3NUVA

Crystal structure of ketosteroid isomerase d38nd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D38ND99N from Pseudomonas testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 34
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nuvA00
2XSOB 3VSYA 4R9KA 1ISKA 4HM5B 3EJVA 1IDPA 5G2GA 3DXOA 4HM3B 2HMLB 3EX9A 1QMAA 3MKIA 1O7PB 1ZX2A 2BMOB 2HMMB 2YFIB 2F98A 3NV0A 4K1UA 4L7KA 5CLKA 3OXAA 2PZVA 3NXJA 3HX8A 1JB4A 3FZWA 5AIIA 4HKVB 4XB5A 1ULIB 2GEXA 2OWPA 3F8XA 2HMNB 4HZ9B 3RGRA 1OF5A 4H3UA 2F99A 2GEYA 3T8UA 3EN8A 3UNLA 2GXFA 3OWSA 1A2KA 3MG1A 3DM8A 1DMNA 1OHPA 3T8NA 2XSHB 2Z77A 5DREA 3RGAA 3KKGA 4PEJA 5HGRA 1Q40B 1O7NB 4R1KA 4L8OA 1O7GB 3MHEA 1QJGA 2Z7AA 4WP5A 3EN1B 4HM1B 4L8PA 4LEHA 4IIAA 2RFRA 4X2HA 4KVHA 1WQLB 3MYTA 3F9SA 4STDA 3F7XA 2YFLB 3SOYA 2K54A 3E99A 4XM4A 3NV0B 2HMOB 3SEDA 4HM7B 3GRDA 1JKGA 1BUQA 4XBYA 5IG0A 5KP4A 2YFJB 1ULJB 1GYBA 5IEPA 3HK4A 4HZBB 5FW5A 1OUNA 3BB9A 3FLJA 1OF5B 3DZLA 3KSPA 3IPTA 5D81A 2IMJA 5D82A 4N3VA 3B7CA 3LZAA 3MG2A 3I0YA 1SJWA 4I4KA 3H3HA 2B1XB 4HM2B 5IF6A 3WMDA 4OUQA 3M8CA 4CDLA 2A15A 3F40A 3F8HA 5AIFA 1C7HA 5JPUA 1ZO2A 1NDOB 4RZMA 3F14A 2BNGA 3FKAA 5TGNA 3CU3A 5AEWB 4J9AA 1OCVA 8CHOA 5CK6A 1GY7A 5AIGA 1DMQA 4Q53A 5AEUB 5D83A 3KE7A 2XRXB 3OWYA 3EHCA 1JB2A 1JB5A 1CQSA 1ASKA 2BMRB 2GBXB 3CPOA 3HZPA 5IENA 1W00A 1OPYA 5BXQA 1VZZA 4ORLA 3D9RA 1K41A 1JKGB 3EBYA 3K7CA 3NBRA 1E3RA 3KZTA 3B8LA 5AIHA 4HVNA 1NWWA 2XR8B 1STDA 3A76A 3B4PA 3CNMA 3F7SA 4FCJA 1O7MB 3JUMA 1OGZA 1EG9B 1UUWB 5IG5A 2QIYA 3ECFA 5IG4A 3DMCA 5JPPA 3K0ZA 4HM8B 5EVHA 2R4IA 3JUNA 4GB5A 4K1VA 3GWRA 1GY5A 1Z1SA 3G16A 4J8TA 3EQQB 4LMIA 3BLZA 1E97A 1W01A 4OVMA 1TUHA 3NUVA 3GZXB 3EBTA 2F86B 2UX0A 3STDA 3ROBA 4XBTA 2QGUA 1OHSA 1OH0A 1TP6A 3EF8A 2HMJB 3S5CA 5DRVA 3JUQA 4HM0B 3MSOA 1UUVB 3OWUA 2I9WA 5CF1A 4WYKA 3H51A 3NHXA 3MG3A 3GZYB 1HKXA 5CXOA 2JQ5A 1JN5B 5AI1A 1NU3A 2B24B 3UJMA 1Q42A 4R9LA 4XBXA 4HM4B 6STDA 3Q90A 4X2OA 3CNXA 5IG3A 2RGQA 3JUPA 5BVBA 3FF2A 4HJLB 1GY6A 2BMQB 5KP1A 2HMKB 3GZRA 4XDWA 3VGNA 1W02A 5KP3A 3OX9A 4U13A 2GBWB 1JN5A 3JUOA 5IEOA 4HM6B 2W2CA 3FGYA 4MJDA 4FCMA 4XDVA 1OGXA 3SOAA 3GZBA 4WWUC 1AR0A 2STDA 3OV4A 1O7HB 2CHCA 1OHOA 4LGQA 1O7WB 2RCDA 5CF2A 3B4OA 3FF0A 2Z76A 2CKFB 1Q40A 3EC9A 3FH1A 3NM2A 3LYGA 1S5AA 5IERA 1E3VA 3DUKA 3FSDA 3G0KA 5STDA 4WYKB 7STDA 3G8ZA 1EA2A 1U5OA 3ER7A 1W6YA 1DMMA 2INXA 1GS3A
chains in the Genus database with same CATH superfamily
3PYJA 2CFKA 2XSOB 4EBGA 3VSYA 1DYUA 1QALA 2GU1A 4BU4A 1IT7A 2OOVA 2K0MA 4R9KA 1ISKA 4HM5B 3EJVA 1AVKA 1FGOA 1GOUA 1IDPA 2Y74A 4RBNA 1GSPA 4NHFA 1NB5I 1WNHA 1BRNL 5G2GA 3X41A 1VQ43 2YX9A 4WHAA 3DXOA 4HM3B 2HMLB 3EX9A 2Q07A 1UCLA 3PS8A 4FMCA 3FG1A 2CH9A 1N9JA 2AADA 1KWIA 1QMAA 2O9UX 3MKIA 1YJN3 4ZM8A 1QVF2 1SARA 1O7PB 1ZX2A 2QEX3 1UGHI 2MF7A 1FGTA 1GOYA 3X3YA 5M18A 3CCS3 1FA3A 2BMOB 2HMMB 4HOHA 3QRDA 5FGOA 3V92A 2W9QA 2YFIB 2L4VA 2F98A 3D5GA 3NV0A 4K1UA 3S67A 2H0HA 3N8BA 3TDGA 4MEIA 2GSPA 4L7KA 5CLKA 3OXAA 3DH2A 1D6YA 1IQXA 2ZL8A 2PZVA 1SIIA 1UW1A 3NXJA 4GHOA 4FMAA 2OTJ3 2CFDA 4EYCA 5M19A 3HX8A 1JB4A 1RLSA 2W03A 1JZDA 3FZWA 5AIIA 1RGEA 1RGHA 1LOXA 1ZS7A 4FMDA 4HKVB 4XB5A 1ULIB 2GEXA 1L5GB 2OWPA 2WGOA 1LQGC 1Y4KA 2CFWA 2K3DA 2HMNB 3F8XA 3FG4A 4HZ9B 3RGRA 4N6MA 3CCE3 1OF5A 1AQZA 1I8VA 4H3UA 3HIIA 2F99A 2GEYA 3PXMA 3Q3FA 2MC8A 3OW22 3T8UA 3K5TA 1FUWA 3AGOA 3EN8A 3UNLA 4J5KA 1GMQA 1LNHA 2GXFA 5EEOA 3OWSA 1PY3A 4EC6A 1B2SA 2KRTA 1A2KA 3K9MC 3NQZA 3Q1CA 3X42A 3ZFZA 1EQKA 3MG1A 1IVUA 1W6GA 3K63A 3DM8A 5JBSA 1DMNA 1D6UA 1RJOA 2E2TA 3AMOB 1BNRA 4BTYA 2PNCA 1OHPA 3T8NA 2XSHB 2Z77A 8RNTA 3LOYA 5DREA 3RGAA 3KKGA 4N6LA 3JVCA 4PEJA 5HGRA 1Q40B 1TFOA 3U1WA 1CYUA 5LC6A 1RCLA 1O7NB 1SQWA 4R1KA 2KF3A 1BGSA 3WR2A 4L8OA 1O7GB 1BVIA 2Y73A 3MHEA 2OQEA 2W9PA 1QJGA 4N6NB 2Z7AA 4BIRA 1KC84 2FXTA 6GSPA 2LYXA 4WP5A 3EN1B 4HM1B 4BTXA 4L8PA 1BRGA 1YGWA 4LEHA 1RCKA 2KF6A 3KCHA 1YVSA 2CWVA 3FCSB 3BNCA 1K28A 1DE3A 1T2HA 2FGTA 1AV4A 4IIAA 3U97A 3URPA 4N6TA 2Z6BA 2ZDJA 2C4BA 2IUJA 2RFRA 3SLUA 9RNTA 1K734 4X2HA 1Q824 1BNSA 2KAAA 3LTBA 3CCU3 1Q7HA 1RGFA 4KVHA 1GD3A 1RHLA 1BNFA 5BU4A 1WQLB 1RGLA 3F9SA 3MYTA 1IV7A 4STDA 1JBSA 2E2UA 4DKIA 2H0GA 3PZWA 5ELUA 2GU3A 1GMRA 1YIT3 1IVWA 3LTAA 3F7XA 2YFLB 3QK9A 3SOYA 2K54A 1TFKA 3KIIA 3E99A 1YJ93 4XM4A 4OK0A 2CFLA 3NV0B 1X1YA 2HMOB 3SEDA 1GMPA 1LOVA 4HM7B 3GRDA 1JKGA 1BUQA 4XBYA 5IG0A 4CPKA 3WA3A 3LMLA 1FZUA 5KP4A 2YFJB 1ULJB 1V57A 3BNDA 3D3LA 3CXC2 3DGNA 1B27A 1GYBA 5IEPA 3HK4A 4HZBB 5FW5A 3KFQC 3PCSA 2D1WA 1OUNA 3BB9A 3FLJA 2V1LA 1BIRA 2XGLA 1OF5B 1RTUA 3DZLA 3KSPA 2JDIH 3IPTA 5D81A 1GD4A 1X1WA 1KQS2 1NO3A 3IMAB 1ROAA 2IMJA 5D82A 4MMZB 3UL6A 1HYFA 2P38A 4RNYA 4N3VA 4NREA 3B7CA 1RNBA 1RN1A 1WMOA 3LZAA 4QWTA 1UCIA 4N6UA 2ZHXB 1FW7A 2W56A 1N5HA 3I0YA 1IQYA 3MG2A 3NBBA 2XH9A 4K61A 1G0TA 2SBLA 1RMSA 1SJWA 4I4KA 1B2MA 3H3HA 2B1XB 1STFI 3N9HA 4HM2B 3D4AA 5IF6A 3WMDA 1FGRA 2KCDA 1KD14 1RGAA 4OUQA 4FR9A 1DVDA 3M8CA 4H61A 4CDLA 2A15A 3HI7A 4WFOA 2IY2A 2XF3A 3F40A 3F8HA 4TX4A 1F8NA 1MWSA 5AIFA 1BRJA 1C7HA 2UUGC 5JPUA 1A2PA 1ZO2A 3D79A 1EKMA 1UI7A 2OOVC 1AVLA 1MOLA 1B2ZA 4FMBA 1NDOB 3LH4A 1BSEA 4RZMA 1A90A 1JV2B 3S28A 3J7Yd 3F14A 2BNGA 3FKAA 3CCV3 5TGNA 1MGWA 1IK3A 3CU3A 1W2ZA 5AEWB 2OCTA 3WHOA 1VQM3 1KSIA 3NBJA 3N54B 2CFGA 3S27A 1TJDA 3L0RA 4J9AA 1OCVA 1BU4A 4KZ1A 1YVBI 8CHOA 5CK6A 1GY7A 1RN7A 1IQ8A 2CX0A 1Q814 5AIGA 1DMQA 4Q53A 5AEUB 1JRQA 1US1A 5D83A 2WOFA 1YIJ3 1RGKA 3CMA3 3KE7A 2C10A 4LZIA 1WMPA 2P09A 4J5GA 2OTL3 2CWTA 4EV5A 2XRXB 3OWYA 1N8R4 4K90B 1BOXA 3EHCA 1JB2A 1JB5A 2RBIA 4FCZA 1CQSA 1ASKA 4N6V0 2BMRB 2P0MA 3AHSA 2GBXB 3CPOA 3HZPA 2ZA4A 1IVXA 5IENA 3WODG 1W00A 3DGMA 1OPYA 1JJ22 1R4YA 5BXQA 1VZZA 2F5MA 4ORLA 3LT8A 3HIGA 1DETA 1M1K4 3D9RA 3LTCA 1K41A 2UGIA 3SYUA 1MWTA 1LXEA 1UCJA 1B2UA 1JKGB 2R41A 4HAAA 3EBYA 3CPW2 1BSBA 3K7CA 5AYSC 3NBRA 1E3RA 2KXGA 1MGRA 2CX1A 1NNVA 3ALAA 1I2EA 1W7CA 3KZTA 3B8LA 4O8SA 3G4S3 1YJW3 1BRKA 2E2VA 3WOFB 5AIHA 1A2VA 1PU4A 2P05A 3EB8A 1Q864 1VQN3 1RRHA 3LT9A 3NM7A 1IT8A 1S723 4HVNA 1NWWA 2XR8B 2D42A 1STDA 1RDSA 3EE1A 2CK3H 1I3IA 2QA43 3A76A 3B4PA 1YHQ3 1VQ83 1ROVA 3CD63 3CNMA 5RNTA 1BNIA 3DGYA 3F7SA 3Q2PA 1V74A 4FCJA 1O7MB 4KT3B 2M7OA 3ZG5A 5HOHA 3JUMA 1VQ73 4NPBA 1LNIA 1OGZA 1WTHA 1EG9B 3NQYA 5BIRA 1JBRA 1UUWB 1M1XB 1D6ZA 2LQVA 4IPBA 2RNTA 1DVCA 2W56B 5IG5A 2XEPA 1M904 2QIYA 4AKYA 2OQEC 1FUTA 3UB1A 2KF5A 1RN4A 1W2B2 2BU4A 4CCVA 3ECFA 1W5ZA 2CW9A 1CEWI 1IV9A 1QAFA 1R4CA 3V99A 5IG4A 1BSCA 3DMCA 3BNEA 5JPPA 3K0ZA 4HM8B 5EQLA 5EVHA 2R4IA 3JUNA 1I3FA 4GB5A 1N8QA 3GWRA 4K1VA 1GY5A 4O02B 4KFFA 1LOWA 1UCKA 1Z1SA 4O2HA 3RDEA 3G713 3G16A 4J8TA 3AGNA 1BANA 5G1KA 2AAEA 1VQO3 2F4YA 1VQ63 2ML6A 3EQQB 2FNQA 4LMIA 3DGLA 2IUKA 3BLZA 1E97A 1W01A 4OVMA 5GSPA 3CC73 1B21A 1TUHA 1W4NA 1VQ93 3NUVA 1B2XA 3GZXB 2CC3A 3EBTA 2F86B 1VQL3 1RNTA 2UX0A 1TRQA 2IA7A 1MWUA 1UI8A 3ROBA 3NX0A 3STDA 1VQ53 4XBTA 2L1SA 4MMXB 4R4KA 1X1UA 2QGUA 2BO9B 1OHSA 1OH0A 1JNQA 1TP6A 3EF8A 1JZOA 1T3BA 1WMNA 2BIRA 2HMJB 4RNTA 3S5CA 2WO0A 3X3XA 3CME3 1BNGA 1N9EA 3I563 3RNTA 5M1AA 5DRVA 3JUQA 1FGQA 1J2BA 3SVAA 4HM0B 1Q9EA 2WGQA 3KSED 3MSOA 4R80A 1UUVB 2XFTA 1X1XA 3OWUA 1SPUA 1SIHA 2I9WA 2F5WA 3V98A 5CF1A 4N6OB 4WYKA 3H51A 1MWRA 3O8YA 2F56A 3NHXA 3CCM3 3GSPA 3MG3A 2XFSA 3BNBA 3PGBA 3GZYB 1NJI4 1LOYA 1N5PA 1IVVA 1HKXA 2W6JH 3D5IA 4HYZA 5IW9A 5CXOA 1QAKA 1BSDA 2IYJA 3CC23 3CCL3 2RSXA 3CC43 1NB3I 2JQ5A 4EV2A 1T2IA 4BL2A 3LTDA 4KFEA 1BNEA 1JN5B 2ML5A 5AI1A 1VQK3 1AY7A 2HOHA 1EEJA 2H0IA 1EUIC 1NU3A 4BTWA 2B24B 4GSPA 1JBTA 2CWUA 3UJMA 1Q42A 3WOEB 1CYVA 1LRAA 2C11A 4R9LA 4XBXA 3HOHA 1K8A4 1BRHA 4O3VA 5ELJA 1IU7A 3KN4A 4HM4B 4IT7A 3X40A 1YI23 1FUSA 3T0UA 6STDA 1VQQA 3Q90A 4GL6A 1I2FA 4X2OA 1A67A 3BIRA 3CNXA 5IG3A 2RGQA 3DY5A 1G96A 2BHMA 3JUPA 1I2GA 1G02A 1MNLA 3MWZA 5BVBA 3FF2A 4HJLB 3X3ZA 1GY6A 1C54A 2W04A 1CH0A 2BMQB 1W6CA 3GAXA 5KP1A 1TU5A 2HMKB 3CCR3 1M9GA 1BRSA 1YGEA 1RSNA 1ZGXA 3GZRA 1BRIA 4XDWA 4HBRA 1UUGB 3VGNA 1W02A 4G1MB 2BT3A 1IYYA 5KP3A 3OX9A 4U13A 5G1LA 3CCQ3 3CCJ3 2GBWB 2CG0A 4LYLB 4CJNA 4AEQA 1JN5A 1YNVX 3JUOA 2XGNA 5IEOA 1RKYA 4HM6B 1VQP3 3I553 3DGOA 2W2CA 4JF8A 3UL5A 3FGYA 1I70A 1UDII 4MJDA 4FCMA 1GOVA 4LSOA 1OACA 1FGMA 1I0VA 1OGXA 4XDVA 3SOAA 2CIUA 3GZBA 4WWUC 1PFPA 3SX1A 4ILFA 1BSAA 2CG1A 1AR0A 1BNJA 1B3SA 2STDA 3A5EA 7GSPA 5I97A 3OV4A 1I0XA 1O7HB 1HU9A 2CHCA 3WDGB 2KF4A 3MPHA 3FG3A 1HZ1A 3ZG0A 1PYLA 3LXUX 7RNTA 1OHOA 1TIJA 4LGQA 1O7WB 2RCDA 3AMOA 6RNTA 5CF2A 1RGGA 3B4OA 3FF0A 1K9M4 3VF1A 4MMYB 1BUJA 4KFDA 4EW5A 1LQMB 2Z76A 4I5QA 1BAOA 4AKZA 2CKFB 1Q40A 2SARA 3EC9A 3SXXA 4EXRA 5A0OB 3FH1A 2O3OA 3WA2X 2WOHA 1FYSA 3NM2A 3LYGA 1S5AA 4BL3A 1TRPA 1E3VA 2W0QA 3DUKA 3FSDA 4RNZA 5AYRB 5IERA 3AHWA 3BU4A 1LVNA 3G0KA 1Q7Y4 1U8CB 5STDA 4WYKB 5LC7A 3S29A 7STDA 3G8ZA 1V58A 1EA2A 1UGIA 1RRLA 1U5OA 1T5YA 3PCRA 3G6E3 3IJEB 1B20A 3ER7A 1W6YA 1DMMA 1TTOA 2J8XB 2INXA 1GS3A 4JRFA 1QVG2 2P0XA 1RGCA
chains in the Genus database with same CATH topology
3PYJA 2CFKA 2XSOB 4EBGA 3VSYA 1DYUA 1QALA 2GU1A 1IT7A 2OOVA 2K0MA 4R9KA 1ISKA 4HM5B 3EJVA 1AVKA 1FGOA 1IDPA 2Y74A 4RBNA 4NHFA 1NB5I 1WNHA 5G2GA 3X41A 1VQ43 2YX9A 4WHAA 3DXOA 4HM3B 2HMLB 3EX9A 2Q07A 4FMCA 3PS8A 3FG1A 2CH9A 1N9JA 1KWIA 1QMAA 2O9UX 3MKIA 1YJN3 4ZM8A 1QVF2 3CC73 1O7PB 1ZX2A 2QEX3 2MF7A 3X3YA 1FGTA 3CCS3 1FA3A 2BMOB 2HMMB 3QRDA 5FGOA 3V92A 2W9QA 2YFIB 2L4VA 2F98A 3NV0A 3S67A 4K1UA 3TDGA 3N8BA 4MEIA 4L7KA 5CLKA 3OXAA 1D6YA 1IQXA 2ZL8A 2PZVA 1SIIA 1UW1A 3NXJA 2OTJ3 4FMAA 2CFDA 4EYCA 3HX8A 1JB4A 2W03A 3FZWA 5AIIA 1LOXA 4FMDA 4HKVB 4XB5A 1ULIB 2GEXA 1L5GB 2OWPA 2WGOA 3F8XA 1Y4KA 2CFWA 2HMNB 3FG4A 4HZ9B 3RGRA 4N6MA 3CCE3 1OF5A 4H3UA 3HIIA 2F99A 2GEYA 3PXMA 2MC8A 3OW22 3T8UA 3K5TA 1FUWA 3EN8A 3UNLA 5EEOA 1LNHA 2GXFA 3OWSA 4EC6A 2KRTA 3NQZA 1A2KA 3K9MC 3X42A 3Q1CA 1EQKA 3MG1A 1IVUA 1W6GA 3K63A 3DM8A 5JBSA 1DMNA 1D6UA 1RJOA 2E2TA 3AMOB 4BTYA 2PNCA 1OHPA 3T8NA 2XSHB 2Z77A 3LOYA 5DREA 3RGAA 3KKGA 4N6LA 3JVCA 4PEJA 5HGRA 1Q40B 1TFOA 3U1WA 1CYUA 5LC6A 1SQWA 1O7NB 4R1KA 4L8OA 1O7GB 2Y73A 3MHEA 2OQEA 2W9PA 1QJGA 4N6NB 2Z7AA 1KC84 2FXTA 2LYXA 4WP5A 3EN1B 4HM1B 4BTXA 4L8PA 4LEHA 2CWVA 3FCSB 3BNCA 1K28A 2FGTA 1AV4A 4IIAA 3U97A 4N6TA 2Z6BA 2ZDJA 2IUJA 2RFRA 3SLUA 1K734 4X2HA 1Q824 3LTBA 3CCU3 4KVHA 1GD3A 1WQLB 3MYTA 3F9SA 1IV7A 4STDA 2E2UA 3PZWA 5ELUA 2GU3A 1YIT3 1IVWA 3LTAA 3F7XA 2YFLB 3QK9A 3SOYA 2K54A 1TFKA 3KIIA 3E99A 1YJ93 4XM4A 4OK0A 2CFLA 3NV0B 2HMOB 3SEDA 4HM7B 3GRDA 1JKGA 1BUQA 4XBYA 5IG0A 3WA3A 3LMLA 5KP4A 2YFJB 1ULJB 3BNDA 3D3LA 3CXC2 3DGNA 1GYBA 5IEPA 3HK4A 4HZBB 5FW5A 3KFQC 3PCSA 2D1WA 1OUNA 3BB9A 3FLJA 2V1LA 2XGLA 1OF5B 3DZLA 3KSPA 2JDIH 3IPTA 5D81A 1GD4A 1KQS2 1NO3A 3IMAB 1ROAA 2IMJA 5D82A 4MMZB 3UL6A 2P38A 4RNYA 4N3VA 4NREA 3B7CA 1WMOA 3LZAA 4QWTA 4N6UA 2W56A 1N5HA 3I0YA 1IQYA 3MG2A 3NBBA 2XH9A 4K61A 2SBLA 1SJWA 4I4KA 3H3HA 2B1XB 1STFI 3N9HA 4HM2B 5IF6A 3WMDA 1FGRA 2KCDA 1KD14 4OUQA 4FR9A 1DVDA 3M8CA 4H61A 4CDLA 2A15A 3HI7A 4WFOA 2XF3A 4TX4A 3F40A 3F8HA 1F8NA 5AIFA 1C7HA 5JPUA 1ZO2A 1EKMA 1UI7A 2OOVC 1AVLA 1MOLA 4FMBA 1NDOB 3LH4A 4RZMA 1A90A 1JV2B 3S28A 3J7Yd 3F14A 2BNGA 3FKAA 3CCV3 5TGNA 1IK3A 3CU3A 1W2ZA 5AEWB 2OCTA 1VQM3 1KSIA 3NBJA 3N54B 2CFGA 3S27A 4J9AA 3L0RA 1OCVA 4KZ1A 1YVBI 8CHOA 5CK6A 1GY7A 1RN7A 1IQ8A 1Q814 5AIGA 1DMQA 4Q53A 5AEUB 1JRQA 1US1A 5D83A 2WOFA 1YIJ3 3CMA3 3KE7A 2C10A 4LZIA 1WMPA 2P09A 2OTL3 2CWTA 4EV5A 2XRXB 3OWYA 1N8R4 4K90B 3EHCA 1JB2A 1JB5A 4FCZA 1CQSA 1ASKA 4N6V0 2P0MA 2BMRB 2GBXB 3CPOA 3HZPA 1IVXA 5IENA 3WODG 1W00A 3DGMA 1OPYA 1JJ22 5BXQA 1VZZA 4ORLA 3LT8A 3HIGA 1M1K4 3D9RA 3LTCA 1K41A 1LXEA 1JKGB 3CPW2 3EBYA 3K7CA 5AYSC 3NBRA 1E3RA 2KXGA 3ALAA 1W7CA 3KZTA 3B8LA 4O8SA 3G4S3 1YJW3 3WOFB 2E2VA 5AIHA 1A2VA 1PU4A 2P05A 3EB8A 1Q864 1VQN3 1RRHA 3LT9A 3NM7A 1IT8A 1S723 4HVNA 1NWWA 2XR8B 2D42A 1STDA 3EE1A 1VQ83 2CK3H 2QA43 1YHQ3 3A76A 3B4PA 1ROVA 3CD63 3CNMA 3Q2PA 3F7SA 4FCJA 1V74A 1O7MB 2M7OA 1VQ73 3JUMA 1OGZA 1WTHA 1EG9B 3NQYA 1UUWB 1M1XB 1D6ZA 2LQVA 4IPBA 5IG5A 1DVCA 2W56B 2XEPA 1M904 2QIYA 4AKYA 2OQEC 3UB1A 1W2B2 4CCVA 3ECFA 1W5ZA 2CW9A 1CEWI 1IV9A 1QAFA 1R4CA 3V99A 5IG4A 3DMCA 3BNEA 5JPPA 3K0ZA 4HM8B 5EQLA 5EVHA 2R4IA 3JUNA 4GB5A 1N8QA 3GWRA 4K1VA 1GY5A 4O02B 4KFFA 3G713 1Z1SA 4O2HA 3RDEA 3G16A 4J8TA 1VQO3 1VQ63 2ML6A 3EQQB 2FNQA 4LMIA 3DGLA 2IUKA 3BLZA 1E97A 1W01A 4OVMA 1TUHA 1W4NA 1VQ93 3NUVA 3GZXB 2CC3A 3EBTA 2F86B 1VQL3 2UX0A 2IA7A 1UI8A 3ROBA 3STDA 3NX0A 1VQ53 4XBTA 4MMXB 4R4KA 2QGUA 2BO9B 1OHSA 1OH0A 1JNQA 1TP6A 3EF8A 1WMNA 2HMJB 3S5CA 3CME3 2WO0A 3X3XA 1N9EA 3I563 5DRVA 3JUQA 1FGQA 1J2BA 3SVAA 4HM0B 2WGQA 3KSED 3MSOA 4R80A 1UUVB 2XFTA 3OWUA 1SPUA 1SIHA 2I9WA 3V98A 5CF1A 4N6OB 4WYKA 3H51A 3O8YA 3NHXA 3CCM3 3MG3A 2XFSA 3BNBA 3PGBA 3GZYB 1NJI4 1N5PA 1IVVA 1HKXA 2W6JH 4HYZA 5IW9A 5CXOA 1QAKA 3CC23 3CCL3 2RSXA 3CC43 1NB3I 2JQ5A 4EV2A 3LTDA 4KFEA 1JN5B 2ML5A 5AI1A 1VQK3 1NU3A 4BTWA 2B24B 2CWUA 3UJMA 1Q42A 3WOEB 1CYVA 4R9LA 2C11A 4XBXA 1K8A4 4O3VA 5ELJA 1IU7A 3X40A 4HM4B 4IT7A 1YI23 3T0UA 6STDA 3Q90A 4GL6A 4X2OA 1A67A 3CNXA 5IG3A 2RGQA 3DY5A 1G96A 2BHMA 3JUPA 1MNLA 3MWZA 5BVBA 3FF2A 4HJLB 3X3ZA 1GY6A 2W04A 2BMQB 1W6CA 3GAXA 5KP1A 1TU5A 2HMKB 3CCR3 1M9GA 1YGEA 3GZRA 4XDWA 4HBRA 3VGNA 1W02A 4G1MB 2BT3A 5KP3A 3OX9A 4U13A 3CCQ3 3CCJ3 2GBWB 2CG0A 4AEQA 1JN5A 3JUOA 2XGNA 5IEOA 1RKYA 4HM6B 1VQP3 3I553 3DGOA 2W2CA 4JF8A 3UL5A 3FGYA 4MJDA 4FCMA 4LSOA 1OACA 1FGMA 1OGXA 4XDVA 3SOAA 2CIUA 3GZBA 4WWUC 1PFPA 3SX1A 2CG1A 1AR0A 2STDA 5I97A 3OV4A 1O7HB 1HU9A 2CHCA 3WDGB 3MPHA 3FG3A 3LXUX 1OHOA 1TIJA 4LGQA 1O7WB 2RCDA 3AMOA 5CF2A 3B4OA 3FF0A 1K9M4 3VF1A 4MMYB 4KFDA 2Z76A 4AKZA 2CKFB 1Q40A 3EC9A 3SXXA 4EXRA 5A0OB 3FH1A 2O3OA 3WA2X 2WOHA 3NM2A 3LYGA 1S5AA 2W0QA 1E3VA 3DUKA 3FSDA 4RNZA 5AYRB 5IERA 1Q7Y4 1LVNA 3G0KA 1U8CB 5STDA 4WYKB 5LC7A 3S29A 7STDA 3G8ZA 1EA2A 1RRLA 1U5OA 1T5YA 3PCRA 3G6E3 3IJEB 3ER7A 1W6YA 1DMMA 2INXA 1GS3A 4JRFA 1QVG2 2P0XA 3KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSO B;  3VSY A;  4R9K A;  1ISK A;  4HM5 B;  3EJV A;  1IDP A;  5G2G A;  3DXO A;  4HM3 B;  2HML B;  3EX9 A;  1QMA A;  3MKI A;  1O7P B;  1ZX2 A;  2BMO B;  2HMM B;  2YFI B;  2F98 A;  3NV0 A;  4K1U A;  4L7K A;  5CLK A;  3OXA A;  2PZV A;  3NXJ A;  3HX8 A;  1JB4 A;  3FZW A;  5AII A;  4HKV B;  4XB5 A;  1ULI B;  2GEX A;  2OWP A;  3F8X A;  2HMN B;  4HZ9 B;  3RGR A;  1OF5 A;  4H3U A;  2F99 A;  2GEY A;  3T8U A;  3EN8 A;  3UNL A;  2GXF A;  3OWS A;  1A2K A;  3MG1 A;  3DM8 A;  1DMN A;  1OHP A;  3T8N A;  2XSH B;  2Z77 A;  5DRE A;  3RGA A;  3KKG A;  4PEJ A;  5HGR A;  1Q40 B;  1O7N B;  4R1K A;  4L8O A;  1O7G B;  3MHE A;  1QJG A;  2Z7A A;  4WP5 A;  3EN1 B;  4HM1 B;  4L8P A;  4LEH A;  4IIA A;  2RFR A;  4X2H A;  4KVH A;  1WQL B;  3MYT A;  3F9S A;  4STD A;  3F7X A;  2YFL B;  3SOY A;  2K54 A;  3E99 A;  4XM4 A;  3NV0 B;  2HMO B;  3SED A;  4HM7 B;  3GRD A;  1JKG A;  1BUQ A;  4XBY A;  5IG0 A;  5KP4 A;  2YFJ B;  1ULJ B;  1GYB A;  5IEP A;  3HK4 A;  4HZB B;  5FW5 A;  1OUN A;  3BB9 A;  3FLJ A;  1OF5 B;  3DZL A;  3KSP A;  3IPT A;  5D81 A;  2IMJ A;  5D82 A;  4N3V A;  3B7C A;  3LZA A;  3MG2 A;  3I0Y A;  1SJW A;  4I4K A;  3H3H A;  2B1X B;  4HM2 B;  5IF6 A;  3WMD A;  4OUQ A;  3M8C A;  4CDL A;  2A15 A;  3F40 A;  3F8H A;  5AIF A;  1C7H A;  5JPU A;  1ZO2 A;  1NDO B;  4RZM A;  3F14 A;  2BNG A;  3FKA A;  5TGN A;  3CU3 A;  5AEW B;  4J9A A;  1OCV A;  8CHO A;  5CK6 A;  1GY7 A;  5AIG A;  1DMQ A;  4Q53 A;  5AEU B;  5D83 A;  3KE7 A;  2XRX B;  3OWY A;  3EHC A;  1JB2 A;  1JB5 A;  1CQS A;  1ASK A;  2BMR B;  2GBX B;  3CPO A;  3HZP A;  5IEN A;  1W00 A;  1OPY A;  5BXQ A;  1VZZ A;  4ORL A;  3D9R A;  1K41 A;  1JKG B;  3EBY A;  3K7C A;  3NBR A;  1E3R A;  3KZT A;  3B8L A;  5AIH A;  4HVN A;  1NWW A;  2XR8 B;  1STD A;  3A76 A;  3B4P A;  3CNM A;  3F7S A;  4FCJ A;  1O7M B;  3JUM A;  1OGZ A;  1EG9 B;  1UUW B;  5IG5 A;  2QIY A;  3ECF A;  5IG4 A;  3DMC A;  5JPP A;  3K0Z A;  4HM8 B;  5EVH A;  2R4I A;  3JUN A;  4GB5 A;  4K1V A;  3GWR A;  1GY5 A;  1Z1S A;  3G16 A;  4J8T A;  3EQQ B;  4LMI A;  3BLZ A;  1E97 A;  1W01 A;  4OVM A;  1TUH A;  3NUV A;  3GZX B;  3EBT A;  2F86 B;  2UX0 A;  3STD A;  3ROB A;  4XBT A;  2QGU A;  1OHS A;  1OH0 A;  1TP6 A;  3EF8 A;  2HMJ B;  3S5C A;  5DRV A;  3JUQ A;  4HM0 B;  3MSO A;  1UUV B;  3OWU A;  2I9W A;  5CF1 A;  4WYK A;  3H51 A;  3NHX A;  3MG3 A;  3GZY B;  1HKX A;  5CXO A;  2JQ5 A;  1JN5 B;  5AI1 A;  1NU3 A;  2B24 B;  3UJM A;  1Q42 A;  4R9L A;  4XBX A;  4HM4 B;  6STD A;  3Q90 A;  4X2O A;  3CNX A;  5IG3 A;  2RGQ A;  3JUP A;  5BVB A;  3FF2 A;  4HJL B;  1GY6 A;  2BMQ B;  5KP1 A;  2HMK B;  3GZR A;  4XDW A;  3VGN A;  1W02 A;  5KP3 A;  3OX9 A;  4U13 A;  2GBW B;  1JN5 A;  3JUO A;  5IEO A;  4HM6 B;  2W2C A;  3FGY A;  4MJD A;  4FCM A;  4XDV A;  1OGX A;  3SOA A;  3GZB A;  4WWU C;  1AR0 A;  2STD A;  3OV4 A;  1O7H B;  2CHC A;  1OHO A;  4LGQ A;  1O7W B;  2RCD A;  5CF2 A;  3B4O A;  3FF0 A;  2Z76 A;  2CKF B;  1Q40 A;  3EC9 A;  3FH1 A;  3NM2 A;  3LYG A;  1S5A A;  5IER A;  1E3V A;  3DUK A;  3FSD A;  3G0K A;  5STD A;  4WYK B;  7STD A;  3G8Z A;  1EA2 A;  1U5O A;  3ER7 A;  1W6Y A;  1DMM A;  2INX A;  1GS3 A; 
#chains in the Genus database with same CATH topology
 3PYJ A;  2CFK A;  2XSO B;  4EBG A;  3VSY A;  1DYU A;  1QAL A;  2GU1 A;  4BU4 A;  1IT7 A;  2OOV A;  2K0M A;  4R9K A;  1ISK A;  4HM5 B;  3EJV A;  1AVK A;  1FGO A;  1GOU A;  1IDP A;  2Y74 A;  4RBN A;  1GSP A;  4NHF A;  1NB5 I;  1WNH A;  1BRN L;  5G2G A;  3X41 A;  1VQ4 3;  2YX9 A;  4WHA A;  3DXO A;  4HM3 B;  2HML B;  3EX9 A;  2Q07 A;  1UCL A;  3PS8 A;  4FMC A;  3FG1 A;  2CH9 A;  1N9J A;  2AAD A;  1KWI A;  1QMA A;  2O9U X;  3MKI A;  1YJN 3;  4ZM8 A;  1QVF 2;  1SAR A;  1O7P B;  1ZX2 A;  2QEX 3;  1UGH I;  2MF7 A;  1FGT A;  1GOY A;  3X3Y A;  5M18 A;  3CCS 3;  1FA3 A;  2BMO B;  2HMM B;  4HOH A;  3QRD A;  5FGO A;  3V92 A;  2W9Q A;  2YFI B;  2L4V A;  2F98 A;  3D5G A;  3NV0 A;  4K1U A;  3S67 A;  2H0H A;  3N8B A;  3TDG A;  4MEI A;  2GSP A;  4L7K A;  5CLK A;  3OXA A;  3DH2 A;  1D6Y A;  1IQX A;  2ZL8 A;  2PZV A;  1SII A;  1UW1 A;  3NXJ A;  4GHO A;  4FMA A;  2OTJ 3;  2CFD A;  4EYC A;  5M19 A;  3HX8 A;  1JB4 A;  1RLS A;  2W03 A;  1JZD A;  3FZW A;  5AII A;  1RGE A;  1RGH A;  1LOX A;  1ZS7 A;  4FMD A;  4HKV B;  4XB5 A;  1ULI B;  2GEX A;  1L5G B;  2OWP A;  2WGO A;  1LQG C;  1Y4K A;  2CFW A;  2K3D A;  2HMN B;  3F8X A;  3FG4 A;  4HZ9 B;  3RGR A;  4N6M A;  3CCE 3;  1OF5 A;  1AQZ A;  1I8V A;  4H3U A;  3HII A;  2F99 A;  2GEY A;  3PXM A;  3Q3F A;  2MC8 A;  3OW2 2;  3T8U A;  3K5T A;  1FUW A;  3AGO A;  3EN8 A;  3UNL A;  4J5K A;  1GMQ A;  1LNH A;  2GXF A;  5EEO A;  3OWS A;  1PY3 A;  4EC6 A;  1B2S A;  2KRT A;  1A2K A;  3K9M C;  3NQZ A;  3Q1C A;  3X42 A;  3ZFZ A;  1EQK A;  3MG1 A;  1IVU A;  1W6G A;  3K63 A;  3DM8 A;  5JBS A;  1DMN A;  1D6U A;  1RJO A;  2E2T A;  3AMO B;  1BNR A;  4BTY A;  2PNC A;  1OHP A;  3T8N A;  2XSH B;  2Z77 A;  8RNT A;  3LOY A;  5DRE A;  3RGA A;  3KKG A;  4N6L A;  3JVC A;  4PEJ A;  5HGR A;  1Q40 B;  1TFO A;  3U1W A;  1CYU A;  5LC6 A;  1RCL A;  1O7N B;  1SQW A;  4R1K A;  2KF3 A;  1BGS A;  3WR2 A;  4L8O A;  1O7G B;  1BVI A;  2Y73 A;  3MHE A;  2OQE A;  2W9P A;  1QJG A;  4N6N B;  2Z7A A;  4BIR A;  1KC8 4;  2FXT A;  6GSP A;  2LYX A;  4WP5 A;  3EN1 B;  4HM1 B;  4BTX A;  4L8P A;  1BRG A;  1YGW A;  4LEH A;  1RCK A;  2KF6 A;  3KCH A;  1YVS A;  2CWV A;  3FCS B;  3BNC A;  1K28 A;  1DE3 A;  1T2H A;  2FGT A;  1AV4 A;  4IIA A;  3U97 A;  3URP A;  4N6T A;  2Z6B A;  2ZDJ A;  2C4B A;  2IUJ A;  2RFR A;  3SLU A;  9RNT A;  1K73 4;  4X2H A;  1Q82 4;  1BNS A;  2KAA A;  3LTB A;  3CCU 3;  1Q7H A;  1RGF A;  4KVH A;  1GD3 A;  1RHL A;  1BNF A;  5BU4 A;  1WQL B;  1RGL A;  3F9S A;  3MYT A;  1IV7 A;  4STD A;  1JBS A;  2E2U A;  4DKI A;  2H0G A;  3PZW A;  5ELU A;  2GU3 A;  1GMR A;  1YIT 3;  1IVW A;  3LTA A;  3F7X A;  2YFL B;  3QK9 A;  3SOY A;  2K54 A;  1TFK A;  3KII A;  3E99 A;  1YJ9 3;  4XM4 A;  4OK0 A;  2CFL A;  3NV0 B;  1X1Y A;  2HMO B;  3SED A;  1GMP A;  1LOV A;  4HM7 B;  3GRD A;  1JKG A;  1BUQ A;  4XBY A;  5IG0 A;  4CPK A;  3WA3 A;  3LML A;  1FZU A;  5KP4 A;  2YFJ B;  1ULJ B;  1V57 A;  3BND A;  3D3L A;  3CXC 2;  3DGN A;  1B27 A;  1GYB A;  5IEP A;  3HK4 A;  4HZB B;  5FW5 A;  3KFQ C;  3PCS A;  2D1W A;  1OUN A;  3BB9 A;  3FLJ A;  2V1L A;  1BIR A;  2XGL A;  1OF5 B;  1RTU A;  3DZL A;  3KSP A;  2JDI H;  3IPT A;  5D81 A;  1GD4 A;  1X1W A;  1KQS 2;  1NO3 A;  3IMA B;  1ROA A;  2IMJ A;  5D82 A;  4MMZ B;  3UL6 A;  1HYF A;  2P38 A;  4RNY A;  4N3V A;  4NRE A;  3B7C A;  1RNB A;  1RN1 A;  1WMO A;  3LZA A;  4QWT A;  1UCI A;  4N6U A;  2ZHX B;  1FW7 A;  2W56 A;  1N5H A;  3I0Y A;  1IQY A;  3MG2 A;  3NBB A;  2XH9 A;  4K61 A;  1G0T A;  2SBL A;  1RMS A;  1SJW A;  4I4K A;  1B2M A;  3H3H A;  2B1X B;  1STF I;  3N9H A;  4HM2 B;  3D4A A;  5IF6 A;  3WMD A;  1FGR A;  2KCD A;  1KD1 4;  1RGA A;  4OUQ A;  4FR9 A;  1DVD A;  3M8C A;  4H61 A;  4CDL A;  2A15 A;  3HI7 A;  4WFO A;  2IY2 A;  2XF3 A;  3F40 A;  3F8H A;  4TX4 A;  1F8N A;  1MWS A;  5AIF A;  1BRJ A;  1C7H A;  2UUG C;  5JPU A;  1A2P A;  1ZO2 A;  3D79 A;  1EKM A;  1UI7 A;  2OOV C;  1AVL A;  1MOL A;  1B2Z A;  4FMB A;  1NDO B;  3LH4 A;  1BSE A;  4RZM A;  1A90 A;  1JV2 B;  3S28 A;  3J7Y d;  3F14 A;  2BNG A;  3FKA A;  3CCV 3;  5TGN A;  1MGW A;  1IK3 A;  3CU3 A;  1W2Z A;  5AEW B;  2OCT A;  3WHO A;  1VQM 3;  1KSI A;  3NBJ A;  3N54 B;  2CFG A;  3S27 A;  1TJD A;  3L0R A;  4J9A A;  1OCV A;  1BU4 A;  4KZ1 A;  1YVB I;  8CHO A;  5CK6 A;  1GY7 A;  1RN7 A;  1IQ8 A;  2CX0 A;  1Q81 4;  5AIG A;  1DMQ A;  4Q53 A;  5AEU B;  1JRQ A;  1US1 A;  5D83 A;  2WOF A;  1YIJ 3;  1RGK A;  3CMA 3;  3KE7 A;  2C10 A;  4LZI A;  1WMP A;  2P09 A;  4J5G A;  2OTL 3;  2CWT A;  4EV5 A;  2XRX B;  3OWY A;  1N8R 4;  4K90 B;  1BOX A;  3EHC A;  1JB2 A;  1JB5 A;  2RBI A;  4FCZ A;  1CQS A;  1ASK A;  4N6V 0;  2BMR B;  2P0M A;  3AHS A;  2GBX B;  3CPO A;  3HZP A;  2ZA4 A;  1IVX A;  5IEN A;  3WOD G;  1W00 A;  3DGM A;  1OPY A;  1JJ2 2;  1R4Y A;  5BXQ A;  1VZZ A;  2F5M A;  4ORL A;  3LT8 A;  3HIG A;  1DET A;  1M1K 4;  3D9R A;  3LTC A;  1K41 A;  2UGI A;  3SYU A;  1MWT A;  1LXE A;  1UCJ A;  1B2U A;  1JKG B;  2R41 A;  4HAA A;  3EBY A;  3CPW 2;  1BSB A;  3K7C A;  5AYS C;  3NBR A;  1E3R A;  2KXG A;  1MGR A;  2CX1 A;  1NNV A;  3ALA A;  1I2E A;  1W7C A;  3KZT A;  3B8L A;  4O8S A;  3G4S 3;  1YJW 3;  1BRK A;  2E2V A;  3WOF B;  5AIH A;  1A2V A;  1PU4 A;  2P05 A;  3EB8 A;  1Q86 4;  1VQN 3;  1RRH A;  3LT9 A;  3NM7 A;  1IT8 A;  1S72 3;  4HVN A;  1NWW A;  2XR8 B;  2D42 A;  1STD A;  1RDS A;  3EE1 A;  2CK3 H;  1I3I A;  2QA4 3;  3A76 A;  3B4P A;  1YHQ 3;  1VQ8 3;  1ROV A;  3CD6 3;  3CNM A;  5RNT A;  1BNI A;  3DGY A;  3F7S A;  3Q2P A;  1V74 A;  4FCJ A;  1O7M B;  4KT3 B;  2M7O A;  3ZG5 A;  5HOH A;  3JUM A;  1VQ7 3;  4NPB A;  1LNI A;  1OGZ A;  1WTH A;  1EG9 B;  3NQY A;  5BIR A;  1JBR A;  1UUW B;  1M1X B;  1D6Z A;  2LQV A;  4IPB A;  2RNT A;  1DVC A;  2W56 B;  5IG5 A;  2XEP A;  1M90 4;  2QIY A;  4AKY A;  2OQE C;  1FUT A;  3UB1 A;  2KF5 A;  1RN4 A;  1W2B 2;  2BU4 A;  4CCV A;  3ECF A;  1W5Z A;  2CW9 A;  1CEW I;  1IV9 A;  1QAF A;  1R4C A;  3V99 A;  5IG4 A;  1BSC A;  3DMC A;  3BNE A;  5JPP A;  3K0Z A;  4HM8 B;  5EQL A;  5EVH A;  2R4I A;  3JUN A;  1I3F A;  4GB5 A;  1N8Q A;  3GWR A;  4K1V A;  1GY5 A;  4O02 B;  4KFF A;  1LOW A;  1UCK A;  1Z1S A;  4O2H A;  3RDE A;  3G71 3;  3G16 A;  4J8T A;  3AGN A;  1BAN A;  5G1K A;  2AAE A;  1VQO 3;  2F4Y A;  1VQ6 3;  2ML6 A;  3EQQ B;  2FNQ A;  4LMI A;  3DGL A;  2IUK A;  3BLZ A;  1E97 A;  1W01 A;  4OVM A;  5GSP A;  3CC7 3;  1B21 A;  1TUH A;  1W4N A;  1VQ9 3;  3NUV A;  1B2X A;  3GZX B;  2CC3 A;  3EBT A;  2F86 B;  1VQL 3;  1RNT A;  2UX0 A;  1TRQ A;  2IA7 A;  1MWU A;  1UI8 A;  3ROB A;  3NX0 A;  3STD A;  1VQ5 3;  4XBT A;  2L1S A;  4MMX B;  4R4K A;  1X1U A;  2QGU A;  2BO9 B;  1OHS A;  1OH0 A;  1JNQ A;  1TP6 A;  3EF8 A;  1JZO A;  1T3B A;  1WMN A;  2BIR A;  2HMJ B;  4RNT A;  3S5C A;  2WO0 A;  3X3X A;  3CME 3;  1BNG A;  1N9E A;  3I56 3;  3RNT A;  5M1A A;  5DRV A;  3JUQ A;  1FGQ A;  1J2B A;  3SVA A;  4HM0 B;  1Q9E A;  2WGQ A;  3KSE D;  3MSO A;  4R80 A;  1UUV B;  2XFT A;  1X1X A;  3OWU A;  1SPU A;  1SIH A;  2I9W A;  2F5W A;  3V98 A;  5CF1 A;  4N6O B;  4WYK A;  3H51 A;  1MWR A;  3O8Y A;  2F56 A;  3NHX A;  3CCM 3;  3GSP A;  3MG3 A;  2XFS A;  3BNB A;  3PGB A;  3GZY B;  1NJI 4;  1LOY A;  1N5P A;  1IVV A;  1HKX A;  2W6J H;  3D5I A;  4HYZ A;  5IW9 A;  5CXO A;  1QAK A;  1BSD A;  2IYJ A;  3CC2 3;  3CCL 3;  2RSX A;  3CC4 3;  1NB3 I;  2JQ5 A;  4EV2 A;  1T2I A;  4BL2 A;  3LTD A;  4KFE A;  1BNE A;  1JN5 B;  2ML5 A;  5AI1 A;  1VQK 3;  1AY7 A;  2HOH A;  1EEJ A;  2H0I A;  1EUI C;  1NU3 A;  4BTW A;  2B24 B;  4GSP A;  1JBT A;  2CWU A;  3UJM A;  1Q42 A;  3WOE B;  1CYV A;  1LRA A;  2C11 A;  4R9L A;  4XBX A;  3HOH A;  1K8A 4;  1BRH A;  4O3V A;  5ELJ A;  1IU7 A;  3KN4 A;  4HM4 B;  4IT7 A;  3X40 A;  1YI2 3;  1FUS A;  3T0U A;  6STD A;  1VQQ A;  3Q90 A;  4GL6 A;  1I2F A;  4X2O A;  1A67 A;  3BIR A;  3CNX A;  5IG3 A;  2RGQ A;  3DY5 A;  1G96 A;  2BHM A;  3JUP A;  1I2G A;  1G02 A;  1MNL A;  3MWZ A;  5BVB A;  3FF2 A;  4HJL B;  3X3Z A;  1GY6 A;  1C54 A;  2W04 A;  1CH0 A;  2BMQ B;  1W6C A;  3GAX A;  5KP1 A;  1TU5 A;  2HMK B;  3CCR 3;  1M9G A;  1BRS A;  1YGE A;  1RSN A;  1ZGX A;  3GZR A;  1BRI A;  4XDW A;  4HBR A;  1UUG B;  3VGN A;  1W02 A;  4G1M B;  2BT3 A;  1IYY A;  5KP3 A;  3OX9 A;  4U13 A;  5G1L A;  3CCQ 3;  3CCJ 3;  2GBW B;  2CG0 A;  4LYL B;  4CJN A;  4AEQ A;  1JN5 A;  1YNV X;  3JUO A;  2XGN A;  5IEO A;  1RKY A;  4HM6 B;  1VQP 3;  3I55 3;  3DGO A;  2W2C A;  4JF8 A;  3UL5 A;  3FGY A;  1I70 A;  1UDI I;  4MJD A;  4FCM A;  1GOV A;  4LSO A;  1OAC A;  1FGM A;  1I0V A;  1OGX A;  4XDV A;  3SOA A;  2CIU A;  3GZB A;  4WWU C;  1PFP A;  3SX1 A;  4ILF A;  1BSA A;  2CG1 A;  1AR0 A;  1BNJ A;  1B3S A;  2STD A;  3A5E A;  7GSP A;  5I97 A;  3OV4 A;  1I0X A;  1O7H B;  1HU9 A;  2CHC A;  3WDG B;  2KF4 A;  3MPH A;  3FG3 A;  1HZ1 A;  3ZG0 A;  1PYL A;  3LXU X;  7RNT A;  1OHO A;  1TIJ A;  4LGQ A;  1O7W B;  2RCD A;  3AMO A;  6RNT A;  5CF2 A;  1RGG A;  3B4O A;  3FF0 A;  1K9M 4;  3VF1 A;  4MMY B;  1BUJ A;  4KFD A;  4EW5 A;  1LQM B;  2Z76 A;  4I5Q A;  1BAO A;  4AKZ A;  2CKF B;  1Q40 A;  2SAR A;  3EC9 A;  3SXX A;  4EXR A;  5A0O B;  3FH1 A;  2O3O A;  3WA2 X;  2WOH A;  1FYS A;  3NM2 A;  3LYG A;  1S5A A;  4BL3 A;  1TRP A;  1E3V A;  2W0Q A;  3DUK A;  3FSD A;  4RNZ A;  5AYR B;  5IER A;  3AHW A;  3BU4 A;  1LVN A;  3G0K A;  1Q7Y 4;  1U8C B;  5STD A;  4WYK B;  5LC7 A;  3S29 A;  7STD A;  3G8Z A;  1V58 A;  1EA2 A;  1UGI A;  1RRL A;  1U5O A;  1T5Y A;  3PCR A;  3G6E 3;  3IJE B;  1B20 A;  3ER7 A;  1W6Y A;  1DMM A;  1TTO A;  2J8X B;  2INX A;  1GS3 A;  4JRF A;  1QVG 2;  2P0X A;  1RGC A; 
#chains in the Genus database with same CATH homology
 3PYJ A;  2CFK A;  2XSO B;  4EBG A;  3VSY A;  1DYU A;  1QAL A;  2GU1 A;  1IT7 A;  2OOV A;  2K0M A;  4R9K A;  1ISK A;  4HM5 B;  3EJV A;  1AVK A;  1FGO A;  1IDP A;  2Y74 A;  4RBN A;  4NHF A;  1NB5 I;  1WNH A;  5G2G A;  3X41 A;  1VQ4 3;  2YX9 A;  4WHA A;  3DXO A;  4HM3 B;  2HML B;  3EX9 A;  2Q07 A;  4FMC A;  3PS8 A;  3FG1 A;  2CH9 A;  1N9J A;  1KWI A;  1QMA A;  2O9U X;  3MKI A;  1YJN 3;  4ZM8 A;  1QVF 2;  3CC7 3;  1O7P B;  1ZX2 A;  2QEX 3;  2MF7 A;  3X3Y A;  1FGT A;  3CCS 3;  1FA3 A;  2BMO B;  2HMM B;  3QRD A;  5FGO A;  3V92 A;  2W9Q A;  2YFI B;  2L4V A;  2F98 A;  3NV0 A;  3S67 A;  4K1U A;  3TDG A;  3N8B A;  4MEI A;  4L7K A;  5CLK A;  3OXA A;  1D6Y A;  1IQX A;  2ZL8 A;  2PZV A;  1SII A;  1UW1 A;  3NXJ A;  2OTJ 3;  4FMA A;  2CFD A;  4EYC A;  3HX8 A;  1JB4 A;  2W03 A;  3FZW A;  5AII A;  1LOX A;  4FMD A;  4HKV B;  4XB5 A;  1ULI B;  2GEX A;  1L5G B;  2OWP A;  2WGO A;  3F8X A;  1Y4K A;  2CFW A;  2HMN B;  3FG4 A;  4HZ9 B;  3RGR A;  4N6M A;  3CCE 3;  1OF5 A;  4H3U A;  3HII A;  2F99 A;  2GEY A;  3PXM A;  2MC8 A;  3OW2 2;  3T8U A;  3K5T A;  1FUW A;  3EN8 A;  3UNL A;  5EEO A;  1LNH A;  2GXF A;  3OWS A;  4EC6 A;  2KRT A;  3NQZ A;  1A2K A;  3K9M C;  3X42 A;  3Q1C A;  1EQK A;  3MG1 A;  1IVU A;  1W6G A;  3K63 A;  3DM8 A;  5JBS A;  1DMN A;  1D6U A;  1RJO A;  2E2T A;  3AMO B;  4BTY A;  2PNC A;  1OHP A;  3T8N A;  2XSH B;  2Z77 A;  3LOY A;  5DRE A;  3RGA A;  3KKG A;  4N6L A;  3JVC A;  4PEJ A;  5HGR A;  1Q40 B;  1TFO A;  3U1W A;  1CYU A;  5LC6 A;  1SQW A;  1O7N B;  4R1K A;  4L8O A;  1O7G B;  2Y73 A;  3MHE A;  2OQE A;  2W9P A;  1QJG A;  4N6N B;  2Z7A A;  1KC8 4;  2FXT A;  2LYX A;  4WP5 A;  3EN1 B;  4HM1 B;  4BTX A;  4L8P A;  4LEH A;  2CWV A;  3FCS B;  3BNC A;  1K28 A;  2FGT A;  1AV4 A;  4IIA A;  3U97 A;  4N6T A;  2Z6B A;  2ZDJ A;  2IUJ A;  2RFR A;  3SLU A;  1K73 4;  4X2H A;  1Q82 4;  3LTB A;  3CCU 3;  4KVH A;  1GD3 A;  1WQL B;  3MYT A;  3F9S A;  1IV7 A;  4STD A;  2E2U A;  3PZW A;  5ELU A;  2GU3 A;  1YIT 3;  1IVW A;  3LTA A;  3F7X A;  2YFL B;  3QK9 A;  3SOY A;  2K54 A;  1TFK A;  3KII A;  3E99 A;  1YJ9 3;  4XM4 A;  4OK0 A;  2CFL A;  3NV0 B;  2HMO B;  3SED A;  4HM7 B;  3GRD A;  1JKG A;  1BUQ A;  4XBY A;  5IG0 A;  3WA3 A;  3LML A;  5KP4 A;  2YFJ B;  1ULJ B;  3BND A;  3D3L A;  3CXC 2;  3DGN A;  1GYB A;  5IEP A;  3HK4 A;  4HZB B;  5FW5 A;  3KFQ C;  3PCS A;  2D1W A;  1OUN A;  3BB9 A;  3FLJ A;  2V1L A;  2XGL A;  1OF5 B;  3DZL A;  3KSP A;  2JDI H;  3IPT A;  5D81 A;  1GD4 A;  1KQS 2;  1NO3 A;  3IMA B;  1ROA A;  2IMJ A;  5D82 A;  4MMZ B;  3UL6 A;  2P38 A;  4RNY A;  4N3V A;  4NRE A;  3B7C A;  1WMO A;  3LZA A;  4QWT A;  4N6U A;  2W56 A;  1N5H A;  3I0Y A;  1IQY A;  3MG2 A;  3NBB A;  2XH9 A;  4K61 A;  2SBL A;  1SJW A;  4I4K A;  3H3H A;  2B1X B;  1STF I;  3N9H A;  4HM2 B;  5IF6 A;  3WMD A;  1FGR A;  2KCD A;  1KD1 4;  4OUQ A;  4FR9 A;  1DVD A;  3M8C A;  4H61 A;  4CDL A;  2A15 A;  3HI7 A;  4WFO A;  2XF3 A;  4TX4 A;  3F40 A;  3F8H A;  1F8N A;  5AIF A;  1C7H A;  5JPU A;  1ZO2 A;  1EKM A;  1UI7 A;  2OOV C;  1AVL A;  1MOL A;  4FMB A;  1NDO B;  3LH4 A;  4RZM A;  1A90 A;  1JV2 B;  3S28 A;  3J7Y d;  3F14 A;  2BNG A;  3FKA A;  3CCV 3;  5TGN A;  1IK3 A;  3CU3 A;  1W2Z A;  5AEW B;  2OCT A;  1VQM 3;  1KSI A;  3NBJ A;  3N54 B;  2CFG A;  3S27 A;  4J9A A;  3L0R A;  1OCV A;  4KZ1 A;  1YVB I;  8CHO A;  5CK6 A;  1GY7 A;  1RN7 A;  1IQ8 A;  1Q81 4;  5AIG A;  1DMQ A;  4Q53 A;  5AEU B;  1JRQ A;  1US1 A;  5D83 A;  2WOF A;  1YIJ 3;  3CMA 3;  3KE7 A;  2C10 A;  4LZI A;  1WMP A;  2P09 A;  2OTL 3;  2CWT A;  4EV5 A;  2XRX B;  3OWY A;  1N8R 4;  4K90 B;  3EHC A;  1JB2 A;  1JB5 A;  4FCZ A;  1CQS A;  1ASK A;  4N6V 0;  2P0M A;  2BMR B;  2GBX B;  3CPO A;  3HZP A;  1IVX A;  5IEN A;  3WOD G;  1W00 A;  3DGM A;  1OPY A;  1JJ2 2;  5BXQ A;  1VZZ A;  4ORL A;  3LT8 A;  3HIG A;  1M1K 4;  3D9R A;  3LTC A;  1K41 A;  1LXE A;  1JKG B;  3CPW 2;  3EBY A;  3K7C A;  5AYS C;  3NBR A;  1E3R A;  2KXG A;  3ALA A;  1W7C A;  3KZT A;  3B8L A;  4O8S A;  3G4S 3;  1YJW 3;  3WOF B;  2E2V A;  5AIH A;  1A2V A;  1PU4 A;  2P05 A;  3EB8 A;  1Q86 4;  1VQN 3;  1RRH A;  3LT9 A;  3NM7 A;  1IT8 A;  1S72 3;  4HVN A;  1NWW A;  2XR8 B;  2D42 A;  1STD A;  3EE1 A;  1VQ8 3;  2CK3 H;  2QA4 3;  1YHQ 3;  3A76 A;  3B4P A;  1ROV A;  3CD6 3;  3CNM A;  3Q2P A;  3F7S A;  4FCJ A;  1V74 A;  1O7M B;  2M7O A;  1VQ7 3;  3JUM A;  1OGZ A;  1WTH A;  1EG9 B;  3NQY A;  1UUW B;  1M1X B;  1D6Z A;  2LQV A;  4IPB A;  5IG5 A;  1DVC A;  2W56 B;  2XEP A;  1M90 4;  2QIY A;  4AKY A;  2OQE C;  3UB1 A;  1W2B 2;  4CCV A;  3ECF A;  1W5Z A;  2CW9 A;  1CEW I;  1IV9 A;  1QAF A;  1R4C A;  3V99 A;  5IG4 A;  3DMC A;  3BNE A;  5JPP A;  3K0Z A;  4HM8 B;  5EQL A;  5EVH A;  2R4I A;  3JUN A;  4GB5 A;  1N8Q A;  3GWR A;  4K1V A;  1GY5 A;  4O02 B;  4KFF A;  3G71 3;  1Z1S A;  4O2H A;  3RDE A;  3G16 A;  4J8T A;  1VQO 3;  1VQ6 3;  2ML6 A;  3EQQ B;  2FNQ A;  4LMI A;  3DGL A;  2IUK A;  3BLZ A;  1E97 A;  1W01 A;  4OVM A;  1TUH A;  1W4N A;  1VQ9 3;  3NUV A;  3GZX B;  2CC3 A;  3EBT A;  2F86 B;  1VQL 3;  2UX0 A;  2IA7 A;  1UI8 A;  3ROB A;  3STD A;  3NX0 A;  1VQ5 3;  4XBT A;  4MMX B;  4R4K A;  2QGU A;  2BO9 B;  1OHS A;  1OH0 A;  1JNQ A;  1TP6 A;  3EF8 A;  1WMN A;  2HMJ B;  3S5C A;  3CME 3;  2WO0 A;  3X3X A;  1N9E A;  3I56 3;  5DRV A;  3JUQ A;  1FGQ A;  1J2B A;  3SVA A;  4HM0 B;  2WGQ A;  3KSE D;  3MSO A;  4R80 A;  1UUV B;  2XFT A;  3OWU A;  1SPU A;  1SIH A;  2I9W A;  3V98 A;  5CF1 A;  4N6O B;  4WYK A;  3H51 A;  3O8Y A;  3NHX A;  3CCM 3;  3MG3 A;  2XFS A;  3BNB A;  3PGB A;  3GZY B;  1NJI 4;  1N5P A;  1IVV A;  1HKX A;  2W6J H;  4HYZ A;  5IW9 A;  5CXO A;  1QAK A;  3CC2 3;  3CCL 3;  2RSX A;  3CC4 3;  1NB3 I;  2JQ5 A;  4EV2 A;  3LTD A;  4KFE A;  1JN5 B;  2ML5 A;  5AI1 A;  1VQK 3;  1NU3 A;  4BTW A;  2B24 B;  2CWU A;  3UJM A;  1Q42 A;  3WOE B;  1CYV A;  4R9L A;  2C11 A;  4XBX A;  1K8A 4;  4O3V A;  5ELJ A;  1IU7 A;  3X40 A;  4HM4 B;  4IT7 A;  1YI2 3;  3T0U A;  6STD A;  3Q90 A;  4GL6 A;  4X2O A;  1A67 A;  3CNX A;  5IG3 A;  2RGQ A;  3DY5 A;  1G96 A;  2BHM A;  3JUP A;  1MNL A;  3MWZ A;  5BVB A;  3FF2 A;  4HJL B;  3X3Z A;  1GY6 A;  2W04 A;  2BMQ B;  1W6C A;  3GAX A;  5KP1 A;  1TU5 A;  2HMK B;  3CCR 3;  1M9G A;  1YGE A;  3GZR A;  4XDW A;  4HBR A;  3VGN A;  1W02 A;  4G1M B;  2BT3 A;  5KP3 A;  3OX9 A;  4U13 A;  3CCQ 3;  3CCJ 3;  2GBW B;  2CG0 A;  4AEQ A;  1JN5 A;  3JUO A;  2XGN A;  5IEO A;  1RKY A;  4HM6 B;  1VQP 3;  3I55 3;  3DGO A;  2W2C A;  4JF8 A;  3UL5 A;  3FGY A;  4MJD A;  4FCM A;  4LSO A;  1OAC A;  1FGM A;  1OGX A;  4XDV A;  3SOA A;  2CIU A;  3GZB A;  4WWU C;  1PFP A;  3SX1 A;  2CG1 A;  1AR0 A;  2STD A;  5I97 A;  3OV4 A;  1O7H B;  1HU9 A;  2CHC A;  3WDG B;  3MPH A;  3FG3 A;  3LXU X;  1OHO A;  1TIJ A;  4LGQ A;  1O7W B;  2RCD A;  3AMO A;  5CF2 A;  3B4O A;  3FF0 A;  1K9M 4;  3VF1 A;  4MMY B;  4KFD A;  2Z76 A;  4AKZ A;  2CKF B;  1Q40 A;  3EC9 A;  3SXX A;  4EXR A;  5A0O B;  3FH1 A;  2O3O A;  3WA2 X;  2WOH A;  3NM2 A;  3LYG A;  1S5A A;  2W0Q A;  1E3V A;  3DUK A;  3FSD A;  4RNZ A;  5AYR B;  5IER A;  1Q7Y 4;  1LVN A;  3G0K A;  1U8C B;  5STD A;  4WYK B;  5LC7 A;  3S29 A;  7STD A;  3G8Z A;  1EA2 A;  1RRL A;  1U5O A;  1T5Y A;  3PCR A;  3G6E 3;  3IJE B;  3ER7 A;  1W6Y A;  1DMM A;  2INX A;  1GS3 A;  4JRF A;  1QVG 2;  2P0X A;  3KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...