3NURA

Crystal structure of a putative amidohydrolase from staphylococcus aureus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
305
Chain Sequence
MKSITFEEHYVIEDIQKETNADELSHHDERIQFMNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPEAAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIYQSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFFLERMDEALFAEHLNHSVSYYFKNSFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIEPEKLGVFLDELGLTDEEKEKISYTNGAKLLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative amidohydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Amidohydrolase
total genus 111
structure length 305
sequence length 332
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3nurA00
1KRMA 5A6TC 5HMDA 4G7EB 2R1MA 1EF2A 4OFCA 4F0LA 1RJRA 5HMEA 1KRAC 3F4CA 2QVNA 2PGRA 3HTWA 4QS5A 3RHGA 3GUWA 3IRSA 2GWGA 4IFKA 4CQDA 3WYZA 2E1WA 4IFOA 3EWCA 4DLFA 4C5ZA 4BKNA 4IQJA 1ITQA 3UPMA 4CEXC 4KESA 3ORWA 3ITCA 3EWDA 4XD5A 3E74A 3DC8A 1FWDC 2PLMA 4BY3A 4HK6A 2E25A 1K70A 4RDYA 3IACA 3UR2A 1FKXA 4QS6A 4WGXA 2FVMA 2HPIA 3QY6A 1KRBC 4R88A 3S2LA 5E5CA 4JOMA 4WVXA 2Z25A 2CZVA 1NDZA 4NG3A 2WJEA 3MDWA 4LALA 2VHLA 2HPMA 2OOFA 1IE7C 4IGNA 1RJPA 3DUGA 3NEHA 1ZZMA 3MVIA 4AC7C 3PBMA 4KEVA 4CQBA 4HA0A 3DCPA 4GYFA 1YRRA 3A3XA 1V7AA 2Z00A 4J5NA 4C6OA 2GZXA 3RCMA 3TNBA 3D6NA 2YB1A 1O5RA 2WJFA 4B3ZA 2ANUA 3AUOA 1A4MA 4XAFA 2EG8A 4XD4A 4GY7A 3QGKC 2R1PA 4GXWA 3WZ0E 4RDWA 3MKVA 4XAYA 1KCXA 4C6IA 4LANA 3ICJA 3GU1A 2OGJA 4YIWA 2Y1HA 2Z28A 3N2CA 1GKPA 3AU2A 2YXOA 1NDVA 2YZ5A 4LAOA 3CJPA 1EJSC 1EJVC 4F0SA 1FWEC 4LH8A 4R7WA 2GWNA 4ZSUA 3OQEA 1R9ZA 1FKWA 1ADDA 3TN4A 4CNTA 4LCRA 2Q09A 1W1IE 5FSDC 2EG7A 1EJTC 2FVKA 2HBVA 3V7PA 4L6DA 3URBA 3LY0A 1FWJC 4J2MA 3IJ6A 3T1GA 2ADAA 1RK6A 2QS8A 4H9TA 4XD6A 1RA5A 3HPAA 2UBPC 4IG2B 3O0FA 1XRTA 1A5MC 3F2DA 3CS2A 3K4WA 4PCPA 3B0XA 4DYKA 3JZEA 3RYSA 2QT3A 2ICSA 4PE8A 1PB0A 4GZ7A 4RDVA 2PAJA 4HK7A 3O7UA 4LEFA 5HMFA 1P6BA 3MSRA 2FFIA 4IG2A 4EPDC 2AQOA 2D2JA 4IGMA 4RE0A 4UB9A 1A5NC 3URQA 4IFRA 2YB4A 1O12A 1WXZA 4H9YA 4GBDA 2WM1A 1V79A 4I6KA 5AKQA 3GRIA 1V51A 3F4DA 1JGMA 3MJMA 3FEQA 1QW7A 4DZIA 3K2GA 1RA0A 1NDWA 1S3TC 3MVTA 4C5YA 1POKA 4XAZA 1VFLA 4EPKA 4C6NA 1BF6A 3QY8A 2OB3A 3K5XA 3FDGA 3LA4A 3MPGA 4GY1A 4V1XA 4F0RA 2D2HA 1NFGA 4TQTA 2O4MA 3MDUA 1FWIC 1YNYA 4B91A 4DI8A 4KEUA 1YBQB 4P5UA 3B40A 1EJUC 4ERIA 1J6PA 1ONXA 3LGDA 4QTGA 2VM8A 3GTHA 1ITUA 1PSCA 2Z7GA 3F2BA 4EPBC 1RK5A 4C6FA 3E0FA 2VR2A 4NI8A 4H9UA 1I0DA 2D2GA 4C6EA 2AQVA 4HK5A 2F6KA 3GTIA 4LCQA 4PBFA 1QXLA 3G77A 3IPWA 3OODA 3OJGA 1J5SA 4AQLA 3E2VA 4MUPA 2DVTA 4C6LA 1K6WA 3GTXA 4H01A 2WJDA 3URNA 3QGAC 4E3TA 3S2JA 4PBEA 1R9YA 1YBQA 2Q01A 3TN5A 5FSEC 2FTWA 2DVXA 4LAMA 4J35A 3C86A 4D8LA 3T8LA 1EZ2A 2IMRA 1FWCC 1A5OC 4KERA 4KIRA 4G7EA 3IARA 2AMXA 1ONWA 2I5GA 3LGGA 1PO9A 3B0YA 4H9ZA 4CNSA 1GKRA 2ZC1A 3GU9A 2VC7A 3IGHX 1UMLA 3CAKA 3E0LA 1P6CA 4IFKB 1UIPA 3A4JA 1WXYA 4ERGA 4H9VA 3SO7A 4DLMA 1FWHC 2O4QA 3IV8A 2I9UA 3SFWA 4H9MA 2P50A 2R1NA 2EG6A 1I0BA 2HNHA 4QRNA 3MTWA 4GX9A 3GU2A 4H9XA 1E9ZB 2PUZA 2Z27A 4GC3A 4GX8A 4UBPC 2P53A 3OVGA 1POJA 4C6MA 3T81A 4C6JA 3E38A 2KAUC 1XRFA 2Z26A 1E9YB 2R1LA 3WMLA 3F2CA 4H00A 1UIOA 5LXXA 2A3LA 2HQAA 3GTFA 4XD3A 3E3HA 3RN6A 3LSCA 4CEUC 1RAKA 1KRCC 4C65A 3ISIX 1J79A 4LFYA 4GK8A 3BE7A 1A5LC 2UZ9A 3UBPC 4IF2A 3LU2A 4RZBA 4NP7A 3OOQA 2W9MA 1P1MA 2BGNE 3UR5A 3LSBA 4INFA 4B92A 4DIAA 1A5KC 3PANA 2G3FA 4GY0A 2HBXA 2OQLA 3TN6A 1XWYA 4HJWA 3URAA 4KQNA 3LNPA 4I6VA 3NQBA 2GOKA 3AU6A 4M51A 4GOAA 4WHBA 4KETA 2GSEA 4C6KA 2Z29A 4EPEC 1DPMA 3TN3A 1M65A 1UBPC 4Z42C 2VUNA 2BB0A 4C6QA 4DI9A 3KM8A 4PCNA 4C6BA 1FWBC 3NURA 4LCSA 3OU8A 3S4TA 4CNUA 4CQCA 1R9XA 1FWGC 1M7JA 4RDZA 1GKQA 1HZYA 1K1DA 4DNMA 1PTAA 1A4LA 1M68A 1YIXA 1EJXC 1V77A 4XAGA 3GIQA 2QPXA 3S2MA 1V4YA 3ID7A 2DVUA 4V1YA 4BJHA 1FWAC 3HM7A 3GIPA 4B90A 2VC5A 2Z4GA 2Z2AA 4DO7A 4R85A 3EGJA 4G2DA 4C6CA 3A3WA 4DZHA 1EJWC 4ICMA 3GG7A 1EYWA 4LAKA 1J6OA 2XIOA 2PGFA 2RAGA 4ZSTA 3UF9A 1XGEA 2Z24A 3LS9A 2OODA 2Z2BA 4L9XA 1NDYA 4IH3A 4KEZA 1EJRC 5CH9A 5G4HC 1RJQA 4EP8C 3R0DA 3PNZA 4C60A 4C6DA 2FTYA 4C6PA 3PAOA 3QY7A 2R1KA 4QROA 3S2NA 4KF1A 3PNUA 4ERAA 3FDKA 4QSFA 1YMYA 1FWFC
chains in the Genus database with same CATH superfamily
1ITXA 3WMBA 3WLSA 1TSIA 1TYGA 3KFTA 3BMWA 3GFYA 3YPIA 3AOFA 2R1MA 5C70A 2I17A 4UC5A 2HJPA 3VNMA 3KRSA 4DJED 5EMUA 3HQ1A 2E5CA 4KH2A 4IFKA 4FALA 1O60A 3CYJA 4LS0A 3GZ3A 3DYMA 2ISDA 3UPMA 2X1IA 3TAKA 2ZE0A 2D23A 2RH9A 1TCMA 4I9JA 4EXAA 1FWDC 4U28A 1XFBA 2OYLA 3FSUA 3W7CA 3QY6A 1KRBC 1R2TA 4ZL1A 4OQVA 3EEZA 2CZVA 2J77A 5HJXA 4DWSD 1H60A 3NQCA 4O1DA 5RUBA 3ZJ7A 2PBGA 4XQ6A 2VX4A 3E6EA 3MUY1 1OY0A 1PV8A 2WCSA 3ES8A 2E09A 4AWTA 2AL2A 5A6BD 5E70A 3E5BA 4E2OA 4DUVA 2BNJA 1PIGA 5DLCA 5D9OA 4XTIA 3CH9A 2OO0A 2D73A 4FZIA 1WQ5A 4OVXA 4EVZA 1C3FA 3C3NA 1DJQA 2F2HA 4DUXA 3DECA 3OB8A 2VEKA 3NCOA 3TH6A 8XIAA 2JE8A 1O4UA 3T08A 4QIUA 2EKGA 3OVRA 4DAIA 3F03K 4CNTA 3CZ8A 3W38A 1OF8A 3H2EA 1I1XA 3GXPA 3FAXA 2QS8A 5AYZA 1W5QA 1TA3B 1QBBA 4GUGA 1LRNA 4J28A 3CQJA 4AIEA 1DQWA 4MY8A 3VVGA 2ICSA 5JXQA 3RRXA 3PSWA 3NDYA 4MFDA 2W79A 2ZE3A 3NM3A 2RKXA 2V3DA 4GISA 2GYIA 4DNHA 2YA2A 3EWUA 1XICA 2R8WA 3UJFA 2WZMA 4DBSA 1VFUA 4GBDA 1DYSA 2REQB 3AYRA 4TVCA 5DXYA 4KRUA 1LDCA 4K8HA 3DG7A 1BRLA 1X6NA 2DH3A 1SM9A 3ARVA 5DY3A 3F1QA 4GH3A 1E1EA 4N9DA 2ZX7A 2Y63A 2DEPA 4JEQA 2C14A 3W1MA 2QPUA 1RQBA 3PBGA 3FVDA 3LENA 1W1TA 2QUUA 2UY4A 3WDJA 2Q8XA 3Q67A 1SZGA 2JKPA 4O8RA 5HINA 4IP5A 2GJRA 2VR2A 4PRRA 4A3RA 1JYWA 4UNKA 2IKGA 3UXDA 1RQEA 1JZ6A 1Q6RA 2XSBA 3KS6A 5HJLA 3ZT6A 4FK9A 4C7GA 4TXEA 4N4QA 4AX7A 3LRLA 4YLWA 4C1KA 5LGZA 4CVUA 4ACZA 5ECVA 3AS0A 3DFYA 4LBRA 4PBEA 3H2MA 2PBOA 4JDBA 2OSYA 3OZPA 3MHUA 2VWSA 3KW3A 1K7FA 3I3EA 2OT0A 3JS3A 1U1JA 3VGGA 3LGGA 4O11A 1VGAA 1Y7VA 4RZ4A 6CGTA 1UIPA 5EFDA 5M2FX 1GVSA 2WSRA 4NAEA 3TWAA 3MV01 1OX5A 2H9AA 4ATLA 4IISA 4JKMA 3NWRA 1XCFA 3PBWA 2OOGA 4ZOAA 1XG3A 3ZWTA 1BXCA 1HO4A 3E9AA 3LCHA 3JU2A 4H1ZA 2C1GA 2XN1A 2HK0A 2FDSA 1ISVA 3S9ZA 3TK7A 3V0UA 1A80A 3EXTA 3W00A 2BTMA 3WMLA 2NW0A 2V69A 3F2CA 5DN1A 1EX1A 3TUUA 3GB6A 4QQ3A 4Q8VA 1W32A 1HKJA 1PDZA 3QLDA 4FS9A 3R12A 3T55A 1QW9A 1MUCA 4O28A 5CG7A 3SCOA 1HNYA 2W9MA 3AIWA 3FYOA 1P5BA 5JBDA 2F6XA 2VCBA 3C3UA 2HROA 4NAEB 4PBGA 1JEZA 4I6VA 1B57A 1QPQA 4ZBCA 1XX1A 4GXMA 5A6LA 3MZ2A 4O1CA 2Y7GA 3TZFA 2OSWA 4B4HA 3UR7A 1GQKA 3WUGA 1HKIA 3GIYA 2E6FA 3KM8A 3DEQA 2P0OA 3VIFA 3A4WA 1JNDA 2V0TA 1FWGC 1HZYA 1V93A 1RP8A 3BAXA 1V77A 3EZ4A 4LYPA 5EY5A 3K4AA 1YTEA 4FXJA 2J7GA 3WK1A 2ISFA 4C6CA 1L8PA 1Q3NA 2Y8UA 2XIJA 4O53A 4RNIA 1QO2A 3FSTA 3QBUA 3GNDA 2OODA 3OO2A 1S1RA 4JTEA 1ZJHA 2WXDM 3CV6A 5D05A 2C1HA 3MUZ1 2PDUA 3WQEA 3B8WA 4ZOEA 3PFRA 4JL1A 3QVQA 3TEVA 4HHHA 2G3NA 1W8SA 3QPZA 3M46A 2ZZ4A 3BW4A 3CEPA 4LOCA 3CL8A 3EDJA 4OFCA 3VNDA 4OOUA 1JRBA 3SCWA 3ZLHA 2V5DA 4K6AA 3TLQA 2VFDA 2WVVB 1TX2A 3GUWA 5FF0A 4DO5A 4CQDA 5HNRA 4WJXA 1KBKA 1ZCCA 5G1YA 1UZ1A 3B97A 3BCJA 4JD4A 2OZ3A 4IIBA 1CGVA 4O17A 3DC8A 4W4QA 3VDCA 3WLRA 1JFXA 2IUZA 2ZA1A 3DIPA 2DQXA 4GH1A 2QVHA 3R79A 4AG0A 1FKXA 4Q6XA 4IX2A 4HSHA 4U2YA 4GQ0A 4M6UA 1NDZA 2CXEA 3QYQA 3BV4A 5ABFB 4HZ8A 4RNHA 3BLOA 4GBUA 3FK4A 4AUBA 1EOMA 4YYFA 2AL1A 4PRWA 5GJMA 3ATYA 2FZ8A 3QM3A 3VAVA 2XSAA 4DWSB 4O14A 1OG6A 3BSGA 4MVAA 1RR2A 4H6QA 2V9DA 1KV8A 1LOSA 1OCJA 5LXEA 4XAYA 1I6NA 4A3QA 2O55A 3LYEA 4KGJA 1H5VA 1MQPA 2ACRA 4JFUA 2CESA 3ITYA 3K8KA 5FJRA 2V5JA 1EB3A 1HXJA 3T07A 2V5BA 3VYLA 2PDYA 4Q7NA 3HN3A 2PLCA 4X0VA 3ZJ8A 4AZCA 4GZIA 4B15A 4M0XA 2NLIA 1EC8A 1FHLA 4H3DA 4DYEA 4UWMA 5EL1A 3VIPA 4O4VA 2YDRA 1RA5A 4UTTA 3W7PA 2W0UA 3RLHA 1NQ6A 2POTA 1CW2A 4JIRA 3K4WA 1UD2A 1AW2A 5H1WA 2GL5A 4XZLX 3F5LA 3RYSA 4AZ7A 5BU9A 3UEQA 2ZIDA 2QR6A 1P6BA 1AH0A 1CX9A 3DBPA 4JTHA 4I6KA 4W84A 4DBEA 1HJUA 2XJ7A 4OKDA 5I3IA 1QW7A 3W25A 3GHSA 4X60A 1RA0A 3P3BA 1X1ZA 5CQ1A 3KRBA 3VNIA 4TX8A 2QF7A 1JD7A 1QPOA 2BG5A 4KEMA 4LTSA 1XYCA 4L61A 2G50A 5CGTA 1C29A 1J0IA 4HA4A 1UA3A 5BYWA 4PUKA 3E5PA 4TQTA 1H41A 3FA5A 3LK6A 2X1SA 4JHOA 1VYPX 3B40A 1TPC1 4ZZ9A 1K8XA 4HHMA 2WMGA 2H8ZA 1PVNA 1XC4A 3F2BA 1U1HA 1RK5A 1B3WA 3KXQA 3BLEA 4NSBA 2DDXA 3KOYA 4NI8A 4UTTC 4JY9A 2CXGA 4HK5A 1ENUA 4RPPA 2YIHA 2CCRA 3KVLA 1V3KA 3WJYA 7A3HA 1DXEA 3O6CA 4JHZA 1GPWA 4AB4A 4O4WA 4PYSA 1X7IA 1AG1O 4J3WA 1IR1A 1V08A 1EZ2A 1FWCC 3CYVA 1QNRA 3CWHA 1JXJA 3MSDA 4IL2A 3WUEA 3MP3A 1XIEA 4ZFMA 5HWNA 1MNSA 3H54A 1W3TA 3W26A 3E2RA 4CKQA 1GYNA 2NQLA 3NL6A 1KXVA 3MKKA 1QPNA 3BCFA 3NM1A 2FHCA 2JEPA 1IZKA 4ENLA 4AFYA 3R25A 4AX6A 3O3RA 1FWNA 3TSMA 1TRIA 2NQ9A 5FJPA 1O95A 1V8EA 4ZGYA 1L6YA 1P0BA 1EWEA 2C1IA 4NJKA 7ENLA 3QQWA 5FD0A 3OLDA 2WJZA 4GUJA 1UJPA 3TE9A 5D8ZA 5E0CA 5T9CE 4ADTA 2P53A 4HMCA 3IUIA 2ZQ0A 2EXOA 1XFCA 3QZEA 5EMYA 2QJGA 3OHIA 1TPVA 2QKFA 4IMCA 4F9DA 2XTKA 1G0CA 1UJQA 3CV1A 3U4AA 4RE2A 1BWVA 4C65A 4H41A 2QULA 3CZGA 4MM1A 4IMFA 4D72A 5I24A 3MS8A 1FFRA 3RX4A 1MZHA 3PTKA 1HGWA 3HFTA 2QPSA 4JKKA 5F4XA 1FQ0A 3VOIA 4B92A 4XTDA 5IDZA 1ECQA 2OQLA 3M4HA 3PAJA 3S5NA 3L4ZA 3RCYA 2R94A 1F7BA 1Q2RA 2WLZA 3QN3A 4UMAA 3PJTA 4NASA 3GAYA 2CC0A 1KM4A 1PTDA 3J7HA 3FVMA 5BROA 4QLKA 1PL9A 6TIMA 1OCQA 2OPJA 3W7OA 3IS4A 5AHFA 2ON3A 3TLLA 5C9XA 3C0SA 2FGZA 2XWEA 1LG1A 4GLEA 1K7EA 1GTEA 4Z2KA 1D3GA 2R9RA 1A4LA 2HNEA 3DFHA 3H4GA 3TROA 4G1KA 4Y9MA 3PZVA 2PZ0A 4BQ2A 1M7XA 4XBJA 3CMFA 4WDWA 1TMLA 1PAMA 4P7NA 1VFSA 5K4XA 1KQYA 4JYDA 3VDAA 1XM3A 3THDA 2FPYA 4HU3A 4O12A 3H4WA 4O1EA 3M5VA 3ARTA 4DWSA 3L12A 2A2IA 2J88A 5JIPA 4GFSA 3SQSA 2VYOA 3QY7A 2A7NA 5LNSA 4ZQNA 4QSFA 5IRPA 1YTDA 3HG3A 2DJLA 2UWFA 4XV0A 1WKYA 2VZTA 4J27A 4OUEA 1B0IA 2DUXA 4TIMA 2HS8A 2QCLA 4ZQCA 4IIEA 3TA6A 3W9ZA 1FP8A 3WIJA 4C90A 5F4WA 4KT2A 4MWAE 2WVSA 1QOQA 1US2A 3MMTA 1NFPA 1CXLA 1TWWA 5BCAA 3E0WA 3G1FA 2AGKA 1IXQA 1ZAJA 2Q3RA 1R2RA 3KHDA 1Y0EA 2CERA 4ACYA 3VDHA 2GSJA 2V3FA 1ICPA 2E68A 4RDYA 1LUCB 3QC0A 4NG3A 1M04A 1H50A 3AAMA 1JCXA 2G8ZA 3K8MA 3HQPA 1RHCA 3B0VC 3BGJA 2PWGA 1GWJA 1NF7A 1JQVA 2QJHA 1UC5A 1F9CA 2OKTA 3CTTA 1DQXA 2AQWA 1XDMA 3LCWA 3SUUA 4M24A 4C6OA 3CPRA 1LT8A 4B5VA 1BG9A 2VEGA 3HA1A 5C54A 1G1YA 1UP0A 3AUOA 1GOQA 4XAFA 2JFEX 1ZB5A 3GY1A 1K4HA 3GQYA 4POCA 3ITOA 1DJYA 3RR1A 1MXSA 4LS1A 1LL6A 4DXXA 2PDWA 5F1VA 3T0DA 3SY8A 2CLHA 4NNCA 2GWNA 1ONRA 1XHGA 3PPFA 2A3BA 1ADDA 2W63A 4LCRA 3W87A 4S3DA 4RR4A 2INZA 3LTPA 4BR1A 1XIIA 4GYPC 2DSKA 1BLIA 1XIFA 5A2CA 4Q4MA 3W1LA 3QR0A 4DJDA 5HWMA 2J66A 4IPPA 1UR0A 3HV8A 3SAZA 1YNQA 4H7CA 2WMFA 1VRDA 3DXIA 3RCNA 1J0ZA 4DF1A 2J27A 3I4KA 3JZEA 3FA4A 4ZQOA 2PAJA 1UUMA 1C90A 5AZ1A 4J9JA 1I8JA 4HYRA 4IXHA 4LEFA 1PX8A 2IPFA 2WQDA 4ZFCA 4EPDC 5H6HA 4IPLA 5A8QA 3SCTA 2WM0A 1ZP4A 4IICA 2RJGA 2FMNA 3O2LA 4HU8A 2I9EA 3KL3A 5HUOA 5G2WA 1MUWA 1IV8A 1BSLA 1XP3A 1EA0A 4EPKA 4C6NA 5F2LA 3FDGA 4GY1A 4AHQA 1KXHA 3VXGA 1F05A 4KFPA 3OG3A 5BU6A 3VI2A 1XLBA 4O1FA 2CWNA 4J3VA 1XYAA 1G01A 1I0DA 2P1FA 4W8AA 2H6RA 5ABTA 2PDLA 5KINA 3ARPA 1S5VA 3INPA 5GJNA 5A5WA 3OODA 3JZUA 3E2VA 2J24A 3TCEA 4MIMA 1EHAA 4E5TA 2OLAA 3L21A 5CLWA 3A4XA 4J35A 1FWTA 4L7ZA 3I6RA 2FGBA 3USBA 3WF4A 1SW7A 3B0YA 1UMYA 2QJNA 1Q8JA 3MP4A 1XC6A 4AD5A 1F5ZA 3NYDA 3THUA 3IIXA 2CWXA 3HPSA 1AJ2A 2QUVA 3S6DA 3VMOA 3V16A 1AMYA 4S38A 2P50A 4I5RA 2GK1B 3RNDA 3Q65A 3G18A 1XKJA 4JZ5A 2VX5A 3ERPA 2Z27A 5E93A 3ES7A 3REQB 1TQXA 4JXCA 1IQ8A 4ZQPA 3E49A 1DTNA 4C6JA 1XBYA 2DIJA 2OWXA 1E9YB 3WF3A 4A21A 2PPGA 1IT0A 4B3KA 1GVRA 2A3LA 3EX2A 4QHRA 2D0FA 3GR8A 1H62A 2J9YA 3RN6A 2DORA 1A49A 3UWVA 2D24A 5M17A 2NXIA 5CC6A 3NOYA 3VNYA 3S9IA 1PX3A 1C9DA 3MCNA 1KGXA 4E8GA 2UZ9A 4YS1A 3R5EA 2BOEX 4E4FA 1YNPA 1X8CA 1G94A 4YTUA 2NV9A 3RILA 2BGNE 4O8AA 2QV4A 2EBNA 1F3XA 3PANA 2VQUA 3EX4A 1DWAM 3ARSA 3WJXA 3VKBA 4JQ1A 4O0QA 4PSRA 4CD7A 3V0TA 4OGZA 4CU6A 3WQ6A 4L4PA 2Z29A 4EPEC 3KOZA 3GKAA 1KFBA 2TMDA 4UFKA 4J1OA 2WWCA 3WH7A 3P67A 3R58A 3L5LA 1REQB 1SW3A 3ZMRA 4UFJA 3NQ6A 5FCZA 4KCUA 1CNVA 4RNJA 4MJZA 4A2SA 3GTNA 3TYDA 1W5MA 3BQ6A 4XZMX 1OC6A 2OVLA 5H91A 5IBXC 4AMCA 3CH0A 4PEEA 1QVBA 1UROA 4S2BA 4MJ2A 1ISXA 1ADOA 2MANA 3WFAA 3U5UA 3RXZA 4BF5A 1GEQA 1KBLA 4CN1A 3R8GA 4HD5A 3PY2A 1UCWA 2QCCA 1X38A 2OMAA 4OV4A 2HV5A 3QC3A 1OD0A 3GX9A 5E1QA 3STCA 3F5KA 3CWNA 3EDKA 4ZB0A 2QYGA 4NKCA 2NQJA 4C6DA 1KFJA 4C6PA 1IR2A 3OBKA 3FY1A 3AHTA 3ALGA 4CNNA 3W88A 2PDPA 5A6BA 1ZGDA 4Y8EA 4JIIX 4Q8TA 1MMFA 1Q4WA 4DJEA 2DT1A 2XVNA 3N15A 3N6QA 4HNCA 3LX9A 3EXSA 1XD1A 1KTCA 5CZ0A 4NZ3A 5D2YA 3M0YA 3NAVA 4KCTA 4QSHA 5I3HA 4DB7A 3L9CA 2V5LA 2P8BA 4P7OA 1V0MA 4N0RA 1EOKA 4JCLA 3W81A 5JIWA 3A47A 3IAQA 2OZ0A 1ZBVA 1I2PA 4JTIA 1VBJA 4PUJA 2X42A 1P4CA 4FLRA 4J3XA 1QOPA 3N14A 1SMDA 3TJ4A 3UFYA 4CQ9A 4XX6A 2BVTA 1MDLA 5CBJA 2J7FA 2XVGA 1RY0A 3WQPA 2C3ZA 1UD6A 3L66A 3UG8A 1XGZA 3ZO9A 4S1FA 5IXEA 1BAGA 2PA6A 1KKRA 4ZR8A 2ZWYA 1XR2A 4XSLA 4HCDA 4MB3A 3ECQA 4AEEA 3W07A 3SCUA 3UG5A 2B7QA 3DDMA 2GDVA 4C6IA 4Y9NA 4HZ7A 4S3EA 3RLUA 1NSJA 2OGJA 1P0KA 3LTSA 3TC7A 2BS9A 4MWAD 3W27A 1GKPA 1LLWA 4XUGA 1JPKA 3OLGA 4M82A 4HA3A 1U5VA 3WLKX 4Q4KA 3QXBA 2E67A 1UWQA 4PULA 1EF3A 5LNVA 3W7JA 3O6AA 1VBGA 1VYSX 1PYFA 4DJDD 1Q7ZA 4PTWA 4HSOA 3S9YA 1B3YA 4I7VA 1LL4A 2WMHA 2BLEA 1OGSA 2ZXDA 3ZIZA 1C8XA 1IZCA 4FLOA 1S5TA 4RDVA 5EPDA 1YDYA 2ISVA 1W1PA 3RU8X 4N9CA 5IOBA 3MW7A 2IXUA 3BLPX 2H3DA 1S1PA 1UB3A 5C9RA 3R1ZA 3BURA 2FHBA 5LNRA 3ZXWA 4KMQA 2IKJA 1E6NA 1FP9A 3KX6A 2WSYA 1ZSXA 5HK4A 1DJIA 3U48A 1IHIA 2RDTA 2QDHA 4F0RA 4RK8A 4PTMA 1NFGA 5BRPA 1SZNA 3SQMA 4JQ3A 3G1AA 1BQCA 2DUAA 3HGRA 1R2SA 3H6OA 3E0VA 2VM8A 3CHDA 3NSNA 3MB9A 1OD8A 3S1XA 2D3LA 4JYEA 4A3HA 2VNCA 3GZAA 2WW5A 2C79A 1B4EA 5C5YA 4UQ9A 4BQ3A 1N8WA 3KS5A 2HSAA 1QWGA 2VQTA 5EMLA 1YBQA 3S5OA 5FSEC 2DVXA 2HVNA 1VEMA 5AVHA 4UUIA 4JIQA 3BLIA 1KM2A 2X0YA 3UWUA 2AMXA 3LHZA 5FEPA 4PUWA 3IJIA 4OU1A 4AIUA 3I6EA 1JF5A 4UQAA 4DN1A 3W22A 1P6CA 1PXGA 2VGFA 4JTSA 4AVFA 4UCFA 3AC0A 2XM2A 1UR2A 4DLMA 3S1UA 3CV7A 3G3MA 4DJFC 3G0SA 2V6AA 3M6DA 2Q6ZA 2ZUWA 4UCGA 1AW1A 5CEWA 4Q33A 2E6YA 4AAJA 2Z1KA 5A8GA 4QLJA 4R33A 1CYGA 4HPHA 4PFHA 3ZFHA 4GC3A 2CLFA 2XGBA 3IK2A 3NL2A 3GSMA 2JBMA 1Z32X 3T81A 1OFPA 3N12A 5A8NA 3OTRA 1RD5A 2GDQA 4XZBA 3M44A 3UA3A 1OX4A 3N25A 2BVYA 4MSSA 4LUIA 3PG8A 4X22A 5A8PA 4AIOA 3NOEA 3HPFA 4CEUC 4QISA 4WCJA 3TR2A 1V5XA 3GVWA 4B9ZA 3L0KA 4WOQA 2V30A 1T41A 5DMYA 4AWUA 1CXIA 2WZTA 2YYTA 3UGRA 3FIGA 5HQEA 4K1GA 2QMJA 4Q8WA 4HJFA 5F4SA 4WSKA 5C55A 1BGGA 1LUCA 1A5KC 1ML1A 6ENLA 4GY0A 3UZZA 4FAMA 3KBJA 5LIXX 1ZJBA 1UWRA 4FNTA 5LSMA 1Z3NA 3RPMA 4ZE4A 1PEZA 3N2MA 2ZC8A 2G3MA 1H4PA 4LUYA 4WLCA 1XH1A 2YLAA 3O6DA 2REQA 2YW3A 3OU8A 2J8TA 3A9BA 1YPIA 1R9XA 1FFQA 2VZUA 3C0JA 2DSUA 3RO6A 2WHKA 4E3VA 3SRHA 5C9ZA 3WNKA 1KFLA 1T5AA 4HHLA 2FB3A 2ZZ5A 1W3HA 3Q2DA 1SVDA 4V1YA 2GJXB 3ITTA 2DZWA 2ACUA 2GPTA 5DT5A 3BG5A 4Q4RA 2CBJA 2XG9A 3RMJA 1MW0A 3VMNA 3SUWA 3P6LA 3OW1A 5BOOA 4PMDA 1D8WA 3S5ZA 4W89A 2XH0A 1UKPA 3EPNA 1UYQA 2W6RA 2FTYA 2POZA 2C71A 3NPVA 4ZTYA 1R87A 1TCDA 3DZ1A 4FEZA 3VD5A 1OT1A 4ZCWA 1CPUA 4O0ZA 3RLVA 5HMDA 1LQ2A 1XF0A 4NX5A 1K9DA 1TVNA 1YX1A 1B30A 2R91A 2PGRA 2QCNA 5I79A 4WF7A 8CGTA 4PRTA 3TR9A 4Q4SA 3C6CA 3EWCA 3BOLA 4C5ZA 2Y85A 1TZZA 1TTIA 4HMNA 1AJZA 1JZ4A 5DMNA 2ZXQA 1N7KA 5H8MA 1R3YA 1S5WA 1RH9A 2OZTA 1ECEA 5E09A 2DV0A 1WDPA 4BY3A 1ZBWA 3FLUA 3N18A 2E25A 1THFD 4WGXA 1KR0A 4W85A 4I5UA 2YR1A 4GKLA 3OA5A 1GVFA 1VR6A 3N9RA 2FGLA 2CLIA 3VM7A 1WZMA 3SFKA 4QJ3B 4L9ZA 4LV9A 4Y90A 5IFPA 1YRRA 1I4NA 5AC4A 1JUEA 1KC7A 3QGVA 2CZDA 4DBDA 1RPXA 2GOUA 3R89A 3C2OA 4UR7A 4W8BA 1YE4A 4U3CA 4GJ1A 5HPCA 3GVRA 2NSXA 1O1HA 1E0TA 3UJEA 1CT5A 3GO2A 4MFEA 3THQA 1VF8A 5MKGB 2PP0A 1EBHA 5D37A 3WD3A 4G9PA 3ZT7A 1AQFA 1N8IA 5K7JA 1PHQA 1BWLA 2I1OA 3S42A 3WD2A 3MUCA 3T0CA 1PWMA 1F6PA 2ADAA 4UQBA 4HIBA 4EWJA 4TU1A 3PB0A 2XZ7A 4IG2B 1XRVA 1R47A 4RLIA 4FPSA 1JPMA 4GNVA 2VI0A 3WFZA 3H7VA 1XLFA 2Q71A 1SFJA 5IHRA 1K4GA 1SJDA 2BOGX 4V27A 4NF7A 4Z2IA 4Z1BA 4KS0A 1KCZA 4ROPA 3ITVA 4UB9A 1A5NC 2HE8A 1AQ0A 1O12A 4HGXA 3N11A 3SN1A 3VZZA 3L4TA 2EJAA 1Y65A 4WXYA 3DHDA 4PN2A 4DF2A 1OFQA 1TJPA 4O52A 3AIRA 1S3TC 4PSPA 2Y0FA 1K02A 3BZGA 1VFLA 2X30A 3FFSA 3GNPA 4QAIA 3VD9A 4NAFB 2XZ9A 4MDPA 3LA4A 1WBHA 1G4PA 3BK0A 3LLXA 1TR1A 3SBFA 1SPQA 3COTA 1UQYA 3LQLA 4CCDA 3QF0A 2XFRA 1JCJA 4B91A 4CD5A 2WSKA 1SO6A 3HPZA 2P3ZA 4ERIA 2ONEA 1J6PA 4AVNA 4GYPA 5F2GA 3BSHA 3R13A 1AMKA 2DUZA 1DJXA 4PB5A 1XIJA 2V2CA 1C9WA 1TVLA 3WDQA 1HN1A 1QK2A 4JTRA 1J18A 2XUCA 2YBUA 4HPXA 3GHUA 4PUMA 2NX1A 4TVDA 1IEQA 3OGVA 1C91A 3EPOA 3MMUA 4HNOA 5I3KA 1Y8BA 4BQ4A 4UTJA 1LRQA 1XDJA 3S2JA 1HJVA 3UNTA 1GJUA 1JPIA 1R30A 4KIRA 4FNSA 3GXFA 3MSYA 3BOFA 4PL2A 4F2BA 1CENA 2Z2UA 3E2SA 1JRCA 2OFJA 3E0LA 4GKTA 1UKSA 4PMRA 2X1TA 4CCEA 2DT0A 5HR6A 4ATDA 2I9UA 1BVWA 1H1YA 5FEWA 3NPWA 4LC6A 1VYRA 3M16A 3VGFA 3H7RA 2O9PA 2V3EA 1FCVA 4F2UA 1UHVA 2VGIA 3EKLA 2GJLA 1V6TA 3L7RA 4GX8A 1CI1A 1FWSA 2VX6A 4UOJA 3AROA 1NAL1 1H11A 1FDZA 1XRFA 1E4LA 3OQ8A 1OT2A 5CGQA 4A8RA 1P0EA 5CZKA 4G1NA 3WLOA 4OT7A 2F9RA 4HU4A 3ABRA 1YDVA 1IIGA 1LM1A 3L2IA 2B7PA 3SDOA 1K3UA 3N04A 4DPQA 3HPXA 3SCVA 3W53A 3WLLA 3U2ZA 1TTPA 3WDPP 3B0PA 1XYZA 3LEPA 1CLVA 2A0NA 3OVQA 3BJFA 3R10A 2PSNA 4DRSA 2V68A 3R94A 4HJWA 1QHOA 2HCVA 2ZX6A 3NQBA 4FR1A 5DT7A 2ZZ3A 3MO4A 1DP0A 1HW6A 3P5ZA 2A6LA 1DHKA 2VRJA 1H0IA 4OOZA 1H7NA 1E43A 2JQXA 2PC8A 4TTGA 2XYLA 1DWJM 3CEUA 4YHGA 1G67A 3WD4A 2BB0A 1D9EA 4JFTA 3GFXA 1B9ZA 1KFWA 3NURA 3WEOA 4E8DA 2X2GA 3F7JA 2BP1A 3OZMA 4KGLA 1WZLA 3STPA 4GQGA 1HFBA 1MZRA 1OK6A 3W1NA 5FA5A 3M47A 2VGBA 3REQA 2VZVA 2VURA 1V4YA 2OO6A 4NXSA 1TX0A 1ZBCA 3KOXA 2WC7A 1JFHA 2PU0A 1GOXA 1LRTA 4DO7A 2YL6A 2XFYA 1R0MA 4DZHA 3VKJA 4GPNA 4AISA 4DPPA 4ICMA 3GG7A 1A5AA 4ZSTA 4Q4PA 2GQ9A 1EKOA 2PDIA 4U3AA 3ZJKA 2FH8A 4HMDA 3THAA 1F6KA 4TX6A 3DFPA 1NY1A 3WQOA 3WQFA 1KLYA 3P8JA 1TV3A 1VFTA 1TA3A 1U30A 1UR8A 1VLWA 4HT3A 3QMSA 3W7NA 2I56A 1XYFA 5A95A 3LHUA 2ISWA 5CPMA 3WBXA 1W2PA 1CTNA 2R24A 3CV2A 3DBNA 4GNJA 1JYNA 3CASA 4D8ZA 4L1GA 4I9TA 5TBOA 4BQ5A 2NQ5A 3BGGA 2J4GA 4H8HA 5JBFA 3N3MA 2ALDA 3RHGA 1VFMA 1B3ZA 4GRSA 4LX4A 4RCXA 3U7BA 4IFOA 1W2VA 1LLZA 2YLLA 3HIJA 1J4EA 1V6XA 4ADSA 1LJYA 3WX7A 1OK4A 1CCWB 3ITCA 1NH6A 4GG9A 3V35A 3VUPA 1SFTA 3W6MA 2PD5A 1O5KA 4X61A 3UR2A 9XIMA 2HPIA 1H09A 2W91A 2ACSA 3EOLA 5D03A 3LERA 4Z17A 1OZMA 1CLKA 5HDRA 3A21A 1XDLA 3NEHA 3W6LA 2WNNA 5CJMA 1M9HA 3KL0A 1E9IA 3KHJA 4BFAA 3GE7A 3KZPA 3TNBA 1R3SA 2XFFA 3M43A 3SIZA 4E2VA 4NZ4A 2EAWA 2E77A 3F5JA 1BXBA 4K36A 2EPMX 5CKSA 4B5UA 3GAKA 1S3HA 3SGZA 6XIMA 4YIWA 1FH9A 2GQ3A 4LU0A 1U5HA 3VOCA 3BANA 1EJSC 1EJVC 1E6QM 3MBDA 4ZSUA 3OQEA 4F0MA 3SCQA 3S5SA 3CUJA 8A3HA 1HQTA 4XIAA 3AXKA 3OGRA 2FVKA 1QU4A 5GPRA 3TVAA 4LF2A 3C4UA 3URBA 2EF9A 3GUGA 3GNXA 3T1GA 4HQVA 1DXIA 2YA0A 5LA2A 4LUJA 4H9TA 2YX0A 3GXDA 3HPAA 2YL8A 3LRMA 5KSWA 3WLIA 1FUYA 4AD2A 1VBRA 4PCPA 2ISSA 1GZGA 3OVPA 4JYFA 3VZYA 4DZAA 2I16A 4MAZA 5FEZA 5BRBA 4PCTA 4OHQA 3ZVIA 1GVIA 3MSRA 7TIMA 2D2JA 3CAVA 4RE0A 3WJSA 4H7VA 1OX4B 3QKZA 3N2XA 2Y70A 3URQA 4AY8A 4IL0A 1J2WA 4J3ZA 4LUSB 5AKQA 1GONA 3GRIA 2X2YA 4HN4A 5LNUA 1QCWA 3VIJA 1NDWA 4P7LA 3IJ8A 4UR9A 2OELA 4S23A 4BCEA 2JALA 2IKIA 2PWFA 2JKAA 4AZ6A 5HNUA 2ZUVA 2G41A 4QM1A 4YTTA 3S1GA 4BWLA 4GZJA 3O0KA 1EJUC 4L80A 1G4EA 3FXYA 3VX0A 4K3ZA 1EDGA 4I7WA 2QEZA 4AH7A 5KMYA 3BARA 3B0UX 1ME9A 4ZOBA 3O06A 2AQVA 5I5RA 3USZA 4ZQRA 4HHPA 3GTIA 4NL1A 3DGRA 4JTAA 1FDYA 5U4NA 1C8QA 3IJQA 2OSXA 4C6LA 5DMMA 4YCOA 3B4YA 3QW4B 4E4UA 1XUUA 3I7QA 2WMJA 4I9AA 4L1XA 3AXXA 3DG6A 3VCRA 2FTWA 2WYSA 3RFAA 1B4KA 2BBFA 2WMKA 1SFSA 3WFLA 3TFXA 4CD6A 1JI2A 2Y5SA 3H2OA 4GIEA 1UMLA 1L8NA 2FFCA 4CU7A 4ORIA 4XZHA 3KBWA 1TWDA 1FHUA 1XGDA 3B05A 4PEKA 2J7DA 2Y7EA 3CUXA 1W37A 4UFHA 2ABBA 2X05A 3MHFA 1HF6A 2PF8A 3FJ4A 5FACA 1UH4A 1K9TA 4MHBA 4IXXA 4ASTA 1AZ1A 3NTYA 2I7GA 2QQ6A 3LXCA 4G7FA 4CQAA 3OVGA 5C7HA 1WDWA 3EX6A 4JTCA 1RBLA 1W56A 2VO5A 1GOMA 1R3VA 1DQUA 1UWIA 4MNJA 5DX7A 3UWQA 3HURA 3B9NA 3GTFA 5T91A 1C93A 4CGTA 2E5DA 1DIOA 1Q8AA 4V2XA 4MUZA 3G1DA 4PTDA 4WEVX 4P61A 4NIRA 2QGYA 2QDDA 1QT1A 1Z44A 3T0TA 3BZJA 2W3ZA 4NZ5A 1GW1A 2FTPA 3CL7A 1GVEA 3TN6A 5CBIA 2VFEA 2XIMA 1Q6EA 4KQNA 5I02A 1GORA 2PDHA 2CW6A 3LV6A 1JDFA 5BXRA 3TXVA 3BTNA 4IPIA 3VINA 4WY0F 1E72M 1DPMA 1DWGM 2XU2A 3WL1A 4FSAA 3A4AA 1DIEA 1S2WA 1M7PA 3PJWA 1TKKA 3W75A 2G3JA 4E2DA 4L4LA 4RDZA 2F38A 1ALDA 1TV4A 5K3VA 3CQHA 5DMLA 1DJZA 4NJGA 1SZRA 3UYCA 3OYZA 2W27A 3BOXA 3GIPA 1KB3A 1ISZA 4B90A 4D6GA 3FHAA 3VD3A 3AS1A 2PLJA 1K9FA 4M5PA 4H7ZA 3T78A 2PDFA 1VCVA 2QZRA 3UY8A 1TE1A 3WQCA 4HVXA 5DANA 2A3HA 3FAWA 3TQPA 3LS9A 4MKNA 3WLQA 5C7VA 4D6IA 3GR7A 2NXGA 3AMKA 3KCOA 4GUFA 2GDUA 1F2JA 1W3KA 4QLLA 1P0NA 3TSBA 2CKSA 3TXZA 3QFWA 5A6TC 3UR8A 1A0EA 1F6YA 2YW4A 2EHHA 4F0LA 4W5UA 3ITXA 5EKYA 1OCBA 1KGUA 4QJ1A 4F48A 1GHRA 4R9XA 3VKKA 2YCLA 1XLMA 2VGGA 5AHNA 3C2YA 2GWGA 4RZ6A 2E9BA 1ZP3A 2FJKA 4RV8A 2FYMA 3P62A 5FF2A 4AVOA 3PM6A 4GYJA 3SADA 3ORWA 3U2EA 5AC5A 4H83A 5CC3A 4ML4A 2NUXA 3G8EA 2AAAA 3CGTA 2GVJA 1QHPA 1TUXA 5ECUA 2WC4A 2WLYA 4IGNA 4JFVA 3RITA 3WK3A 1EZWA 4AZBA 4LB3A 3EA3A 4HP5A 1ZZMA 3MVIA 4QE5A 1VAHA 3B9DA 3DCPA 3F4WA 1E4MM 3WN6A 4W93A 1O5RA 2WJFA 3K8LA 2OKOA 3G1XA 1NFBA 2W66A 2ZUTA 1LOQA 4B9YA 4RDWA 5JH2A 1LWHA 2CEQA 3WMCA 3ONCA 1UA7A 4Q22A 4V15A 4MYXA 2R82A 2Y1HA 1HVQA 2X7WA 4KWUA 5JBEA 1G7VA 2YZ5A 1GK8A 1R38A 2YXXA 3WQ5A 3T4CA 3EDDA 1FHVA 3EBVA 5CPOA 2Y24A 2X40A 1OIMA 2GFTA 3U57A 1WCGA 1DJNA 2PWVA 3WK0A 2YPIA 2ZDRA 4J2MA 5KZEA 1S5MA 5LIYX 1W9PA 2W67A 4NRSA 2PS2A 3NQMA 3UXIA 5H8PA 1TFVA 5AYIA 3C2FA 3MC5A 4PTNA 4HNVA 3ME3A 5I7GA 3BWWA 2ZTKA 4N02A 3VFCA 2FHFA 5A6KA 1IYXA 1JUKA 3BPWA 3LZ5A 1PB0A 3S6TA 1W3JA 2XDFA 2H9AB 1E6XM 4QXIA 5HNTA 5EBAA 4X9YA 2NX9A 2VDHA 3H2NA 1J9YA 1WXZA 4CNOA 3G1HA 1EH9A 1UC4A 7XIMA 1WO2A 3IVTA 3TONA 3GS6A 1MI3A 2C0AA 4UFMA 1BYDA 4AZGA 3JUGA 2Y7FA 4MDOA 3MVTA 1UG6A 4O1BA 1GEHA 3K5XA 3WKZA 1NELA 3IRDA 1FHDA 3H22A 2FKPA 2WPGA 3V4BA 1HG3A 3A13A 4MPQA 3W1TA 1WDQA 4HN8A 2CNCA 4P5UA 2MUCA 3QOKA 3W7DA 5I00A 1FTXA 4EF8A 5D32A 2Z7GA 1WX0A 2DZPA 3M6YA 2XH2A 4ZB5A 3CUFA 4C6FA 2Y5JA 3DYPA 2YCLB 4HOZA 2XN0A 5GNXA 5AC6A 2D69A 2QJMA 4AF0A 4GUIA 1SO5A 5CPQA 4LCQA 4ORMA 1QXLA 3G77A 5T26A 5LA0A 3OJGA 4WY0A 2ATSA 2WPBA 4XBKA 2WANA 3GTXA 3I10A 1MQQA 1ZBKA 5CC5A 3B03A 1WA3A 2WVTA 4EOUA 4B5TA 3GXTA 1LROA 1SQ7A 1WKFA 1I60A 1DHPA 3S46A 1IGSA 1LBMA 1ME8A 2QCMA 4Z08A 4D8LA 5A8OA 1E4NA 4KERA 2WWDA 3EKZA 1V3MA 3WF1A 2VT0A 3NGFA 3ZYZA 1VHCA 1BXNA 1AD1A 5TD4A 5AVNA 1W3IA 3RLGA 3W7RA 2XVPA 3A4JA 3WO8A 2O9TA 1IEWA 2AAMA 4NJJA 2HVOA 4AWSA 1PZ0A 1FWHC 2CLPA 4H2HA 3CHCA 3M64A 3TX9A 2Y8KA 1BSIA 3AALA 2BGQA 3MJYA 4O10A 3RX2A 2HNHA 4TOQA 1X1NA 1H61A 3GH7A 1E9ZB 4M6PA 3T0BA 4AWEA 3NA8A 3BICA 4AMAA 1QATA 1POJA 3HGOA 1ZJIA 4TX9A 2E1DA 4KPLA 4CN4A 1F3WA 1XYLA 3IANA 4H00A 1J8VA 3H8AA 4KRZA 1RALA 5HJYA 4BI6A 1VIZA 2B7OA 3OGSA 4HKPA 4JHMA 4XVDA 1PJ9A 4CCZA 1OFAA 3G6MA 3LBOA 4LGXA 3GVGA 7ODCA 1O7AA 2OWCA 1M7OA 3P93A 3K4DA 1BG4A 1BYCA 1TPEA 1IF2A 3VC6A 1FVPA 3S1WA 5CG0A 3L2LA 1VLIA 2ZVRA 4CU8A 3LHTA 1ISWA 4I8YA 4KETA 1EX5A 1SJAA 4A22A 4E0CA 4LRSA 4L64A 2VUNA 3AS3A 1Z42A 4D6JA 4W5ZA 3DESA 3EMCA 1HL2A 1PWLA 5TNVA 1PCWA 3QLLA 2B4GA 5FESA 2Y5EA 3LD5A 2VELA 3VFLA 3M0XA 4XAGA 3VCCA 3ZSTA 4C91A 4K38A 1PHWA 3ZT5A 3XINA 2XHYA 3ARUA 4RW5A 1E3ZA 1S2CA 3RM8A 4LW7A 5I2UA 1NU5A 3A22A 4WKFA 1XSJA 5I0DA 1RCQA 1PBGA 1SZFA 2HS6A 2WVVA 2GGEA 3E2QA 4Y9PA 1J6OA 3UF9A 4ZODA 5KZ6A 3GDTA 5HQMA 3ELFA 4HOXA 2PCEA 4IP7A 1RXOB 3R2GA 4JY8A 1NDYA 2QCDA 4GGHA 1BVZA 3PAOA 3GG1A 3E0IA 1NWUA 4QROA 4F40A 4GVIA 1OYBA 2PZNA 4FX6M 1KRMA 3EA1A 2WMIB 4J2PA 2ZDSA 1TB3A 1A53A 3KWSA 1VPXA 1XCWA 1Q2SA 3P5YA 2QVNA 4QEHA 3E1F1 3FOKA 2J75A 4PB4A 3GG0A 4LAZA 1J5TA 5DELA 3CIVA 6A3HA 2VKZG 4HPJA 2GVYA 2CZFA 2O7QA 3AIBA 3LZ3A 2CPUA 3A5FA 1EA9C 1UBSA 1H51A 4ROQA 2HDJA 1UD5A 4O16A 4QS6A 3RJXA 2P10A 5D2XA 3CLMA 5JUVA 5K9CA 2HPMA 4OBSA 1F07A 3BLLA 3BLFA 4J4KA 3M5YA 2EO7A 1GT8A 3CQKA 3UZJA 4W86A 4KEVA 2XFWA 4CQBA 1QPKA 3BW3A 4F9JA 4A3YA 1S38A 2ZWZA 3GVVA 1WOAA 3DI1A 4EIVA 1DVJA 3TYEA 2O92A 2VFIA 3I3BA 1KFKA 2A1YA 4AHPA 3QV7A 4D6HA 3O8AA 5CBBA 2O9RA 4L5ZA 1LLOA 3QGKC 1AK5A 4DXKA 5CZTA 5I3JA 1W9DM 1UD3A 4GVFA 4JICA 3C2VA 4F0HA 2CLMA 1EJ7L 3V1HA 1KFEA 1SJCA 3WQ8A 3AS2A 3UCCA 4LAOA 2QAFA 4R7WA 3S1VA 3S47A 1TQJA 3G1VA 3FGCA 1HGYA 3UWEA 1EJTC 4BF7A 4RV3A 2CHRA 3RJYA 2W4XA 4LT9A 4AZ5A 3IJ6A 2VZSA 1P7TB 4X0NA 3ZLGA 1UUOA 4JFSA 1J93A 3VKDA 2DU2A 4EAYA 4A8IA 2Y62A 4UTWA 5BZAA 3OA3A 2E6DA 1A5UA 4L4MA 2ZCGA 1HJXA 1L0PA 3P14A 5FKYA 1TJ2A 1ZALA 1R6WA 3NPUA 2NX3A 2PF0A 1ODUA 4Q8OA 1A5BA 2E8ZA 4DUWA 4HB7A 3CZKA 3CK5A 3B8TA 2C0HA 4RNFA 1NQKA 4JTQA 3MV11 3VDBA 2YFNA 4AXKA 2WBGA 3N6HA 3NXFA 4GI4A 1JGMA 4TMCA 1REQA 3DN5A 5JQ9A 1M1BA 4HMEA 4X2PA 1QI4A 3ALFA 4AD1A 1TIMA 4XAZA 1SO4A 4MNMA 4DJDC 3CZLA 3L2MA 1JCMP 5M5DA 3W02A 2Z0IA 3SCNA 1V0LA 3PZQA 4FMVA 4AEOA 3QH2A 1UH2A 3LXAA 4AD4A 3DENA 4U5KA 5A8MA 4REQA 3RAOA 4GCAA 3H4XA 4GVGA 2YDSA 5C8BB 3NDZA 4NILA 4B4FA 1MFUA 2VD9A 1OGBA 5DBTA 1EGVA 3I6TA 2PWUA 3EOOA 4HA1A 3APYA 4S3GA 4YVVA 1TR9A 1J5SA 2VVNA 1H1ZA 1LG2A 1Z8AA 3M0LA 4UOZA 4D8AA 1M03A 2DIKA 4H01A 4KWOA 4R9OA 3KVKA 5A2BA 1R3TA 1OGGA 2V8ZA 3SUVA 2WSQA 1DWFM 4UMBA 3C86A 3G2GA 4A2RA 1D8CA 1A5OC 3VGEA 3LN3A 3QHMA 4C7FA 3WQWA 2XVKA 5A2AA 1YW1A 4ZEPA 7CGTA 3GU9A 5C2GA 5G2IA 1FCQA 4IFKB 3PVFA 4Q8PA 4UTLA 1X7FA 4FF7A 3BJTA 2PGWA 3TCSA 4H9MA 2XISA 2GGHA 2P88A 4EX4A 1H63A 2PUZA 1HP5A 1JDAA 3S83A 3BQ5A 4UTKA 3TJXA 3AXHA 1IT8A 3H53A 1Q65A 5I77A 3HMCA 4KWSA 3CIXA 3N3TA 1OINA 4LB4A 5AYYA 4B16A 4IMEA 1MRQA 4IOTA 1LWJA 4DUOA 3LPPA 1KO0A 1H7XA 3UYIA 3E3HA 3VO0A 2AL2B 1JDEA 4RX0A 1VD6A 3W1QA 4L6HA 3TV8A 3AISA 2H90A 2GJPA 3L5AA 3N4EA 3PN8A 5CSYA 4JX4A 1U5JA 2FMOA 4L56A 1A47A 3KE0A 3PR2A 5A1AA 2G3FA 1EHNA 4E8CA 1C7TA 1W5OA 4XAPA 3AIUA 1AW5A 3T09A 4BK9A 4GI6A 4D6FA 3DAQA 1US0A 3PB2A 2PRLA 3U2CA 3L4YA 1OWQA 1O94A 1VBHA 2PURA 2NVAA 4PMXA 4DEFA 3ITLA 2F7FA 2XIQA 4PCNA 4X9SA 4AHOA 3IIVA 4LCSA 3L65A 3IVUA 3W7MA 3H24A 2VC9A 1Q45A 1M7JA 4PR4A 1GKQA 4WDTA 3HB9A 4MG4A 1K1DA 5FJTA 3ARXA 3R7MA 4P2VA 2ZUUA 1NEYA 2FIQA 4W7WA 3MYOA 4FOJA 2CZEA 3PWIA 1RY8A 4WOZA 4REQB 5FJIA 3S8HA 1UWSA 4HCLA 4J40A 4AU0A 1CXEA 4LC8A 4YN5A 1QNSA 3GDKA 2PE4A 4KRTA 2IXVA 4DHGA 4UTUA 1UR4A 2PTZA 4GQQA 4NNBA 2Z2BA 1H2JA 4MADA 5CPSA 4L9XA 3OBAA 4IH3A 1FBAA 2PEVA 3QR3A 3FKKA 3GDBA 1D3HA 3C5QA 1JD9A 1CB7B 2FH6A 4JTKA 4R3UA 1EO7A 1W91A 2PP1A 1DKWA 1X98A 6REQA 5LIUX 1ZLPA 3UG4A 1FA2A 1ZHAA 1X97A 3P0XA 4GNKB 3R0KA 3T2QA 3W7LA 4HU0A 3IJ9A 4XO7A 2E1WA 4DLFA 1GYLA 5IM51 1P43A 1W1VA 1W1B1 4XK2A 1WAWA 4IQJA 4PCSA 4UZUA 1NOUA 1Q4NX 5D8WA 4H6KA 4PMZA 2FPTA 3TOYA 4H2CA 1BFNA 1Q63A 4C1NA 3BSMA 4JTFA 1AL8A 2ZUMA 2PWHA 3VM5A 3SB0A 3SSJA 2P5NA 1NOFA 1R86A 4LY4A 1XJBA 2I14A 4P7RA 1Q13A 3OIXA 1RUSA 5D33A 4LALA 1C8VA 5GQBA 2OOFA 1TRDA 3AHVA 1RJPA 1X8FA 1QNVA 1I2RA 2YXGA 4NZCA 3ARWA 3LI0A 4GYFA 1G4SA 3DU0A 3D6NA 2JGYA 3T9PA 2ZVIA 3W3OA 2X0HA 4B3ZA 1XYBA 1EBGA 2BOFX 4XG1A 1GYMA 1XG4A 1V3LA 2J7EA 3D3AA 4GXWA 3DFQA 2VJXA 2VX7A 3PZMA 3ICJA 1J0YA 3VCNA 4MLRA 2D3NA 3C52A 3WD1A 1QNQA 4XZ9A 1T7LA 2NSOA 5M3WA 3SRKA 1A0CA 3SZ8A 1PKYA 1UW9A 3KOWA 2Q09A 4QDWA 5E6YA 1W1IE 2GQAA 1W0MA 1BTCA 2GUYA 1CIUA 3PPGA 1OZQA 3V7PA 4D6DA 3NZQA 1VFFA 1FWJC 3HQNA 1HVXA 2PWEA 3LCGA 2WC3A 1XXXA 1AFSA 4DWDA 2ZRYA 3L0GA 3O0FA 5FAJA 4Z2LA 4O50A 5AC8A 4OECA 3MWAA 4OE7A 1QTWA 1B5TA 3H2AA 3CQIA 3T0AA 1XW8A 4PODA 3B0XA 4IX0A 5CLTA 3AMDA 1ESWA 1UWAA 3Q37A 2NLYA 1LQ0A 4GZ7A 1GVOA 5L6UA 1EPXA 1XLAA 3N1AA 4PMNA 1JG9A 3WLHA 4DELA 2AQOA 2UY5A 3C56A 3PJUA 5CZSA 4Z2JA 1VJIA 4WZHA 1WUEA 5I3DA 1XLGA 4Q4OA 4Q7IA 2YCEA 3WLNA 3K2GA 5TF0A 4JN7A 2ASHA 3NXLA 1BF6A 3W76A 1F73A 1GHSA 4PC8A 1OJXA 4QGCA 4XIMA 2ZBTA 1YNYA 4NJHA 3Q58A 3DGBA 3NQAA 3UW6A 2C6QA 3G3DA 5A6JA 4YL2A 3B9OA 3L5MA 1RVKA 3W2MA 3UXLA 2Q3OA 4GYKA 4JS3A 1XLDA 3R6IA 3WBAA 5LIWX 3T42A 1H7PA 2OYMA 4G6CA 1U83A 3QZAA 1K6WA 3G8RA 3QR1A 5GNYA 3WF2A 4JCMA 2E4TA 5D9PA 3R8RA 1R9YA 3GH4A 1ZJAA 4LAMA 2D2OA 4M6QA 1HL9A 3K46A 1WE5A 3ZSSA 2WHLA 2ZFAA 3HV9A 4H9ZA 1FOBA 2VC7A 3TTSA 4AF0B 3BXWA 4GUHA 2HK1A 3CL6A 5HUPA 3EWYA 2CIPA 4KCVA 2WB5A 2DZAA 4HTBA 3SFWA 2OZ8A 3LHYA 1I0BA 3WLMA 3NDOA 1BQGA 3NL3A 4QEEA 2CZ5A 1L2QA 4MWAC 3EWXA 4CQ8A 1QI3A 4G5DA 4IP4A 5E6ZA 1EEPA 4JQ4A 3TYBA 3NSXA 3QOMA 1VP5A 3C2RA 1IXNA 3AZRA 4XBSA 4DZ5A 1M01A 3CUHA 1BD0A 4K8EA 4HYWA 4UFIA 1D7KA 1SUXA 1JAKA 3WCZA 4QJ4B 3EXRA 3DERA 2DW7A 1CWYA 1F4AA 2DIEA 1DJGA 1OG0A 2AKMA 3FEMA 4JTUA 4BI7A 4X63A 1UR9A 1QHZA 1TTJA 1MXDA 5D4YA 4F3HA 1W54A 2QF8A 3SURA 5I07A 1TMQA 4N9BA 4F0KA 2E9LA 3MCMA 1ZL1A 3G1RA 5ABEA 1UD8A 3UU0A 2XIIA 2DGAA 3VOGA 1AZ2A 3VX1A 1PZ2A 3W2LA 2Z1VA 3ABOA 2NVDA 1XL9A 2YDQA 1AUSL 3GM8A 2E6AA 2VFFA 2BMBA 3R11A 1BKHA 1XLIA 4B3LA 3CMGA 3WQ4A 4FXSA 5C2XA 4DM2A 1EJXC 1Q85A 2A85A 1PUDA 2VRQA 3KDNA 1KCLA 4I3GA 5CC7A 2Z2AA 4NZFA 4ZQMA 2P0IA 1VEOA 1Z6KA 1VFOA 2BXYA 4UIOA 2E5BA 1F4HA 1W1YA 4LAKA 3G0UA 3IIZA 4MTVA 3LBMA 2HWGA 1W5PA 1R7AA 3KP0A 4ZOCA 4LXFA 1E51A 1F74A 3PNZA 1KXQA 4GJIA 1D2KA 5J5RA 2PDCA 1O5QA 5LHEA 1FXPA 2Y88A 2Q02A 4IPJA 4M29A 1FY6A 1Y5XA 1Q6LA 1O66A 1W3LA 2V81A 4Q8QA 3ZWSA 1J01A 3OZYA 2A7RA 3U7VA 1WV2A 4QCEA 5HMSA 2Y6ZA 1PX4A 2OTDA 3TC3A 2J74A 3GYEA 1WYIA 3CB8A 4JN8A 1BF2A 3VOFA 1UOKA 4LUTB 2V63A 3O1NA 3OZOA 4RPQA 3TOPA 3E74A 1V7YA 3GXNA 2IPWA 5T9BG 6PTDA 3AHXA 3W29A 3IACA 3WENA 1S39A 1A5CA 3S2LA 3RX3A 4JOMA 4NXKA 4IZGA 4R7OA 3WBWA 1IE7C 3TYZA 1XLKA 1NWRA 2PTDA 1E1FA 3BAJA 3VE9A 1LTDA 3T6CA 1VC4A 5C9WA 4ICNA 3W1AA 3M7WA 2Z00A 3CHVA 3WUFA 2C15A 1H49A 2NT0A 4M56A 4N2YA 5B7ZA 4JEJA 4GY7A 1UP3A 3GU1A 1JCYA 2BASA 4MKSA 4NYYA 1E71M 4S2CA 5HA7A 1MRAA 1UKTA 3TC6A 3R43A 1SSGA 3WNPA 5A69A 4U10A 4JX6A 4F0SA 3BL3A 1GNXA 3TW7A 1QMLA 1W3NA 4AZIA 3O05A 5FSDC 2QJJA 3ARQA 3GLCA 3MZNA 4ZB2A 2E0PA 2EPLX 4OJYA 1OYAA 3LCXA 2VCCA 2WBKA 3G24A 4PZVA 2JIWA 4M81A 1JDCA 3K13A 3A24A 2TPSA 4B2DA 3AWNA 4U4MA 1SFLA 1VENA 3GC2A 3UJSA 4KCWA 4FIRA 5FAGA 1F76A 4AW7A 3UVAA 4QNWA 3SGUA 2ZUNA 3OLEA 2BHZA 1JULA 1DJWA 3GNOA 4DBWA 4PMJA 1GQIA 1GQNA 4TR9A 2JF6A 4GCXA 4M6VA 1MQRA 3V1PA 4FR6A 3JVAA 4LVGA 2HE5A 5J5DA 3F4DA 3FCPA 2WK2A 3FEQA 1EGMA 4XKMA 3WNLA 2PCQA 7REQA 2O9OA 2EPNA 4C1LA 3K30A 2XN2A 5BOFA 1SYTA 3PK7A 2GLKA 3CTLA 2B0MA 1PZ1A 3W1XA 3N9SA 3RPDA 1PSCA 3NQ8A 1OFDA 2YKKA 1CBGA 3H2FA 1W17A 3NZ1A 3UQNA 4PB3A 4LYQA 3HJZA 1DE5A 4NAFA 4LUTA 4MZ8A 3TZNA 2XWDA 1MXGA 3DYOA 5HWJA 1EP2A 2ZOXA 5G1TA 1ZUAX 3GW0A 4CCCA 4NZJA 4F66A 3WD0A 1JCNA 1VB9A 1Z41A 4G7EA 3PZ9A 4HNLA 3NO1A 1GPFA 1GCYA 4DQWA 1FH7A 1MW3A 3R8HA 1ICSA 1PPIA 4CNSA 3NGJA 4TV6A 3IGHX 3EB2A 1H5YA 3DHFA 4JIPA 3AZTA 4KFOA 1WXYA 4U2ZA 5SWUA 3TQ0A 3PP7A 3ZQ9A 4H8NA 3SR7A 1E9LA 3VGDA 3FJ6A 4DJFA 3OP2A 2EG6A 3VIOA 4JTLA 4GO9A 4MWAB 4QRNA 3PFMA 3UGVA 4CUCA 1G9HA 3DH7A 2PI6A 1R8LA 1UASA 4IIGA 4LRTA 4D9PA 3VKAA 3N2TA 1A50A 3ZR5A 1FCUA 4P8XA 1UPPA 1I2OA 1CXHA 1N8FA 2BGSA 4KIEA 3M07A 3WH6A 3L4XA 1QO5A 3KLLA 3EOUA 4WUIA 4FA3A 3IUHA 2VOMA 1V3IA 3LU2A 3WEMA 2BV9A 4ZO9A 3OOQA 4Z0SA 3LUTA 4DO4A 4DIAA 3II1A 2OT1A 3MU7A 1OEPA 5D9NA 3NVTA 2PTWA 3HZ3A 5FI8A 3AZSA 3PUGA 2GOKA 3QPYA 5FF7A 1MW2A 4GOAA 1T8XA 3IJDA 2DY3A 2FB2A 2QW5A 2ZRWA 8TIMA 3SUSA 2F2KA 2E3ZA 2W62A 3SW6A 4BEUA 4DI9A 2TODA 3EPMA 2HXTA 3L4UA 1KQZA 1UWTA 2PDKA 1OC7A 3B8SA 2OGYA 2AMGA 3S4TA 2WQPA 1IEIA 1NIUA 5GJPA 3O63A 1FX6A 1U22A 1YXDA 4MLJA 3VD7A 2PDJA 3QV6A 1M68A 1EUAA 4Y9AA 3BAWA 4ICCX 4EE9A 2CYGA 3GIQA 3N34A 5G4WA 1O1ZA 2DVUA 1FWAC 5G1MA 1QK0A 2PWDA 3MQTA 4IUGA 5FF3A 5BOEA 3WBYA 2DT2A 3PS7A 3AQUA 3ZVHB 2D0HA 1GZ1A 1UKOA 1QUMA 2PGFA 4AYGA 3DFNA 1XGEA 2Z24A 4TVUA 3NO5A 3MHGA 4H6EA 4EP8C 3PG9A 2PDBA 4A8LA 2OWWA 3BDKA 7PTDA 3W84A 4MY9A 4FLSA 1SGJA 3S2NA 3UZXA 3PNUA 4GC4A 4ERAA 5HR7A 2OR2A 3GKFA 4LAUA 2FVLA 5IDIA 1EP1A 2SFPA 5BW6A 4Q8NA 3CC1A 2Q8LA 2VP8A 3RUBL 1W9UA 4GACA 1TWSA 3ANUA 4LBUA 1G7UA 2IPJA 2ZADA 4CEXC 4IJCA 3PSVA 3JW7A 1M41A 1TPB1 4M3PA 3RF9A 3SCRA 1E5JA 1MFVA 2YGYA 3HGJA 3QSTA 3V3WA 1KBBA 3EMQA 1CDGA 3P60A 1WDDA 5E5CA 4GO8A 3STEA 3MWCA 5D2WA 3W2JA 4Q8MA 2QUNA 2GGJA 3B8IA 2A4AA 3HFYA 2JGQA 1JCLA 3KDOA 2PFHA 4EK7A 2G3IA 3PHAA 3S3GA 2RDWA 5DXXA 5REQA 5A94A 1V7AA 3IJ7A 3PPCA 1NP2A 5I23A 3NQEA 2ACQA 1CEOA 2G97A 3MT1A 4JTJA 1BWKA 2YJQA 1R3QA 4RJEA 2GK1A 3MKVA 1X39A 2HTMA 1EPVA 3FJNA 3DI0A 4YWSA 1UUQA 2DJXA 3ABQA 2GJXA 3AIQA 3N2CA 3WY1A 5CSRA 5H8UA 4N9EA 3AU2A 3SIMA 4QQUA 2QJIA 3VOHA 1DIDA 5DY2A 1E56A 3A5VA 1DJHA 3MMWA 3EDEA 2P3EA 2EG7A 1HTIA 1GOWA 4G8TA 2VENA 4TO8A 1O68A 1SMAA 5D09A 1HJQA 1XI3A 3B8UA 3W70A 3WDHA 1Q6FA 1RK6A 4NRRA 2VZOA 3SCSA 1QBAA 3SSZA 2QCFA 3MBFA 3MI2A 2O56A 3QQ0A 3NVDA 3I65A 4YVPA 1A5MC 1DOSA 3EYPA 5D02A 2IQDA 3CUGA 3VKCA 3WK2A 2RHGA 1UZ4A 5G2HA 1OQFA 2FFIA 4IG2A 2FZ9A 3T44A 3W6YA 1KM3A 2CLLA 1XS2A 1BYBA 3AHZA 4MMWA 1GTHA 3LB0A 1SR9A 3VIKA 3QV8A 1VIWA 1Q66A 3BLDA 2DQWA 1IEXA 2HRWA 5DCEA 3V0SA 4M80A 4C5YA 1H1NA 3TMQA 2YCKX 1A3HA 3FX4A 1HJSA 3WLTA 1OABA 2CLKA 2G4FA 3C8FA 3U8GA 5ABHA 4JDYA 1FWIC 2GGGA 4KEUA 2C8NA 3A6OA 1Q7QA 3P8IA 3W7IA 4ZVJA 4ZO6A 1ONXA 3KTSA 1F61A 4XVEA 3HG5A 4Y96A 4PUEA 3NQFA 3SY1A 3TTQA 5HPOA 4H9UA 3P84A 2OEKA 3DFSA 1DIKA 4UMCA 3PZUA 2NV2A 4LWWA 4JX5A 3TMLA 3GG8A 4QX4A 1HO1A 5AHLA 4A6GA 3BVJA 4E3TA 3HJEA 2OU4A 1KV5A 3M0JA 2IMRA 3PZTA 2PTYA 5D38A 2PP3A 2J79A 1W1A1 3IARA 3UWYA 3LBCA 3VA8A 3ONBA 2X0SA 3DHUA 1E1CB 1J96A 4ERGA 4QDPA 3H26A 3W37A 4MB4A 3VZXA 4XKYA 1IT7A 3VILA 2OG9A 3XISA 2WV8A 3B8DA 5DRIA 1VFHA 5FJUA 3AXIA 1TUFA 1XSIA 3KBNA 1B2YA 3SECA 3IK4A 4F79A 1NOWA 4X3ZA 5MF5A 3UT0A 4IT1A 3ZLFA 4K7VA 2A3CA 3BC9A 3E38A 2KAUC 1JZ3A 4MWAA 1AQHA 4GFIA 2QNEA 1TZ7A 5E9AA 3V5OA 2HQAA 4XO6A 3W23A 1ZQ5A 4ZTXA 4XD3A 4DO6A 1H0GA 2J7HA 3CZJA 3UCQA 3WF0A 6XIAA 2ZZ7A 4XB3A 2BXVA 1TIWA 4GI8A 4GA8A 4LYRA 1CGTA 4RZBA 3KTXA 1WAUA 4JTDA 4D6CA 4YTRA 4FX7A 1P1MA 1FH8A 1GOKA 4INFA 2ZICA 1E1CA 5BXTA 4H6RA 4I90A 2PGEA 5KITA 5K9XA 3FN9A 3FS2A 2BY1A 3VNJA 4WHBA 1O5XA 3FNDA 1JPHA 5XIMA 3RG6A 4C6KA 2HZGA 4OWGA 1OFBA 3TN3A 4JKLA 1M65A 1UBPC 4GHRA 1AD4A 4C6QA 4QAWA 5M1TA 3TW6A 5BRQA 2V82A 1FWBC 4R5EA 4Z1YA 3GD6A 2OQYA 3FGCB 1QI5A 3AIEA 2E28A 1R85A 3HG2A 3STFA 5CZJA 3W72A 3RIKA 5A6MA 3EWZA 3RM4A 2FZDA 2C7FA 1K9EA 1ZS2A 3RK8A 1FRBA 1XLLA 4QBXA 4G56A 1OCNA 1EFZA 1OF6A 3KP1A 4G2DA 4ZMGA 4MZYA 1YXYA 3I3DA 3ZZ1A 5D04C 3UJRA 5CPTA 2YL9A 1JZ2A 5G4HC 4JIHA 1Q6GA 2BWGA 3SRFA 3QFEA 2XVLA 3I7SA 2RJHA 1B9BA 4KF1A 4I8DA 3AI0A 1IXOA 4D1JA 4AC1X 4AY1A 3V75A 4R27A 3PTQA 1EQPA 3LMYA 3PBYA 3IEBA 4IWWA 1RJRA 2W61A 3NFUA 4S3KA 1U2YA 1KRAC 3TTOA 4QS5A 3IRSA 3MY9A 4FNRA 4UTMA 1L6GA 4BKNA 4JNYA 4LY8A 3GH5A 3N13A 3TIMA 2L5HA 3WH9A 4O54A 3BUVA 2PTXA 3V18A 4HK6A 1IWBA 5CAHA 1PKMA 2FVMA 3W24A 1T96A 4DF0A 2ALRA 3UERA 1HP4A 2E40A 1QRQA 4OV9A 3APTA 1TJRA 1E0UA 3NEVA 5PTDA 3GK0A 3TFCA 3A3XA 2J7BA 4J5NA 2GZXA 4F2TA 1V3HA 2BDQA 5D2TA 1JUBA 1NWSA 4J7RA 1TPUA 1K7XA 4A29A 3W2UA 4BF9A 1GOOA 5AC7A 3H2CA 5E0FA 2F6UA 1E55A 1KCXA 3H55A 9CGTA 2VMFA 3M0ZA 3W7QA 4O1AA 4TUFA 5JH1A 3B06A 1XBVA 5L9FA 3CJPA 2OQHA 2Y89A 3DX5A 1JZ8A 4HCHA 3TN4A 2ZX8A 2YA1A 3UD6A 1TVPA 4LVDA 3T2PA 1C8YA 5C0QA 1ZAHA 3SY5A 1NARA 1QR7A 1Z69A 3VIGA 1LBLA 1EEXA 3UESA 1BGAA 3EX1A 3L4VA 2KZHA 5DCDA 3DFOA 3VU2A 1Z7AA 3NNTA 3B04A 3WDIA 1S5NA 4DYKA 4HZMA 5AFDA 3Q4DA 1PIFA 4EF9A 2OXNA 4W7VA 3O7UA 3EOEA 2B81A 1XIHA 5HMFA 5ABFA 3EWBX 1OFEA 3LOTA 4OUIA 1ZAIA 3A12A 5HXMA 3QMRA 3LDVA 2YB4A 3WNMA 1FWRA 2Z1SA 1KD0A 4WKHA 1PDYA 1V51A 3MJMA 2R14A 4NT0A 3VC5A 4MGGA 1T40A 4IQEA 2QDGA 3MPGA 1J12A 4V1XA 1OM0A 4FX8A 3LG3A 3M0MA 3NQ2A 2O4MA 1W8GA 3MDUA 4BZYA 3VOJA 1W9BM 2KX9A 5KZDA 1MUMA 1VCGA 3CUIA 2WHJA 2Z7KA 4UTWC 4YJ5A 1GVYA 3E0FA 1BEUA 5AB3A 3T05A 4C6EA 1QDSA 1OC5A 2F6KA 2BY2A 1Q6QA 4U5IA 3IPWA 1ZU8A 5GNZA 3MI3A 5DFAA 3QW3A 3GVQA 3W4RA 4YVXA 4V28A 1EQCA 2DT3A 2WJDA 1TG7A 2GVEA 3VNKA 3CM4A 3ZS4A 2Q01A 4NUWA 3N4AA 1RQHA 3T8LA 4CLMA 4L65A 2D0GA 2QCEA 2OYKA 4QCFA 1I75A 2ZC1A 3VDGA 4DJEC 1ELSA 2VR4A 3TSDA 5FEXA 1TPWA 3TTYA 4N6FA 3AHYA 4RE3A 1E0XA 1S2TA 3W01A 4GABA 3T2OA 2E9MA 3LHVA 1VRXA 1JNEA 4UNLA 2I5IA 4KWVA 4URIA 1F3EA 4EACA 5CPLA 3SEPA 4D1IA 4GD0A 3EWWA 2VR5A 4NY2A 3UA4A 1P0DA 3BAIA 3GFZA 5LHFA 4CVWA 1KTBA 2R1LA 3BAYA 2Y7DA 5AOUA 2NUWA 1RD6A 5DBUA 4HZ6A 5BWFA 3A23A 5I6SA 1RAKA 5IHSA 3D5HA 4HNNA 3C8NA 2E7FA 5DQPA 3DC0A 3T7VA 2B31A 1WDSA 1Q6OA 3CXOA 2FZMA 2A21A 4OIFA 4GQRA 2CITA 3NSMA 3UR5A 3LLDA 3JRKA 2QIIA 4W88A 1GQLA 4MB5A 1XWYA 4FO4A 3URAA 4DBUA 1KR1A 5F7UA 1XIBA 4S3CA 3AU6A 1KCKA 4PMVA 1IIHA 3AMGA 3ZOAA 3VE7A 1RBAA 4Q7BA 4GJJA 3OIHA 2ODOA 1E73M 3N73A 2IW0A 4K68A 3VD4A 2Z1WA 1CGWA 4DX3A 3RR4A 3S6OA 1TV7A 3T40A 1HT6A 3P74A 1UR3M 3MO7A 3DHPA 2TRSA 5HATA 3ZVHA 5DO8A 1ADSA 5CGMA 3S2MA 5B7YA 5D30A 4BJHA 4AEFA 1JR1A 3LM7A 3ATZA 5F1UA 4GE8A 1BPLB 3N4FA 2QIWA 3R4IA 2ZRXA 5E9XA 4ES4A 1R5YA 1UH3A 1GG0A 3KVMA 4E38A 4Y2WA 1QI2A 4WD0A 2OX1A 3KZSA 1XSKA 3CHEA 3H7UA 3L67A 3TA9A 4KEZA 3GDRA 3ENLA 1US3A 3PUDA 5CJ5A 2FPVA 3AO0A 4LVAA 1GZJA 1PS9A 4GGBA 3NPXA 4ACZB 5K9DA 3PTMA 5BMXA 3AUJA 1PKNA 4UTIA 4JN6A 3QTPA 2IPGA 3CLWA 1MYRA 1YMYA 1FWFC 3L68A 2J9ZA 4DNMA 2WSPA 1T8QA 4JR5A 4XKYB 3W0KA 3WQDA 3EKGA 4HPNA 3QRHA 3A3HA 4E2BA 3MMDA 3KAOA 3C61A 3UZYA 1ZENA 3M5XA 1TWZA 5EB8A 2PDNA 3SCPA 2DZUA 1XPGA 4JQAA 3F4VA 2QAPA 4UQDA 1NM9A 4KESA 1YTKA 4MF4A 3GC4A 4IJRA 2Z6IA 4PMUA 2GVLA 3GWQA 3EWDA 1EDQA 4FNQA 5A6SA 4R88A 2V5CA 4H8UA 2VHLA 4BHYA 4IM4A 2DSWA 1B3VA 1LOLA 3M41A 4NI3A 2H8XA 4AD0A 4Y8FA 2H3BA 4CN6A 4PMYA 4FI4A 2CHNA 1PZ3A 1V0KA 1SR0A 4YCPA 4Q8UA 4U33A 4B5NA 4NHVA 4Y6GA 1OADA 2VDGA 1EIXA 2EG8A 4C7DA 4OBTA 2CETA 2EJ1A 2X8RA 4PMQA 3I4EA 3QV9A 2VC6A 2ABAA 3WG6A 3SQLA 3CT7A 1Q5MA 3U5YA 4YYCA 1KKOA 1JF6A 3RPTA 2YCIX 1FWEC 3RU6A 1R9ZA 1FKWA 3NJ3A 3OG2A 1QASA 3N17A 1V6VA 3LY0A 2WO5A 4N42A 3C0LA 4RXGA 1ISYA 2G37A 1K8CA 2BY3A 4DYJA 2IS7A 5J04A 1YADA 2BHUA 3TTEA 3W1UA 1RPKA 3IGXA 1XRTA 3NYZA 2Y8VA 4WXZA 1X6LA 3QJAA 1B3XA 1XIMA 2CLOA 2QT3A 4Y9OA 3E02A 1TJ0A 1WZKA 4S3BA 4QP0A 5I3FA 4GIRA 3KCJA 1SSDA 2DPEA 3GHRA 4IGMA 4FP1A 3A9IA 1YDNA 1D3CA 3FKRA 1QWKA 2PB1A 4KKXA 1K8YA 2WM1A 1E6RA 1M3UA 1K6AA 4YTQA 1IZJA 5JU6A 1DORA 1MO0A 1KM5A 1XD0A 3W85A 4LNYA 2J6VA 3AYVA 2GUBA 1CGYA 4WDUA 1IGWA 3V5CA 4O0KA 1IXPA 4H8VA 2I5QA 5B80A 5ABGA 3SGGA 4RUBA 2ZRUA 3LGDA 3M0KA 3GTHA 2LLEA 2QDEA 4QG8A 3L23A 1B3OA 4FB7A 3H70A 4IJBA 2INFA 3SRDA 4F8XA 3AICA 5FL0A 2D2GA 1YE6A 2ZZ6A 2NUYA 4YHEA 3AFBA 2WKJA 3GHTA 4JNZA 4MUPA 1VBUA 3BAKA 4UTHA 2EGZA 3OYXA 1OFOA 1O6IA 1A5SA 3N9KA 3KCLA 4D71A 2BVWA 5AYBA 5C71A 2J47A 4NX0A 3MANA 1A0DA 5TQLA 1DE6A 2NV1A 3K1DA 4Z1CA 5AZ0A 1ONWA 2J62A 3BG9A 3NR0A 3Q94A 2QUMA 2VEFA 1ONEA 4Q3MA 4NNAA 3SO7A 1B90A 3IV8A 2O4QA 4FF5A 4DJFD 4OBRA 4QG6A 3VK5A 2R1NA 1CGXA 1RCOB 1S2UA 4HSNA 1VJZA 1JPDX 3MTWA 4H9XA 3W1RA 3HOJA 2DSVA 4H19A 4HNUA 3P61A 4HBKA 1OBAA 3AYTA 1CXFA 4MNKA 4GIYA 2PU1A 2ZA2A 3G0XA 3FJLA 4S3JA 4BWLC 4Z2HA 4ILSA 5CCZA 4AZCB 4RL3A 3UPBA 1KRCC 2J8GA 1NP0A 2TAAA 1J79A 1VS1A 3RGTA 1QNPA 3BE7A 4WSHA 1X96A 4RW3A 2WKGA 3PPHA 2PC4A 4O19A 3E12A 1J10A 1QAPA 3G1SA 1VCFA 5AHEA 5ENLA 1W31A 2Y2WA 3ARYA 3TWBA 1Z48A 5C2CA 3TYCA 5EMKA 1JI1A 3VMPA 3VUSA 2CBIA 4DWSC 1XIGA 3PBVA 5LKYA 3N2BA 4MKVA 1JZ5A 7TAAA 1WB0A 4Z1DA 1RVGA 3O07A 2ZRZA 2OJPA 5J8LA 1UOZA 3B8VA 3W1PA 5CPNA 1EXBA 4CNUA 3LPOA 5I09A 1XYMA 3IV3A 2EPOA 4M1RA 4M7TA 2PD9A 2F8QA 4AY7A 4RZ5A 1SW0A 2MNRA 1GVQA 1BVNP 2ZX9A 2QPXA 4MB1A 4O18A 2RDXA 9RUBA 3UWZA 1CB2A 5BXPA 4R85A 5A3HA 3U4FA 4NQ1A 4AIBA 1CECA 3WNNA 4KBXA 4WRHA 4JIEA 4WR3A 1EYWA 4NYUA 2RAGA 4XUYA 3P82A 3MUAA 2GUUA 3AYSA 3W2KA 3DG3A 1EJRC 1OB0A 3N29A 4WGHA 1BRLB 1WP6A 1N82A 1WDRA 3B9AA 4HTYA 2EPKX 2V2HA 1LQAA 2P8CA 5KETA 3CAQA 4QITA 1NJJA 2G5WA 1P7TA 4HYVA 1TZ9A 2IKHA 4G7EB 4GIAA 1DWIM 3MP5A 2J8FA 1V02A 5AY7A 5HMEA 4LF1A 4PTVA 2INEA 2ZTJA 1CGUA 4MNLA 2X1UA 2O0TA 3WYZA 3QQ1A 3LMZA 2VRKA 3CPUA 4QE4A 5LA1A 3TYUA 3UNDA 3S2CA 1SJBA 1WKEA 1Q6DA 4LSBA 1KXTA 2PLMA 1B1YA 3STGA 1WXJA 1K70A 1HIZA 1OFRA 3MA8A 1OHLA 3RO8A 3T8QA 4S39A 2TYSA 4Z1AA 1JXKA 1XRSA 4WVXA 3NZGA 3O15A 1VJSA 5GVJA 3DUGA 1JQXA 4WSJA 1E6ZA 5T8GA 2NWSA 1EGZA 4UOQA 3GC5A 2QXWA 3RCMA 1YLVA 1VH7A 2YB1A 4ZA0A 2NQZA 2Y4SA 5HNNA 1MSSA 2OLHA 4AD3A 4LBSA 5EYWA 1PKLA 1TE6A 2BZNA 3EX3A 2AGTA 2ZYFA 3NL5A 1GW9A 1VEPA 1V0NA 1J0HA 2P76A 3AMCA 4LPCA 2Z28A 4P8UA 4HOWA 2WZHA 3CU2A 3CBWA 1EC7A 1NDVA 5EBUA 3THCA 4LNCA 1M6JA 2QCHA 2HISA 3ZR6A 2A5HA 4B5WA 1H7OA 2D22A 1TJ1A 2IQ0A 3FW6A 1E0VA 4KFNA 3M0HA 1QW8A 2UY2A 4GVHA 2UV8G 3ARRA 3MYPA 4XD6A 5D9MA 4J3TA 4WDXA 3EDFA 4FXFA 4MJ4A 4XSMA 2BY0A 3FA3A 4ML9A 1LZOA 3CIWA 3FYPA 3CS2A 4FOUA 4WJ8A 2A3EA 4MZ1A 5REQB 2A79A 4PE8A 1XBZA 3IUDA 1J11A 1NF0A 4FLQA 2EQDA 3GNRA 3CB3A 3VTRA 2WAGA 4NU7A 1VKFA 1MW1A 2DW6A 2GQ8A 3W7EA 2CKRA 4Q32A 2D1ZA 2NT1A 5D2VA 3K1GA 3NQVA 2FJUB 1T99A 1V79A 2BHYA 4K37A 1TO3A 4H4IA 3BO9A 3VNZA 2RGMA 1NVMA 3EOSA 5TIMA 3QY8A 1LORA 5BMWA 2D2HA 3N6JA 1DWHM 1EO5A 1OSEA 3BMXA 3KBMA 3M5ZA 1KM6A 2VFHA 3R0UA 3OBEA 4MYAA 1SO3A 8XIMA 3WELA 1GG1A 2JEQA 3ANVA 4EPBC 3TYAA 4B2DD 2YBVA 4A35A 3NQDA 2DZSA 1F3TA 5DCBA 3WEZA 2F61A 4EXQA 3HF3A 3HG4A 3CO8A 1DEDA 3EEGA 3O9NA 3U6WA 1A3WA 4IQDA 1MDRA 4OZOA 3W74A 3B3DA 1YHTA 2AKZA 5JVLA 2XGZA 4WIWA 3FXGA 3HMJG 1XLEA 1QNOA 1XQLA 1ZY9A 3ITGA 3SJ3A 1LT7A 1L6SA 1E5NA 1GKRA 4UNIA 1QOXA 2YCJA 1EYEA 1I9CB 3JR2A 5DEZA 3KBVA 2XGIA 4JAWA 2BX7A 1RLDA 1EIBA 1DL3A 2XH7A 2V3GA 5F2IA 3IIPA 1EL3A 3HU7A 3GU2A 3PULA 3LM3A 3E96A 4ZXLA 5M03A 1J0JA 4UR8A 2BVDA 4N7QA 1F8MA 1G6CA 1I2NA 2DSZA 3P2VA 4GQBA 3RDKA 2YFOA 1OYCA 3NG3A</