3NURA

Crystal structure of a putative amidohydrolase from staphylococcus aureus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
305
Chain Sequence
MKSITFEEHYVIEDIQKETNADELSHHDERIQFMNNQDVQIQVLSYGNGSPSNLVGQKAIELCQKANDQLANYIAQYPNRFVGFATLPINEPEAAAREFERCINDLGFKGALIMGRAQDGFLDQDKYDIIFKTAENLDVPIYLHPAPVNSDIYQSYYKGNYPEVTAATFACFGYGWHIDVGIHAIHLVLSGIFDRYPKLNMIIGHWGEFIPFFLERMDEALFAEHLNHSVSYYFKNSFYITPSGMLTKPQFDLVKKEVGIDRILYAADYPYIEPEKLGVFLDELGLTDEEKEKISYTNGAKLLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative amidohydrolase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Amidohydrolase
total genus 111
structure length 305
sequence length 332
ec nomenclature ec 3.5.1.-:
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3nurA00
2D2HA 4G2DA 1EZ2A 4R7WA 4C6PA 1KRCC 2AQVA 4LCQA 2AQOA 1KRAC 3T8LA 4DLFA 2YXOA 2PUZA 4OFCA 3QY8A 2UZ9A 3OOQA 3TNBA 4PCPA 1K1DA 2PLMA 2YB4A 3TN6A 2Q09A 3B0XA 1GKQA 1A5MC 4KEZA 4CNTA 3RCMA 3S4TA 3QY6A 3E2VA 4DLMA 3LS9A 4P5UA 4B92A 4KEVA 1RJPA 2XIOA 3CJPA 2I9UA 3QGAC 4EPKA 3OU8A 3BE7A 1J5SA 4C6KA 3IPWA 1V79A 4IGMA 4H9UA 4C6NA 3WYZA 2WM1A 3IJ6A 4HK7A 1YBQA 4DZIA 3ISIX 2GSEA 2Z2BA 1E9ZB 2Z24A 1FWCC 3K5XA 4F0LA 4LAOA 4R85A 2RAGA 4GY0A 3OJGA 3TN4A 2HNHA 4EPBC 3FDKA 1RJRA 3GTHA 2ICSA 2WJFA 4DI8A 4EPDC 3RN6A 4XD3A 2Z2AA 1RK6A 3LU2A 1V7AA 2VM8A 4H01A 4GY7A 4B90A 2BB0A 3URNA 4XAYA 1UIOA 1KRBC 2ZC1A 2YB1A 4LCSA 1M65A 1XRFA 4HJWA 4ZSUA 1W1IE 1POKA 2VHLA 4IFKB 1RA5A 2VUNA 5G4HC 3OQEA 5A6TC 2GWNA 2P53A 1YRRA 3MSRA 3LSCA 3AU6A 3GTFA 3PNZA 3DUGA 4AC7C 4NG3A 1PO9A 2KAUC 5CH9A 1R9XA 3B40A 4H9TA 3C86A 3FDGA 3RYSA 1XRTA 3AUOA 4RDWA 4PE8A 4MUPA 1PSCA 4GBDA 1P1MA 2Z26A 1EF2A 1PTAA 3O7UA 3TN3A 4RDYA 3DCPA 2W9MA 4B91A 2OGJA 3PAOA 2PAJA 3GTIA 3F2CA 2VC5A 4H00A 4C6DA 4GC3A 2Z25A 3GIQA 3NQBA 4KEUA 4XAFA 1WXYA 1JGMA 4GYFA 5HMFA 2Z7GA 4DYKA 4KETA 2VC7A 2HPMA 4H9VA 1NDYA 2OB3A 1QW7A 3LNPA 2ANUA 4DIAA 1EJSC 2OOFA 4RZBA 4WVXA 4GX8A 3EWDA 4IFRA 3MVTA 4D8LA 4RDVA 4HA0A 4V1XA 3F4DA 4C6BA 1A4LA 2R1KA 2VR2A 3O0FA 1VFLA 4L9XA 3MKVA 1YMYA 3A4JA 2Z28A 3IARA 4EPEC 4BKNA 2EG7A 4H9YA 4CNUA 1UIPA 2FVMA 3KM8A 4F0RA 1NDVA 2D2JA 2DVTA 4WGXA 2R1LA 4NI8A 3GU1A 3MVIA 4C6CA 1XWYA 4RE0A 3IGHX 1EJXC 4M51A 1V77A 1P6BA 1ADDA 2R1MA 1FWFC 4CQDA 4WHBA 2GZXA 4QS6A 3UF9A 4J2MA 1POJA 4DI9A 3URBA 3F4CA 2FTYA 3WMLA 4BJHA 1EYWA 3F2BA 4GK8A 1NFGA 3QGKC 3URAA 1HZYA 1FWHC 4LAMA 1A5LC 1RK5A 4KQNA 1I0DA 2HBVA 3SO7A 1RJQA 4C6JA 1GKRA 2QPXA 4F0SA 3HTWA 4G7EB 4KF1A 1K70A 4C6QA 4C6IA 4B3ZA 4LH8A 1IE7C 4DNMA 3G77A 3T1GA 4H9MA 1EJWC 3AU2A 1I0BA 4LFYA 4QS5A 1FWJC 4YIWA 2DVXA 4PCNA 2EG6A 4GOAA 4HK5A 3WZ0E 4LALA 1NDZA 4LCRA 3S2MA 3GRIA 5HMEA 1QXLA 1FWIC 4CEXC 1K6WA 4IQJA 4GZ7A 4C6FA 2Z00A 4KERA 3S2NA 4KIRA 4ZSTA 3RHGA 1ITQA 3JZEA 2GWGA 1P6CA 4PBEA 4QRNA 3N2CA 2R1PA 2Z4GA 2HBXA 3PBMA 2WJEA 3MJMA 3QY7A 4ERGA 1UBPC 1NDWA 1RAKA 2QT3A 1FKWA 5E5CA 2FFIA 2QVNA 2O4QA 3K2GA 4R88A 2G3FA 4J5NA 3F2DA 4QSFA 1FWBC 4JOMA 4IFKA 3UR5A 2CZVA 2R1NA 3OODA 3IRSA 4GY1A 2FVKA 4I6KA 3URQA 4DO7A 3ICJA 4ERIA 3E3HA 4RDZA 4IH3A 1FWDC 1J6OA 3ID7A 1PB0A 3E74A 4C6EA 3IV8A 4ICMA 4XD5A 3D6NA 1FWGC 3TN5A 4UBPC 1RA0A 2OQLA 1A4MA 2P50A 4IG2A 4E3TA 4XD6A 1A5NC 1ONWA 1KRMA 3PANA 2IMRA 1EJUC 1J79A 4XAZA 4IF2A 3CAKA 3B0YA 2WJDA 3GUWA 3A3XA 4LEFA 4PBFA 1ONXA 1GKPA 1E9YB 4ERAA 4IGNA 3PNUA 1R9ZA 1FKXA 1YBQB 2Z29A 3GU2A 4C5ZA 4C60A 4BY3A 3K4WA 4C6MA 2EG8A 2YZ5A 1M68A 4DZHA 5LXXA 3UBPC 2OODA 4HK6A 3GU9A 2F6KA 2E1WA 4C65A 5FSDC 2PGFA 4CQCA 3LGGA 3NEHA 3HM7A 1S3TC 3E38A 3MDUA 4UB9A 1YNYA 3NURA 3IACA 4I6VA 1EJRC 3LSBA 3OVGA 1EJVC 4XAGA 4J35A 4GXWA 1KCXA 4QROA 1DPMA 3EWCA 1ITUA 4INFA 4C6OA 1FWEC 4CEUC 1XGEA 2I5GA 3MPGA 4EP8C 5FSEC 4CNSA 2BGNE 3LGDA 4C6LA 3CS2A 2GOKA 4QTGA 2E25A 1V4YA 4C5YA 1UMLA 3UPMA 4AQLA 1ZZMA 1O12A 2D2GA 3HPAA 2O4MA 4CQBA 2A3LA 1R9YA 3V7PA 3LA4A 4V1YA 2Y1HA 2UBPC 3MTWA 4XD4A 4NP7A 4IG2B 2Z27A 2PGRA 4GX9A 4Z42C 3ITCA 3A3WA 4KESA 1WXZA 1EJTC 2Q01A 4LANA 4G7EA 3GIPA 4L6DA 1A5KC 3DC8A 4H9ZA 2QS8A 3SFWA 1YIXA 4H9XA 1A5OC 3MDWA 1O5RA 3S2JA 3EGJA 4LAKA 2FTWA 1M7JA 4TQTA 5HMDA 3T81A 3GTXA 2HQAA 5AKQA 2ADAA 1V51A 2AMXA 3LY0A 1FWAC 3E0LA 4IFOA 3UR2A 1BF6A 1J6PA 3GG7A 3FEQA 3S2LA 2HPIA 3E0FA 3R0DA 3ORWA 2DVUA
chains in the Genus database with same CATH superfamily
4C6PA 1DIEA 4LCQA 3ZOAA 1S2UA 1KRAC 3HFTA 2QPSA 1V6WA 2PUZA 4N0RA 2XVLA 3QMRA 1VYRA 4Q4MA 1ZALA 2R24A 2YB4A 2AKMA 3P62A 4IHCA 4ZO8A 4E4UA 4JY8A 2HCVA 4C91A 2AL2A 2ZUMA 1RBLA 1EX5A 2TYSA 2XZ7A 1EP2A 4F48A 4JD4A 3G22A 4WEVX 1CI1A 5MHBA 4I5UA 4HCDA 3W4RA 5GJMA 4U5IA 3B8IA 2J27A 1TWDA 1MNZA 2PZ0A 3QTPA 1W17A 4DZIA 4HYRA 5CSYA 3UD6A 4ROQA 3T40A 3M0MA 4LF1A 1LM1A 3ANUA 2F6UA 3ZLFA 4YTRA 2J7HA 1AW5A 4PTNA 4REQB 4L65A 1X1OA 3GG0A 3VUSA 3H2CA 3DG3A 3W7EA 2EEXA 3QV6A 3KLLA 4HN8A 1LBMA 1JZ8A 2VZUA 3PJUA 1MYRA 2GGEA 2PWUA 1A0CA 5DFAA 3B0VC 4M81A 4AX6A 2WKLA 3NPUA 4Q32A 3MANA 3TFCA 2WM0A 3V0TA 3ANYA 2Y4SA 3S47A 5LNSA 2FPYA 3WBAA 1JCXA 1LDCA 1XRFA 3W7NA 1EA0A 2PDQA 4ZSUA 1BSLA 3ARYA 2PRHA 3C2VA 2EJAA 3HIJA 4CVUA 2Z6JA 3T2QA 1IQ8A 2F61A 1T41A 4IPIA 4DELA 4DJFC 2KAUC 3M43A 1VIWA 4KFNA 5E1QA 3RIKA 4MUPA 1O5XA 2BHUA 3MV01 3TLQA 3HMCA 4DXXA 2BMBA 1W3KA 1XH1A 5HNTA 1AW2A 7ODCA 5C5YA 1A50A 3RK8A 1L6FA 3V75A 3OBKA 3L68A 4HOZA 3V35A 3A5FA 1RBAA 4XAFA 4DY1A 3BLIA 5DRIA 3OVQA 3P6LA 4EWJA 1VCFA 2XVGA 2OX4A 3AAMA 3SJNA 3BVJA 3WQFA 3M0VA 4ZFMA 1K02A 4N9DA 1EXBA 2X30A 3TTQA 1JDDA 5JH1A 5CPMA 1OCJA 1FP9A 2FHCA 5BXRA 3NVDA 2R1KA 4FPSA 4TVDA 4YCPA 3MKVA 1LJYA 2I56A 2EG7A 2D0HA 1DHPA 4OTKA 3LZ5A 5FA5A 4MNLA 5CSSA 3AIEA 4TU1A 1BD0A 4FI4A 3H4XA 3SBFA 7CGTA 3U57A 3G5EA 4HJFA 2GZXA 3PPGA 3B9AA 3UG3A 2OQYA 1MSSA 3L0NA 1QW9A 3VOFA 3W86A 4M8UA 2GSJA 2Z1BA 3WENA 1R3QA 3DHPA 5CC5A 3ZT7A 4AEFA 2CXGA 4DNMA 1Z41A 3LCGA 2J88A 1FCUA 4NHVA 1I45A 1AD1A 3HBLA 4O1BA 4TMBA 4GBUA 4B16A 4O19A 3I3BA 4PL2A 4RX0A 4HU0A 1NDZA 5HMEA 3GDBA 3HJZA 2A3AA 3BICA 1VJIA 5AC4A 4X61A 3LCIA 1IR2A 4HSHA 3VGGA 2ZE3A 1RD5A 1S3HA 3CTTA 3WDPP 3T0CA 5CPNA 1FTXA 1I1XA 1SPQA 3KCLA 4YYFA 5D8WA 1R87A 3ZXWA 2QT3A 4PMOA 3IGSA 1W1VA 2GUYA 2PODA 2O4QA 4UR9A 1QI2A 2GQ3A 4PUWA 2A4AA 3M4HA 4JOMA 4K1GA 3IRSA 4CQ9A 3CZGA 5CLTA 3VD9A 5BMWA 4DBEA 1B3WA 5LZLA 3A24A 1W9PA 3N11A 4DO7A 3KVLA 4I90A 5KINA 1BYCA 4K8HA 3S42A 1FWGC 3BGGA 1J2WA 3KOFA 2J77A 1ZAHA 3GFXA 4UQCA 2WYSA 3RPTA 1UB3A 2E7FA 1J79A 1T99A 4AEOA 1TV7A 2J66A 5F2GA 3I6TA 4UFJA 4LBSA 4Z1CA 3LLFA 4CN4A 4ERAA 2DUAA 2O92A 5C71A 4NQ1A 3IAQA 4C6MA 1M68A 1VLIA 3SCNA 3M0YA 4CQCA 3MDUA 3QF0A 1YNYA 1AVAA 2W5FA 4P7RA 5D2TA 4DJFD 2PDPA 4UOJA 1YTKA 1X6NA 1MEWA 3ES7A 3WNOA 2QMKA 1V4YA 3N29A 3CZEA 3NM1A 4HCHA 3LA4A 3N1AA 5DX7A 4IXHA 4Z1AA 3H7VA 4OQVA 4Z42C 3MKKA 1TA3A 4JTSA 3EWYA 4L1XA 1E43A 1RBOB 1BYDA 2ZWYA 1ODZA 4IP4A 4GZJA 3WH7A 3W71A 2ODOA 1CWYA 6A3HA 3UZYA 3ITTA 4PR4A 4OWGA 1XLAA 1XR2A 4UOQA 3IJQA 1ZJBA 3GBEA 2VGFA 1P0KA 4ZQCA 3VILA 2QHAA 1EZ2A 3WDRA 2QUUA 1F5ZA 1FHLA 3SSZA 5BU9A 3L2LA 2V5BA 4IMDA 2J7EA 2PDKA 3TN6A 1LLZA 1SZGA 2BWGA 3EA2A 3VNZA 3D3AA 1OVDA 1WDSA 4J27A 3S4TA 1N55A 3LZ3A 4JIIX 4AAJA 2W6RA 3W07A 3NZPA 4MDOA 1OCBA 3BC9A 2I9UA 3LLXA 3UZ5A 1MZRA 3R25A 4PTWA 2FYMA 2B31A 2O9OA 4H9UA 5ABGA 1CGXA 3C3NA 4F2TA 3L5AA 4EXQA 3KL3A 1G4SA 1ZS2A 2DZPA 1YBQA 5LA1A 2P10A 1UMYA 2VD8A 3AZSA 3ISIX 3VKAA 1FWRA 2F6XA 1XV8A 3AWOA 4UTTA 3LRKA 3W7JA 1FWCC 2ZRZA 3HO8A 3W2UA 4LAOA 5AZ1A 4FX6M 1F4AA 4OUEA 3Q65A 4GNJA 1ADSA 4Z2GA 1TJ2A 3W2JA 1E0VA 1RJRA 5JBDA 2BOFX 4EPDC 1PDYA 2PS2A 4YVPA 5HQLA 4XD3A 1BVWA 2RDXA 3UZWA 3HG4A 2JIWA 4BFAA 3BARA 1LG2A 2YB1A 3UT0A 5CAHA 1UD3A 4FX7A 2OJPA 5IXEA 1E6QM 1D9EA 1ZTVA 3VZXA 1TTJA 2WMFA 3A13A 1GOWA 1QK2A 3OQEA 4DRSA 3TYAA 2V6AA 4HPNA 1UROA 1GVOA 1FUYA 4AC7C 3M5ZA 5FCZA 5A6BA 3ZWTA 3W0KA 4PB5A 2IQDA 4JQ1A 3AHVA 3F5KA 3CEPA 1JCNA 1RALA 2VX6A 1JRCA 3AUOA 2GJPA 3ARVA 1Y65A 3W70A 3CB3A 4IX0A 1XSJA 2WO5A 3CUHA 3TA6A 4HNTA 1PTAA 1Z42A 5L6UA 3TN3A 1UG6A 3AIBA 1VPYA 3K1GA 4Y9AA 5IBXA 5T26A 3NYDA 4NX0A 4Q8MA 3ARSA 5A69A 4GYFA 1GVIA 4F2UA 1PKNA 4CU8A 4LRSA 2B4GA 1CEOA 3CUIA 3N14A 1OJXA 1X6UA 3PWGA 2ZWZA 4HA0A 3F4DA 2O7QA 5EBUA 4BQ2A 3TC6A 4WRHA 2C19A 1G01A 4JTRA 3DEQA 4L9XA 4WGHA 2OPJA 1E4NA 4C90A 5CQ1A 2A1YA 3G24A 4WJ8A 4XIAA 1M6JA 1VQTA 3B0PA 4C6CA 5JMUA 3MMUA 3N4AA 1L6WA 4O1FA 3P7YA 1CLXA 3K4DA 3TXVA 1XG3A 2SFPA 1E73M 1T5AA 4L6OA 5KITA 2D69A 4HBKA 3ZLGA 2VZTA 4GPNA 1JR1A 5AOUA 2H6RA 2X1UA 5D04C 2E6FA 3O6CA 2VGBA 4M6PA 4JCLA 3LOTA 3PWAA 3OBEA 1S5WA 4A22A 3GR4A 3M47A 1SR0A 1LORA 1C9WA 3UG5A 4DHGA 2D20A 1KV8A 4B3ZA 5H8PA 3POCA 3BAIA 5U4NA 4GG9A 4H9MA 4IIHA 2UY2A 3GVGA 1GW9A 1W5PA 5E6ZA 1E9LA 2AL2B 4Q3MA 1AH4A 5KZMA 3ARWA 3AIUA 3AIRA 9CGTA 3MUZ1 2E4TA 3W81A 1Z3NA 1FWIC 1YDOA 2Y7EA 1QWGA 3DHUA 3EWBX 1KV5A 4XBJA 1MVYA 4KIRA 2W3ZA 2GK1A 3RHGA 3MBDA 1FXPA 3JZEA 2GWGA 3WL1A 4KWOA 4QRNA 2Z4GA 1UBSA 2BY3A 1QWKA 3PBMA 1TPEA 1W37A 2WV8A 5E6YA 3SUSA 1GVYA 1BYAA 1RP9A 2CLPA 2E5CA 3NZQA 3D0CA 1XS2A 2PE4A 3K2GA 4AHQA 2AQWA 3F2DA 2WNWA 1NU5A 3WY1A 1BXNA 4O12A 1CNVA 5D32A 3S5NA 1MXSA 3NOYA 4QDWA 3O07A 1TPDA 3E3HA 1ZB5A 1KLYA 3NPVA 1ZBCA 2E40A 1IT7A 3E74A 3IV8A 1HO4A 1W1ZA 2ISSA 3S46A 4FNTA 4LVFA 1J12A 4K7VA 2NVDA 4EXAA 3W7KA 5LIUX 4ML9A 1KRMA 3L7RA 4HNCA 4I8DA 3C2RA 3PF3A 1W8GA 5FEXA 7TAAA 5LSMA 4BQ4A 3G0UA 1JXKA 4JQ4A 4X9SA 3UY7A 3KX6A 1GOKA 1R9ZA 4GIYA 1PE1A 3JR2A 1HX0A 4ZOAA 3ZZ1A 1S2VA 4DZHA 2C0AA 1VC4A 2CNCA 3TUUA 3I7SA 3NEHA 2WSPA 1EEPA 3IACA 1OF6A 4AYGA 4O57A 2YXGA 4JL1A 1D7KA 1KCXA 1DPMA 1KM1A 1F05A 1S1RA 4A3QA 3GDKA 2YDSA 1EB3A 3FX4A 1KXTA 3P5ZA 3CHEA 1TG7A 2GL5A 3YPIA 1J01A 1WXJA 4PL1A 3AS2A 3KTSA 4BZYA 3FN9A 2A3LA 3BJSA 4PEKA 5CBBA 4KGLA 4MB1A 3T6CA 4XD4A 3VIJA 3VK5A 1H11A 1R47A 4IP5A 3C5QA 4GX9A 2DSVA 4GABA 1EDQA 3VOJA 3A3WA 4FEZA 1SW0A 1XCWA 2YDRA 1E3XA 1H50A 3R0KA 1CXKA 3UZZA 2NX3A 1K4GA 1KCLA 3M7SA 3ZJ6A 1FHUA 2VRJA 2WPGA 4GI6A 4C7FA 4AXNA 5CZTA 5REQB 2QCCA 1GZ1A 3O06A 2IPFA 4RKAA 3C8NA 4W5UA 1HNYA 3B05A 3I7RA 3TR2A 4JTQA 3E0FA 3L2MA 3EMCA 3O2LA 1OINA 2JIEA 3EDKA 1S5TA 2AQVA 4QISA 2ZZ3A 1XYCA 1GQLA 4HHPA 1XXXA 2W0UA 4D6EA 3TYCA 2V2DA 5I7GA 1VENA 3GQYA 5CBIA 3P67A 3D47A 4ZGYA 4GNKB 3DESA 3VDBA 3GDRA 3L0KA 4JYEA 4YN5A 5JUVA 3E2QA 3KOXA 4NT0A 1AJ0A 1R3YA 5HQMA 3ARTA 1AUSL 3UNTA 3IJ6A 3PN8A 4M1RA 1SFSA 4AY1A 1IXNA 3LDVA 4K3ZA 4HNVA 4PC8A 4AD0A 4HMCA 1AD4A 4O1CA 3OHMB 4JTIA 3BLPX 2DZWA 5K4XA 1JCYA 5D05A 3FDKA 1K9EA 4U4MA 3W7MA 1EQPA 3GIYA 1Z44A 2NV1A 4L4MA 5ABFA 2VM8A 1EOKA 5G2IA 1F9CA 2AOSA 2R9RA 2VEFA 1KRBC 3IVUA 4LCSA 4TVCA 4HJWA 4W5ZA 1FA2A 2J75A 3KWSA 1TJRA 1POKA 4EIVA 1JZ5A 3TOPA 3GFZA 4D6DA 2QCGA 1TRIA 3SJ3A 1NAL1 1SO3A 4MY8A 5CGTA 4DAIA 2Q3RA 3GTFA 4IP7A 1DHKA 3DUGA 1XM3A 4HPGA 3B40A 4HHLA 4KRZA 4EACA 1Q66A 3FV9A 5D30A 1OX6A 1TUXA 2ZRVA 4AF0B 1C92A 2C91A 1PSCA 2FB3A 4MUZA 4FOUA 1K8CA 4J3ZA 4RDYA 1KGXA 4B91A 3GTIA 3VIHA 5EMJA 4ZQMA 1YEYA 2FHFA 1W3JA 1JAKA 5LA0A 1GCYA 4S38A 2Z25A 1LP6A 4XQ6A 1NJJA 3PP7A 4GRSA 4GQ0A 2LLEA 4AHOA 3L23A 1SYTA 3IIPA 3GR8A 1G4TA 1V3HA 2ANUA 3W88A 3HOJA 3CUXA 3NQVA 2VDIA 4QBXA 3BOXA 4KH2A 3ABZA 3WG6A 1XW8A 4H8NA 3L4XA 1NP2A 3W1LA 4C1LA 3NQ7A 1TQJA 5KZDA 3PBYA 4UTWC 4R34A 1YMYA 5CPOA 4LS0A 4BKNA 2VZSA 3UA4A 3WD3A 3N6QA 4WK9A 4FXJA 1J9YA 4GI4A 4XK2A 4AF0A 3FHAA 3LLDA 2PF8A 5IRPA 4OBRA 4I8YA 4AC1X 1Q2SA 4J2MA 3BCJA 4H04A 3GLCA 1AW1A 1S38A 2A7NA 5C2GA 2VWTA 4A2RA 1EYWA 4DPPA 1HZYA 4JFTA 4KQNA 1JYNA 5HOSA 3TYZA 3EPOA 5DT7A 4L64A 1DVJA 3C0LA 2YCEA 1O68A 3CZJA 4GNVA 1SM9A 2BGQA 4ZFCA 1MUWA 3PZOA 2V30A 3FYPA 3G77A 1D8WA 1B90A 1I0BA 4RE2A 1GW1A 3AYTA 1Q7QA 4KGJA 2G96A 4CGTA 3LPGA 2E9LA 1DJIA 3J7HA 4QCEA 1ZPTA 4CEXC 4I7WA 1OG6A 4HOWA 2PDUA 3H12A 7TIMA 4K6AA 4BI6A 3ARPA 3SDOA 1EIXA 2R1PA 3UPBA 3WD4A 2WJZA 4F2BA 4YTQA 2E28A 2Y5SA 1ZNNA 2FFIA 1YW1A 4J5NA 3R2GA 4DWSB 3E5BA 3NZ1A 1WAWA 2INEA 3DFPA 1PX4A 3RJXA 1DWFM 7REQB 3VKKA 1ELSA 2R94A 1XLBA 4HU4A 4OGZA 1AMYA 1AH0A 3BLLA 4AD2A 2DJXA 2Q8ZA 2D2OA 4FLRA 4W86A 3VPLA 4ADSA 1XRVA 3WQ4A 4MGGA 2I14A 2XH2A 1K6AA 5DMNA 4CCZA 3VE7A 4WSKA 1HTIA 3UJSA 3MMTA 3MSDA 1LQ0A 3B04A 3VGDA 2BNJA 1HKWA 2TSYA 1PHWA 5DBUA 4GKTA 3QR1A 2VUYA 2EKGA 3QPZA 1OFOA 1ONXA 4CCEA 1E1FA 1QOPA 4MOZA 1ZBKA 1XBVA 3GDLA 5CPLA 3IGXA 1BWLA 5DANA 2F7FA 1DV7A 3VMNA 3LPPA 4RE3A 5FSDC 4EK7A 3PPCA 5A6MA 3E38A 3KEHA 1JYVA 3FAXA 1EYEA 3Q2DA 2XWDA 1LOLA 2HWGA 3OVGA 3R0UA 2ZUSA 3L5LA 4L4PA 4LUYA 4WOQA 3BQ6A 2VEMA 2DZBA 4IMAA 1KM0A 4JQAA 4ZO6A 2RHGA 2GUBA 3NJ3A 2DV0A 4IPPA 4P7QA 3C2EA 2AMGA 1X6LA 4X0NA 2EF9A 5HR6A 1QI3A 1P0NA 1HKKA 4RXFA 3LUTA 3LMYA 3RPDA 4A2SA 4Z0SA 1A0DA 5A8QA 3GFYA 4AMCA 3SI9A 5FJRA 2J7FA 4TR9A 5LIXX 1JGIA 3LPOA 1DJQA 4H9XA 4PULA 3H24A 4XTDA 2OEMA 1K8ZA 1AK5A 2X1TA 2E6AA 4GQQA 4WY0B 4UNIA 5HWMA 1BF6A 3EOOA 2PDGA 1ZAIA 3W02A 1CLVA 4B92A 5I03A 3EX1A 5A6SA 2YCKX 4CN6A 4AD5A 3QZEA 2HMCA 4HPJA 1JDFA 1UD6A 4HA3A 1WV2A 5D8ZA 3WLIA 4HHMA 3TW9A 5EBAA 3TSDA 1LL6A 4H6EA 1R0MA 4FNPA 4M7TA 5TD4A 4FO4A 4CD8A 1J2BA 2PTZA 1XH2A 2WK2A 4JTLA 4KEVA 1I1WA 2CCRA 1J18A 3PSWA 4MB3A 3BAKA 3K30A 3ZM8A 3M0JA 2NT0A 1H51A 1MQQA 1YXYA 2P3ZA 3B8DA 4HK7A 2PB1A 1PYMA 4POCA 3PTMA 3W1MA 2B7PA 1NARA 1OG0A 3Q67A 3AALA 2X2GA 1CB7B 1WAUA 3N9RA 5IDZA 1DIOA 4MMWA 4TV5A 3W2LA 1N8IA 1U5VA 3N6HA 3RN6A 4HZ7A 4JTKA 3V36A 3VYLA 4GY7A 4XAYA 1M3UA 1H09A 2OZ3A 3HPFA 1UIOA 2A6LA 1BEUA 5CAKA 3W2NA 1SJCA 1FFRA 2OGYA 2X1IA 4FIQA 1XPYA 2DSUA 4IFKB 1RCXB 3MI6A 1J0HA 5FF0A 2Y7GA 3DECA 3CYVA 4WUIA 3LX9A 3PVFA 1RLCL 4NG3A 1JRBA 3TVAA 1R9XA 3AYSA 2Y0FA 4U3AA 2UWFA 1G67A 3CQ0A 1TX2A 1WBHA 4FA3A 4CD6A 1EF2A 1Q6DA 3OGVA 1WZMA 1L8PA 1F2JA 3O7UA 1JI2A 4ATLA 2ZUWA 3S1VA 2W9MA 4Y9OA 4AD4A 3Q58A 1JZ2A 3U2CA 4TXEA 3GWQA 4QDMA 1JGMA 1SW7A 4JICA 1WKFA 2OVLA 3GH7A 1J5TA 1YADA 4AZ5A 4PUDA 4NY2A 3TC7A 3LNPA 3TJLA 4DIAA 2ISWA 2OOFA 3NA8A 1LOSA 3W1UA 2AGTA 2DH3A 3KVKA 3H4GA 2PTXA 5BXPA 1W32A 3W25A 1MW3A 2BSLA 2WBKA 4I3GA 3A4JA 1OGSA 2Y85A 2WSKA 1ME9A 1UPPA 2D0GA 1LBLA 1EOMA 4NI8A 1DJHA 1XWYA 1HKVA 2QGHA 1P6BA 1PUDA 3QXBA 3SQSA 4GGBA 3AROA 1UH2A 4DUWA 5E09A 4D6CA 1UZ1A 4ICNA 1IEVA 2JQXA 1CENA 2ZRWA 4O4WA 3EA3A 3W23A 3LHUA 3U2ZA 4TX8A 5JQ9A 2ZQ0A 3CUGA 3WQWA 3TEVA 1H2JA 1RJQA 1L9WA 3G6LA 5D2WA 3GNXA 3M6YA 1JD9A 3FS2A 1UP3A 3HMJG 3I3EA 2GFTA 3I4KA 1Q8AA 1DQXA 3R13A 4C6QA 1CDGA 2PMQA 1E71M 1M03A 3DBNA 4YTUA 3PZGA 1BKSA 2GJNA 4RPQA 1QU4A 3WJSA 1MEIA 1DJYA 6PTDA 3F1QA 2EPKX 3PTDA 3W1QA 1BKHA 3P61A 1PL9A 3CH0A 3A47A 3OTRA 4R3UA 1ICPA 3AICA 1LL7A 3QY7A 4ERGA 1BTMA 3QKZA 3E96A 1H49A 3HPXA 3RX3A 3SUUA 4FK9A 1XLLA 4KFPA 3DAQA 5FJUA 2X8RA 2CZVA 7A3HA 3CAQA 1B5TA 4NSBA 4I6KA 2GDQA 3QSRA 2BDQA 4RNJA 1WZKA 3I3DA 3QQ0A 3ID7A 4P7LA 2GJRA 2D3NA 3A4WA 3QOKA 4G7FA 1XLMA 3TYEA 4UBPC 2FZNA 2ZIDA 1OT1A 2OQLA 1VGAA 2ZUVA 2OTDA 2DZSA 3THQA 4A29A 3C2OA 2J8TA 3IVTA 3UXAA 1IIHA 1KM4A 4PUUA 1OM0A 3DI0A 3FA4A 4LRTA 3RCYA 1VEPA 1C8XA 2GQ9A 4MADA 1HJWA 2PRMA 4AZIA 4C60A 1JPIA 3UCQA 3K4WA 2PD9A 3ABXA 4LVBA 1ITCA 1D3GA 1DJWA 1QPKA 2E1WA 4RW5A 3EWUA 3LGGA 4DJEC 5U7SA 3EWZA 3HN3A 2ZX9A 1GORA 4LYRA 3PAJA 3UR8A 4XAGA 2GYIA 4J35A 2BXZA 4GXWA 1NY1A 1D2KA 1CLKA 3N73A 3CHCA 4JS3A 3VNDA 5F4SA 4W93A 2FIQA 1RV8A 1KBJA 3UY8A 1KC7A 1B9BA 3CLWA 3DFSA 4NYUA 3MP4A 2FPTA 2RKXA 3REQA 3APGA 3MTWA 4NZ1A 3VKDA 1V6UA 1E4MM 4CKQA 3TXZA 4W87A 4M6QA 1EHNA 4PEEA 2PRLA 1ZU8A 4M7SA 1RCQA 3EEZA 3MP5A 4JX4A 5AYZA 2Y62A 3NQMA 2IS7A 5LNVA 3S2JA 1H41A 2I57A 3HGSA 2RH9A 2VXNA 2A79A 5AKQA 3RU6A 4LOCA 3NO5A 1RZMA 4DJDD 3PUEA 2BASA 4CNNA 4OHQA 4PGLA 2R91A 2OEKA 1OYBA 3LI0A 3U2OA 4G2DA 1T8QA 3W7IA 3EZ4A 2NX9A 4IIEA 5G1MA 4AZBA 5HWJA 3T8LA 2NQHA 2F8QA 2VQTA 4PCPA 2WZMA 4J28A 4Q4OA 3N12A 3OLGA 3B03A 1EPVA 1GJPA 3MHUA 5D02A 3E2VA 4DLMA 2PCQA 2J25A 3NQ8A 4PZVA 3WQEA 4H6KA 4RZ4A 4EPKA 4JYFA 1KXVA 1NOFA 4A35A 1E6SM 2JGYA 1H4PA 2BY2A 1XFCA 1UZDA 4PTVA 3SRFA 2PLCA 5CPQA 1GVQA 2WC4A 2YXXA 3VVGA 1GNXA 4KWSA 1O6IA 1Q7ZA 3QPEA 4GFSA 4PTXA 4PMNA 3GG1A 1PIGA 1DE5A 1EC9A 3RCNA 1Q63A 2YFNA 1EIBA 1A5SA 3W1AA 1PBGA 2WCAA 1XLCA 2Y5EA 3WN6A 2A3EA 5LGZA 2J6VA 5F2LA 2TRSA 2C0HA 4JY9A 2J6XA 2BVDA 2ZXAA 5G5IA 4B90A 4IXXA 1AZ2A 3M0HA 5I79A 2FZDA 2G3JA 2INZA 4XAPA 1W1IE 3OIXA 4PMZA 3LGEA 1B3ZA 1H1NA 3KBSA 2FJKA 2Y8VA 1YRRA 5HJLA 1RCOB 3G0XA 2XVNA 1PO9A 3KVMA 2WVTA 4GD0A 4HTYA 2PU0A 4IGSA 1NVMA 3VNKA 1EC8A 4F0HA 1JYWA 3MCNA 2QV5A 3CH9A 2ZVIA 3QMSA 2VFFA 1ESWA 2F2KA 3NL3A 4IL2A 4I9AA 4GIRA 1QRQA 2V68A 4A4AA 4N9BA 3MV11 4F66A 3EDDA 1OT2A 4JIHA 3SGGA 1JCLA 2XH0A 1X39A 4S3FA 2Z7GA 1WA3A 4BS0A 1SZFA 2HPMA 1TTQA 3I6EA 2Q8XA 4AZHA 2QCNA 3GTNA 2CKSA 2IW0A 1KR0A 3OPSA 2DQWA 1BSIA 1XC6A 3WF4A 1PKMA 3GBDA 2VENA 4C7GA 3S5OA 1QO5A 1V8EA 2ZCGA 1U2YA 3N17A 2QCDA 3TDFA 4TMCA 4RV8A 1C9DA 3AHYA 2FVMA 2W92A 1CGVA 5AZ0A 3S9IA 4UOZA 1VEOA 4NX5A 4O10A 3DFHA 4ZEPA 3NGFA 3IJLA 5FD0A 4AXKA 4B5UA 1TPWA 2NUXA 4JAWA 2E8ZA 3OGSA 1XLIA 1MW1A 3U9IA 3QW4B 3KOWA 1POJA 4DI9A 4GLEA 2BP1A 5G1TA 5D33A 2V5LA 1N8FA 3F2BA 1XKJA 5A6BD 1RLDA 3QGKC 2VNCA 1VRDA 2HBVA 5H8UA 2GVLA 1T96A 5BWFA 2XFWA 2ZXQA 3WLHA 3KAOA 3NQ6A 2QJGA 4NUWA 5CZKA 3FVDA 3VC6A 2MANA 3WKZA 1PZ2A 4EXBA 2WHLA 3TQPA 2HISA 2HNEA 3GHSA 4JN7A 2NVAA 4D9PA 1MDLA 2VFDA 3UA3A 4LFYA 4V2XA 2DVXA 3EB2A 2HRWA 3VIMA 3REQB 2YW4A 3AZTA 3AXIA 1HW6A 4NZ3A 1RQBA 1E6ZA 1UJQA 3CUJA 3PZQA 4AH7A 1DBTA 1BRLA 2V8ZA 7PTDA 1OX4A 4V15A 4ZA0A 2PGEA 1E6RA 2B7OA 1P6CA 4PBEA 2PC8A 1KW1A 2I7GA 1G6CA 4PUMA 3O6YX 2DIEA 1SSDA 4QAIA 3APYA 4GZIA 4B4HA 1S5VA 1RR2A 3LCLA 3BUVA 3H2FA 1REQB 4A3YA 3P0WA 2R1NA 1LYXA 3ZSSA 6ENLA 1XKYA 4O53A 3ICJA 2V0TA 1J0ZA 3T55A 1SU5A 3W37A 3CIXA 4O18A 4XSLA 3JW7A 3D6NA 4XD5A 1L6GA 5DT5A 4MAZA 3DERA 3VIIA 3O16A 1ECQA 3UJFA 3WL0A 4IMGA 3PANA 3S9YA 3T4WA 5CLWA 3AUJA 1RH9A 1TQXA 1XIJA 3GNRA 3E6EA 1VJSA 3CQHA 1ZCCA 1IWPA 2NX1A 3V4BA 3G1XA 3LBOA 4N4QA 2DGAA 4WDWA 3H55A 4X0VA 4BY3A 3CL6A 5HJYA 3PY2A 3SCOA 4P61A 1EQCA 4PCFA 2OODA 2IQ0A 3DYOA 2DZUA 3S9ZA 1QFEA 3NL5A 1XC4A 4GI9A 4Y96A 4MB5A 3N34A 4X2PA 1UKOA 2J8GA 3LTYA 1BXBA 3AYVA 3CS2A 3PC0A 2E25A 1W1PA 3LPFA 3UPMA 4K39A 1R2SA 4R33A 1VP5A 3JUGA 4EAYA 4A05A 2OKTA 1MFUA 4JL2A 3WUEA 4UZUA 1OSEA 5FEZA 2CWNA 5F4XA 1V0LA 1K4HA 3W84A 3BPWA 3H2MA 1SR9A 1ICSA 2Q01A 1IT8A 3KTXA 2Z6IA 4Z1YA 2DT2A 2ACQA 1DQWA 4L5ZA 1XP3A 4H9ZA 1J8VA 4XISA 3UPWA 4GINA 1F3XA 3MDWA 4Y90A 1EGMA 3O63A 2GGIA 3GYCA 3OLIA 3G1VA 4BA0A 2NLIA 4Y7EA 3GTXA 3ALGA 4QG9A 1HGWA 4GQRA 3VDHA 1FY6A 2NW0A 1FWAC 3E0LA 4AD3A 4AIBA 1OFBA 5JVLA 1B31A 3R0DA 3WX7A 2DVUA 1ONRA 4CVWA 4AWSA 1B3VA 5I3HA 4PFHA 1K9FA 1ZL1A 2CIPA 4GACA 3MWAA 4ALDA 1CGUA 4RCXA 3MZNA 2OXNA 2Q09A 3IGUA 3ZO9A 1JG9A 3WK0A 3F4WA 4C1NA 3IIOA 1G9HA 3IV3A 1GYLA 4DXKA 4P5UA 3UW6A 1ZRQA 4RJEA 1HJSA 3POHA 4NAFB 1GQIA 3VZYA 2V5CA 3KHJA 4LS2A 1GQNA 3WLQA 3C8FA 2I9EA 2CYGA 3NDZA 2CFFA 2YBVA 4JEJA 1BYBA 3VKBA 8XIMA 3N6JA 3GZ3A 2CLHA 4FR6A 2G3MA 4OBSA 2GVYA 3PZMA 2Z2BA 3NM3A 4GH3A 1C8QA 1P48A 3RR1A 2G50A 3OJGA 4LUTB 1XJBA 3WDQA 4E4PA 4D8AA 1XDMA 1VPXA 2H90A 3UJRA 5I24A 2JKPA 3TV8A 2ZRYA 3G1HA 2DUZA 2NSXA 4OU1A 1F07A 5DQPA 1UP0A 5CGMA 2G8ZA 3LXCA 4JHOA 1LRNA 4AZCB 3TZFA 3W7PA 3UJ2A 4HQVA 3DGBA 4YU1A 2YJQA 3ABSA 2GWNA 1UR8A 2J7GA 3WLLA 2JEPA 4G1KA 3L4YA 1EGZA 2OG9A 3AU6A 1VBHA 1HKMA 2XTKA 3NVTA 4FF7A 2ZBTA 4QGCA 4IISA 4Q7IA 1KFKA 4NZCA 4TO8A 2EJ1A 1U30A 1SO6A 3CYJA 1LRQA 5EB8A 4BF9A 4Q33A 3S2CA 1CX9A 2PTDA 1RQEA 2X05A 1JAEA 3H7UA 1WXYA 1K7EA 4N42A 3L67A 3BAWA 3PUGA 3QPYA 4RUBA 4AVOA 2OB3A 4FLQA 1LOQA 1C7TA 5K2ZA 3EX3A 3G3DA 2Z0IA 4WVXA 5A2AA 4MWAB 4ONVA 2IPJA 1XL9A 5LKYA 6REQB 1UD5A 1TCMA 4QLKA 1F61A 2FTPA 5BW6A 2J4GA 4H9YA 1QHPA 3BLEA 1TWZA 2R1LA 2ZX6A 3MVIA 3SY1A 2Y7DA 3C2YA 3IGHX 4CD4A 4M5PA 1F76A 2IXVA 4WHBA 1KNWA 3LERA 3AS0A 5GNYA 3GSMA 4QS6A 3UFYA 1W8SA 3SM0A 1E6XM 2FTYA 1X7FA 3IIZA 4PMDA 3VM5A 1M5WA 1WOAA 3EAUA 4C6JA 3HGJA 3UG4A 2J79A 2PCEA 4X3ZA 5CEWA 2FDMA 1B57A 4US5D 2HVOA 3TJ4A 1V03A 3B0UX 4DM2A 4QP0A 2FPVA 5TQLA 3GNNA 1ML1A 2QUMA 3CWNA 4LY8A 1U33A 1DWAM 1FWJC 4QR6A 5DEZA 2C1IA 3AQUA 3ITLA 4DUOA 4FXSA 4LALA 3N25A 2W4XA 4GZ7A 5I6SA 2XH7A 2QLYA 3K13A 2OKOA 5F7UA 2G3NA 2ACUA 2YW3A 1XIBA 1FWWA 3QM3A 2XIBA 1VFMA 3RRXA 3MJMA 2XZ9A 1UBPC 3LG3A 3K46A 4YVXA 1CXEA 4RR4A 3CQJA 1EP1A 4QSFA 1FWBC 3HFYA 3HV9A 4ZVJA 1OYCA 3TNOA 4DAFA 1H7OA 1BWKA 2W79A 5CJ5A 4KRUA 4JTUA 3V18A 3ZLHA 1RQHA 3CBWA 5ABEA 4DJED 4GYKA 3KBMA 4HU3A 2C7FA 1Q65A 3ZJ8A 4GXMA 4IPNB 3VABA 4MWAA 1OD8A 1H5VA 3ITGA 4MFDA 3TN5A 3PK7A 3TOYA 4AISA 4US5A 2PURA 1YTDA 1F7BA 2P50A 2GGHA 1W1YA 1ZJAA 3AO0A 1ONWA 7ENLA 1OGGA 3DFNA 2IMRA 1IF2A 2VRKA 1A5CA 4JGDA 5EGRA 1JQVA 4GVGA 3FYYA 3Q4DA 1QI0A 2VELA 1DWIM 2QCLA 3RLGA 1J4EA 1CGYA 1JNDA 3VXGA 2Z29A 1J93A 3GW0A 3SIMA 4BI7A 4QQ3A 1AL7A 5LHFA 5LNRA 1M41A 3UBPC 2E67A 3W72A 3B9NA 1N7KA 2FGLA 2VFGA 3L66A 3GYEA 5FF7A 1EBHA 3SRDA 4L4OA 1OFDA 3UXKA 5C8BB 4UR7A 3KBWA 1OC7A 3NZRA 4IUOA 5A2CA 4UFKA 2HV5A 2E6DA 4LVDA 1UHVA 1O12A 4Q4KA 4EANA 4CQBA 2QDGA 6ALDA 4NAEB 3HU7A 3HF3A 3E5PA 1EL3A 4JNYA 3GAKA 4GCAA 2FMNA 1RY8A 2WVVA 3AHXA 3ARZA 2QJJA 5FJTA 4MAVA 5A8OA 3GXPA 3VOIA 5CSUA 2WMIB 3T81A 3ZVIA 5KEZA 1JPHA 4L6HA 1PTGA 3W7OA 3LD5A 4DX3A 3TLLA 3S2LA 1FCBA 2YCLA 2D2HA 2YBTA 5FEWA 2PDXA 2AQOA 4DBUA 1EUAA 1KM5A 2D22A 1L2QA 5LIKX 4U33A 1J0JA 4IIBA 3EX4A 3CB8A 3GKAA 3VU2A 4B5VA 1OC6A 1GKQA 3S8HA 4ACYA 3EXSA 4B2DA 5MF5A 1RVGA 1IXPA 1XBXA 1T6MA 4DYEA 5A2BA 3L4UA 3CHVA 3A23A 1XIIA 4NXSA 3B9OA 4W89A 1QI5A 4H7CA 3AZRA 3CC1A 3H23A 3BQ5A 2EKCA 3HB9A 1Y0EA 2ISVA 1V0NA 1G4PA 2WVUA 5JIWA 3PS7A 3T78A 1PWLA 1O95A 8RUCA 3P60A 1KM3A 1XYBA 3KOZA 3GHTA 4JFWA 1EJ7L 4IQEA 1E0WA 2VDGA 3EX6A 4Z2IA 1WKDA 4F3HA 1JDCA 4AIEA 5AHNA 3SAZA 1SJBA 3BMXA 1DWJM 3UG8A 5EPDA 4E3VA 3ITVA 3C0SA 3Q45A 4H01A 3OG3A 1BF2A 2BB0A 3URNA 5M5DA 1OADA 2DU2A 3WLMA 4O28A 1R7AA 3LM7A 5G4WA 4HCLA 3PB2A 1UWIA 3STCA 3O0KA 2ZTKA 1AQFA 4ZTYA 2OWCA 3WEZA 2VKZG 2A85A 3WJWA 3VCCA 4MSSA 1REQA 2XSXA 3EX2A 5CH9A 1XPGA 2V81A 1S5NA 3FDGA 4ICCX 1UJPA 3LB0A 5AYYA 1VEMA 1BHGA 1MW0A 1CPUA 2X42A 1Q6OA 2Z26A 4DJEA 4DO5A 5CC6A 5HJXA 3DCPA 2DJLA 3P8IA 2Z1KA 1NQ6A 3CQKA 1YTEA 4E2OA 1K7FA 2O9RA 1IHIA 4O8RA 3G1AA 3TCSA 3NXFA 1F8IA 5CCZA 4H9VA 4OOUA 1OFQA 1QW7A 3NQDA 3P74A 1HO1A 3EWDA 3W1XA 1I4NA 3ZR6A 4YWSA 3TONA 3QV8A 4BQ5A 4IJRA 4RDVA 2PDBA 2B7QA 2ZX7A 1F3WA 3WNKA 1R86A 3MI3A 1MFVA 2POTA 3AXKA 5EA9A 4WIWA 1U1JA 3VCNA 3EDFA 2Q6ZA 3UP8A 1O4UA 4HVXA 4P2VA 4NI3A 2I5IA 2WHJA 4ILSA 1ADOA 2CHOA 2PTWA 1MRAA 3E9AA 1V77A 4GH1A 4QLLA 2R1MA 1EXPA 3OGRA 3EBVA 4PMQA 5CZ0A 1YXDA 1W5QA 4JNZA 3SEPA 1OFAA 3WNMA 1FH8A 1YPXA 1CTNA 2DDXA 3QC0A 1GOQA 3QV7A 3VDCA 1YPIA 3SO7A 4IL0A 3W1TA 3KRBA 3U2EA 4XTIA 3ATZA 1D3CA 3BH4A 1NP0A 4H7ZA 1BPLB 2BHYA 1BG4A 2ZA3A 1H7XA 1TTIA 4F40A 1TV2A 1QO2A 2VC6A 5EMKA 1GZJA 2RDTA 4FHAA 1QHZA 1YNPA 1M53A 4E38A 1S2TA 2WSQA 3RJYA 3GH5A 1O1HA 1VAHA 4GVIA 1HG3A 3A6OA 1EO5A 3N2CA 4S2CA 4AEEA 3ARUA 3FXGA 1LRTA 4QIUA 1X96A 3RILA 1LTDA 4CN1A 1V02A 3DFTA 1UUMA 1WKEA 4WX2A 2VI0A 4J7RA 1B2YA 4XVDA 2XSBA 3CAVA 4RDZA 2NWRA 1NWRA 1S46A 3WK3A 4J3XA 4Q8TA 3GHUA 3I7QA 1EO7A 1MXDA 3MHFA 4LXFA 1WQ5A 4LNCA 1UCWA 4WDTA 3VC5A 1TMLA 1O94A 1JZ6A 4RXGA 4XB3A 1Q3NA 3B8UA 2VDHA 3GUWA 3NNTA 5C9UA 2YYUA 4B9YA 2QPUA 4QITA 3CWOX 4XX6A 4QE4A 3SADA 4BWLC 4MWAD 3PNUA 5K3VA 2X0YA 1B1YA 1WO2A 3RRAA 1AA1B 3ONCA 3VNJA 2EG8A 2YZ5A 4S2BA 3V5FA 4S39A 5FF2A 4M24A 1A0EA 4XZLX 2WLZA 3S5ZA 1XIFA 1QMLA 2WPBA 1YDYA 1C93A 4KWUA 5KSWA 2FZMA 3T0DA 1UASA 1UUQA 2ESCA 4Q8PA 1TMHA 3MYPA 4C6OA 4E2DA 3F5JA 4MFEA 4QHRA 4AZCA 1GOIA 1BAGA 4UNLA 4UQ9A 5J5DA 4NAEA 4GYJA 4NYYA 4AQLA 1C3FA 5GQBA 2ZE0A 2CLMA 2O4MA 1MQRA 4N4PA 4U28A 1R9YA 3U4FA 4GJ1A 2ZDSA 2NUYA 2YDQA 1UKTA 3KRZA 3PB0A 4GIEA 3O6AA 4NF7A 4D71A 4Y9MA 3V0UA 4RL3A 2GDUA 2ZZ1A 1F4HA 2Z27A 5A6AA 1ISZA 4O8AA 1EJTC 4E0CA 1VCVA 4NJHA 3FIGA 4KPLA 3WF3A 4LB4A 5A3HA 1XICA 2EGZA 3VKCA 1XLHA 2C13A 1O5QA 5J04A 3UEQA 1E51A 3EYPA 2G3IA 5C2CA 2AGKA 5HMDA 3WO8A 2VC9A 4M56A 1WBJA 3WJZA 2ADAA 4PN2A 1QASA 1CT5A 1XH0A 1JPDX 3UR2A 4K38A 4ECLA 3GG7A 4Z2KA 1E1CA 1DEDA 3MMDA 1XD0A 1N2VA 3BXWA 4ZE5A 4AYSA 2PZNA 2V67A 2WVVB 4DLFA 4R7JA 3CHFA 3TKFA 5EMYA 3KL5A 4UTLA 3MJYA 3TQ0A 2G95A 4EOUA 1F3TA 1S2AA 3FW6A 4S3DA 4WZHA 4CNTA 3RCMA 2H3DA 3WUFA 4GYPC 3MUY1 4XO7A 3ELFA 1M7XA 1GG0A 3AHTA 3DOPA 4DWSA 3HQNA 3OU8A 4IPLA 5AHIA 4ZO7A 5M2FX 3TTYA 2X40A 3IPWA 4WR3A 3OIHA 3A64A 4C6NA 4RNFA 4ZXLA 3GNOA 3AOFA 3B8WA 2Q71A 1OEPA 5LGXA 4F0LA 4A6GA 1YLVA 1NFPA 5GPRA 2WC3A 2J7BA 5D38A 1XUUA 4DI8A 3CEUA 1FQ0A 2YKKA 3BOFA 3WLNA 2CHNA 1OYAA 2DSKA 2Q3OA 1VB9A 1TV8A 5G4HC 3N9SA 3F03K 1OF8A 5MKGA 4UR8A 1HVQA 2YA1A 1EDGA 2XHYA 4A8IA 4M1BA 1TV4A 3H2AA 1T0OA 3BAYA 2EBNA 1R3SA 1PJ9A 3FY1A 4G56A 4GKLA 3RYSA 1P0DA 1XRTA 5BYWA 2HS6A 3L4ZA 2FFCA 5DMYA 4E5TA 3IUDA 4FR1A 4GUJA 4E8DA 2QCFA 3PAOA 3CPGA 3W6MA 3THDA 3UJEA 4C6DA 5A8MA 2PDNA 4YHEA 3AMKA 4AWEA 3GR7A 1U5JA 4DYKA 3L12A 3UGRA 4FNRA 2QEZA 5E93A 1KFEA 2D0FA 3ZJKA 4DXVA 3MVTA 4XZMX 1Q6QA 1TO3A 2IKGA 5K9DA 2IUZA 3GVQA 4BR1A 4CD7A 2VR2A 3AIVA 1I6NA 3S5SA 4JQ2A 3N2MA 3QC3A 3LCXA 3IARA 2Z28A 3FA3A 2VVNA 2JK2A 3QQ1A 1Q6FA 4UQEA 5J5RA 3H6OA 4DF1A 1DOSA 2XIMA 1TPFA 1SFTA 4QX4A 4QM1A 1XDLA 3S6TA 2QCEA 4MTVA 3R43A 2QQ6A 3WMLA 2D3LA 1R7OA 4GK8A 3H26A 2JKAA 3WSUA 5E0FA 4Q8NA 4UZSA 2OT1A 2OYKA 4M80A 1H7WA 1Q5MA 5DF0A 5DMMA 2X7WA 5AC6A 4U2YA 3UWVA 4C6IA 4LH8A 2WANA 1IE7C 1PS9A 2J9XA 4AWTA 3DKJA 4FS9A 3AU2A 2WMGA 3IRDA 4DF0A 3UCCA 1GQKA 1KTCA 3T42A 3DFQA 1IZJA 2QNEA 3N19B 2C14A 1IZCA 1ZSXA 3S2NA 1IEWA 5HNUA 1ITQA 1UWSA 2WNNA 3AMLA 1E40A 1K77A 3SZ8A 4HNNA 1CXFA 3HQPA 2W61A 4US6A 4XZ9A 3BWWA 1EZWA 5C6MA 4TIMA 1B3YA 4LJ3A 3VGBA 1NQKA 1HKJA 3KE0A 4HB7A 1RPXA 2CPUA 2YLLA 2E5DA 1A47A 2PSNA 4J3VA 1IIGA 5LIWX 4J3WA 4PMRA 1PX8A 4DQWA 1KD0A 4A3UA 2BY1A 1MWOA 4ADUA 4O13A 1ZAJA 4QFUA 4EE9A 2QAPA 2Z7KA 2QKFA 1WDPA 1VS1A 5K4ZA 4OKDA 3CZKA 2A3HA 2F84A 4HU8A 4NILA 1V0MA 4V33A 2ZVRA 1QOXA 1VRXA 4ZCWA 3WLRA 2CW6A 1JCMP 1ISWA 4XVEA 4Q4QA 3ZT6A 2WSRA 1I2RA 1W9DM 1Q6EA 3SN4A 5BU6A 2D1ZA 3N2TA 8A3HA 3FJLA 2F6KA 2HK0A 3DZ1A 3TW6A 1S3TC 4L56A 4O0KA 1OIMA 2QJHA 4LUIA 1HN1A 5E70A 4Z2LA 3CV6A 4PUEA 1XQKA 2X09A 1JZ7A 2CLLA 2FJUB 3EOEA 3BK0A 2OFJA 1ME8A 2RFGA 2IKJA 1LWHA 4A3RA 1KFLA 4I9MA 3RLHA 4MKVA 2FLIA 3AHZA 3FKRA 5B7ZA 2DT0A 1ZBWA 4I9JA 3ZIZA 3NFUA 3GX9A 5JXQA 4XZWA 1E5NA 3CMGA 2I16A 4J9JA 1Y8BA 3FEMA 1UQYA 1IXOA 3W87A 2XIQA 3EGJA 1VHCA 3T2PA 4LF2A 1KTNA 4FNSA 2IQTA 4AG0A 2IXUA 1LLWA 4KT2A 1V51A 3U3HA 3EEGA 2O9TA 3LY0A 4K2SA 5HK4A 4H2HA 2DIKA 1J6PA 3NQFA 2QV4A 3XISA 5D2VA 1IZKA 3P3BA 2VUNA 3TCEA 2GSHA 4H2CA 2ZZ7A 4P7OA 1JZ4A 4IIGA 1KRCC 4HTBA 3G8EA 3CNYA 4HN4A 4R9OA 4XG1A 4EVZA 2PLMA 4QJ3B 3CMFA 3E0WA 3TAKA 4TV6A 3NQEA 1QJWA 1XDJA 3BO9A 3M0LA 3M41A 3IS4A 3LBMA 4JBRA 5C9RA 2C16A 1O7AA 4WY0A 4XV0A 3BE7A 8TIMA 4H41A 1PWMA 1J5SA 4D6HA 3PZIA 5DELA 3KRSA 5G4EA 1W3LA 3L0GA 5LIYX 1Z9AA 4WSHA 2ZRUA 5A95A 3THAA 1KLZA 2VX4A 1XLDA 2Z24A 2FDSA 3K5XA 2Y7FA 3H70A 2WBGA 2IPWA 5XIAA 1VYPX 3E02A 2GDVA 3LI1A 1P7TB 4ACZA 3ALFA 4ROPA 1I60A 2BZNA 3MA8A 3ARXA 3AIQA 2YGYA 4H8VA 4FAMA 3W2KA 1C8YA 3FJ6A 1TWWA 2QF8A 1C91A 3HG3A 1B4EA 2OWWA 3H2EA 5AHFA 4IIDA 1XFBA 2OYMA 2XGBA 3M5YA 1OC5A 2DFAA 3F5LA 3WEMA 4B15A 2OU4A 2VHLA 2ASHA 3MI2A 3VGHA 2NXIA 5A6TC 1X8CA 2ISFA 1UC5A 3WDHA 3MMWA 1DTNA 3RG6A 2DH2A 4JX6A 1M7PA 2HDJA 3PZVA 1KM2A 1HL2A 5PTDA 1QBBA 5E9XA 1YDNA 1AL8A 2EPMX 4JDBA 3HG2A 2OELA 4O0ZA 4H00A 3W7RA 5HAOA 3GIQA 1PVNA 2I17A 1W9BM 4MNMA 1NDYA 1QUMA 3TJXA 2ATMA 2BLEA 1KCZA 2YCIX 4GX8A 2E3ZA 4DO6A 3SCQA 4N6EA 1DKWA 4C6BA 3UXIA 3UQNA 1C7SA 5RUBA 1XI3A 5FL0A 1RXOB 4EPEC 4F4RA 2V5JA 1UR9A 3DBPA 1UOKA 2D2JA 1PIFA 2PC4A 1HUVA 4KW2A 3U7BA 2OLAA 2ZZ2A 1JIBA 2BODX 3JVAA 1E6PA 3OLEA 3WF2A 1BWVA 3LHWA 3DH7A 1X98A 5DRCA 1LLOA 3C0QA 1B3XA 3PFRA 1HVXA 3K4AA 3VIPA 4WLCA 1W5OA 3R4IA 4ZE4A 3VNLA 4MHBA 2F2HA 4QSHA 1H7PA 5KZ6A 1KM6A 5M3WA 3CL8A 2P0IA 3HTWA 3B8SA 3W00A 1DWHM 1IR1A 1M9HA 4MJZA 3MKCA 4ZQOA 1GOXA 3T1GA 3ES8A 3GXTA 2JALA 2WNZA 1EP3A 3Q37A 3SSJA 3BGAA 2Q02A 3H21A 5I23A 3BCDA 1ZY9A 1S2CA 1GG1A 3TC3A 3G1DA 3QQWA 1WZLA 3GNPA 5I3KA 4C1KA 4G8TA 2V38A 3NIYA 1JL8A 5CXPA 3W6YA 3ZS4A 2OCZA 4AU0A 2VEIA 3KBJA 1F6KA 2YIHA 3FNDA 4AIUA 1XLJA 1R3VA 4UMBA 5HINA 1YDVA 8XIAA 1EPXA 3NEVA 2NQ5A 3UU0A 3T0AA 4GY1A 3KOYA 3O3RA 4LT9A 4JX5A 4GGHA 4HNLA 5EY5A 5A6JA 4XUGA 4FSAA 4C6EA 4JTEA 4Q6XA 1R6WA 4MNJA 3W24A 1A3WA 3WH8A 1AODA 1A4MA 3VIGA 2A3CA 1SQ7A 3VUPA 4Q7NA 1X1NA 3QBUA 3RO8A 5CBJA 3WJYA 3WELA 3AXXA 4JR5A 1GKPA 7REQA 3KFTA 3UWZA 1Q7MA 1W2PA 3WK2A 4EWND 1FDJA 2WMIA 3MO4A 4FP1A 3MUIA 4C65A 2W66A 3M0IA 4E2VA 1X7IA 4OOZA 1Q45A 2A21A 2XM1A 3RITA 1V3MA 5AB3A 1TV3A 1QW8A 4IJCA 2GGGA 3WQVA 5BOFA 3M5XA 3WLTA 4G5DA 1YHTA 2PPGA 4HA1A 3MPGA 4E8GA 2BOGX 3MUCA 1UMLA 3SGZA 5E9AA 2ACRA 1XIEA 1ZQ5A 1TUFA 4HPXA 2VR4A 1I2QA 4ENLA 2A7PA 4V1YA 2Y1HA 4FLSA 4LUJA 2PWFA 4JTAA 4AZ6A 2B0MA 3K8LA 3P2VA 4Q22A 1JULA 1KA9F 4AW7A 1GPWA 4KESA 1IEQA 3MB9A 4FB7A 1UUOA 1W5NA 4KFOA 2QDHA 5EMUA 2QS8A 4FMVA 2WXDM 1A5OC 1SSGA 4DF2A 1R85A 4S3AA 1W56A 5LHEA 3P0XA 4H4IA 3BAJA 3RX2A 1LZOA 2YL9A 3VD7A 3QYQA 2D23A 4MJ4A 2R6OA 1V02E 5BXSA 2OZ0A 4O15A 4PTDA 4KWWA 1YE4A 4ZQNA 2YXOA 4NASA 3EOLA 3PBVA 1KGWA 4Q8QA 1RPKA 2D24A 2UZ9A 3WQ8A 3UWQA 3DU0A 3NPXA 4ZBCA 3GDMA 1OY0A 4JTCA 3GG8A 1OABA 1SZNA 1PV8A 4NNCA 3TR9A 1DJXA 4PMUA 4WXYA 3G1RA 1ZP4A 5BOOA 4HT3A 3VOGA 4MDPA 2XIOA 1T8XA 5B80A 1IEIA 4ZB5A 4Y9NA 4GJIA 2HK1A 3G1YA 2QCHA 3FK4A 1XLFA 4YTTA 2MUCA 1OGBA 4WY0F 1E0XA 2WM1A 3WUBA 4WSJA 3OHIA 3DG6A 2GSEA 2BG5A 1FXQA 4JEQA 6XIMA 4QNEA 3T4CA 4QEEA 3BMWA 4GVHA 2RDUA 4O52A 5CC7A 1ZGDA 4FIRA 3SCSA 2R14A 2J9YA 3R58A 3O6DA 3V1HA 1EC7A 3ZQ9A 3OZPA 2E5BA 2DZXA 1WUFA 4KBXA 5C2XA 2BOEX 3L5MA 3W22A 3PJXA 4FZIA 2C1GA 3M64A 4I5XA 3JS3A 4IM4A 4EF8A 4L1GA 3WLOA 3C56A 3W27A 2FH8A 1WP6A 1CZ1A 1GHRA 1TJPA 2DW7A 3E0IA 1FCQA 3CPRA 1EBGA 4Q6JA 3DHDA 1VBRA 1UR4A 2X1SA 1B30A 4S23A 5DLCA 2FGBA 2QUNA 3QEZA 1J10A 3WNNA 2XSAA 3EWWA 2ZICA 1SZEA 1LCOA 2JFEX 4RK8A 3EXTA 4W7VA 2R8WA 1FH9A 2YPIA 3MHGA 1GVRA 1JVNA 2P76A 2A5HA 1LWJA 1XSIA 2Q8LA 3QLDA 1WCGA 2VC5A 3ARQA 2EPLX 5CJMA 5T9CE 5I78A 4GZEA 4KETA 4R5EA 5B7YA 2H8XA 3VDGA 5D9OA 1V3KA 3T44A 2POZA 4J3SA 3N4EA 2VR5A 2PU1A 3CTLA 4X2RA 3QFEA 1KQYA 2ZZ4A 1XYFA 5FESA 3H53A 2E9MA 2G97A 1UWRA 2P8BA 1U1UA 2Y8KA 5D37A 3RGTA 4HHHA 3UWWA 2OYLA 3S1UA 3VIOA 2E09A 1EJXC 3SUVA 3KBVA 4UQAA 2XVPA 2HJPA 1OK6A 1SO5A 1HQTA 4ORMA 3LHYA 1XIGA 1NIUA 3OZYA 3QLLA 1ZHAA 3L4VA 4JDYA 1NFGA 3TSMA 1PEZA 1I0DA 2YA0A 2XGIA 4NJJA 1XQLA 1K8XA 3F7JA 1H63A 3H7RA 1K70A 3BSHA 3VNIA 3I68A 4H6RA 4QJ1A 2BBFA 1V6XA 1EWDA 1VH7A 4ES4A 2WQPA 4DBDA 1H62A 3ZR5A 3L4WA 3CQIA 2VFIA 4CU6A 1DXEA 4LCRA 1Q6GA 4LPCA 1LT8A 4JXCA 3MCOA 1E5JA 6XIAA 2CZDA 4Z17A 4ZSTA 3VX0A 1GYMA 3W83A 5K7JA 4MYAA 4K37A 3SN0A 2WJEA 4L9ZA 1NDWA 1RAKA 1E72M 4PSRA 1AJZA 2CESA 3HQOA 4B3LA 3C2FA 2GVEA 3QFWA 1V6VA 1UR1A 1MNSA 3IJ9A 4PCTA 1HL8A 2FZ9A 3R8HA 5I3GA 5A6KA 4C1NB 1GTEA 4Z08A 3DIPA 2EO7A 1V7YA 4MLJA 1Z69A 2FH6A 1FRBA 3W29A 4ORIA 4PMJA 3W38A 1E70M 1Q6RA 1VFSA 2J24A 4E3TA 2G4JA 1A5NC 1FWNA 4DJDC 1JFXA 3FA5A 1QR7A 4Q4PA 2WJDA 4IMFA 3VFLA 1NOUA 4BHYA 3WFAA 3G1FA 2QXWA 2WC7A 2PBOA 1LG1A 4ACZB 2WZEA 4PBFA 4E2BA 4QE5A 5I3IA 4N02A 5HNNA 4ZQPA 3LMZA 3GXMA 3OQ8A 1H5YA 1ISXA 2E9BA 4JIRA 3V1PA 1IT0A 4HK6A 3TE9A 1P0BA 4LBRA 3W26A 2YX0A 4H3DA 4MVAA 1EJRC 1Q13A 2UV8G 3EPMA 1DP0A 4Y6GA 4PMXA 1V5XA 3IK4A 3WEOA 5F2MA 2CBVA 1FWEC 2AKZA 4IIFA 2L5HA 2I5GA 4GMEA 4PRTA 2EPOA 4WXZA 1FH7A 1A3HA 3QZAA 4S3CA 1QNQA 1UR0A 3GO2A 3HPAA 3W7CA 1I8JA 1GVEA 5A5WA 5L9FA 4QEHA 2P0OA 4UCFA 3H2OA 2HEJA 3WFLA 3JRKA 3MCMA 4GA8A 1JPKA 1U5HA 3D5HA 2ABBA 4O11A 1WXZA 4HKPA 4PRWA 2DT3A 5C55A 1G0CA 2ZXBA 3GY1A 4OVXA 3ZVHA 4H6QA 5GNZA 1LUCA 1GWJA 2HVMA 1TPUA 1HFBA 3GVWA 4WJEA 1AFSA 3LTSA 1UR2A 3VDAA 3CIWA 4LAKA 4ZZ9A 3T8QA 1FP8A 4KKXA 1NELA 1L2UA 3SY8A 4JTTA 5EL1A 3TQVA 3THUA 1KR1A 5D9NA 4OV4A 4UTUA 2V3GA 4DZAA 1L0PA 1DE6A 1W9VA 2AAMA 4KCWA 1VFHA 2KX9A 4DWDA 1BRLB 3TNBA 3PM6A 2E0PA 3W1PA 1QTWA 3LXBA 3PG9A 1NSJA 3FVMA 1K7XA 4KEZA 1O66A 4LC6A 3SCTA 2DZAA 3W53A 3QY6A 3THCA 1RSCA 2YYTA 4WKFA 1WDWA 3KWXA 4H19A 1X1ZA 3FCPA 3PJWA 4MKSA 3RXZA 5I3DA 1E4LA 5CZJA 3UZXA 4FALA 3W74A 1V79A 1B3OA 2UY3A 3QGVA 1AMKA 4Q8UA 3DYMA 1WX0A 1OX5A 1UYQA 4ASTA 3NSNA 1WPCA 2DQXA 1WDRA 4BCEA 1E9ZB 2XM2A 1UD8A 4LU0A 1PCWA 2VURA 4R85A 4ML4A 3R89A 4C7DA 4GY0A 3TN4A 5BRBA 2QYGA 2JE8A 4RV3A 1VD6A 2ZZ6A 3EWXA 1UWAA 5DY2A 4B4FA 1R8LA 4M6UA 4N7QA 3DFYA 1KFCA 1GHSA 1H0GA 1HKIA 3KDOA 4N9EA 1LF1A 4NAFA 1QCWA 2WHKA 3S1GA 5EKYA 2QCDB 3WH9A 1ENUA 3IJIA 2ISDA 3K8KA 2P53A 3MY9A 4RLIA 4DVOA 4BEUA 2WKGA 3LK6A 3S1XA 5DO8A 3D46A 3TTEA 3GS6A 1ONEA 1F6YA 2Y5JA 3SQMA 2J7DA 3RU8X 4XKYA 2BY0A 5H8MA 3DGRA 4DPQA 2PAJA 4A8LA 2WHMA 4GQGA 1R2TA 2H9AB 4P8XA 3NQBA 3STPA 3NGJA 3A9BA 3IJ8A 4HGXA 2GVJA 3STEA 1W91A 4TOQA 2P8CA 4I7UA 4IGHA 5MKGB 3BLKA 3G8RA 1UA3A 3AXMA 4IQLA 1LQAA 4JHZA 3KM8A 5JIPA 4NJKA 4MLRA 3MO7A 3CK5A 4WQ6A 4AY7A 1I2PA 4RE0A 2X7VA 4LVAA 5BNKA 4O4VA 2PEVA 2EHHA 3UF9A 1RY0A 3VINA 3F4VA 4G1NA 4U3CA 3A3HA 1P1XA 1RVKA 2ZKMX 4XWUA 6CGTA 3VX1A 4H7VA 4FOJA 1B9ZA 1J0IA 4B5TA 2VX7A 2PWDA 2ZA1A 3GDTA 3C61A 4ZENA 4S3GA 5ECUA 1IWAA 2DUXA 3GUGA 4XIMA 3PPFA 1VCGA 3LV5A 2RUSA 1V6YA 4M29A 4Y2WA 1KFJA 4YTSA 2XFRA 1TZZA 2PDCA 2OSWA 3GRIA 1R2RA 2XGZA 4IQJA 5M03A 1E6NA 2A6NA 1C8VA 4IPJA 4AVFA 2PWHA 2O9PA 1BQCA 3PFMA 4JTFA 1JQXA 3TAOA 4ZB0A 4JIEA 5BZAA 1YXCA 1KCKA 1I75A 1SUXA 2ZC8A 4XBKA 1FKWA 5A8NA 3W7QA 1MXGA 5AHLA 2G3FA 2VVSA 2Y88A 5HWNA 1MW2A 1CXHA 1MI3A 4IFKA 3UR5A 4CQAA 2YBUA 5XINA 3V3WA 2QUTA 4L80A 3TH6A 3URQA 1MUMA 3KTCA 1WDDA 4Y9PA 1C29A 2OLSA 2HE8A 3RO6A 4HPHA 3R7MA 1RA0A 5FKYA 5LA2A 4LS1A 4QJ4B 3VNMA 3W7GA 2EPNA 3NSXA 3GC4A 2YLAA 3PZUA 1TWIA 2BFGA 3SR7A 4TX9A 5K9CA 2W27A 5FEPA 3WD2A 4FNQA 2NUWA 3W75A 3BLOA 3QTGA 1EH9A 1KGUA 1J0YA 1GEQA 4NZ4A 4JFUA 4V28A 3VFCA 3GU9A 2VJXA 3VOCA 4CCDA 2YZRA 3LTPA 4PRRA 2EAWA 4JTHA 5HPOA 2Z1XA 3BCFA 3NDOA 1WYIA 3NO3A 3TROA 1IYXA 1WZAA 1EJVC 4IOTA 4INFA 5K9XA 3U7VA 5FSEC 3VZZA 4CNSA 2CBIA 2CBUA 4C5YA 4K68A 3SCPA 5DCBA 2CZFA 1ZLPA 4AX7A 1CXIA 4KIEA 3PG8A 3PUDA 5D9MA 2HS8A 3KS5A 5I06A 1VFUA 1KBBA 3RM4A 4Q8WA 1KFBA 1MO0A 2QZRA 3VI2A 3P84A 2FZ8A 4LANA 4L6DA 4QXIA 3TMQA 4XZBA 3DC8A 3L2IA 1T40A 4LB3A 5I0DA 3SN1A 4S1FA 4H8UA 1ZCOA 1PKYA 2NSOA 2FTWA 2RDWA 3GVRA 5DN1A 5DMLA 1A80A 1VR6A 5HULA 1JPMA 1OBAA 4D6JA 3CT2A 3AS1A 1KBLA 2AMXA 3GC5A 5T9BG 1DYSA 3DENA 3RDKA 5C9WA 3ITOA 4HZ8A 1G94A 3AMGA 1CIUA 2C79A 4UTIA 4EKJA 3ORWA 2RJHA 4KS0A 3M1ZA 3NXLA 3MS8A 2X41A 1TMQA 3WQDA 4KRTA 3GAYA 4M0XA 1Y5XA 4F8XA 2A2IA 2CBJA 2ATSA 4AIOA 1TPB1 3QY8A 1TKKA 4B5XA 4BEQA 1VIZA 2YL6A 1TWSA 3CUZA 3M07A 5BWAA 4AWUA 3TK7A 4R9XA 2RGLA 1JCJA 2GVGA 3LS9A 4S3KA 5IBXC 3R12A 1UH3A 2VL4A 1ISVA 3GNDA 3MWCA 1SFLA 1VKFA 3QGAC 5KTLA 4Y8FA 2WZTA 4LYPA 4F9DA 4IGMA 5E0CA 3QH2A 3EB4A 4F79A 5HMSA 3G1SA 2XG9A 1TB3A 2HVNA 4YLWA 2ZYFA 5FACA 2OT0A 4RPPA 3UESA 3XINA 4PSPA 1DORA 3P80A 5C9XA 3D3FA 1DWGM 2PI6A 3ZT5A 1PKLA 4PTMA 2QCMA 4L7ZA 3UVAA 1W5MA 5HBFA 3CMJA 2NQZA 2P88A 1V7AA 4UMAA 4URIA 4JKMA 4BF7A 2HROA 5LYRA 1P4CA 5AYXA 1GUVA 1AQHA 1IXQA 4H1ZA 5HR7A 4LNYA 3MYOA 1XIMA 1QATA 4UIOA 4GUGA 3R1ZA 1UKPA 4MG4A 3M6DA 3AJ7A 2NQJA 3CGTA 3PNZA 3DX5A 3OEXA 4JFVA 3TWBA 3R8GA 3FJNA 3LQGA 2VRQA 3INPA 4MPKA 3XIMA 3WLSA 2CITA 3SCUA 2PP3A 2PDIA 1TIWA 3JZUA 1BTCA 1DQUA 5HANA 3TJIA 1B54A 1XX1A 3RF9A 1DXFA 2OGJA 3T08A 3FGCA 2GK1B 1UP2A 1GOMA 4X63A 1W2VA 3O9NA 4OZOA 4UFLA 3S6DA 3BJFA 2XYLA 4L9YA 4ZO9A 5D4YA 3PZNA 4L61A 1TE1A 1O1ZA 5CG7A 4M19A 5AFDA 1TZ9A 3MQTA 4H83A 2DT1A 3ZJ7A 4AVNA 4D8LA 1PIIA 2QULA 4O16A 1A4LA 2ON3A 3T05A 2ONEA 3MBFA 5DCEA 1RP8A 1JDAA 2NQLA 4AB4A 1UIPA 1UOZA 2VCCA 4QNWA 2DVTA 4WGXA 1EHAA 3NYZA 1HXJA 4KCVA 1OZMA 3IANA 1PZ0A 1JUKA 1TTPA 4CQDA 2HXUA 1R38A 4LGXA 3VNYA 1R46A 4NIRA 2J74A 4IWWA 1FOBA 4PYSA 2PLJA 3H8AA 3APTA 2QF7A 4UC5A 2ALRA 5AVNA 4F0SA 3B9EA 4G7EB 3U8GA 1FHVA 2WAGA 3L4TA 4W8LA 3BDKA 3STFA 1XGZA 3BG9A 2J47A 1UWQA 2WNQA 4J40A 1EJWC 1PCKA 4Q8VA 2BHZA 4AZGA 4YIWA 2EG6A 5D9PA 5DY3A 4K8GA 3WZ0E 2V63A 1FCVA 2PWEA 4MYXA 4MF4A 1K6WA 3OB8A 1OWQA 3IAPA 1W1TA 3VM7A 3QHOA 4OBTA 2GLKA 1A5UA 3B06A 3TYUA 4LAUA 1K3UA 4EX4A 3LXAA 1UPMB 1US3A 5EMLA 5E5CA 1OD0A 2QVNA 3N9KA 4Z1DA 3KXQA 4LUSA 3R11A 2F9RA 4Q8OA 4JKKA 3E2RA 4PA8A 5AC7A 4RW3A 3B4YA 1MZHA 1TPC1 3NSMA 3SURA 3VD4A 3KRUA 1FVPA 3VE9A 1HP5A 4W4QA 4E4FA 4AZ7A 3W73A 5BRPA 2WMKA 2YR1A 3BV7A 2YCLB 4D8ZA 4JHMA 2YCJA 4FX8A 3UYCA 4GWEA 3GW3A 1L6YA 3BW3A 3LHZA 4JYDA 1E9YB 4HMNA 4DUXA 4WOZA 1GJUA 2VEKA 4MZ1A 2FGZA 1YPFA 5CG0A 5I77A 2C3ZA 4RE4A 2OLHA 3M7WA 1R3RA 3W3OA 5C70A 2PGFA 3HM7A 1R30A 1PDZA 1F74A 3KBNA 3L9CA 4TUFA 3VGFA 1LWIA 4AD1A 3PUOA 2RJGA 4PFMA 3E2SA 3CPUA 5FL1A 1XGEA 5BOEA 1W1B1 2PWGA 3HV8A 4CQ8A 2E1DA 2J62A 4ZODA 4HZ6A 1WUEA 3QW3A 2D2GA 4YXGA 1KWKA 3A12A 6REQA 2G37A 3V7PA 2UBPC 3GE7A 3P8JA 3LHTA 1X38A 3MT1A 3EOSA 3BL3A 1HL9A 3QZ6A 1Q4WA 3HZ3A 5J8LA 5REQA 5C54A 1BG9A 1KKRA 1UWUA 1BXCA 1US2A 4K1WA 3MUXA 4B2DD 5HATA 2BXYA 2HSAA 1XYZA 5HDRA 4DYJA 4I7VA 3BW4A 3GVVA 5DXYA 4YHGA 4IFOA 5IM51 1H7RA 3EB3A 3NAVA 4AY8A 1Z8AA 3R6IA 1LROA 3U5UA 5G2HA 2QDEA 4I5RA 3RLVA 4AMAA 1QVBA 3CHDA 3IIXA 4OIFA 4F0MA 1OCNA 1V3LA 4NNAA 1PTDA 3GM8A 4JN6A 1DJNA 5AECA 3ABOA 1MEHA 3A21A 3W28A 4UQDA 2GPTA 2VEGA 3OBAA 3STGA 3QHNA 3UWEA 5I00A 1QPNA 4Y8EA 2H3BA 2NLYA 2NVCA 1Z32X 4R53A 1E15A 2VQUA 1M01A 4FXFA 4NZ5A 2ZZ5A 3P5YA 1FX6A 3E12A 4B5SA 1H0IA 2ZTJA 1SGJA 3L65A 2CKRA 3EKLA 1CECA 4UWMA 2C71A 4RZ5A 1BVZA 3OZMA 2X2YA 3U0HA 4D1JA 4D2JA 3WBXA 3T9PA 2CZEA 2OQHA 1L6SA 3IVSA 3P82A 4WKAA 3VIFA 2ZFAA 1LL4A 1TE6A 1HJQA 2J7CA 2E77A 1FDYA 3NDYA 3EDJA 4ZMGA 3EDEA 2CEQA 2YL8A 1HGYA 1W9UA 1TVLA 4IUGA 4QCFA 3SGUA 1NWUA 1P43A 4OJYA 3IJDA 5AVHA 5H2ZA 3R10A 3KS6A 3MSRA 3LSCA 3CM4A 1QAPA 4NXKA 3K8MA 4N6FA 2PDWA 3CV1A 5KETA 1ZBVA 4H9TA 1OQFA 3F4NA 4LBUA 4PE8A 4MZYA 3B3DA 4GBDA 1P1MA 3DYPA 2VGGA 3OA5A 3ZYZA 4XKYB 1W1A1 3AWNA 4UQBA 3OVPA 5EFDA 4LVGA 5DBTA 3VKJA 4U10A 4HOXA 3DI1A 4XKMA 3M9YA 1I9CB 4KEMA 3NQAA 3ERPA 1KBIA 2FKPA 2QMJA 4OT7A 1EJSC 3CV2A 2J78A 1O60A 4LV9A 2ZUTA 3A4AA 4M82A 4O1DA 1Z6KA 5ABHA 1E55A 1TV5A 3MU7A 3FAWA 5BRQA 4J1OA 3WMBA 3DXIA 3RLUA 3WLPA 3PBGA 2XUCA 2E6YA 4CNUA 4F0RA 1JXJA 4D6IA 1MRQA 1NDVA 3LHVA 2WW5A 1NF7A 3OA3A 2PTYA 4M51A 1QK0A 4NRSA 1QNSA 2J9ZA 3ECQA 2XINA 2R82A 3C52A 1M1BA 9RUBA 3CAWA 5C7VA 2QIIA 3B9DA 1W3HA 1XD1A 3C0JA 3NUKA 3URAA 4LAMA 3NTYA 1PYFA 1P6WA 4KCTA 1KBKA 1XCFA 4BWLA 4HMDA 3SUWA 3PPHA 3T0BA 5C0QA 1LT7A 3PBWA 1PZ3A 1B4KA 5ABFB 3QYSA 2V5DA 4QJ5B 1UD2A 4FOKA 1Y7VA 1JEZA 3GH4A 5EMMA 4GOAA 2ZOXA 2I5QA 5FJOA 2ZX8A 5BROA 4LEQA 1SJDA 3VMOA 1UA7A 4C6FA 3RM9A 5FI8A 5E0KA 2E68A 1OFPA 1Q2RA 1GVFA 1GVSA 3TMLA 3WLJA 3FLUA 5IDIA 2C6QA 1IWBA 1KFWA 3A9IA 3EPNA 5IFTA 3WDIA 3RNDA 3KCOA 1QNOA 1V3JA 2FVKA 5CGQA 2VZVA 2GGJA 4YVVA 3BANA 3M44A 4YWIA 2QDDA 4JKLA 2DP3A 1KXHA 3WBWA 4WKHA 2YSWA 1CBGA 3IK2A 4JTGA 1J6OA 3AI0A 1JFHA 1SFJA 2Z2UA 2WMHA 4M3PA 3NOEA 5I02A 3GC2A 5A8PA 2CC0A 3UERA 5AYIA 4DEFA 3ABQA 5TBOA 2BS9A 4O17A 5D2XA 5FF3A 3EOUA 5TAOA 3MZ2A 3M16A 1OFEA 2PDFA 4OV9A 1YBQB 4W8BA 1T7LA 1SZRA 2RGMA 3LRMA 4HA4A 4GUHA 1Z7AA 1HJVA 4GUFA 2BVWA 3L21A 4AHPA 3PWIA 1U1HA 5GNXA 4MY1A 4GYPA 4Z1BA 3II1A 2XU2A 3W7HA 3LSBA 2OZ8A 2YL5A 3CZ8A 2QVHA 4PODA 3H2NA 2BGNE 5HNRA 2BGSA 1QNVA 1EEXA 4LC8A 2VCBA 3TU9A 1OFRA 4ZOEA 1CB2A 2ACSA 1TJ0A 4R27A 2BV9A 1XYMA 2ABAA 2O56A 4NP7A 1XBZA 3USZA 2G4FA 3UETA 3AMDA 4KCUA 2GQAA 4O1AA 2PDLA 4HZMA 3PTQA 2VZOA 1G4EA 2YFOA 2GUUA 3A4XA 3SFWA 3TSBA 1OCQA 1JF5A 2H9AA 1O5RA 4UTMA 1TJ1A 1ODUA 4IMEA 1TR9A 1PX3A 1D7FA 1XBYA 5BMXA 3SUTA 3VD5A 1NWTA 1XISA 3NQGA 3M0KA 5M1TA 3FEQA 3P14A 3R79A 3OYXA 4BK9A 3RUBL 1TSIA 5HUPA 2YA2A 4R7WA 1Q8JA 4QE1A 2I1OA 2XIIA 4OFCA 1S1PA 2WMJA 3OOQA 4GFIA 1K1DA 3ME3A 1FDZA 5A1AA 2DY3A 1J11A 1E0UA 1A5MC 2OWXA 4NZJA 3EKGA 2W63A 1PPIA 4G6CA 1NF0A 1TZ7A 4B9ZA 3RMEA 2JBMA 4ZXOA 8CGTA 4C6KA 1D8CA 2GJXA 3R5EA 3WH6A 5M17A 2PA6A 3KUMA 2XFYA 5ECVA 4LUTA 5FIPA 4E6MA 1XRSA 3KL0A 2INFA 1EGVA 2V3FA 4XUYA 2KZHA 3O8AA 5A6LA 3NCOA 3MW7A 2HNHA 4BF5A 4R7OA 4CD5A 5IHSA 1H61A 2WB5A 4DNHA 3MSGA 4A21A 1RK6A 4GIAA 5G1YA 3LU2A 1F6PA 4HSOA 4JQ3A 2Y63A 4IMCA 2CLKA 4RZ6A 5LNUA 3N3MA 3SCRA 3WF1A 4DUVA 4DWSC 2PFHA 1AZ1A 2HZGA 3B97A 3PTKA 3E1F1 4UMCA 4W88A 3HG5A 2XJ7A 1ZP3A 1WOBA 5HQEA 4DB7A 1G7UA 1NFBA 2A0NA 4LWWA 3UNDA 1G1YA 1RD6A 2WWDA 2EPHA 1M04A 1JCTA 1P7TA 3WBEA 4X60A 4P8VA 4U2ZA 3OO2A 3KVJA 4LAZA 3N18A 2ZRXA 1U83A 4UFMA 4RDWA 5BXTA 2YDAA 5TNVA 4UTKA 3TQKA 3LCHA 3WQCA 4W85A 1BQGA 3H4WA 4REQA 3BOLA 1FWTA 3CLMA 6TIMA 4PMVA 1E3ZA 3TX9A 2TAAA 2NXGA 1N8WA 4GC3A 3TIMA 2FHBA 4KEUA 4DM1A 5HMFA 4DN1A 4GISA 3ZVHB 4S3BA 4LY4A 1XUZA 2VC7A 4JNMA 3NR0A 3EXRA 1KWGA 3B4UA 3BTNA 3O05A 4P7NA 4RZBA 3ZFHA 1GOOA 1XLGA 4JTJA 3UYIA 5CKSA 3BGJA 2BTMA 1BFNA 4V1XA 3WBYA 2JF7A 1GZGA 1VFLA 4TX6A 3WIJA 5IFPA 4JIPA 2ZXDA 3FHQA 3W9ZA 2C1HA 4PUNA 2NWSA 4CNOA 3CV7A 2O7SA 3DDMA 4G9PA 1ADDA 3G3MA 1ICQA 1US0A 1F73A 1VF8A 3QMTA 3LCFA 3URBA 5F1UA 1YE6A 5F4WA 1HT6A 3GD6A 1OB0A 2VGIA 5AY7A 3I4EA 2FVLA 1QBAA 1FWHC 3BSGA 3QKEA 1RK5A 2V3DA 4JIQA 4Q7BA 3QV9A 3KZSA 3CUFA 4O14A 2WKJA 3W2MA 2QPXA 4WDXA 3RM8A 1VBJA 1V6TA 2W67A 3BW2A 4UTFA 4GQBA 3HA1A 3I6RA 3S0CA 4FF5A 4JCMA 1IEXA 3WF0A 1WDQA 4QS5A 3UCDA 3CO4A 4LTSA 2CETA 4Z0JA 1W6TA 2FZBA 3C4UA 3S2MA 1NEYA 1TVPA 4ZOCA 3RR4A 2P3EA 4JZ5A 4OUIA 3WNPA 3S5YA 5DCDA 3LV6A 4XSMA 5EYWA 1CYGA 3CWHA 1H1YA 2GQ8A 2HBXA 3R8RA 4GCXA 3DFOA 3PR2A 1VPQA 2CHRA 1QI4A 3ZSTA 1TPVA 3DHFA 1EA9C 5CC3A 1DJGA 2XISA 4QLJA 2DZTA 1MMFA 3BZJA</