA 3JCMX 2ZXRA 3K0XA 5CCAA 4X9CA 4J6HA 4OELB 4OX9L 1ZYRD 5IP9H 3V7SA 2MHVA 2K3YA 1AWJA 2EY6A 2KHIA 2P5ZX 4HCEA 1WHHA 4K6LA 3C1FA 2DL5A 1SE2A 2F0LA 1TWCH 5KNCA 4QVCA 4LWCA 3GTMH 1O78A 1YITA 3OW7A 5ELDA 3A54A 1BBUA 2M0YA 3D8GA 3D6CA 4IURA 1MJCA 4JBJA 3W2DA 4F16A 4PJOC 4WJ3M 2ES2A 3K6OA 4E7ZA 3QWNA 2FVUA 2ATCB 2A5HA 2QA4T 1QVGA 1NBEB 1FMWA 2NVTB 1UGPB 3V05A 3JAMc 4A4HA 3CW2C 1Q7YU 2NB0A 4M1UB 1O9SA 4LDXA 2KHSA 2ABLA 3QO2A 1AZQA 1FJGQ 1NSNS 3OYYA 3OWEB 4M4ZA 4P2CB 3RUZA 3L3OC 3RKYA 1TS4A 5BR8L 4Y7NH 1I1JA 1VUBA 1WXBA 2EJ9A 5GAOq 5FO9B 1I6HH 1EFID 5M5YB 3CMEQ 1N8RC 4KN7C 4KGXB 1ONLA 1G83A 1K9MU 3EA6A 1YI2A 2CP3A 3QIIA 4CRIA 3DWAA 3WXMB 1YNND 2H8HA 1NLOC 3MCAB 1DOMA 3B6YA 3KK7A 5J3BA 5IH2A 2A74C 2NLUA 2K4KA 1DGSA 3BDUA 3V96A 1OEBA 1UGVA 1D6EC 2EY5A 2ZJQA 3I90A 2B2UC 1QP2A 3M0UA 3E5SA 1VQKQ 3QDRB 3VR6A 2XICA 3UATA 2LNVA 1SHFA 1YBYA 3KF6A 4K2KA 2JTMA 1U9RA 4NXNL 4P74A 3JB9F 1IBML 2NYZD 5A2QL 3G6EA 1QVGS 3I70A 2L12A 2LMCB 4A4IA 5KYXB 4DV7Q 3HL8A 5GMKi 3R8BA 3MXUA 5IYCG 1NM7A 4C3IB 3KBGA 2BDOA 4DOVA 2MO0A 4GOPC 1FJGL 5GMKh 2CP2A 3R93A 1WJRA 1VQ9Q 1QWEA 1WX6A 1VQ4T 5IYCH 3VR5A 4R4OA 1KG1A 1IW7D 1RIPA 1KIXA 3G48A 2MUYA 4GLMA 5ELNA 4DR3L 4WJ4A 1UWVA 1NG2A 4FU6A 3H0GB 3UDCA 2D9TA 1WVLA 1EU4A 1Q81U 3T53B 5IP7H 2E64A 1PH6A 3CPWS 2LXJA 2K5IA 3D6WA 3ITPA 3GBQA 5CMDA 4A93H 3H0GG 1JOKA 2H3JA 3OYEA 3P8DA 1JE4A 5L8RE 3KOJA 5CKBA 4LDVA 1B8AA 1NBWA 4DN4M 3BS1A 4R1JA 2HHHQ 1VF7A 4QY7A 3RNJA 4A3DG 2NVQB 1C8CA 1ZSZB 5I4DA 1YIJQ 2DXBA 5C0XJ 5GJWB 3RLNA 2EQSA 2PUOB 2K52A 2K5WA 4DNTB 1L1OB 1BU1A 2DJZA 3MHXA 4A3CH 1FL0A 1RI0A 3CQTA 4HCBA 2CVRA 1HNZL 4LFAQ 1H9KA 2E74C 3T9NA 1K0RA 1H95A 4O42A 1V1OA 4JJNK 4HSVA 4H02A 3V7RA 1N27A 1WNLA 3L7ZC 2NUPB 4RTTA 4BY1G 3O8VA 3CMAT 1BDOA 1XX8A 4FW2A 4ZTFA 2F0EA 4UY8C 2NZ1D 2FINB 3SVMA 3FRNA 5DAUA 4XTWA 1VYVA 3K7UC 2LX7A 3PMIA 4UP8A 4BACA 1WTQA 2ZGWA 5I21A 1DYQA 1Z6HA 4M7AF 1WTVA 4OO1I 2JA7B 1VIFA 5HY6A 2X3WD 3DM3A 3Q22A 3JB9J 3I4OA 1CTMA 4J8QA 4J8OA 2RPNA 2JA7G 1PSFA 2C0IA 3K5OA 2DY8A 2K5DA 1YFNA 1DXMA 2BA1A 2IIMA 1HNZQ 1RAEB 1HA6A 1LTBD 4YTLA 1ET6A 2KECA 1BCPB 3M3YH 1VQMT 5C0XI 1A8VA 3RMQA 4M7AC 1K4US 1OPKA 2F0IA 3J7AF 2VQEQ 5E3FA 4BY6B 2EQIA 3PUZA 3QJYA 5FLMG 4A4KA 4JZ4A 2QYZA 4M78A 1O7LA 2R57A 2GVBA 4C1NI 1DJ7B 1G3SA 5IWAQ 3X3MA 5IXBA 4GNXC 2LQNA 1Y07A 3FDRA 2VV5A 2PQWA 1KD1U 2M02A 2QA4Q 2Q2TA 4OMPA 3P1HA 2EQUA 2J7IA 3MP6A 3EGXB 5ELEA 3GTOH 2B2TA 1BI3A 1NUCA 3DM1A 4LK1C 1HNWQ 5GAOr 1XOVA 2FHDA 4AFZC 1BCPC 1I81A 4JRIA 1M90U 1PTOC 3F2UA 2XDPA 1HTLD 4G57A 3QOLA 3KXTA 1EFWA 4O6JA 2HIXA 4AMCA 1IBLL 2JA9A 3HKZG 3WVEB 1IYJB 3RR5A 2XD0A 1SNMA 4KD3A 4DV4Q 3LX7A 3PUXA 2A68D 3CC7A 1JJ2A 4IFDG 1HZBA 2JK8A 1RACB 2K01A 3L0OA 3T16A 2OTLQ 4AG1C 2YU9H 4OX9Q 4E7SA 2HKNA 3D4WA 2VKNA 4AT1B 2F0OA 5M3FB 1WZOA 4RTXA 4A3CG 3AHUA 2WKCA 5E7NA 1Q86C 2F0UA 4C3HB 3VS0A 4B3TL 1BNZA 4J9EA 2O88A 4TQUS 2K3BA 2ZZDA 1F1BB 3MPUB 5EBDA 1LT6D 4DR5Q 4B3SL 1ZX6A 3ZJYC 3UPUA 4KGZB 3FDTA 2DD5A 1Q82R
chains in the Genus database with same CATH topology
1H9SB 4QIWB 2DXTA 1I4XA 3PT9A 1C4QA 3JB9I 1PDQA 4JLIA 4E6IA 3KUPA 2KAFA 4RAUC 2QQSA 4KY7A 2O01E 4HCZA 2K7VA 5D3DA 4ULLA 2VXFA 5CAIA 5EG2A 3X20B 2VUBA 1KTKA 3ONAB 3VKIA 4M75C 1OXVA 1N8RU 3QBYA 4HMIA 1PRTB 4OB2B 4A4GA 2H1EA 2L89A 1UEBA 1EZ6A 2JTFA 1Y1VB 1GJXA 4RMOA 2GF7A 1PRTD 3EFXD 1NR2A 1KNEA 4PKCC 2X6LA 1HQMC 4BBSB 3A8GB 2WB1B 1WD1A 5AYFA 1ZBXA 1PZJD 1Y96A 1W2BS 3OMCA 1QVFS 2K33A 2ID0A 5M5WB 1JWUD 4BDYA 2XU8A 1ENFA 1EL0A 2DNEA 2EOTA 4HTHA 2EKOA 3OBWA 5TSSA 1RODA 4M78G 2X4WA 4XTUA 1HTPA 1ET9A 3CMET 1PYWD 4K14A 4QCLA 3H8ZA 4BY7B 3CBOA 4OIKA 2B8GA 3SWNC 5C0MA 4G4KA 4C5HA 2Y4YA 3OIPA 3BVGA 4RCCA 2PUKB 1A3VA 4M77E 1SYDA 4IFDI 4B08A 5IT9L 4A3GB 4U673 3GTPB 2R92B 3KLSA 2M16A 5GAMe 1TS2A 3BVMA 1UGRB 3URYA 1AEXA 4K5WA 2IWHA 5I2XA 3A56A 3OYJA 1OXSC 4PJOD 5D6WA 2CW0C 2RI5A 3C12A 3CCVT 3J80E 2X35A 2L4NA 4XT3B 3S14B 3VJPA 3NQIA 4KV6A 5CORA 4CBVA 3JCMW 4KJNA 3LW5E 4A3EB 3OYMA 3K57A 2DNCA 1BI2A 3SK8A 3LGFA 3UT1A 2E10A 3MP8A 1Q7YC 1TWFB 2F03A 3WOFA 3E19A 4Y28E 3M54A 4OGEA 3LX0A 4XQQA 1V8QA 1QJOA 1EIFA 1CHQD 3EJIA 2MWPA 1XYIA 3S9WA 3QZ5B 3MEUA 1QE6A 3S2DB 4IFDH 1U8RA 2MGSA 3K58A 3M4OB 4M77F 1PTOH 1UUPA 4K6DA 1FNUA 4KBMB 2E65A 2M00A 2PMZB 3T56B 3N52A 2AQ3B 2EYMA 2K28A 2PVOB 4HR7B 1KLUD 3PIOA 1IW7C 1YHQA 5JEAH 2BKDN 3ZBDA 1XNIA 2IT1A 1K73C 2E6NA 4M7DF 1SBBB 2AHJB 3CXCA 1I4K1 4HCCA 4B9XA 1DCZA 4MZTA 1Y8OB 2BUDA 4J6YA 2K5QA 5LJ5h 5CQXA 5K36H 3TCJA 2VGMA 2JEAI 3M7NA 2LVMA 1NR4A 3H94A 1OZ2A 4QUCA 1FR3A 2BOSA 2PCFB 2K57A 2E2DC 2KQWA 2LFNA 1Z7TA 2EJFA 3KBXA 3JCMh 2B2YC 1SNCA 5I6WA 3BYTB 1JB3A 4LDUA 5CO7A 3OS2A 1TU2B 1BXTA 1M9SA 1VQOA 1P92A 2RB6A 3M55A 3ND9A 5HGTA 2CZ1B 1A3TA 3LH0A 2XDDA 1J9OA 1GUTA 1TIID 5DEHA 2OTLT 3U9OA 4QMGA 3AU7A 1D2BA 3R3OA 4C0GA 3PIPA 3PUVA 2CZ6B 3V7CA 3PUWA 2SNSA 4E7HA 4ODGA 3CCLT 1HPCA 3NXWA 4ZUIA 1SFOB 4BD3A 1RD9D 2BA0A 2K32A 1EOTA 3GV3A 4XYOA 2F0JA 2XIWA 1GUOA 3L2WA 1VQMA 2CS7A 2YYZA 5LJ3g 3CCMA 1ML0D 2OAUA 2IW3A 2HQXA 1PLFA 5CV9A 2ZT9C 1II3A 3G6ET 2P0QA 1STNA 4GZYC 2P0KA 4J6WA 3A8JE 1MBYA 5EPLA 3TSSA 4XU3A 3RKWA 1TWCB 3SK6A 1GHKA 5FOBB 1KC8U 1TKWB 4A3DB 3NBIA 1TY2A 1UAPA 5J22A 2KUMA 1EY7A 5IGBA 2B2WC 2OTLA 4ZK9B 3K5MA 1G91A 1O75A 2NN6H 2QDBA 4A3MB 2K2VA 3VR4A 1VQ5A 4L6TB 1I4QA 2QQRA 4ME7A 4H13C 4NKLA 1EYCA 1KABA 3OW2A 1H9SA 4GY5A 3QB3A 4R8NA 2XRQD 3G4SA 1BYMA 2XRSD 1F2MA 2D5DA 5C0XH 3J7YW 4M75G 1ILQA 1RDPD 3HP9A 3PFSA 2LKVA 5KNDA 3NSWA 2NWGA 3P20A 2PW7A 4HMJA 4M75A 3DLLA 5J1ZA 3JAML 4JK1C 4JRKA 4DGZA 3SK5A 2A73B 5LJ3h 3LWEA 2HNIA 3CCST 3O13A 2SDFA 3K0YA 1V1PA 4OF1A 2LCLA 5HK0A 2NN6G 1YCYA 3F70A 1QILA 2OXPA 5GAN7 3GF5A 3I91A 1VIEA 1SMYD 5JPNC 4Q0FA 1QVPA 3BVZA 5J26A 5BN3A 4ZUJA 4C0FA 5GMKe 3QZ9B 2EYQA 1SYFA 2KDSA 2V8IA 2WINB 2F0NA 4M77A 1NJIU 3RESA 1EY9A 1LABA 3CMEA 2FB7A 3CC4T 4C92C 3CC2T 2RHUA 4CKBA 2XSCA 2EYOA 3NTIA 3CPWA 3P8HA 2FFKB 4JDSA 3GTLB 1XTCD 2GQVA 5ELBA 5DY9A 1G3WA 1SNDA 3I73A 1EYDA 2LT1A 4II1A 3K7AB 1YITT 4KN4C 4ELZC 4C1NK 5CKDA 5LJ3j 1VQ7T 4DNRB 5CGKA 1PTOD 1LOJA 2RKSA 5FO7B 1WTWA 3DB3A 3I4NB 4C8QE 1XWEA 4QUFA 3MP1A 5KCHA 1S5ED 2XI9A 3EFRA 4C8QC 3CCRA 4CJ0B 3S16B 5FRNA 5CKFA 5JAVA 3SEBA 4KKUA 2EXZA 4ZTJA 3S3MA 1B44D 2D62A 3FB9A 3MEAA 2A6EC 4M7AG 4RGTA 1VQ7A 3C46A 3S3NA 1R4PB 1TWHB 1I8FA 2CW0D 1SSOA 5A0GA 5C6AA 2WKDA 4DK0A 1CZWA 1Q3LA 3ZEHA 3Q6SA 3VA7A 1G2TA 2E5QA 3VYSA 1HA5A 3QSUA 3X24B 2Z4HA 1E2VA 3JB9D 3QOJA 4RHRA 3X28B 3QUIA 2L55A 4M75E 1ZQ1A 3X3NA 2LDMA 4PJOF 5KE2A 4LMQD 5IGDA 4OVAA 4BBRB 4WFN3 4P5NA 1CA5A 5KYIA 3FMCA 4M75D 4HAEA 4OB1B 2R6GA 4FL6A 3QG1A 5FU6C 4J7IA 4ZLTF 3RERA 5CYUA 1D1IA 3ZYYX 1SJED 1U4RA 3HRTA 3SB2A 3TBIB 2EYFA 1E2WA 2MP1A 3E9GA 1KQSS 1BF4A 5EKKA 1UB4A 5CQYA 2D0QB 4MZPA 1TWGB 4MZMA 4TVRA 1LLRD 2MWOA 1U4MA 4MN3A 2QXFA 5GMKj 4FT4A 5GANh 4M77B 3OYFA 2XNAC 3NK9A 2EYPA 4UDUC 4DK1A 3GD7A 2JNGA 4C8QG 2XG8D 4M77G 4OP0A 1ESRA 2ICIA 2N88A 2HCCA 2GCXA 3K59A 2E75C 4HEDA 3LYIA 1ESFA 3OIQA 1T5XD 2EZVA 1EWHA 2HQEA 3E0JA 4RFBA 5D6XA 1S72T 4KD4A 2F0WA 5EGTA 4F7XA 5KEEA 5EKIA 2RO0A 3VYGA 4M7DG 2EQMA 4XTYA 2QF7A 2FMMA 4KULA 2F0MA 4DA4A 3CC7T 3RKXA 1M5Q1 1HUNA 4PJOG 3I56T 1FYCA 2KVMA 3ASKA 3DKMA 3S15B 3TEEA 4QF4A 2A69D 4EMHA 2TSSA 1H9RA 3HRSA 2RHIA 3H6ZA 4DAVA 5CV8A 4XDXA 1CFMA 2F1MA 4NL3A 4ILWA 4N4HA 2RQXA 1PMRA 5DNFA 2X4YA 1C48A 3CKIB 1BKBA 3HFOA 4JS4A 2A3LA 1F9PA 5ISRA 1LTRD 1KQSA 1Y71A 3VYUA 4DA2A 1VQLT 3FPPA 3G7ZA 3J80L 2F5TX 5D6YA 5LJ5g 1G6ZA 2BE5D 4FVMA 1CA6A 2PNRC 1K8AC 2EVBA 3DWPA 4RGMA 4XT1B 3D31A 2F0KA 1AFPA 4ZN1A 1QNUA 3OHXC 2RK1A 2RJEA 3OA6A 1JWSD 1WTXA 2J4XA 5GAMf 1EY6A 4KT0E 3M57A 1F77A 2XIDA 4ZAIA 3G4ST 2HAXA 2EIFA 1STYA 5GAN5 3X26B 2QQBA 3HRUA 4QQGA 3T51B 3A8OB 4ZGEB 1BUVT 4G7ZC 2EQKA 1ENCA 4TKOB 3TU4K 5GAN2 1XTDA 4M78D 4XU1A 4X3UA 2KVQG 2V8KA 2L5QA 5I2SA 3S1NB 4R9WA 1SXTA 1GUGA 4K8JA 1AW7A 3ERQA 3OW2S 3N6RA 3OYKA 3DXJC 1DJRD 5IGEA 3X25B 5C3EB 3BG3A 3QJ6A 1M1GA 2VGNA 1SYGA 3TMEA 4XTCS 3OQ5A 4C3JG 2WSEE 2XWJB 3Q23A 2WSFE 3OYDA 3MO8A 2SNMA 1LTAD 1RF2D 4JBWA 1FD7D 1RHPA 2M1HA 1D3BA 1TVXA 5D14A 4LD6A 1YNNC 4KK7A 1I4RA 3TN2A 1MGQA 1A2UA 5GAN3 3OYHA 5HKCA 1VQ8A 4N4GA 2E70A 4UC4A 1M1KU 3OYLA 5IIFA 2DK3A 5C4HA 1KD1C 1IZ6A 3KLSX 1NPRA 2EJGA 2K05A 2GFAA 4E7KA 4J5YA 3CMAA 3QPHA 4M7DC 3HRZC 5CVIA 1Y8PB 4FF3A 3L2RA 4EMKA 4K5XA 1CQFA 2RDFA 3FJPA 3D4DA 1A2TA 3JCMe 5GANj 4XIGS 3J7AV 3M85A 4M78B 5A2QE 2A6ED 3MVVA 3VR3A 3M3YB 5M5XB 2DZCA 1OI1A 5FROA 1JRIA 2B2YA 3TP8A 2HD0A 2BCOA 4C8QD 4WORA 2VNUD 3OBYA 1MGSA 1Q86U 1O7ZA 2DTHA 4MMKA 5C0XG 3RLFA 1I6VC 3OYNA 1PFNA 2L1BA 2L11A 2MJ8A 2SOBA 1PZKD 1STHA 4E7IA 5LJ5j 1S5FD 1FWZA 2DN8A 1HUMA 4IUTA 1Q12A 2I46A 3FVQA 4X3TA 1IYVA 4LDWA 4VUBA 4IZ8A 2WSCE 4FF2A 2J0TD 2R5AA 4BUGA 1KNAA 1YHQT 3RMSA 5CBEE 4X9DA 4KI0A 3A8KE 2ENBA 1BQQT 1SE4A 2PZUA 1B34B 2M0OA 3OYIA 3CXCS 3S1MB 3CD6A 2LCCA 3NBHA 2AUJD 2DPPB 3EQLC 5NUCA 5DM7R 3QKJA 4C0DB 1SYBA 2IX1A 4PMCA 1LT3D 1B9MA 5CIUA 3CRLC 4QQ6A 4ZN3A 2KK4A 1VQOT 1G8ZD 1KHCA 3MXPA 2NVXB 4QW2A 2HBPA 3W3AA 3RZOB 2DKGA 3VUZA 2HUGA 2DAQA 2B2WA 5M3MB 1XQHA 4O5VA 3QO3A 2DY7A 4M7AD 3GTGB 3ZFJA 2IX0A 3MA2B 3P7JA 3I3CA 3CEYA 4UAIA 2ZXOA 5KGUA 4BI8B 1NJIC 4ZKBB 3M53A 4M7AE 3I4MB 3JSCA 3CU7A 3BDLA 3VYRA 4ID6A 2B63B 3ND8A 1R9TB 5KIXA 5C5LA 1QOHA 3HP3A 3URGA 4K5VA 4BE2A 2XVSA 2K04A 3S2HB 4IUNA 4M75F 3H6MA 5GAN6 2RH2A 4KY6A 2QEJC 1HK9A 3I55T 4A3BB 2K3XA 4JRPA 2O2LD 5CKHA 1B3AA 3SDZA 5GANg 1GUWA 1VDZA 2F5KA 3S1QB 1STBA 1IYUA 1D1KA 4EMKB 2DTOA 4C2MB 1SNPA 3I56A 1SMYC 4F87A 2KSSA 5KCOA 1SEBD 4OB3B 1QW1A 4J83A 3CC4A 2RVLA 3HG9A 2XKOC 3E6ZX 3T13A 5GAN4 3S3OA 2EWNA 2WP8J 2E41A 4J6XA 4OHJA 3CCQT 4F7UA 4MMLA 3EROA 5GAMj 3E1SA 4DF7A 3K5LA 1TR5A 1TWAB 4QB4A 3MC0B 2R5MA 1GOZA 1IKLA 3VV0A 4JRQA 4BDZA 1JQYD 2BE5C 5C4XB 4E7LA 4DQ2A 2QI2A 4OIJA 3OWFA 4FYDA 1WCMB 2VYTA 3CCET 1B4OA 4XQNA 3NPPA 3ER0A 1MD2D 4L6V5 2FYKA 4BB7A 2KCCA 4C3IG 1BBXC 1BCPD 5GAN8 1B9NA 3PIP3 1PRTC 3SWNB 1TT2A 4PQXA 1F9QA 1WQWA 2RHXA 2MF2A 2AQ1B 4IUUA 1Q90A 4M77D 2R58A 3VR2A 5LJ5d 1KC8C 2A68C 3A7AB 3CHBD 4ATOA 1B34A 4JS5A 1GUSA 1CK1A 1DZ1A 2EQJA 1EU3A 2VUMB 5GAOn 4KHZA 2RHZA 3VYTA 1I5LA 2QQAA 4C92F 1MSHA 1SNQA 4ABNA 3CBPA 2EYLA 4WRDA 1STEA 4TSSA 2JA5B 5I6YA 1BCPF 2MI6A 2JA6B 4H44C 3BW1A 1SNOA 1F9RA 4L5GA 1FGBD 4OO1G 2E6ZA 1GUNA 3DHQA 4N9TA 3NWTA 1YIJA 1NAPA 1L0XB 2LX9A 2FJ2A 2CKKA 2PZWA 3WOEA 2MMPA 1CM9A 1OZ3A 2ZPFB 3LWHA 3A7LA 1WQ7A 3FIFA 3HOZB 1AHJB 2K6AA 4L63B 4EQOA 3GQBA 3I4LA 1EYAA 3BDCA 4X34A 2CGHA 1WJQA 2Q8RE 3GLXA 1BIAA 4RWSC 3VYHB 1DONA 1WPYA 4RCOA 3V8JA 3L42A 2P0PA 2RM4A 1WTPA 3GIBA 2R3ZA 1JR0D 3RD4A 1D3BB 1U1TA 1WJSA 4FM4B 3K5NA 4L8JA 1XXGA 2LS01 4EPCA 3TZDA 4XAXB 1EZ8A 3C1EA 3PGGA 3CCEA 5CV4A 1YNJC 1Y96B 5CV7A 3MHBA 4OB0B 1HQRD 1IREB 1PRTF 1LTGD 3HPWA 4BY6C 1LTTD 1F2YA 4EGVA 2K5LA 1K8AU 4JUVA 4FO2A 1GXDC 4QQDA 3OYBA 1LT4D 4F7UB 1ILPA 4Z9CB 3OOCA 3G71T 2YHTA 1PTOB 1O80A 4IUPA 2X6GA 5LJ3f 2B2UA 4S3SA 1FNWA 4PMBA 1SE3A 2SEBD 3IKJA 2L0CA 2JE6I 1SAPA 1EY5A 4PJOE 1YJ9T 1KAAA 4C5EA 4O1NA 2F0SA 2HDMA 5LHY1 5IN1A 1LACA 2B39A 3NUCA 3NWSA 1SYEA 2K1BA 3SHLA 1S4ZA 1JBMA 4NP5A 3NP8A 1K8MA 5IGGA 1AZPA 3CBMA 1U4LA 2H4OA 2DZ9A 1VQ8T 4C92G 2J7ZA 3A55A 1VQ9T 2Y0SB 4M7DD 4KY5A 3A8MB 2F0HA 3A5ZB 4XK8E 1DOKA 1W6JA 1HFNA 2Z8LA 4NMZA 1N6AA 4DXFA 3MXGA 3A8IE 2DXUA 1JC7A 1HCZA 5GAOm 3IL8A 4HSPA 2PW5A 2PQEA 2ZPIB 1JB0E 1TY0A 4L59A 3CCLA 4M7AB 2L3RA 3OS1A 3L2VA 4E7JA 2TMPA 3JCMf 4C56C 2G9HD 1JJ2S 3EFSA 3QXEB 2XDBA 1BIBA 1CZGA 3M7GA 2VXEA 2F0FA 5FKAC 1F9SA 1LNXA 1X6OA 4BI4A 5COYA 4EQNA 3M4YA 2AWOA 2A6HC 2R93B 1LTSD 5GAOl 2IJ0A 4PNOA 2HCIA 4WJWA 2DD5A 3WVDB 4RGOS 4FF4A 2ZPHB 3DWQA 1R4QB 3OYCA 3UWNA 4NDXA 1S72A 1EQTA 4IQZA 4CI0C 2RJDA 1F2ZA 1H9JA 3PV0A 1IHZA 1VQKT 3E9FA 2IVWA 5GAOp 1JOOA 1CT1D 1I50B 4RG8A 4IALA 3DEOA 5BN4A 2O4XB 4LD9K 4WF2A 3RUXA 2KOLA 1V1PB 4FNFA 3D3RA 4MIUA 1RKNA 3M5AA 1RTOA 4BE1A 2KA7A 2XHCA 1X3PA 4FIBA 5I9OA 3G6JB 5EBCA 1WGSA 2QTXA 3OSVA 5FRMA 2XWBB 2DEQA 2B8AA 3D4RA 1BR9A 1G5VA 3JB9G 4M7DB 2NTSA 1YIJT 3LNNA 2JA8B 3PO2B 2M9UA 1Y8NB 3M58A 3FLGA 4PJOB 3GO5A 4XU0A 2RSOA 3KF8A 4IN3A 3RIRA 4LAAA 1TH7A 4CHTB 5CR2A 2K03A 5GMKm 1NE8A 5GANf 3DB4A 1Q8IA 3JCMQ 3M9QA 3GNFB 2XN9C 3BZDB 3MEVA 1Q82C 4EMKC 1KLGD 4PNYA 4BE0A 2PO4A 3I55A 1I4GA 3EAEA 2OT2A 1KQ2A 2WACA 3GPLA 4C0ZA 3FPUB 2P4TA 4ME5A 1W2BA 1QVFA 2EJMA 3LLRA 3CCSA 1M90C 4IFDJ 1Z47A 2CYZB 4RKUE 4N4IA 3EVQA 3HFNA 1E2ZA 4M78F 4IKFA 4X3SA 5GANd 1FNVA 2FL7A 3BFMA 4HT8A 1ZHIA 1KDCA 4X3KA 1VQKA 1Y69U 2A7YA 2DIGA 4ZQ3A 5EQ0A 1NZ9A 5CK9A 1UGQB 2QCPX 5LJ3d 1VQNA 1PFBA 1S5DD 1YJWA 3FEWX 3OS5A 4YIJA 4FSXA 1VQPA 3I72A 3TZUA 5IGCA 1RL2A 5C4JB 5K36G 4H7BA 5LJ5f 4NL2A 2C9OA 2CZ7B 1EWCA 3OB9A 1S5BD 5DM63 2QKIC 3PMTA 1YNJD 4XXEA 1VQPT 3CRKC 3V8KA 3GTJB 2IL8A 3VUBA 1IL8A 2QA4A 3HOVB 1G291 1HXYD 1EQVA 2JUFA 2L9HA 4KMUC 4N0AC 1U1SA 1EY0A 2MAMA 1PSEA 4C0DC 1Y7XA 2JEBI 2RD1A 1ZYRC 2KMTA 3FRPB 5C4ZA 2F0VA 3HHTB 4A4FA 1K83B 3P8BB 2JN0A 2R7ZB 2Q8IB 1FXXA 4EMGA 4M8AA 3CQZB 1GXIE 4MDXA 5A0DA 2PPBC 1JORA 1DOLA 1A6XA 1EY4A 3KLRA 2BIVA 3P75A 1YJNA 4D6WA 3U9SA 5K5PA 4M78C 1DM0B 4IUQA 2K4YA 3JCMP 3H91A 1OXTA 5EJWA 4BWGB 4XTVA 1JCKB 4H0LC 3TREA 1NPPA 1D5MC 4XQJA 3JCMc 3CCQA 1G2SA 5CV5A 5C6SA 4DAYA 1QB5D 4LDYA 3MTSA 1QP3A 4F7UF 1M1FA 2JP1A 4C5GA 2FMCA 1EIGA 1SJHD 2PVDB 5DLOA 1M4ZA 1YJWT 4R8IA 5E1FA 4OGQC 4M77C 1UGSB 3MFYA 2KEDA 2OTJA 3HOWB 4G7OC 4M7DE 5G3LF 5M9OA 5C5MA 3BDOA 2VB3X 2LC4A 2DXCA 2B2VC 4CKEA 2F69A 2RDGA 4FP5D 3DLMA 2RA2A 1K9MC 3OY9A 2RA4A 1VQ4A 5D3IB 3JCMd 1A3UA 1M4VA 1WTRA 4V190 3HSBA 2RK2A 3SR1A 1KHIA 3SWNA 3IAYA 2ZPEB 2D2CC 3Q0AA 5I2YA 3V8LA 1A15A 1ICWA 1VF5C 1STAA 3JB9H 4DU9A 2LT4A 3S1RB 2EE1A 3QYGB 4R55A 4FF1A 3HKSA 3H3VC 1VMCA 2RI3A 1YJ9A 3INZA 1RJTA 2VC8A 4PLIA 3GP7A 1JWMD 4F7UG 3HKZB 5I2MA 1BO0A 4RKBA 1D5ZC 5LL6S 3AMUA 5FU7C 2LRQA 3J81E 1ZXTA 3DMUA 1ENAA 2M2LA 5JOBA 5ELFA 3NTHA 3GTQB 4OL7A 2EAYA 2M9VA 2IPKD 4V0BA 2KQ3A 3A8HB 3QHSA 5LJ3e 2O4XA 4RH6A 2ZPBB 2D9UA 1V43A 2DD4A 4C3JB 2I07B 3MFGA 4C92B 2KY9A 1B1ZA 2E1HA 4CKCA 3HGBA 3NFCA 4XYQA 2X4JA 1X3QA 3CCJA 5KE3A 4ZYSA 3CCUA 2C06A 3TDQA 2WIIB 1OO9B 2OEOA 2EJGC 3M59A 5CV6A 3DUZA 2D6FA 2F0QA 1AP0A 4KTAA 4MHEA 3C4SA 5A35A 1VQ9A 1VQ6A 4LJZC 5FK9C 5GAMd 4EVOA 1HHVA 2DIQA 3L2UA 1EIHA 4HT9A 4BS9A 4EQPA 4C8QF 3FKIB