3NUNA

Phosphoinositide-dependent kinase-1 (pdk1) with lead compound
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
288
structure length
278
Chain Sequence
PPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aminoindazole PDK1 Inhibitors: A Case Study in Fragment-Based Drug Discovery
rcsb
molecule keywords PkB-like
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 84
structure length 278
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nunA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nunA01
4FIJA 3GCUA 4BY9E 1QPCA 2UW4A 4K11A 4NWMA 5M07A 3OCGA 2XNEA 5BYYA 5CASA 4PQNA 2C0OA 4CLIA 2PMOX 5AV4A 4FA2A 5CF6A 4AZSA 3FKNA 2QU6A 4EBWA 4BKJA 4ARKA 1PYXA 3JUHA 2JDVA 3I5ZA 3MA6A 4Z7HA 2UW5A 2X8DA 3MH0A 3NS9A 4H39A 5HU3A 2W4OA 1KUTA 2A19B 5BVWA 4PPAA 1LR4A 3FY0A 3A60A 4C3PA 3TNHA 2C6KA 4FT9A 3P5KA 4PUZA 5HE3A 5BVEA 2O2UA 2X6DA 3ULIA 1K3AA 5ACBC 3NEWA 5JZNA 4I94A 5I0BA 2IG7A 1Q99A 5CX9A 2Z2WA 2HOGA 1P4OA 4EH8A 4ZSAA 3MTFA 4IW0A 5DOSA 5CEKA 5C4LA 2QI8A 3EN7A 4DC2A 5CI7A 4TZRA 2G9XA 2ZM3A 2ERZE 4DT9A 4MNEB 3TCPA 2J0KA 1ERKA 4OBOA 4C02A 4G34A 4CCBA 3D15A 3PTGA 3FMHA 1PF8A 4M15A 2E9NA 3K5UA 4UYNA 3V5PA 3PZEA 3E64A 5HVYA 4CZYB 4D2RA 4DE4A 2VTMA 3CBLA 5M4CA 3QC4A 5J9LA 2QONA 2QOCA 4HPTE 3G6HA 4M12A 4M3QA 4O0VA 4RJ7A 3PWYA 4AACA 3UIXA 2CKEA 1J1BA 1LPUA 4D2SA 4EKLA 2PU8A 4IDTA 2XM9A 5D11A 3IKAA 4FGRA 1I09A 4FT3A 4CTBA 2VO3A 4EOLA 5C4KA 3W1FA 5B2MA 2C0IA 4FTLA 4WSQA 2F7EE 4CEGA 1KE9A 4AA0A 2FUMA 3T9TA 2R0UA 4BCMA 2VNWA 2Y7JA 1YOLA 2YWPA 4FODA 2XK9A 3N4TA 2XIXA 2VTAA 3D5VA 4NJDA 3LXPA 3NNUA 2PTKA 1EH4A 3AC1A 4O38A 4F1MA 5K5NA 4B7TA 5IDNA 3FLWA 1ND4A 2P2IA 2PL0A 2F2UA 3CTQA 3ZS5A 4M13A 4W8DA 4EWHA 2BPMA 4FNYA 4NKAA 2WTKC 1XH5A 4IVBA 3EFLA 4QO9A 5GHVA 4FGBA 4D4VA 2FB8A 2ITUA 3MJ2A 1Z9XA 3F3WA 4GH2A 4IACA 5AUZA 4RG0A 2UZTA 4X2NA 2A2AA 2C6MA 4MXOA 5AP3A 3W2SA 4AX8A 3U6JA 3ZU7A 1SMHA 4FYNA 5AUYA 2J5FA 5ETFA 2QNJA 3EJ1A 4JR3A 1JVPP 3EIDA 4D0WA 3HAVA 4U9AA 3MPMA 3CXWA 3FLYA 5FP6A 5LWNA 4UALA 2EVAA 4G3CA 5C27A 1UU9A 2PVNA 4L7SA 4K6ZA 4NK9A 2Z02A 3PDTA 2VWVA 3Q2JA 4M8TA 5DEYA 3ZZWA 1U5RA 2FSMX 4H3QA 3ZUVA 3POOA 3VUTA 5JFSA 4FTQA 3RPSA 2YIQA 4NYEA 4MXXA 2C5XA 2V0DA 4CG9A 4IVCA 2QOKA 4BTKA 5FBOA 3QWJA 2X7GA 3GCVA 5E90A 4QMZA 3LXKA 4DN5A 3H9OA 2PPQA 3BU3A 3LMHA 1ZWSA 4JG8A 3HP5A 5CNNA 3THBA 3V8TA 3GUBA 4L9IA 3F61A 2C6LA 4TWOA 3A7IA 3FMKA 3LFSA 2R9SA 2VTTA 4U5JA 5E8ZA 4BBFA 2C30A 3SOCA 3VNTA 1JKKA 3VO3A 3EMGA 2BAJA 2CN5A 2OJIA 2ITNA 3OTUA 4RSSA 2PMLX 4JS8A 5JSMA 2HZNA 4GK2A 3FJQE 4IWQA 3ZBFA 2GNFA 2WO6A 3IO7A 1TVOA 2B53A 4MYGA 2BFYA 3DBQA 3EQDA 5EFQA 2IVUA 2YCRA 2GQGA 1QL6A 3BE9A 3L8PA 3ORIA 4FKIA 5ANJA 5J9YA 3SLSA 5L2IA 3CR0A 5IQAA 1MUOA 2W1HA 2ETRA 5FEEA 3NGAA 2YERA 3DBDA 3LKMA 4JJRA 4M84A 5J95A 3G51A 3JS2A 3JY9A 3NYNA 3UC4A 4AT5A 5IUHA 3DKOA 2R7BA 4X7QA 3COIA 4IAYA 5CSPA 3I0OA 5JK3A 2EU9A 5HBHA 4WNKA 1H1SA 4TYIA 5BYZA 5IUGA 3OMVA 4OUCA 3KVWA 3KN6A 2A1AB 2ITPA 4XV2A 5C8KA 3OROA 3Q4UA 3E8DA 2IVSA 4L68A 1RQQA 4NTTA 3R04A 4II5A 3HV3A 3P9JA 2C6OA 3RK5A 3TTIA 3ZO2A 3RWQA 5I9XA 4FZ6A 1FGKA 3GVUA 2XCKA 5DR6A 4CFXA 2PZIA 1QPJA 5EG3A 3BQCA 4LQMA 3TIZA 1WFCA 4IC7A 4Q9SA 2OJFE 4AZTA 4UWYA 4FBXA 4FKTA 2QR8A 2V7AA 4RA4A 5IQHA 3KXGA 5KMLA 2WQNA 2HZ4A 4XG9A 4CFUA 1UA2A 3GOPA 4B4LA 5AM7A 3V5TA 4D4YA 1YHSA 4E7WA 3DK7A 4YJRA 5HCZA 3IDPA 4BWKA 4IQ6A 5TF9A 4C3FA 3UMXA 3VQUA 4G2FA 2VD5A 4BDDA 1H0WA 3ATTA 2X7FA 4ZSGA 2B1PA 3CKWA 3MY0A 3FQSA 3TTJA 2QOIA 4ZIMA 1TKIA 3CQUA 4LV5A 3RJCA 3OG7A 3UJGA 4RJ6A 3IGOA 5ANIA 5EHYA 4ALWA 3MVHA 4OTHA 5FTOA 3NW5A 3PP1A 4Q5HA 2Z7LA 2C5VA 3L1SA 3VS4A 3ZXTA 2J0MB 3IS5A 3QYWA 2V55A 4HVSA 3ORLA 2X9FA 2X6EA 1WBVA 4IAZA 5HO8A 5H8GA 4N0SA 4PNIA 3F3VA 1VYWA 4FZDB 2UW9A 3GFWA 4F0GA 3N4UA 2YCQA 2BDFA 2RFEA 3KXXA 1VEBA 5IUIA 4P4CA 4KBAA 3DQXA 3LFEA 3UIMA 2CLXA 3LVPA 3I1AA 4O2ZA 4G6NA 4WUAA 5IH4A 3BBWA 1ATPE 3L9PA 5HIBA 4EH7A 3PG3A 2BZIB 5K0XA 1M2RA 3BHUA 4EOJA 4C4EA 5M55A 1HCKA 1ZYSA 2J51A 2OSCA 4LYNA 1H1RA 4ZSJA 5J8IA 2XK8A 5AFVA 4JDIA 3NVKI 3SV0A 3MFRA 3SXFA 2ZOQA 5I9UA 5DBXA 3LFNA 5IA4A 3TJCA 4KIOA 2P55A 5HTCA 2W5BA 5IA3A 2QURA 3UVQA 4O86A 3NCGA 3QZHA 2OF2A 2V22A 3FV8A 2IN6A 3D5UA 4QD6A 5BVKA 4B99A 2XIKA 4L46A 5M4FA 1H0VA 3LXNA 2X39A 4R3CA 1ZOHA 3VRZA 3FI3A 3KXMA 3NX8A 4S2ZA 2OLCA 5TE0A 1OPKA 3HUBA 1U54B 3MSSA 3T9IA 4CSVA 1PY5A 2XIZA 1H01A 2I6LA 2PSQA 3BHYA 3PG1A 4LG4A 5AIKA 5K3YA 5AV2A 5JFWA 5DT4A 4F70A 3PVWA 4NL0A 2UVXA 4CRSA 4GG5A 4XG3A 2OW3A 2Y9QA 3ZO3A 3CEKA 4PRJA 3R8LA 4AN2A 4F7SA 4DFBA 2VWUA 3QTWA 3TUBA 1YHVA 2PHKA 4AA4A 5HG8A 4TYEA 5G1XA 1AGWA 4BDBA 4E4LA 4QYEA 2R3GA 4ANLA 1H24A 1ZOGA 3DPKA 3WYYA 5BMSA 3HAMA 4FF8A 4MQ1A 2ETKA 1A06A 1H25A 2W4KA 4L6QA 3PFQA 2WMRA 4IX3A 4YGAA 2UVZA 4ZY6A 3OTVA 4EQCA 4OW8A 2XK7A 4QMXA 4C4FA 4C4IA 4TYHA 3LFBA 3FKOA 3Q2MA 2I7QA 4FSUA 2DUVA 5CU6A 2GS6A 3H9RA 1OIUA 2R3JA 3FHRA 4Y8DA 5BYLA 5IU2A 4H1MA 4M67A 4YZBA 3QC9A 4MNFA 4C34A 3QXOA 1FOTA 2XRUA 4DGMA 5KHXA 4MH7A 4FOCA 3QA8A 1ZYDA 3ORMA 4FTIA 1XH4A 2JBOA 2C1AA 2PUNA 2O5KA 4TN6A 5LVNA 3MIYA 3IGGA 4F1TA 3GI3A 4DFZE 3OVVA 2HENA 3KY2A 2WQEA 3OWPA 2JKKA 3A62A 4BCKA 3IECA 3ZUTA 4FYOA 1LEWA 3VAPA 3V01A 4TYHB 4K0YA 2F9GA 3II5A 5EDRA 4CTCA 3EQBA 2R3MA 2WOUA 2AUHA 3FLZA 4Y73A 4ZJJA 5IA2A 4LM5A 4U43A 4Y5HA 4DBNA 4N57A 2JIIA 3WI6A 3IG7A 3C13A 5FLFA 4FZAB 2BR1A 2G1TA 2UVYA 5ACKA 4WRGA 2C5NA 1TQPA 4D5HA 5KUPA 3FYJX 4X3FC 5FQDC 4E93A 4G3FA 4UWCA 2WHBA 3WZUA 5LWMA 2VGOA 3O7LD 2GFCA 3EWHA 2PVJA 4YC6A 1OL5A 4GU6A 4NEUA 4XG2A 2BKKA 2YABA 5K5XA 2YCFA 2J4ZA 4XRLA 3G6GA 4R7IA 2FSLX 1GJOA 4KBKA 4WSYA 4XS2A 3QGYA 4BBMA 5CI6A 4CT2A 2BILB 3ZEWA 3BPRA 3HP2A 4O7NA 3AMBA 2GS7A 2C5YA 5ANEA 4I3ZA 3KXZA 2XKEA 3DK3A 4EH2A 3R1SA 1U59A 1LP4A 2NRUA 2PE1A 4JAIA 4CNHA 2VTIA 3E8EA 2VN9A 3KMMA 2C5OA 2GMXA 3R83A 3C50A 5FXSA 2BFXA 3NR9A 4EH9A 2OU7A 5EDQA 4KRDA 2W5AA 1XR1A 5C8NA 3V8SA 5AR8A 3S0OA 4RJ5A 1XH6A 4M66A 3EB0A 4LFIA 4EZ3A 3F82A 3SKCA 4PMSA 5FDPA 3BYUA 3F3UA 3L8VA 4PX6A 3RM7A 5HLPA 1PXMA 1Q8TA 4UYAA 5HO6A 3U4WA 4HVDA 1OKZA 3SC1A 2GNGA 4BDIA 1XQZA 2UZVA 3EFKA 4YO6A 2JFLA 3TV6A 3R1YA 5KMNA 3BYMA 2R3PA 4XV1A 3ACJA 4IE9A 4GIIA 4GK4A 3PXRA 5L4QA 5DT0A 4FUYA 2BALA 5CF8A 4BR3A 4NM0A 2E9PA 1PXOA 5AUXA 4GRBA 4GIHA 4HZRA 2IZSA 1OUKA 4IDVA 5L2TA 3AT2A 5IF1A 4O7LA 3ZLYA 3UOLA 3WOWA 1J1CA 3IPHA 1DM2A 4QP4A 1GZKA 4N70A 3FL5A 3GNIB 3PSCA 3P08A 4QRCA 2HWOA 3V6SA 3KQ7A 2PYWA 3PXFA 4S34A 4FV5A 1IEPA 4DTKA 2GDOA 3FLQA 3G5DA 5DRDA 5GJFA 3EQFA 3QTXA 2VWIA 3EN9A 2O65A 2AC5A 3P79A 3BBTB 4BC6A 2WFYA 4I6FA 2WMAA 3E88A 4G16A 1SVEA 3VS7A 3FMLA 2VAGA 3A7JA 4LOPA 5E8SA 3B8RA 3NNVA 2VX1A 3CGFA 1SVGA 3AD4A 5FBNC 1F5QA 3NUAA 1BL6A 2XVDA 4EOQA 2FH9A 2XP2A 4DGGA 3R8PA 2CCIA 3OUKA 3OBGA 3SG8A 4L3PA 5GZAA 4D2TA 4F99A 2C6EA 5JRQA 3BQRA 4ZTRA 5A4TA 2BRHA 4AT4A 4KKEA 3FMMA 4DITA 2JDOA 4ZK5A 3VHKA 4BDFA 2Z8CA 3ORXA 3F7ZA 2WXVA 4PPCA 4R5SA 4YZMA 3ZZEA 5IQEA 4YMJA 5DHJA 3R1QA 5CVHA 3QKLA 5CQUA 4RIWA 3ZO1A 4NTSA 4EOSA 3O8UA 4FSYA 1YWRA 1XBCA 1GIHA 5CXHA 4F9CA 2JBPA 2O8YA 2O63A 4TY1A 4NFMA 4RX5A 3V04A 3C7QA 3UQCA 5J9ZA 4TRLA 4O96A 4L8MA 4BCOA 5L8LA 4CRLA 4Y72A 3VS2A 3Q52A 4YSMA 3TWJA 2RFDA 1JKLA 3KMWA 1W0XC 2WMQA 3Q6UA 4OTRA 3FMEA 3QAME 3UP2A 5HKMA 4C2VA 4L44A 3ZRLA 2H8HA 5AP1A 5EYCA 4ZEGA 4RIWB 5I5ZA 2QC6A 3H10A 1JSVA 3R7UA 4PTGA 3OCTA 2BMCA 3OCBA 3GENA 4AT3A 1V0OA 5BVNA 2WZJA 3TEIA 2WQMA 4RIYA 4KBCA 3DAEA 3BYOA 3MV5A 3BWJA 2CJMA 1BLXA 3ODYX 5B2KA 4ZJIA 1YOMA 3QD4A 2R3KA 2XCHA 2BDWA 3VS0A 4BWXA 3V8WA 2GHLA 5A6OA 1UKIA 4RVKA 4ACDA 1UU3A 3LFFA 1FQ1B 4IAFA 5HE1A 4D28A 2BVAA 3NUNA 5F9EA 3G9NA 4TWNA 5D7AA 3LCKA 3QRTA 3RPOA 3EQIA 4FT0A 5AAFA 2P33A 5EYMA 4HW7A 3QTQA 3QZIA 4TXCA 5J1VA 2HYYA 5JZJA 4HVGA 3GQIA 4YZ9A 5DA3A 2I40A 3HRFA 3F3TA 3FYKX 3Q6WA 2BRNA 3MFTA 3VJNA 2AC3A 3FL4A 3CE3A 5CVGA 4FV4A 1S9JA 3KA0A 4YU2A 5ANDA 4BCHA 2YIWA 3AT3A 1YHWA 4BI0A 2R5TA 4LI5A 2GQRA 3ORTA 3DQWA 3O8TA 4BFMA 2Z60A 2V7OA 4BB4A 4MEDA 4IB5A 5T3QA 1WBWA 3OHTA 3R2BA 4QQJA 4W8EA 1CKIA 5DFPA 2I0EA 3E5AA 3H30A 3QQKA 3I81A 4W4YA 4JDKA 2I1MA 2C68A 2XK6A 2ZV9A 3Q32A 1NVQA 5BUEA 1JOWB 5HD4A 2XF0A 2GNLA 3GU8A 3MDYA 2OGVA 4KSPA 3EHAA 2JDTA 5LQFA 4RPVA 2IZRA 3F5GA 5EQPA 3TDVA 4DF3A 3HGKA 2GNHA 4I0TA 2J0JA 4YTHA 4GV1A 2ZMCA 4LGGA 1B39A 4IX6A 1P14A 1PXPA 3BE2A 1VJYA 2JD5A 5BPYA 2W1GA 4GT5A 3PVGA 3UG2A 1Q41A 4HVIA 4W9WA 3CC6A 5HCXA 2G2HA 4FTTA 2GCDA 5AAGA 3F88A 2E9VA 3NLBA 1GZOA 4NH1A 3ZRMA 2G2FA 3SXSA 2OIQA 3W33A 3ZBXA 1H26A 5I9WA 3OXTA 3ZONA 3D9VA 2NNWB 3RZFA 3KXHA 3SVVA 3LJ2A 2XH5A 4NCTC 4R5YA 3UGCA 4IH8A 4ANMA 4MX9A 5KMJA 3VWAA 4BDEA 1W84A 3LFDA 4ASDA 4U8ZA 3AD6A 1UWHA 4YZNA 3IW4A 3R02A 2PZ5A 3NYVA 4Z9LA 4WA9A 1R1WA 4WO5A 5K4IA 2BRMA 3POZA 1W98A 5KMKA 4OAVB 2X4FA 3NAYA 2QOLA 5GJDA 4IMYA 4RVMA 4FV0A 4UB7A 4UMUA 5HE0A 4EYJA 3OOGA 3QLFA 3DTCA 2OFVA 3GU7A 5ANOA 1Y8YA 5BMMA 3UZPA 2NRYA 3EN4A 3QZFA 4ZMEA 2I0VA 4G6OA 4QMUA 4IC8A 3QGWA 4NU1A 2ZAZA 3FKLA 4OBQA 4O91A 4TYGA 3FI4A 4GUEA 4DFNA 3CLYA 3COKA 4QYGA 5CEQA 5A6NA 4BCPA 5DVRA 4GS6A 3W2CA 1ZMWA 2W1ZA 4FSWA 2VTHA 4QTCA 4TKSA 3R7EA 5H9BA 3ENHA 5AUTA 4G5PA 4ZOGA 3PLAE 3D5XA 2OXXA 4QMQA 4N6ZA 4C4GA 2Q0NA 3FMDA 5FP5A 1JAMA 4AGWA 1WBNA 3A99A 4FG8A 4PTCA 4YUQA 4QMOA 3VUHA 2ONLA 3TZ9A 4BHNA 2W7XA 3PJ3A 4PV0A 5KKRC 4JQ7A 2UW8A 5TO8A 3R8VA 5E8TA 5HX8A 3SQQA 5A46A 2WD1A 3PXQA 4J1RA 5CWZA 3ZOSA 4A9UA 4CT1A 4G5JA 5EW9A 3L9MA 4OBPA 5HGIA 1PHKA 3R01A 1H00A 3RPVA 4YTCA 3FAAA 2W1CA 2XKDA 4RWJA 4MNEA 4R1VA 1F3MC 4E5AX 4XOZA 2WTCA 3DU8A 3PJ1A 3R1NA 4C8BA 4C58A 4F7NA 2C47A 3RNIA 3BCEA 3TNQB 4JG7A 4F0FA 4R3RA 4QMLA 1OL7A 3BGZA 3DB8A 3O50A 4O81A 2QU5A 4ZLOA 4MHAA 4FT5A 1IR3A 3RKBA 5CALA 4FKVA 3RVGA 3DZQA 3HDMA 4MBIA 5DR2A 4L45A 4XBRA 2EB2A 1BI8A 4E5WA 3NIEA 2YM7A 4P7EA 4GFOA 2C3JA 2Y8OA 3R7VA 3BIZA 4DINA 1ZMUA 4D2PA 2QCSA 3SHEA 3KRRA 2X81A 3QA0A 3R00A 4ASEA 4YSJA 4RQVA 1W82A 1R3CA 3I60A 3C4EA 3O2MA 3KU2A 3C1XA 1OB3A 5CT0A 4EC9A 4BYJA 1PRYA 4ZSLA 3S1HA 4O0RA 4ZTSA 4EOPA 2VO6A 3A7FA 4PWNA 4K77A 2FSOX 5HG7A 3U6IA 4KKGA 1YW2A 4KIKA 3R8UA 3WILA 4L52A 4DCAA 5DRBA 2BAQA 4EHEA 3LCDA 3HMPA 5LXMA 2VO0A 4RWLA 4Z3VA 2QO7A 5KMIA 5IQCA 3DAKA 3GC8A 2X4ZA 3VIDA 2J7TA 3BLHA 3D4QA 3ZSHA 4APPA 2W06A 2WTIA 2DQ7X 1PMVA 3F7WA 4QT1A 5EK7A 5TR6A 4AAAA 4CFVA 3KRJA 3QQFA 3QD2B 4GFGA 4AN3A 3KF7A 4U42A 1IASA 2OKRA 3TJDA 3C4CA 5L8KA 2UZUE 2QD9A 3R7GA 3AC3A 2WQBA 5D7VA 3HV7A 3PPJA 3ZSGA 4EH3A 2W4JA 3KKVA 2BRGA 1JBPE 3AT4A 3FBVA 3MVJA 3QFVA 4Y5QA 4YJTA 2BIKB 5HO7A 4F7LA 3UNKA 4O82A 3C4WA 3D7TB 4KIKB 5CEOA 3QD3A 5CAQA 3PYYA 3UOKA 1OZ1A 4C35A 5I9YA 4TWPA 4BIDA 3PY0A 1LEZA 2Y6MA 1WZYA 2EXMA 4IZ5A 4EK8A 4OAUC 3WZDA 3IDCA 1XBBA 4W9XA 4CV8A 4M68A 5FGKA 2WMSA 4BZNA 5DEWA 1SNUA 3O23A 4BZDA 3M42A 3L9LA 3QF9A 4DEGA 4MBLA 4QOXA 3DJ5A 3LM0A 4YR8A 4NZWB 1QPDA 5IA1A 5M57A 4KKHA 2NPQA 4A4LA 2DS1A 2ITZA 5EHOA 2VTSA 5BUIA 1P5EA 3NUXA 2IVVA 3P7CA 1KE6A 1TQIA 2P3GX 3BHTA 4MD9E 3LCSA 4U80A 2CHLA 2HK5A 4DFXE 3E3PA 3RHKA 2W05A 3ZEPA 3TZ7A 3NZ0A 4MXYA 4YTIA 3FI8A 3G90X 1XKKA 4NW6A 5J5SA 2JAVA 5DH3A 4AA5A 4ZZNA 4LRJA 1L8TA 3FZSA 3DKFA 3NIZA 3Q04A 4JXFA 2QQ7A 3QYZA 2E9UA 3N51A 4FG7A 4YP8A 5TKDA 4HCTA 2A0CX 2CKPA 4CXAA 3CTJA 3DGKA 2OZAB 3G2FA 3OD6X 5A4LA 4AOJA 3QRJA 4MF0A 3F5UA 3UYTA 5H2UA 2VV9A 3VQHA 4CMTA 1Q24A 3MVLA 4IADA 1ZARA 5CT7A 5F4NA 4FKUA 3VN9A 4PL5A 4H58A 4N4SA 5F1ZA 4ACCA 3BX5A 3W2QA 2JGZA 5IQFA 1Q8UA 4X2GA 4CLJA 3BV2A 1R0PA 2YLEA 5E1SA 5HIDA 4MF1A 3DNEA 3WE8A 3FZ1A 2UZNA 3IQ7A 3PSDA 4FK6A 2JAMA 5C01A 3V5LA 3U9CA 4FEWA 2ZB1A 3UDBA 4XOYA 5AR4A 3PXYA 2WOTA 4FUXA 4IZAA 4Y95A 3MESA 2YZLA 2FYSA 4DHFA 3HDNA 3ZCLA 1SZMA 3KK8A 1YXSA 2XNOA 4UMRA 3ENMA 5AADA 2EXEA 3LW0A 1PXJA 3I7BA 4MXZA 5DG5A 1PJKA 3RAHA 3C4FA 5GIOE 5J7HA 3U55A 2VGPA 3R63A 3ACKA 4S30A 4AZFA 5DIAA 4J53A 3HVCA 4WG4A 4BGHA 4FKRA 5EHLA 4ACGA 5A4CA 3LJ0A 4JX7A 2BRBA 3TNWA 4EC8A 3DS6A 5L8JA 1PW2A 3KB7A 3GU4A 4JRNA 3G15A 3OS3A 1NXKA 3MPTA 3FSFA 5CY3A 1OBGA 2YN8A 2VNYA 4IB1A 3ZM4A 4BWPA 5K4JA 3DB6A 1PXIA 3QKMA 4MK0A 3KCFA 1PMNA 2XUUA 4GT4A 3RI1A 1UNLA 3P23A 4KA3A 4L67A 3RPYA 5HBJA 2GHMA 2VUWA 1XWSA 2Q83A 3BLQA 3IW8A 4E8AA 3N9XA 3I4BA 4UXQA 2G15A 5ETCA 3I0QA 4NT4A 5KE0A 2J9MA 4IX4A 4DGLC 4MKCA 4LRMA 3NNXA 1OPLA 3NUPA 2XJ1A 4EK5A 3LZBA 3OWJA 4R3PA 2C3KA 5I9ZA 1OL2A 3K3IA 3UOHA 1P2AA 3WF5A 2H96A 1YI4A 3W2PA 1JSTA 5HZNA 3ALOA 2XMYA 2PE0A 5CAUA 3NVMB 1P4FA 3ROYA 1CM8A 2YDJA 3DJ6A 4IM0A 1JKTA 3BRBA 2YIXA 1NT2A 2O64A 3RK7A 5DNRA 2ZV7A 4XJ0A 4FSQA 2J90A 3KFAA 3VULA 3OF0A 3H0YA 3AGMA 5KMOA 4NM7A 1GNGA 4RGJA 4RQKA 4Z55A 1OITA 4U79A 3C5IA 3LFAA 3OEFX 4L01A 2ITQA 3HMNA 4RLKA 4BDKA 3T8OA 4CG8A 3ORPA 5HNGA 1VR2A 3SOAA 4AG8A 4AOIA 2PUIA 1ZYLA 2ZYBA 5JN2A 4EOOA 2IO6A 4QPAA 1JPAA 2PVHA 2HY0A 3QCSA 3KK9A 2BAKA 5AX3A 2YJSA 4EUUA 4JT3A 4E6QA 2WTJA 2VTRA 3ITZA 3ZDIA 1WBOA 1AD5A 2ITXA 4I24A 3QHRA 3NCZA 4JIAA 5TT7A 3EQHA 3ZYAA 4FK3A 4CCUA 2X1NA 3OP5A 3QCQA 3CCNA 3Q9WA 3ORZA 2R7IA 4D1ZA 1WVXA 4L42A 4CVAA 5HEZA 5HORA 2X7OA 3OCSA 2XNGA 5HX6A 1KWPA 3JVRA 3PP0A 3DXPA 1U54A 5C03A 5HVKA 2WGJA 4UXLA 2EB3A 1R78A 3MIAA 4FTJA 3WF6A 4DEHA 5CXZA 2W17A 3KULB 1YWNA 1UKHA 4QMNA 3ANQA 2YDKA 3FSKA 3LCOA 4O6EA 3F2AA 3A4PA 1U4DA 2XZSA 3QQHA 4TNBA 4C59A 5I4NA 4O0YA 5M51A 4GW8A 3MBLA 3UVRA 2GNIA 2QG5A 4YHJA 4ACHA 3LIJA 3RM6A 1AQ1A 5AP2A 2CMWA 2B7AA 5DGZA 4I23A 3TNPC 4FV7A 1SVHA 4FIHA 3PE1A 3RAIA 4AQCA 2JLDA 3E8NA 1FMOE 3CP9A 4WG3A 4WBBB 2Y4IB 4ALVA 4XP2A 4AFEA 1GZ8A 3PE2A 3UO6A 4A4XA 1Q4LA 4FEVA 3V51A 4BN1A 4E3CA 3CJGA 1M52A 4PP9A 2LAVA 1OVEA 3S4QA 4FKOA 3BGPA 3HEGA 3EQCA 2QKWB 2RGPA 3D7ZA 3JVSA 5AP5A 2R64A 4IJ9A 1H27A 4O0UA 3GU5A 1BI7A 5AWMA 3GCPA 1ZAOA 4FKQA 3VRYA 2YM3A 3SX9A 4F9BA 3UZTA 2PULA 4HNIA 2W1EA 3B2WA 2Z7RA 2WU6A 4WOVA 3LM5A 4BKYA 4UZDA 4HCUA 4YJOA 5EW3A 3LLTA 3QTZA 4BDHA 4USFA 5M53A 1YXTA 3WF9A 2ZVAA 4FV2A 2UUEA 4A9TA 2W9ZB 1DI9A 3O17A 4QMTA 4DLIA 5CAVA 2EWAA 4ORKA 2E9OA 2VTQA 3BEAA 1GOLA 4AOTA 5J1WA 3FEGA 4AU8A 3ZDUA 3R7OA 4JR7A 4FTOA 5M4IA 1FGIA 3QTIA 5E8XA 2JEDA 1JNKA 2ZM4A 4R77A 3NMUF 3DCVA 1WVYA 4G17A 2ITYA 3WF8A 2HAKA 3H3CA 4AWIA 3QRKA 5CVFA 3LQ5A 2CGVA 5E91A 1Z57A 2J0IA 4IAKA 3G0EA 1QPEA 3RK9A 1Q8ZA 3ANRA 4OR5A 3SW7A 3WZEA 3KREA 4ZSEA 4GEOA 5AM6A 3EOCA 3P1AA 4HYUA 4S33A 5GNKA 1BYGA 5IA5A 3GCQA 3EYGA 3LLAA 2XK4A 4XG8A 1KE8A 3SW4A 4J8MA 4G3DA 4RFYA 1QCFA 1XH9A 4XV3A 5AP6A 5BQ0A 4RA5A 3W18A 2UZOA 4HYHA 4FV3A 5AP7A 3P4KA 3R6XA 3K54A 4CZUA 2C6IA 3VVHA 1UU8A 3OC1A 2PVMA 2R3HA 3CS9A 3NRMA 3VBTA 4ZAUA 3AG9A 3S00A 1SM2A 3NNWA 3R71A 5CU3A 4BF2A 5M09A 4KNBA 1FVVA 4I6QA 2Y4PA 3CPBA 4Q9ZA 4JDHA 2YIRA 3FE3A 2BZKB 2YAAA 4YC8A 2W5HA 2PWLA 3BHVA 4I20A 3BELA 1J7UA 3VBVA 4F9WA 5JKGA 1CTPE 4O7RA 2QOFA 4F7JA 4EUTA 3FZOA 5CNOA 5AV1A 3BHHA 3FXZA 4TTHB 3LJ1A 1M14A 2XBAA 4Y85A 5E7RA 4R78A 2DWBA 3OXZA 3MFSA 4IVDA 1E1XA 2P4IA 3ZO4A 4CYJA 1A48A 4CGAA 3CKXA 5CZIA 4QP6A 2WMXA 1PYEA 4RZVA 4W4XA 4AW1A 1WVWA 2HZIA 1GIIA 5EM8A 4ZTHA 2G2IA 3DA6A 3WARA 2XIYA 2WIHA 1YDSE 2WTDA 5DPVA 4F09A 3RAWA 4JNWA 3FLNC 2QODA 4FSMA 4WRSA 3E87A 5H8BA 4EQMA 4M69B 2VWZA 2WMTA 4CYIA 4OTGA 5CAPA 5JQ8A 5M44A 2WMUA 4PTEA 3OUNB 5IQDA 1WAKA 2JKMA 2QOHA 1REKA 2XYNA 3MWUA 3NWWA 3U87A 4ANSA 2OICA 4K2RA 5DR9A 4RWIA 4MWHA 3BYSA 4UWBA 3QL8A 4E5BA 3WBLA 3A61A 3REPA 4ZTLA 4AW0A 3IW6A 3DDPA 3OWLA 4A07A 3HYHA 2B54A 4IWOA 4ENYA 3R9OA 4PMTA 3ORKA 4PDPA 4CKJA 4OGRA 2OXYA 3UO4A 4IM3A 1WBSA 5GZ9A 2KULA 4YHFA 4FIGA 4GVJA 4JL9A 4RX7A 4W4VA 1DS5A 4YPSA 5EOLA 4O21A 3I5NA 2GHGA 4I22A 4U6RA 3F5XA 3F66A 4QP3A 2ZM1A 3C51A 3DFCB 4YNOA 4YJVA 3OY1A 5B0XA 1OKWA 3L9NA 5H3QA 4U7ZA 2R3IA 4TPTA 1Q8WA 1PKGA 4D2VA 4EKKA 5E8VA 5IZFA 5L3AA 1JQHA 1GIJA 3PY1A 2BHHA 4F1OA 3ODZX 5D10A 3RP9A 3DBEA 4U81A 4IAAA 4IVAA 2W96B 4YZCA 5IA0A 4QTAA 3WZJA 4QMVA 4C3RA 5M08A 4XLVA 4AZWA 3DV3A 1YI3A 4Z16A 3QCXA 3HNGA 4U40A 2XEYA 3UMWA 1Y91A 2P0CA 1V0PA 3FC1X 2CNVA 3TV7A 5AUWA 3U8WA 1R39A 3Q5ZA 2CNQA 4CV9A 3BU6A 3SRVA 4RJ3A 4X6QC 1KE5A 2VTPA 4CZTA 5LJJA 4IIRA 4P90A 3UIBA 3KVXA 4DBXA 4N6YA 1Q97A 4C33A 5AR5A 4BBEA 3FPQA 1KV2A 4GG7A 2OFUA 5EW8A 1H28A 5LARA 5C9CA 4L3LA 4A4OA 4AS0A 3H4JA 1KOBA 3VBYA 4B0GA 3Q5IA 4KB8A 5D41A 3DLSA 4ENXA 5M06A 3GEQA 4I93A 4U3YA 3ZLXA 4XHKB 2H6DA 5B7VA 1YXXA 2UZEA 3UIUA 4B8LA 2ETMA 3LXLA 4FL3A 4QP2A 3COMA 3Q60A 4ASXA 4BZOA 1OMWA 5HQ0A 3GC0A 1K9AA 3QCYA 4FV6A 1KOAA 3SRVB 4FVPA 1OUYA 2OIBA 4OTWA 3ZLWA 2FA2A 2IZUA 3MI9A 1XO2B 3DY7A 4XG4A 5LCKA 4GMYA 4IEBA 1B6CB 4FKLA 1Q8YA 2XA4A 2UW6A 3AMAA 4DGNA 5I9VA 3BU5A 3QRIA 3TT0A 2OK1A 4QMMA 4EJ7A 4ZS4A 3WIGA 4O0TA 5FTQA 3TIYA 3ERKA 5EYDA 1LUFA 5K0KA 1OECA 2ZV2A 5FM3A 4D1SA 3UC3A 4X2KA 4KWPA 4AE6A 3A8XA 3HMIA 4E4MA 2OH4A 4O7YA 1BUHA 4A06A 4XH6A 1ZZLA 5HESA 1CDKA 3Q96A 4F6WA 1YVJA 3MY1A 2G01A 3KF4A 1OGUA 2C1BA 4UV0A 3Q9ZA 5IMXA 5HHWA 2W9FB 4O7VA 4HGTA 3EFWA 3EFJA 2R2PA 3IONA 3FZRA 2XBJA 4K33A 2HIWA 4EZ7A 4EONA 4HZSA 3V3VA 4C7TA 2B55A 4LUDA 3OW4A 2X2LA 3S3IA 4BI1A 1BL7A 2Q0BA 2IJMA 2JKQA 3CJFA 3NUSA 1YOJA 5E92A 3V5JA 4AGUA 2OJGA 2XNBA 4L00A 4S31A 5LVLA 4J8NA 4F0IA 5HVJA 4OTFA 5DYJA 4AFJA 1Q62A 3GC7A 2R3OA 4BRXA 4EK3A 4FEXA 5FXRA 2WPAA 3HMMA 2YHVA 2VX0A 3AXWA 4FSNA 2CDZA 5C1QB 4F08A 3EKKA 2J2IB 2XEZA 2OH0E 3GBZA 4WNOA 2R3RA 2QKRA 5E8UA 1Y57A 1REJA 3L8XA 3NUYA 3D5WA 2WTKB 4ZMFA 3FXXA 1R0EA 3BLRA 3E3BX 2P2HA 3TNIA 4BYIA 2OI4X 3LFCA 3ZC6A 3R7YA 2ITVA 4YJPA 5DT3A 4FG9A 3O0GA 2CN8A 5H8EA 3VBWA 5BX0A 4BGQA 4CD0A 1ZOEA 2FSTX 2BZHB 3DZOA 1ZZ2A 5CSHA 4O84A 3CGOA 1U46A 4KS7A 5DE2A 4LOQA 3M1SA 2W0JA 4R7BA 4TL0A 2R3FA 2E2BA 3D0EA 3EQGA 2OJ9A 4ITIA 4YC3A 3LAUA 3OFMA 2XB7A 5FD2A 4F64A 2C4GA 4RMZA 3OW3A 5JT2A 3EZRA 5BVDA 3RAKA 5LVOA 3Q4CA 2V62A 3CSVA 5BVFA 5CEMA 4FL1A 3I79A 3KEXA 3PSBA 3QLGA 4MXCA 3HV4A 3EN6A 3EN5A 1I44A 3IW7A 1PKDA 5A54A 3OZ6A 3RCDA 2IVTA 3MJ1A 3UQFA 3C5UA 4GJ3A 4XRJA 3EL8A 4FMQA 4OTIA 2UW7A 3PLSA 4FKWA 4EI4A 3A7HA 4I21A 5HIEA 1G5SA 3C4ZA 1UWJA 2IZTA 4YHTA 5BUJA 4RJ4A 1RJBA 4AXAA 2W1IA 3KCKA 5CSWA 4AW2A 4DLJA 1G8AA 2XIRA 5CU2A 5EYKA 5IMEA 4D58A 4E20A 5KO1A 2PZPA 4I0SA 4BICA 1FPUA 1WBPA 3AOXA 3FDNA 5J87A 5AA8A 3AGLA 4UMPA 2YM6A 4JDJA 4IAIA 4DFUA 4R8QA 1URCA 5EI6A 3S2PA 3QALE 4DEBA 3GB2A 4V0GA 4E4NA 2BROA 5M4UA 5L2SA 3E7OA 4JQEA 2J5EA 3TACA 4BDJA 4FL2A 4EJNA 3HV6A 4LGHA 4L3JA 3KGAA 5K9IA 1T45A 3FC2A 5T6KA 4JLCA 3P7BA 5B2LA 4ZP5A 4O1PA 1UV5A 2QO9A 3DKGA 2GNJA 2YCSA 3UZRA 2REIA 4M0YA 5AAEA 2RF9A 3OEZA 4FIFA 5EM6A 5JRSA 4BDAA 5IISA 1G3NA 1S9IA 3GU6A 2AYPA 3EZVA 4APCA 4HPUE 5IQIA 1GY3A 5IEVA 2GTMA 3FZTA 4C57A 4O7ZA 4V0GB 4HGSA 4G3EA 2Z7QA 4XNEA 5HTBA 3TKHA 2OWBA 4NFNA 3ZTXA 5E4HA 5HU9A 3VW8A 2FO0A 4BIBA 1MQ4A 4O83A 5AR2A 4LL0A 1ZYJA 4QTBA 3PA4A 4ZTNA 5CAOA 5A9UA 5GZ8A 4KUJA 2CLQA 3UYSA 4DEDA 4TWCA 3MW1A 4I6BA 4ZTMA 3I6WA 3VC4A 2UZBA 2JITA 3D7TA 4OTDA 5C26A 5DWRA 4CQEA 3DXQA 5FDXA 2J50A 3MPAA 4MBJA 2FGIA 2HY81 2WMVA 5HNIX 4EK4A 3FMJA 3JYAA 2RIOA 4I5PA 3V6RA 3O71A 3K5VA 5HOAA 3V5WA 4EHZA 4V01A 4GK3A 4D0XA 3Q9XA 3DK6A 4RC3A 5L6WL 4D5KA 2XKCA 3F3ZA 1WCCA 3UOJA 1IAJA 4A9SA 4V05A 1U5QA 5IQGA 3NW6A 4G9RA 2JKOA 4GYIA 4NW5A 5TOZA 5EKNA 4FEQA 1B38A 4PMPA 1IRKA 4RVTA 5AV3A 4NJ3A 3O8PA 4ONAA 5AP4A 3C0IA 4QMYA 4FSRA 4RFMA 1PMUA 1Q5KA 4LUEA 4BCNA 4CQGA 4PP7A 4FTAA 3AC2A 3LFQA 5ICPA 5G6VA 3PJ8A 1YDRE 5D1JA 3MA3A 4CFFA 4U44A 4J52A 3VUMA 4DTAA 4MD7E 5LOHA 3HV5A 4XBUA 2OZAA 4FT7A 4X6RA 4U3ZA 1OBDA 4PL4A 4WG5A 5HTIA 3G9LX 1E9HA 5ANKA 3RBWA 3ATSA 3QQLA 1Z5MA 4D9TA 2GTNA 4FC0A 3VW6A 4CFNA 2C6TA 5A4QA 2BDJA 4P2KA 4XLIA 2R3QA 5E9EA 3DFAA 4JRVA 2B9IA 3EKNA 4AF3A 3KRXA 3W55A 4DH1A 2QHNA 2CGXA 3NSZA 3L8SA 4FTNA 4HNFA 2KTYA 2RG5A 3RZBA 3WE4A 4ZLZA 5I3RA 3UG1A 4FE2A 1NVSA 3PVUA 3MS9A 3RHXA 3PVBA 2X2KA 4FX3A 1MRVA 2HWPA 4ACMA 3ID6C 4PDOA 3FHIA 2YM5A 2JIUA 2CCHA 3QTRA 4MXAA 3WIKA 5A4EA 1O6YA 3AC4A 4ALUA 4ASZA 4QMPA 4BTFA 4GUBA 4EOMA 4CKRA 4X0MA 5AJQA 1UNGA 2UZLA 2WB8A 3DAJA 4K1BA 2ZMDA 1GZNA 4I4FA 4BKZA 3WF7A 4C37A 5ITAA 4WT6A 3Q4TA 3PUPA 1GAGA 3B8QA 1K2PA 5AUVA 5A14A 2GQSA 3HLLA 3O96A 3VS1A 3IW5A 4CFWA 3GT8A 2JFMA 4OT5A 2VRXA 2VWBA 1IG1A 3A4OX 3NAXA 4FV1A 5EDPA 1T46A 2GFSA 4O0SA 2B52A 4FNXA 3LQ8A 1PXKA 1V0BA 1ZMVA 3QUDA 3SD0A 3VS3A 4E1ZA 2BHEA 4GYGA 4AN9A 4L7FA 2QOOA 2IPXA 3SA0A 4JBPA 2CPKE 4UMTA 2BUJA 4DAWA 4G1WA 4KINA 5FRIA 4OT6A 3F5PA 4YO4A 4I0RA 1OIYA 1ZLTA 1FVTA 5M56A 2YWVA 2BZJA 3H0ZA 4M14A 2J0LA 2B9HA 4QYYA 4E26A 5LCJA 4X3FA 2PY3A 2OBJA 3O7LB 4JQ8A 5AEPA 4DG0E 4DCEA 3HRCA 4QNAA 1YQJA 4RRVA 4F9YA 4IZ7A 3QWKA 2W1FA 5AV0A 4F63A 3MYGA 1O9UA 4YJQA 5L6OA 2CSNA 1YRPA 2C3LA 3MH1A 4FTUA 4LL5A 4YNEA 5EI2A 4DGOA 3E62A 1WBTA 4FNZA 4RJ8A 1FINA 3RPRA 5HG5A 3UVPA 4FV8A 4O7SA 3JY0A 2YISA 3FI2A 4FTMA 2QVSE 5F94A 2BKZA 3QUEA 3VBXA 4G3GA 4C4JA 2F7ZE 4P5ZA 4XUFA 5JFXA 2GS2A 4WD5A 4I1ZA 4X3FB 1OL1A 5KHWA 2WELA 4OTQA 5E8YA 2Y0AA 4HYIA 2UV2A 3LCTA 4LRKA 4AZEA 4DH7A 1ZXEA 3MB6A 4ITHA 4PPBA 3ZHPC 4D9UA 1CKJA 3NYOA 5CTPA 5LMAA 4DFYA 4RT7A 2YM4A 4YTFA 4KIQA 3RMFA 2PZRA 3ZMMA 2ONLC 3A8WA 4R6VA 2BIYA 2WTVA 4IB0A 4JBOA 1Y8GA 4PNKA 4Q2AA 5CEPA 4I6HA 5HLNA 5KCVA 3GP0A 3QRUA 5ETIA 5KZIA 4BHZA 4K8AA 3DNDA 4RC4A 3NYXA 1ZY4A 3MB7A 4G6LA 1CMKE 2IW6A 2JDSA 3KMUA 1XHAA 4QQ5A 3KL8A 2YACA 1HOWA 4FTKA 3U9NA 2OJJA 4X3JA 4QMWA 1IA9A 3I6UA 5IKWA 3KULA 1DAYA 4AE9A 2VWYA 5AR3A 3CTHA 3EYHA 5AIRA 4ZTQA 5JH6A 3O51A 2WAJA 4MAOA 4Z7GA 2ITWA 5FWKK 5JGAA 5AR7A 2ACXA 2VX3A 4FNWA 4IJPA 4H36A 3TM0A 2F4JA 3W10A 1APME 4YURA 2BTRA 3RGFA 3QTSA 2B4SB 4CMUA 3R28A 4QYHA 4JI9A 3OWKA 1OKVA 1ZYCA 4YLKA 4QNYA 4IFGA 5C8MA 3VS6A 3R9RA 5KBQA 5L2WA 2OIDA 4RC2A 4YLLA 4GKHA 3AC5A 3QXPA 4YBJA 3E63A 1Q61A 3DKCA 1H8FA 4O0WA 2A27A 4LMUA 4BDGA 4EOKA 3C9WA 3T3VA 2W99B 3CIKA 4BI2A 4BTMA 4E6AA 4F4PA 5DMZA 1CKPA 2B0QA 1QMZA 4TNDA 1IAHA 5JGBA 2X0GA 3UQGA 2V5QA 5LMKA 2F49A 5EQEA 4MWIA 2RKUA 4D2WA 2O0UA 2YA9A 4QMSA 1L3RE 2R0IA 5GJGA 3QHWA 3R2YA 3A2CA 3HX4A 4J99A 4RBLA 3SGCA 4IWDA 1RE8A 4BTJA 4MVFA 5EM7A 3Q53A 2PVRA 4UN0C 4H3PA 4ANOA 5AP0A 2CNUA 5AA9A 3OOMA 4UEUA 1M2QA 4UY9A 4HJOA 3GC9A 4X2FA 2BTSA 5CENA 2QOBA 2VTNA 4QP1A 1YXUA 3W8LA 4ZY5A 1SYKA 2I0YA 4M0ZA 4EHGA 3ETAA 3TDWA 4DTBA 4FVQA 2Z7SA 4UZHA 4DFLA 3W32A 4J7BA 3DJ7A 3EH9A 2QOQA 3GOKA 3LOKA 4FOBA 4J97A 5CU4A 5HNBA 5A3XA 4C0TA 5CQWA 4O22A 4LOOA 4NUSA 1HCLA 4E6DA 4FKPA 3HECA 3KRWA 4HGLA 4IX5A 3UTOA 2B9JA 3IOPA 3UE4A 1JLUE 3RCJA 4QP7A 2OO8X 4YLJA 4QPSA 4DG3E 4GKIA 4QTDA 5DI1A 2Y6OA 3OXIA 2WNTA 2DYLA 3CD3A 4RIOA 1JSUA 2YITA 4QQCA 4USEA 3R30A 4W4WA 5CSXA 3KXNA 2PMNX 5HCYA 1DAWA 4O7TA 4GU9A 1Q3WA 4YJNA 3MY5A 2ESMA 3B2TA 4ID7A 5D12A 3TV4A 4EORA 3VS5A 3GXLA 4A9RA 4JBVA 3ALNA 1G8SA 4O0XA 3DTWA 4JIKA 4NM3A 5JGDA 2WMWA 3R22A 4FEUA 2QLUA 4Y83A 1ZRZA 3IOKA 4XP0A 3F69A 2OF4A 3ZSIA 3TUDA 2BCJA 5HI2A 1J7LA 4I4EA 3R73A 2LGCA 2X8EA 4IHPA 3K3JA 2F57A 5KZ0A 3FLSA 4DEIA 3HUCA 5FG8A 4ANQA 4BCGA 3AD5A 3DBCA 3AMYA 4U0IA 3MN3A 1E1VA 3PIZA 4U45A 2JC6A 2H9VA 5AX9A 4AGCA 1XBAA 5FEDA 1PMEA 1OKYA 2PK9A 3R9HA 4NIFA 3RTPA 4CFMA 3JPVA 4KIPA 2C3IB 3GGFA 5J7BA 1NY3A 4ZZMA 3MTLA 1O6KA 3VJOA 4ZY4A 4AP7A 4NKSA 3C4XA 3E93A 4JBQA 2PUUA 1CSNA 5GIPE 5KBRA 3FWQA 3KN5A 1H1WA 3C0HA 4Y46A 5JFVA 5IQBA 3KC3A 5EKOA 1OPJA 2H34A 3K2LA 4AZVA 4YZDA 3CPCA 3RWPA 4QTEA 5IH6A 3FMNA 4V04A 4PDYA 5EM5A 4BCIA 4M69A 4FICA 4HOKA 3BWFA 3NPCA 1YXVA 4FKSA 4EK6A 4AGDA 2R4BA 3CQEA 5IH5A 4ZXTA 3OY3A 3PIYA 4FIIA 2PVYA 3EQPA 4NIFB 4O6LA 1SNXA 3C0GA 2QHMA 5EI8A 2VU3A 3IK3A 3ULZA 4QQTA 4YJUA 4O7WA 2HXQA 4FV9A 4J98A 4ZLYA 4FI1A 4G31A 3DDQA 2OG8A 1M7QA 4QP8A 4YBKA 2ZJWA 4XX9A 3W8QA 4L53A 4F6SA 3N4VA 2A4LA 5HICA 5L6PA 2X2MA 4A9YA 4EBVA 3QQUA 4RWKA 3ZUUA 5DN3A 4RFZA 2FVDA 4NCTA 2PUPA 4E6CA 3VF8A 1XJDA 4YPDA 4R7HA 2SRCA 3QD0A 5CYIA 3OT3A 5CSVA 2EUFB 2F7XE 5E8WA 3MVMA 2HW7A 3BGQA 3G0FA 3WZKA 3P0MA 3OT8A 4FSZA 4A7CA 4FTRA 4BL1A 4DG2E 5LVMA 5DLSA 4CKIA 2UW0A 3TZ8A 1OIQA 3PRFA 1STCE 4AUAA 4B8MA 3DOGA 1VZOA 2VTJA 2QLQA 3BV3A 3VF9A 1X8BA 2W1DA 5F20A 1H1QA 1PXLA 1NA7A 3CD8A 4UX9A 4M97A 1MRYA 1Q3DA 2VZ6A 3PPKA 4ITJA 3BKBA 4D4RA 1J3HA 4JOAA 3VHEA 1MRUA 2YIYA 1OM1A 3Q4ZA 4JAJA 4EH5A 2ZB0A 5HE2A 3D83A 3MH2A 2WKMA 3R21A 2RFSA 3ET7A 5CS6A 4TW9A 4EOIA 3HA8A 3JR1A 2YFXA 5BNJA 4LV8A 4PDSA 4WHZA 3D94A 3Q9YA 4G9CA 3E8CA 3UODA 3BI6A 4WNMA 4QP9A 5F95A 5HG9A 4PL3A 2YM8A 2YDIA 2UZDA 4WNPA 3U51A 2CGWA 5T68A 4MQ2A 3FQEA 4GT3A 3PXZA 4DH8A 1URWA 4E4XA 5HLWA 4O2PA 2ZDTA 2IWIA 2YJRA 3BEGA 4GSBA 3PWDA 2XK3A 4NM5A 3T3UA 1YKRA 4GJ2A 3MFUA 3Q3BA 2YLFA 4J95A 1KE7A 4XMOA 4BIEA 1UNHA 5FUTA 2X8IA 4EZ5A 3R8MA 3FZPA 4NSTA 4RX9A 5LVPA 4DH5A 3PY3A 1XH8A 5IG1A 4IZYA 4F9AA 4J71A 4YJSA 3GFEA 3HMOA 1WMKA 2Y4IC 3FY2A 3PA5A 3PRIA 3QBNA 2IW9A 4MTAA 3TKIA 4BCJA 5IEYA 4OLIA 5JMSA 3TZMA 3U6HA 2XJ2A 1OIRA 2PVLA 4I5MA 4IWPA 1FVRA 3PZHA 3W16A 5EQYA 4UBAA 5KKRB 4RIXA 5LMKC 1YI6A 4EQUA 1FBNA 2XNMA 2WTWA 3HL7A 3P86A 4RZWA 3TKUA 4WBOA 3UP7A 3TXOA 1VYZA 4EEVA 3QQGA 4RLLA 4XEYA 5E1EA 2GU8A 1UVRA 2HCKA 4GL9A 4XG6A 3UO5A 1OL6A 3TL8A 4DT8A 4I5CA 3W2RA 3ZXZA 3D14A 3IDBA 3R8ZA 4KS8A 2XNNA 3ZH8A 3M2WA 1W7HA 3A7GA 2YAKA 3DT1A 4XCUA 1KSWA 3U4UA 2XNPA 2UW3A 4DEAA 4DH3A 2XYUA 1M17A 3E92A 4AW5A 2HXLA 4C61A 4R1YA 2NP8A 2RL5A 4XYFA 3PJCA 3HKOA 4H3BA 4IM2A 4RIXB 4UMQA 3VUKA 1BX6A 4ZZOA 4XG7A 4KSQA 3RINA 4FTCA 3UPZA 2WQOA 3PJ2A 1M7NA 2GPHA 2GSFA 4ANBA 3ZLSA 2CGUA 3NDMA 4LGDA 4L43A 4BVUA 4ZJVA 3TUCA 1Y6AA 3E7VA 4GVAA 4KABA 2XM8A 2WU7A 5CF4A 2RG6A 2WIPA 4PF4A 4E73A 1MP8A 1YDTE 1MQBA 3QTUA 1W8CA 4IB3A 4KAOA 2PE2A 3WYXA 4U41A 4P5QA 2R3LA 5ANGA 1H08A 1ZY5A 4RX8A 2CKQA 3EQRA 3VBQA 4IANA 5KMMA 1TQMA 3NUUA 4RVLA 3S95A 1A9UA 1H1PA 3BZ3A 4O1OA 2I0HA 3F2RA 3ZM9A 3ZC5A 2J6MA 2UZWE 4ANNA 3VUGA 5IDPA 3UNJA 5JQ5A 4MCVA 5GINE 2C6DA 4QPMA 4BDCA 3GCSA 2IW8A 4D55A 5KNJA 1J7IA 4WKQA 5HD7A 3OBJA 3COHA 4I41A 4FKGA 4S32A 5FM2A 4GFMA 2PZYA 2ZDUA 4M7IA 5BVOA 1M2PA 1UU7A 1IA8A 3LE6A 5D9HA 3PXKA 4TT7A 5I3OA 3SG9A 3V5QA 3QUPA 4IFCA 4BCQA 4D1XA 2WEVA 4K18A 2ERKA 5KX8A 2RFNA 4C62A 4EHVA 2ITOA 2OXDA 5CF5A 2YEXA 1O6LA 5ETAA 3RALA 2R3NA 5AUUA 4RIYB 3UBDA 4C38A 5CZHA 4D4SA 3LPBA 4FSTA 4HGEA 3SXRA 3DLZA 3TI1A 4JVGA 3TG1A 5J79A 2X9EA 4XP3A 3LQ3A 3UNZA 3AC8A 5L2QA 4QYFA 3PIXA 4ZS0A 1YWVA 3NW7A 2XRWA 3ORNA 4IXPA 5J5TA 2VWXA 3CY2A 3EL7A 3H9FA 3HZTA 4WIHA 3R0TA 2VTLA 1KV1A 4WUNA 3FQHA 1OI9A 2QR7A 1H4LA 4BCFA 3BYVA 1H07A 5FEQA 4OTPA 3U54A 4HYSA 5CEIA 4F6UA 3D2IA 2F2CB 3PPZA 3DXNA 3R7IA 4JX3A 5EOBA 3G33A 1J91A 5JEBA 4PMMA 4IBMA 5EH0A 4I5HA 1F0QA 1DI8A 3LMIA 2ZV8A 1BKXA 3ZFMA 3W2OA 1JWHA 5IEXA 2XJ0A 3F9NA 3FUPA 3FXWA 4EWQA 3ZRKA 2O3PA 2JIVA 2XKFA 3MH3A 3VUIA 5IPJA 1V1KA 2VO7A 3M11A 2ITTA 4KD1A 2HZ0A 3KRLA 3D2KA 3VUDA 2CKOA 4USDA 2VTOA 2YZAA 5CLPA 4B6LA 3TN8A 1W83A 1JKSA 2RSVA 5HBEA 5CU0A 3DBFA 5FTGA 4Q5EA 3P7AA 1NVRA 4MD8E 4EH4A 4FKJA 2WEIA 3R9NA 3QZGA 4C36A 4HVHA 4BGGA 4TYJA 2B9FA 2WMBA 2PVFA 3HRBA 2QO2A 3MGYA 3QQJA 4X2JA 3CQWA 4EH6A 4FZFB 2PVKA 4B9DA 3P78A 4FZ7A 3AQVA 3CY3A 4FVRA 2C69A 3F6XA 2C0TA 4LMNA 3ZFXA 2XS0A 1PXNA 2HELA 3R9DA 4DYMA 1Y6BA 3F2NA 4EL9A 5CANA 1RDQE 1XH7A 3FPMA 5FXQA 3I7CA 4J96A 2HW6A 4FIEA 3RNYA 4I92A 4FR4A 4HCVA 4F65A 4KRCA 4K9YA 2NO3A 4C4HA 2EXCX 2OZOA 1NW1A 1BMKA 1RW8A 4JG6A 3UPXA 4EYMA 4H05A 5AMNA 3HA6A 3LMGA 3ROCA 4C2WA 3GQLA 4DEEA 4GCJA 3QKKA 4PY1A 4ERWA 4ERKA 2JDRA 1FMKA 4CMOA 3ZFYA 3PA3A 3ELJA 4H1JA 4U97A 3QX2A 4X21A 3SAYA 5LMBA 3LHJA 3QU0A 2PMIA 3SDJA 3JXWA 4O27B 4DA5A 3QX4A 2QG7A 2VWWA 4XV9A
chains in the Genus database with same CATH superfamily
4FIJA 3GCUA 4BY9E 1QPCA 2UW4A 4K11A 4NWMA 5M07A 3OCGA 2XNEA 5BYYA 5CASA 4PQNA 2C0OA 4CLIA 2PMOX 5AV4A 4FA2A 5CF6A 4AZSA 3FKNA 3W0NA 2QU6A 4EBWA 4BKJA 4ARKA 1PYXA 3JUHA 2JDVA 3I5ZA 3MA6A 4Z7HA 2UW5A 2X8DA 3MH0A 3NS9A 4H39A 5HU3A 2W4OA 1KUTA 2A19B 5BVWA 4PPAA 1LR4A 3FY0A 3A60A 4C3PA 3TNHA 2C6KA 4FT9A 3UDTA 3P5KA 4PUZA 5HE3A 5BVEA 2O2UA 2X6DA 3ULIA 1K3AA 5ACBC 3NEWA 5JZNA 4I94A 5I0BA 2IG7A 1Q99A 5CX9A 2Z2WA 2HOGA 1P4OA 4EH8A 4ZSAA 3MTFA 4IW0A 5DOSA 5CEKA 5C4LA 2QI8A 3EN7A 4DC2A 5CI7A 4TZRA 2G9XA 2ZM3A 2ERZE 4DT9A 4MNEB 3TCPA 2J0KA 1ERKA 4OBOA 4C02A 4G34A 4CCBA 3D15A 3PTGA 3FMHA 1PF8A 4M15A 2E9NA 3K5UA 4UYNA 3V5PA 3PZEA 2IF8A 3E64A 5HVYA 4CZYB 4D2RA 4DE4A 2VTMA 3CBLA 5M4CA 3QC4A 5J9LA 2QONA 2QOCA 4HPTE 3G6HA 4M12A 4M3QA 4O0VA 1OGYA 4RJ7A 3PWYA 4AACA 3UIXA 2CKEA 1J1BA 1LPUA 4D2SA 4EKLA 2PU8A 4IDTA 2XM9A 5D11A 3IKAA 4FGRA 1I09A 4FT3A 4CTBA 2VO3A 4EOLA 5C4KA 3W1FA 5B2MA 2C0IA 4FTLA 4WSQA 2F7EE 4CEGA 1KE9A 4AA0A 2FUMA 3T9TA 2R0UA 4BCMA 2VNWA 2Y7JA 1YOLA 2YWPA 4FODA 2XK9A 3N4TA 2XIXA 2ZFYA 2VTAA 3D5VA 4NJDA 3LXPA 3NNUA 2PTKA 1EH4A 3AC1A 4O38A 4F1MA 5K5NA 4B7TA 5IDNA 3FLWA 1ND4A 2P2IA 2PL0A 2F2UA 3CTQA 3ZS5A 4M13A 4W8DA 4EWHA 2BPMA 4FNYA 4NKAA 2WTKC 1XH5A 4IVBA 3EFLA 4QO9A 5GHVA 4FGBA 4D4VA 2FB8A 2ITUA 3MJ2A 4AXDA 1Z9XA 3F3WA 4GH2A 4IACA 5AUZA 4O4FA 4RG0A 2UZTA 4X2NA 2A2AA 2C6MA 4MXOA 5AP3A 3W2SA 4AX8A 3U6JA 3ZU7A 1SMHA 4FYNA 5AUYA 2J5FA 5ETFA 2QNJA 3EJ1A 4JR3A 1JVPP 3EIDA 4D0WA 3HAVA 4U9AA 3MPMA 3CXWA 3FLYA 5FP6A 5LWNA 4UALA 2EVAA 4G3CA 5C27A 1UU9A 2PVNA 4L7SA 4K6ZA 4NK9A 2Z02A 3PDTA 2VWVA 3Q2JA 4M8TA 5DEYA 3ZZWA 1U5RA 2FSMX 4H3QA 3ZUVA 3POOA 3VUTA 5JFSA 4FTQA 3RPSA 2YIQA 4NYEA 4MXXA 2C5XA 2V0DA 4CG9A 4IVCA 2QOKA 4BTKA 5FBOA 3QWJA 2X7GA 3GCVA 5E90A 4QMZA 3LXKA 4DN5A 3H9OA 2PPQA 3BU3A 3LMHA 1ZWSA 4JG8A 3HP5A 5CNNA 3THBA 3V8TA 3GUBA 4L9IA 3F61A 2C6LA 4TWOA 3A7IA 3FMKA 3LFSA 2R9SA 2VTTA 4U5JA 4AXCA 5E8ZA 4BBFA 2C30A 3SOCA 3VNTA 1JKKA 3VO3A 3EMGA 2BAJA 2CN5A 2OJIA 2ITNA 3OTUA 4RSSA 2PMLX 4JS8A 5JSMA 2HZNA 4GK2A 3FJQE 4IWQA 3ZBFA 2GNFA 2WO6A 3IO7A 1TVOA 2B53A 4MYGA 2BFYA 3DBQA 3EQDA 5EFQA 2IVUA 2YCRA 2GQGA 1QL6A 3BE9A 3L8PA 3ORIA 4FKIA 5ANJA 5J9YA 3SLSA 5L2IA 3CR0A 5IQAA 1MUOA 2W1HA 2ETRA 5FEEA 3NGAA 2YERA 3DBDA 3LKMA 4JJRA 4M84A 5J95A 3G51A 3JS2A 3JY9A 3NYNA 3UC4A 4AT5A 5IUHA 3DKOA 2R7BA 4X7QA 3COIA 4IAYA 5CSPA 3I0OA 5JK3A 2EU9A 5HBHA 4WNKA 1H1SA 4TYIA 5BYZA 5IUGA 3OMVA 2XAMA 4OUCA 3KVWA 3KN6A 2A1AB 2ITPA 4XV2A 5C8KA 3OROA 3Q4UA 3E8DA 2IVSA 4L68A 1RQQA 4NTTA 3R04A 4II5A 3HV3A 3P9JA 2C6OA 3RK5A 3TTIA 3ZO2A 3RWQA 5I9XA 4FZ6A 1FGKA 3GVUA 2XCKA 5DR6A 4CFXA 2PZIA 1QPJA 5EG3A 3BQCA 4LQMA 3TIZA 1WFCA 4IC7A 4Q9SA 2OJFE 4AZTA 4UWYA 4FBXA 4FKTA 2QR8A 2V7AA 4RA4A 5IQHA 3KXGA 5KMLA 2WQNA 2HZ4A 4XG9A 4CFUA 1UA2A 3GOPA 4B4LA 5AM7A 3V5TA 4D4YA 1YHSA 4E7WA 3DK7A 4YJRA 5HCZA 3IDPA 4BWKA 4IQ6A 5TF9A 4C3FA 3UMXA 3VQUA 4G2FA 2VD5A 4BDDA 1H0WA 3ATTA 2X7FA 4ZSGA 2B1PA 3CKWA 3MY0A 3FQSA 3TTJA 2QOIA 4ZIMA 1TKIA 3CQUA 4LV5A 3RJCA 3OG7A 3UJGA 4RJ6A 3IGOA 5ANIA 5EHYA 4ALWA 3MVHA 4OTHA 5FTOA 3NW5A 3PP1A 4Q5HA 2Z7LA 2C5VA 3L1SA 3VS4A 3ZXTA 2J0MB 3IS5A 3QYWA 2V55A 4HVSA 3ORLA 2X9FA 2X6EA 1WBVA 4IAZA 5HO8A 5H8GA 4N0SA 4PNIA 3F3VA 1VYWA 4FZDB 2UW9A 3GFWA 4F0GA 3N4UA 2YCQA 2BDFA 2RFEA 3KXXA 1VEBA 5IUIA 4P4CA 4KBAA 3DQXA 3LFEA 3UIMA 2CLXA 3LVPA 3I1AA 4O2ZA 4G6NA 4WUAA 5IH4A 3BBWA 1ATPE 3L9PA 5HIBA 4EH7A 3PG3A 2BZIB 5K0XA 1M2RA 3BHUA 4EOJA 4C4EA 5M55A 1HCKA 1ZYSA 2J51A 2OSCA 4LYNA 1H1RA 2XANA 4ZSJA 5J8IA 2XK8A 2X0OA 5AFVA 4JDIA 3NVKI 3SV0A 3MFRA 3SXFA 2ZOQA 5I9UA 5DBXA 3LFNA 5IA4A 3TJCA 4KIOA 2P55A 5HTCA 2W5BA 5IA3A 2QURA 3UVQA 4O86A 3NCGA 3QZHA 2OF2A 2V22A 3FV8A 2IN6A 3D5UA 4QD6A 5BVKA 4B99A 2XIKA 4L46A 5M4FA 1H0VA 3LXNA 2X39A 4R3CA 1ZOHA 3VRZA 3FI3A 3KXMA 3NX8A 4S2ZA 2OLCA 5TE0A 1OPKA 3HUBA 1U54B 3MSSA 3T9IA 4CSVA 1PY5A 2XIZA 1H01A 2I6LA 2PSQA 3BHYA 3PG1A 4LG4A 5AIKA 5K3YA 5AV2A 5JFWA 5DT4A 4F70A 3PVWA 4NL0A 2UVXA 4CRSA 4GG5A 4XG3A 2OW3A 2Y9QA 3ZO3A 3CEKA 4PRJA 3R8LA 4AN2A 4F7SA 4DFBA 2VWUA 3QTWA 3TUBA 1YHVA 2PHKA 4AA4A 5HG8A 4TYEA 5G1XA 1AGWA 4BDBA 4E4LA 4QYEA 2R3GA 4ANLA 1H24A 1ZOGA 3DPKA 3WYYA 5BMSA 3HAMA 4FF8A 4MQ1A 2ETKA 1A06A 1H25A 2W4KA 4L6QA 3PFQA 2WMRA 4IX3A 4YGAA 2UVZA 4ZY6A 3OTVA 4EQCA 4OW8A 2XK7A 4QMXA 4C4FA 4C4IA 4TYHA 3LFBA 3FKOA 3Q2MA 2I7QA 4FSUA 2DUVA 5CU6A 2GS6A 3H9RA 1OIUA 2R3JA 3FHRA 4Y8DA 5BYLA 5IU2A 4H1MA 4M67A 4YZBA 3QC9A 4MNFA 4C34A 3QXOA 1FOTA 2XRUA 4DGMA 5KHXA 4MH7A 4FOCA 3QA8A 1ZYDA 3ORMA 4FTIA 3R9RA 1XH4A 2JBOA 2C1AA 2PUNA 2O5KA 4TN6A 5LVNA 4F78A 3MIYA 3IGGA 4F1TA 3GI3A 4DFZE 3OVVA 2HENA 3KY2A 4O4EA 2WQEA 3OWPA 2JKKA 3A62A 4BCKA 3IECA 3ZUTA 4FYOA 1LEWA 3VAPA 3V01A 4TYHB 4K0YA 2F9GA 3II5A 5EDRA 4CTCA 3EQBA 2R3MA 2WOUA 2AUHA 3FLZA 2A98A 4Y73A 4ZJJA 5IA2A 4LM5A 4U43A 4Y5HA 4DBNA 4QEBA 4N57A 2JIIA 3WI6A 3IG7A 3UDSA 3C13A 5FLFA 4FZAB 2BR1A 2G1TA 2UVYA 5ACKA 4WRGA 2C5NA 1TQPA 4D5HA 5KUPA 3FYJX 4X3FC 5FQDC 4E93A 4G3FA 4UWCA 2WHBA 3WZUA 5LWMA 2VGOA 3O7LD 2GFCA 3EWHA 2PVJA 4YC6A 1OL5A 4GU6A 4NEUA 4XG2A 2BKKA 2YABA 5K5XA 2YCFA 2J4ZA 4QDVA 4XRLA 3G6GA 4R7IA 2FSLX 1GJOA 4KBKA 4WSYA 4XS2A 3QGYA 4BBMA 5CI6A 4CT2A 2BILB 3ZEWA 3BPRA 3HP2A 4O7NA 3AMBA 2GS7A 2C5YA 5ANEA 4I3ZA 3KXZA 2XKEA 3DK3A 4EH2A 3R1SA 1U59A 1LP4A 2NRUA 2PE1A 4JAIA 4CNHA 2VTIA 3E8EA 2VN9A 3KMMA 2C5OA 2GMXA 3R83A 3C50A 5FXSA 2BFXA 3NR9A 4EH9A 2OU7A 5EDQA 4KRDA 2W5AA 1XR1A 5C8NA 3V8SA 5AR8A 3S0OA 4RJ5A 1XH6A 4M66A 3EB0A 4LFIA 4EZ3A 3F82A 3SKCA 4PMSA 5FDPA 3BYUA 3F3UA 3L8VA 4PX6A 3RM7A 5HLPA 1PXMA 1Q8TA 4UYAA 5HO6A 3U4WA 4HVDA 1OKZA 3SC1A 2GNGA 4BDIA 1XQZA 2UZVA 3EFKA 4YO6A 2JFLA 3TV6A 3R1YA 5KMNA 3BYMA 2R3PA 4XV1A 3ACJA 4IE9A 4GIIA 4GK4A 3PXRA 5L4QA 5DT0A 4FUYA 2BALA 5CF8A 4BR3A 4NM0A 2E9PA 1PXOA 5AUXA 4GRBA 4GIHA 4HZRA 2IZSA 1OUKA 4IDVA 5L2TA 3AT2A 5IF1A 1XMMA 3ZLYA 3UOLA 3WOWA 4O7LA 1J1CA 3IPHA 1DM2A 4QP4A 1GZKA 4N70A 3FL5A 3GNIB 3PSCA 3P08A 4QRCA 2HWOA 3V6SA 3KQ7A 2PYWA 3PXFA 4S34A 1TFFA 4FV5A 3AKLA 1IEPA 4DTKA 2GDOA 3FLQA 3G5DA 5DRDA 5GJFA 3EQFA 3QTXA 2VWIA 3EN9A 2O65A 2AC5A 3P79A 3BBTB 4BC6A 2WFYA 4I6FA 2WMAA 3E88A 4G16A 1SVEA 3VS7A 3FMLA 2VAGA 3A7JA 4LOPA 5E8SA 3B8RA 3NNVA 2VX1A 3CGFA 1SVGA 3AD4A 5FBNC 1F5QA 3AKJA 3NUAA 4O4CA 1BL6A 2XVDA 4EOQA 2FH9A 2XP2A 4DGGA 3R8PA 2CCIA 3OUKA 3OBGA 3SG8A 4L3PA 5GZAA 4D2TA 4F99A 2C6EA 5JRQA 3BQRA 4ZTRA 5A4TA 2BRHA 4AT4A 4KKEA 3FMMA 4DITA 2JDOA 4ZK5A 3VHKA 4BDFA 2Z8CA 3ORXA 3F7ZA 2WXVA 4PPCA 4R5SA 4YZMA 3ZZEA 5IQEA 4YMJA 5DHJA 3R1QA 5CVHA 3QKLA 5CQUA 4RIWA 3ZO1A 4NTSA 4EOSA 3O8UA 4FSYA 1YWRA 1XBCA 1GIHA 5CXHA 4F9CA 2JBPA 2O8YA 2O63A 4TY1A 4NFMA 4RX5A 3V04A 3C7QA 3UQCA 5J9ZA 4TRLA 4O96A 4L8MA 4BCOA 5L8LA 4CRLA 4Y72A 3VS2A 3Q52A 4YSMA 3TWJA 2RFDA 1JKLA 3KMWA 1W0XC 2WMQA 3Q6UA 4OTRA 3FMEA 3QAME 3UP2A 5HKMA 4C2VA 4L44A 3ZRLA 2H8HA 5AP1A 5EYCA 4ZEGA 4RIWB 5I5ZA 2QC6A 3H10A 1JSVA 3R7UA 4PTGA 3OCTA 2BMCA 3OCBA 3GENA 4AT3A 1V0OA 5BVNA 2WZJA 3TEIA 2WQMA 4RIYA 4KBCA 3DAEA 3BYOA 3MV5A 3BWJA 2CJMA 1BLXA 3ODYX 3TYKA 5B2KA 4ZJIA 1YOMA 3QD4A 2R3KA 2XCHA 2BDWA 3VS0A 4BWXA 3V8WA 2GHLA 5A6OA 1UKIA 4RVKA 4ACDA 1UU3A 3LFFA 1FQ1B 4IAFA 5HE1A 4D28A 2BVAA 3NUNA 5F9EA 3G9NA 4TWNA 5D7AA 3LCKA 3QRTA 3RPOA 3EQIA 4FT0A 5AAFA 2P33A 5EYMA 4HW7A 3QTQA 3QZIA 4TXCA 5J1VA 2HYYA 5JZJA 4HVGA 3GQIA 4YZ9A 5DA3A 2I40A 3HRFA 3F3TA 3FYKX 3Q6WA 2BRNA 3MFTA 3VJNA 2AC3A 3AKKA 3FL4A 3CE3A 5CVGA 4FV4A 1S9JA 3KA0A 4YU2A 5ANDA 4BCHA 2YIWA 3AT3A 1YHWA 4BI0A 2R5TA 4LI5A 2GQRA 3ORTA 3DQWA 3O8TA 4BFMA 2Z60A 2V7OA 4BB4A 4MEDA 4IB5A 5T3QA 1WBWA 3OHTA 3R2BA 4QQJA 4W8EA 1CKIA 5DFPA 2I0EA 2XALA 3E5AA 3H30A 3QQKA 3I81A 4W4YA 4JDKA 2I1MA 2C68A 2XK6A 2ZV9A 3Q32A 1NVQA 5BUEA 1JOWB 5HD4A 2XF0A 2GNLA 3GU8A 3MDYA 2OGVA 4KSPA 3EHAA 2JDTA 5LQFA 4RPVA 2IZRA 3F5GA 5EQPA 3TDVA 4DF3A 3HGKA 2GNHA 4I0TA 2J0JA 4YTHA 4GV1A 2ZMCA 4LGGA 1B39A 4IX6A 1P14A 1PXPA 3BE2A 1VJYA 2JD5A 5BPYA 2W1GA 4GT5A 3PVGA 3UG2A 1Q41A 4HVIA 4W9WA 3CC6A 5HCXA 2G2HA 4FTTA 2GCDA 5AAGA 3F88A 2E9VA 3NLBA 1GZOA 4NH1A 3ZRMA 2G2FA 3SXSA 2OIQA 3W33A 3ZBXA 1XMLA 1H26A 5I9WA 3OXTA 3ZONA 3D9VA 2NNWB 3RZFA 3KXHA 3SVVA 3LJ2A 2XH5A 4NCTC 4R5YA 3UGCA 4IH8A 4ANMA 4MX9A 5KMJA 3VWAA 4BDEA 1W84A 3LFDA 4ASDA 4U8ZA 3AD6A 1UWHA 4YZNA 3IW4A 3R02A 2PZ5A 3NYVA 4Z9LA 4WA9A 1R1WA 4WO5A 5K4IA 2BRMA 3POZA 1W98A 5KMKA 4OAVB 2X4FA 3NAYA 2QOLA 5GJDA 4IMYA 4RVMA 4FV0A 4UB7A 4UMUA 5HE0A 4EYJA 3OOGA 3QLFA 3DTCA 2OFVA 3GU7A 5ANOA 1Y8YA 5BMMA 3UZPA 2NRYA 3EN4A 3QZFA 4ZMEA 2I0VA 4G6OA 3BL9A 4QMUA 4IC8A 3QGWA 4NU1A 2ZAZA 3FKLA 4OBQA 4O91A 4TYGA 3FI4A 4GUEA 4DFNA 3CLYA 3COKA 4QYGA 5CEQA 5A6NA 4BCPA 5DVRA 4GS6A 3W2CA 1ZMWA 2W1ZA 4FSWA 2VTHA 4QTCA 4TKSA 3R7EA 5H9BA 3ENHA 5AUTA 4G5PA 4ZOGA 3PLAE 3D5XA 2OXXA 4QMQA 4N6ZA 4C4GA 2Q0NA 3FMDA 5FP5A 1JAMA 4AGWA 1WBNA 3A99A 4FG8A 4PTCA 4YUQA 4QMOA 3VUHA 2ONLA 3TZ9A 4BHNA 2W7XA 3PJ3A 4PV0A 5KKRC 4JQ7A 2UW8A 5TO8A 3R8VA 5E8TA 5HX8A 3SQQA 5A46A 2WD1A 3PXQA 4J1RA 5CWZA 3ZOSA 4A9UA 4CT1A 4G5JA 5EW9A 3L9MA 4OBPA 5HGIA 1PHKA 3R01A 1H00A 3RPVA 4YTCA 3FAAA 2AQXA 2W1CA 2XKDA 4RWJA 4MNEA 4R1VA 1F3MC 4E5AX 4XOZA 2WTCA 3DU8A 3PJ1A 3R1NA 4C8BA 4C58A 4F7NA 2C47A 3RNIA 3BCEA 3TNQB 4JG7A 4F0FA 4R3RA 4QMLA 1OL7A 3BGZA 3DB8A 3O50A 4O81A 2QU5A 4ZLOA 4MHAA 4FT5A 1IR3A 3RKBA 5CALA 4FKVA 3RVGA 3DZQA 3HDMA 4MBIA 5DR2A 4L45A 4XBRA 2EB2A 1BI8A 4E5WA 3PFYA 3NIEA 2YM7A 4P7EA 4GFOA 2C3JA 2Y8OA 3R7VA 3BIZA 4DINA 1ZMUA 4D2PA 2QCSA 3SHEA 3KRRA 2X81A 3QA0A 3R00A 4ASEA 4YSJA 4RQVA 1W82A 1R3CA 3I60A 3C4EA 3O2MA 3KU2A 3C1XA 1OB3A 5CT0A 4EC9A 4BYJA 1PRYA 4ZSLA 3S1HA 4O0RA 4ZTSA 4EOPA 2VO6A 3A7FA 4PWNA 4K77A 2FSOX 5HG7A 3U6IA 4KKGA 1YW2A 4KIKA 3R8UA 3WILA 4L52A 4I6LA 5DRBA 2BAQA 4EHEA 3LCDA 3HMPA 5LXMA 2VO0A 4RWLA 4Z3VA 2QO7A 5KMIA 5IQCA 3DAKA 3GC8A 2X4ZA 3VIDA 2J7TA 3BLHA 3D4QA 3ZSHA 4APPA 4BJJB 2W06A 2WTIA 2DQ7X 1PMVA 3F7WA 4QT1A 5EK7A 5TR6A 4AAAA 4CFVA 3KRJA 3QQFA 3QD2B 4GFGA 4AN3A 3KF7A 4U42A 1IASA 2OKRA 3TJDA 3C4CA 5L8KA 2UZUE 2QD9A 3R7GA 3AC3A 2WQBA 5D7VA 3HV7A 3PPJA 3ZSGA 4EH3A 2W4JA 3KKVA 2BRGA 1JBPE 3AT4A 3FBVA 3MVJA 3QFVA 4Y5QA 4YJTA 2BIKB 5HO7A 4F7LA 3UNKA 4O82A 3C4WA 3D7TB 4KIKB 5CEOA 3QD3A 5CAQA 3PYYA 3UOKA 1OZ1A 4C35A 5I9YA 4TWPA 4BIDA 3PY0A 1LEZA 2Y6MA 1WZYA 2EXMA 4IZ5A 4EK8A 4OAUC 3WZDA 3IDCA 1XBBA 4W9XA 4CV8A 4M68A 5FGKA 2WMSA 4BZNA 5DEWA 1SNUA 3O23A 4BZDA 3M42A 3L9LA 3QF9A 4DEGA 4MBLA 4QOXA 3DJ5A 3LM0A 4YR8A 4NZWB 1QPDA 5IA1A 5M57A 4KKHA 2NPQA 4A4LA 2DS1A 2ITZA 5EHOA 2VTSA 5BUIA 1P5EA 3NUXA 2IVVA 3P7CA 1KE6A 1TQIA 2P3GX 3BHTA 4MD9E 3LCSA 4U80A 2CHLA 2HK5A 4DFXE 3E3PA 3RHKA 2W05A 3ZEPA 3TZ7A 3NZ0A 4MXYA 4YTIA 3FI8A 3G90X 1XKKA 4NW6A 5J5SA 2JAVA 5DH3A 4AA5A 4ZZNA 4LRJA 1L8TA 3FZSA 3DKFA 3NIZA 3Q04A 4JXFA 2QQ7A 3QYZA 2E9UA 3N51A 4FG7A 4YP8A 5TKDA 4HCTA 2A0CX 2CKPA 4CXAA 3CTJA 3DGKA 2OZAB 3G2FA 3OD6X 5A4LA 4AOJA 3QRJA 4MF0A 3F5UA 3UYTA 5H2UA 2VV9A 3VQHA 4CMTA 1Q24A 3MVLA 4IADA 1ZARA 5CT7A 5F4NA 4FKUA 3VN9A 4PL5A 4H58A 4N4SA 5F1ZA 4ACCA 3BX5A 3W2QA 2JGZA 5IQFA 1Q8UA 4X2GA 4CLJA 3BV2A 1R0PA 2YLEA 5E1SA 5HIDA 4MF1A 3DNEA 3WE8A 3FZ1A 2UZNA 3IQ7A 3PSDA 4FK6A 2JAMA 5C01A 3V5LA 3U9CA 4FEWA 2ZB1A 3UDBA 4XOYA 5AR4A 3PXYA 2WOTA 4FUXA 4IZAA 4Y95A 3MESA 2YZLA 2FYSA 4DHFA 3HDNA 3ZCLA 1SZMA 3KK8A 1YXSA 2XNOA 4UMRA 2X0QA 3ENMA 5AADA 2EXEA 3LW0A 1PXJA 3I7BA 4MXZA 5DG5A 1PJKA 3RAHA 3C4FA 5GIOE 5J7HA 3U55A 2VGPA 3R63A 3ACKA 4S30A 4AZFA 5DIAA 4J53A 3HVCA 4WG4A 4BGHA 4FKRA 5EHLA 4ACGA 5A4CA 3LJ0A 4JX7A 4DCAA 2BRBA 3TNWA 4EC8A 3DS6A 5L8JA 1PW2A 3KB7A 3GU4A 4JRNA 3G15A 3OS3A 1NXKA 3MPTA 3FSFA 5CY3A 1OBGA 2YN8A 2VNYA 4IB1A 3ZM4A 4BWPA 5K4JA 3DB6A 1PXIA 3QKMA 4MK0A 3KCFA 1PMNA 2XUUA 4GT4A 3RI1A 3NFGB 1UNLA 3P23A 4KA3A 4L67A 3RPYA 5HBJA 2GHMA 2VUWA 1XWSA 2Q83A 3BLQA 3IW8A 4E8AA 3N9XA 3I4BA 4UXQA 2G15A 5ETCA 3I0QA 4NT4A 5KE0A 2J9MA 4IX4A 4DGLC 4MKCA 4LRMA 3NNXA 1OPLA 3NUPA 2XJ1A 4EK5A 4DHZA 3LZBA 3OWJA 4R3PA 2C3KA 5I9ZA 1OL2A 3K3IA 3UOHA 1P2AA 3WF5A 2H96A 1YI4A 3W2PA 1JSTA 5HZNA 3ALOA 2XMYA 2PE0A 5CAUA 2AEGA 3NVMB 1P4FA 3ROYA 1CM8A 2YDJA 3DJ6A 4IM0A 1JKTA 3BRBA 2YIXA 1NT2A 2O64A 3RK7A 5DNRA 2ZV7A 4XJ0A 4FSQA 2J90A 3KFAA 3VULA 3OF0A 3H0YA 3AGMA 5KMOA 4NM7A 1GNGA 4RGJA 4RQKA 4Z55A 4LV7A 1OITA 4U79A 3C5IA 3LFAA 3OEFX 4L01A 2ITQA 3HMNA 4RLKA 4BDKA 3T8OA 4CG8A 3ORPA 5HNGA 1VR2A 3SOAA 4AG8A 4AOIA 2PUIA 1ZYLA 2ZYBA 5JN2A 4EOOA 2IO6A 4QPAA 1JPAA 2PVHA 2HY0A 3QCSA 3KK9A 2BAKA 5AX3A 2YJSA 4EUUA 4JT3A 4E6QA 2WTJA 2VTRA 3ITZA 3ZDIA 1WBOA 1AD5A 2ITXA 4I24A 3QHRA 3NCZA 4JIAA 5TT7A 3EQHA 3ZYAA 4FK3A 4CCUA 2X1NA 3OP5A 3QCQA 3CCNA 3Q9WA 3ORZA 2R7IA 4D1ZA 1WVXA 4L42A 4CVAA 5HEZA 5HORA 2X7OA 3OCSA 2XNGA 5HX6A 1KWPA 3JVRA 3PP0A 3DXPA 1U54A 5C03A 5HVKA 2WGJA 4UXLA 2EB3A 1R78A 3MIAA 4FTJA 3WF6A 4DEHA 5CXZA 2W17A 3KULB 1YWNA 1UKHA 4QMNA 3ANQA 2YDKA 3FSKA 3LCOA 4O6EA 3F2AA 3A4PA 1U4DA 2XZSA 3QQHA 4TNBA 4C59A 5I4NA 4O0YA 5M51A 4GW8A 3MBLA 3UVRA 2GNIA 2QG5A 4YHJA 4ACHA 3W0SA 3LIJA 3RM6A 1AQ1A 5AP2A 2CMWA 2B7AA 5DGZA 4I23A 3TNPC 4FV7A 1SVHA 4FIHA 3PE1A 3RAIA 4AQCA 2JLDA 3E8NA 1FMOE 3CP9A 4WG3A 4WBBB 2Y4IB 4ALVA 4XP2A 4AFEA 3NFFB 1GZ8A 3PE2A 3UO6A 4A4XA 3W0MA 1Q4LA 4FEVA 3V51A 4BN1A 4E3CA 3CJGA 1M52A 4PP9A 2LAVA 1OVEA 3S4QA 4FKOA 3BGPA 3HEGA 3EQCA 2QKWB 2RGPA 3D7ZA 3JVSA 5AP5A 2R64A 4IJ9A 1H27A 4O0UA 3GU5A 1BI7A 5AWMA 3GCPA 1ZAOA 4FKQA 3VRYA 2YM3A 3SX9A 4F9BA 3UZTA 2PULA 4HNIA 2W1EA 3B2WA 2Z7RA 2WU6A 4WOVA 3LM5A 4BKYA 4UZDA 4HCUA 4YJOA 5EW3A 3LLTA 3QTZA 4BDHA 4USFA 5M53A 1YXTA 3WF9A 2ZVAA 4FV2A 2UUEA 4A9TA 2W9ZB 1DI9A 3O17A 4QMTA 4DLIA 5CAVA 2EWAA 4ORKA 2E9OA 2VTQA 3BEAA 1GOLA 4AOTA 5J1WA 3FEGA 4AU8A 3ZDUA 3R7OA 4JR7A 4FTOA 5M4IA 1FGIA 3QTIA 5E8XA 2JEDA 1JNKA 2ZM4A 4R77A 3NMUF 3DCVA 1WVYA 4G17A 2ITYA 3WF8A 2HAKA 3H3CA 4AWIA 3QRKA 5CVFA 3LQ5A 2CGVA 5E91A 1Z57A 2J0IA 4IAKA 3G0EA 1QPEA 3RK9A 1Q8ZA 3ANRA 4OR5A 3SW7A 3WZEA 3KREA