3NUZA

Crystal structure of a putative acetyl xylan esterase (bf1801) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
391
structure length
388
Chain Sequence
WSPKDHNLIKSVREDGRFLSSYGVVHAMLRNTEPRYAFHRDFSPKEFRKWQKGLRHAMEEIMKFPQSPAPVCIKREQREGYRLEKWEFYPLPKCVSTFLVLIPDNINKPVPAILCIPGSGGNKEGLAGEPGIAPKLNDRYKDPKLTQALNFVKEGYIAVAVDNPAAGEASDLERYTLGSNYDYDVVSRYLLELGWSYLGYASYLDMQVLNWMKTQKHIRKDRIVVSGFSLGTEPMMVLGTLDTSIYAFVYNDFLCQTQERAEVMTMPDKNGRRPFPNSIRHLIPDFWKNFNFPDIVAALAPRPIILTEGGLDRDLDLVRKAYAIVGTPDNVKIYHYKKFSDPDTRKNVEYLPEGLDRNEYFRMVNVDGPNHYFKSELVVPWLRKLLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative acetyl xylan esterase (BF1801) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Hydrolase
molecule keywords Putative acetyl xylan esterase
total genus 113
structure length 388
sequence length 391
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12715 Abhydrolase_7 Abhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nuzA00
3I2IA 3L1HA 3R3XA 1XZHA 4BTLA 3FSGA 1WM1A 3LLCA 4JUIA 4PO3X 4JYPA 4A5SA 5HZGA 3G7NA 4KACA 4XJVA 4W9RA 3WA6A 3QH4A 4Q3KA 1FFAA 1CUCA 2VJCA 1U2EA 2O2GA 2QT9A 2VEOA 1DU4A 2WHPA 4QDOA 2XQIA 5LZ8A 3KWJA 2GYVA 4MQMA 1ZGBA 4UFOA 5ALOA 1BRTA 2DHDA 4BC0A 5AKGA 5T4EA 4X6YA 1MAHA 2VJBA 1JJBA 3H2HA 3V9AA 3VVMA 4QZVA 4XWGA 4B81A 4YPVA 3WL6A 3A2LA 1IVYA 5H3HA 1XROA 5ALWA 2WFLA 5HF6A 1C4XA 4CIBA 3IULA 2XUOA 1QGED 2WIDA 2OQIA 3WZMA 4Y2JA 4L72A 4BYMA 4C4XA 4MYDA 4G8DA 3ZI7A 5F4ZA 1QZ3A 2K2QB 5LYYA 5JZ9A 3PUHA 3IVMA 4UHCA 2OLEA 1K8QA 3WK4A 4AMZA 4G8CA 1EX9A 2HHAA 2WQZA 1Q83A 3WKDA 4DLNA 1VLQA 3G02A 5HFNA 5AM3A 1TQHA 5DTIA 5AOAA 1E5TA 5JD5A 3DDUA 4Y2UA 4UHDA 1R88A 1ZJ5A 2ROQA 4ARBA 5AOCA 1EK1A 4EY5A 3SWWA 3DQZA 4X85A 4H7KA 5A71A 4B84A 1AKNA 4L0CA 1BEZA 2Q0XA 1BN6A 4GW3A 2JGJA 4X95A 5ALUA 2V97A 5AIAA 1CV2A 4DIUA 4BC1A 4BDSA 5KWIA 5EIEA 2RHWA 4H35A 5IVDA 3QMVA 1QIDA 4ARAA 4B0OA 4NMWA 2JGEA 2PX6A 3V1LA 3GFFA 5AO9A 4FHZA 1E3QA 3GZJA 2QUBA 3HXKA 4QDXA 3WKAA 3ICWA 1A8SA 1MN6A 3HEAA 2ZSIA 1E89A 2UZ0A 2WTNA 2RONA 1HKHA 5A7GA 3I6YA 1UWCA 4BE9A 1QTRA 3F8SA 5AKKA 3AIKA 3QPCA 4AZ3A 3VJLA 1MNQA 2JGFA 2X5XA 4FFVA 3BF7A 1TCBA 1A8QA 2QR5A 3YASA 4Q1VA 5AH0A 4KRYA 1CUSA 1YAJA 1MPXA 1IZ7A 4FDMA 4AMYA 2H7XA 1C7IA 5ESRA 1LPMA 2G5TA 5AI9A 1QIGA 1YAHA 1BEEA 3C8HA 4N8SA 5AICA 4OSEA 5E4YA 2ONCA 3ZLUA 2HA2A 5C7YA 1I6WA 2W6CX 4M0EA 3E0XA 7YASA 3TGLA 5CTAA 3WWOA 2PL5A 3H17A 5CH3A 1ZD4A 2H1IA 3R0VA 1MT3A 1G5FA 1HPLA 3C6ZA 4CG3A 4N5HX 1QONA 4FKBA 2CKMA 3H1AA 4X97A 5A7HA 4YASA 4JH0A 3I6MA 5ALHA 3M3DA 3ILSA 4DMKA 4W1SA 3VISA 5ALQA 3JWEA 4BAGA 4WY8A 4K5QA 3CCBA 4C4ZA 2QMQA 1YASA 3PF8A 3WKCA 3O9VA 3H2KA 1R1DA 5CURA 3ZLTA 2HRQA 5ALYA 3U0VA 1VXRA 4NVRA 3WWCA 4PF1A 4UBNA 2Y6VA 1TCAA 2QRUA 4AZ0A 5BV7A 3S2ZA 1X2BA 3O4IA 1AURA 1CPYA 3RARA 1ZOIA 1GGVA 3OG9A 3HACA 3FNBA 4XVCA 3BF8A 1UK7A 3B12A 2J3QA 5DTJA 4GLBA 4BVLA 2GBIA 5LKRA 2HA3A 1KU0A 5I7UA 2Y2VA 3GUUA 4OYLA 2VAVA 2VTVA 4ZREA 2C4HA 4CG2A 5A62A 1U65A 5T4BA 2DHEA 2X76A 1GPLA 1QIIA 3ANTA 3DEAA 3QMMA 3ZWQA 5KREA 1R50A 1W4LA 3WJ2A 3CXUA 1H2YA 2BUCA 1EVEA 4HXFB 3NGMA 1QO9A 1L7QA 3I28A 2C58A 1LPNA 3OPMA 1UKCA 5JYCA 1O6GA 3WLAA 4CFSA 3G0DA 5HKBA 3KSRA 4BE4A 5DNWA 2ZYSA 5ALEA 4I19A 4BZZA 2Z3WA 1T2NA 1LGYA 4OYYA 4DNFA 4OU5A 5AK4A 4QDZA 1QIMA 4Q34A 3STTA 1LPSA 4NZZA 4PV7A 1XQXA 4OB7A 2VT7A 1TCCA 5KBYA 4Z49A 1ISPA 4G8BA 3ESDA 5T4HA 4CG1A 4AO8A 3QM1A 3I2FA 1HLGA 4TGLA 4Y2SA 4X71A 3FCXA 3HRHA 4Y9SA 3K9BA 5DNVA 2WFLB 5K3AA 3Q8WA 4J0CA 1DQYA 3ZPXA 3H0CA 3X3HA 5CW2A 5FXMA 2IITA 1LPBB 2WU4A 3Q0TA 2WUEA 4CCYA 3STVA 1XRNA 4QDUA 5E4TA 3VKFA 3FOBA 1UOPA 1R9NA 3OC0A 3D59A 4CIAA 1MO2A 1GKKA 5IKXA 1EHYA 1CUWA 4KAFA 3HSSA 1H2ZA 4KYVA 1WB5A 1UXOA 3NUZA 4GI1A 3RM3A 3QBJA 2RHTA 4W1PA 2QUAA 2C0QA 5CT6A 4BZWA 5SYNA 3GBSA 2RI6A 1XZMA 4MWSA 1CUZA 2XQKA 2XDWA 3AFIA 4Y2XA 3WK5A 5FDFA 4ITVA 3H2IA 4Q05A 4GBGA 1DWPA 3WWPA 1A8UA 4BVJA 4B80A 2RAUA 1UKBA 3KDAA 3F9CA 4J0GA 1Y37A 4U2EA 2WM2A 5EFZA 3F97A 3LS2A 1ODSA 4EUSA 1QLWA 3STUA 3PE6A 1LPAB 5DYYA 3E1GA 1LNSA 1DWQA 4UFNA 5IVHA 4JYMA 1MU0A 1YA4A 4HRYA 2G4LA 1LPPA 4M0FA 4LHEA 2ZYHA 4U2GA 4BRSA 1IMJA 3M81A 2ORYA 1Q0RA 3EBLA 3B3QA 1K5PA 5EHNA 4J03A 4DSZA 3HABA 1LZLA 4IH4A 2O2HA 2AJDA 4P9NA 3ESAA 2PPLA 5FKJA 4U2CA 2XB6A 5KWJA 1XZEA 1W6RA 4B82A 1JFRA 4MJ3A 2XMZA 1P0PA 1AMNA 2VF2A 2ZJ7A 3KWFA 3H2GA 2PUHA 2AJBA 4F60A 4ROTA 4G4GA 3U1TA 3DYIA 4FLEA 5EIHA 1SOMA 3PUIA 4OB8A 3G0BA 1AUOA 5D7BA 4Y2VA 4FNGA 2V96A 1XZDA 3PF9A 4PNZA 4BB0A 4Y7DA 4N8EA 2OAEA 1EB8A 3ZV7A 5ALFA 2CZQA 5FUMA 3LIIA 2VA9A 1R4ZA 2I03A 3PICA 2CB9A 3C87A 2XUIA 4B6GA 4MYSA 4N8DA 3AILA 5JAPA 3D5EA 4EBBA 5ALLA 2XMSA 3FYUA 1CIJA 4WFIA 3STXA 3ANSA 4RNCA 2JGIA 3KXPA 2WKWA 2B9VA 3QITA 5AKIA 2HA5A 1Q0ZA 5K3FB 5FV4A 1UFOA 1BE0A 1VZ3A 4Q3LA 5CH8A 2OXEA 4EY6A 1J06A 3JYHA 2BCEA 3WYNA 2HA0A 4WDRA 2XMCA 4J0JA 2BGRA 1LPOA 1P0MA 1VXOA 3LP5A 3GROA 1E66A 4UBMA 5LIPA 2XUFA 4HZGA 1ZI6A 3DS8A 3ZLVA 4NS4A 3O4HA 1ODTC 1XZIA 4BP9A 1ZD2P 3BL8A 4Y2PA 4KJXA 3IA2A 4UHHA 4C4YA 4BCCA 3B5EA 2D5LA 3F67A 4LKOA 4CCWA 3A70A 4UPDA 2ZVDA 4I4CA 4L3WA 3W04A 3FSGD 5FOQA 1IUPA 3R3YA 3BIXA 4K2AA 4H18A 3FCYA 4TVKA 1K4YA 1CUXA 1DTEA 4AN1A 4G1FA 1HQDA 1UK6A 3BDVA 3I1IA 4AX4A 1AX9A 1NU6A 1P0IA 5E2IA 2XUKA 2I3ZA 5EHQA 5DYTA 5ALIA 2C7BA 1AGYA 1GXSA 3BJRA 4H7JA 1ODCA 2WJ6A 3FAKA 4MXDA 4IO0A 4FMPA 5SYMA 4AO7A 1EA5A 3TJMA 5LZ5A 4U2BA 4KAJA 5FPQA 3IUQA 4ZWNA 5A2GA 1DQZA 2PSJA 2XMBA 5AM5A 1CUYA 1ZICA 1RP1A 3EQ8A 1CUGA 3EIOA 4ZXFA 4AQDA 3D3NA 5DJ5A 1N5MA 4HS9A 1F8UA 2QZPA 3WIBA 2AJLI 4WFKA 4FBMA 5HF8A 2GYUA 4OB6A 1EDBA 1JMKC 3MUNA 3C70A 2B20A 5LZ4A 4MEAA 1YSCA 5AKYA 3OURA 3BJMA 1QOZA 1AQLA 5JALA 4IH9A 2QS9A 3I2KA 5AIBA 1ZJ4A 3STYA 5AI4A 2HADA 1UK9A 2BFNA 2CBGA 3OOSA 4GWLA 1P0QA 4DM7A 1UT6A 2PSFA 1QIHA 4LYEA 4HXEB 2BGNA 2HRRA 3WWEA 2XMDA 4W63A 2OAGA 1Q84A 1XZBA 3EQ7A 3P2MA 4UHEA 4BAUA 2W22A 2DHCA 2AXEA 1WPRA 2IIVA 2QXUA 5AK5A 2VJAA 4INZA 1MX5A 4P08A 3QZUA 1DWOA 5E4JA 4B9EA 3C43A 3AUKA 1OCEA 3V48A 1DX4A 3BE8A 4UHFA 2XLBA 4LXGA 1FFEA 5JZSA 5EHZA 4BRZA 2ACKA 1QE3A 5HKAA 2ZSHA 3PFBA 5EHXA 1LBTA 1XLUA 1LBSA 4EB0A 1ZGCA 1RYYA 4QEKA 1ORWA 3HZOA 3WL8A 1Y7IA 4H77A 1CLEA 3FVRA 2ZJFA 2WIJA 3HI4A 4H0CA 4I3FA 4PQEA 4BCDA 4J7AA 4U2DA 2WU3A 4FBLA 3A2NA 1XZKA 4JNCA 1JT2A 4DMFA 4BCBA 2Z3ZA 1BU8A 2XQJA 5K3BA 4LXHA 4DYHA 1UZAA 4P93A 1E8MA 2ZJ6A 4FLMA 2XMRA 1UK8A 3IUMA 5JADA 5JZBA 5HK8A 5HCUA 5ALDA 4AB1A 3W05A 1GPKA 1WB4A 1CUVA 5AI8A 1PFQA 4KRXA 1CQWA 2WG1A 1Y7HA 5HQ3A 4OUKX 3I2GA 2HL6A 1UOQA 1WPXA 2OCGA 2XUGA 2WLSA 4UUQA 5ALZA 2X8BA 4Q82A 1W1IA 5CRIA 4IH1A 5AP9A 3H1BA 1XQVA 3AIMA 2XMQA 1GQRA 2E3JA 3O4JA 1AC5A 5JD4A 4YX9A 2Z8ZA 3R3WA 4E15A 2YH2A 3G9UA 1MJ5A 1T4MA 1EB9A 5ALSA 1ZIYA 2WG2A 2XUPA 1G4HA 4QWMA 3GA7A 4LIPD 2GZSA 4BBZA 5A7FA 4KE6A 5AK6A 1J07A 1FSSA 1FFDA 3AJAA 3WK7A 3BWXA 2PSDA 3F96A 4DSAA 3QPAA 3FWHA 3E3AA 2J4CA 3C8DA 5LP1A 2XQGA 4G4JA 1CUUA 4QNNA 1XKTA 2HA6A 5JARA 3FYUB 2PSHA 2VSQA 4DNPA 2DQZA 4O08A 2PU7A 3WK8A 5J3JA 1QIFA 5DWDA 5AK3A 1VA4A 1VJ5A 5AJHA 5D6OA 5ALKA 1RWQA 4K6KA 1H23A 1XZFA 1HDEA 1TAHA 4X94A 3E4DA 3R41A 4E46A 2R11A 1TKRA 3WYDA 3WZLA 1VKHA 4OD0A 5CXXA 5YASA 1IUOA 3FBWA 1QFSA 4E11A 1XZCA 3JW8A 5ALTA 2OGZA 1XRQA 3DD5A 2WHQA 3D2AA 1XQWA 1XRPA 3H04A 4F21A 1E8NA 1X2EA 2O7RA 4ZI5A 1QIKA 1CEXA 3C6XA 5EGNA 5K3FA 1GPNA 2JBWA 2H7CA 5CT8A 5AKJA 1VOTA 3WWDA 2RGUA 3AZPA 2JIDA 3AIOA 2WSLA 3MVEA 3WI7A 4Y2RA 3SX4A 3T52A 2PUJA 5BOVA 5JAUA 1N8SA 3WL5A 4EZIA 2ZYIA 1XRLA 3F98A 3I6ZA 4RE6A 3HJUA 3MGAA 5HFAA 4CCYB 5ALNA 1DINA 3BIWA 3DKKA 4HRXA 4GEGA 3AINA 2Y1KA 2HU7A 3KOOA 5AOBA 2G63A 2WFMA 2WFZA 2WIGA 4KEAA 3RK4A 2YXPX 4A16A 1R3DA 2XUQA 1X70A 4PSUA 1THGA 5LZ7A 3VXKA 1QO7A 2Z5GA 3IUNA 1ZD5A 1XQYA 2B4KA 2H7YA 2B61A 1WB6A 3DL7A 3TRDA 3WL7A 5LZ2A 4X3CA 1U4NA 5CBKA 2OQVA 4D9JA 4BDTA 2V98A 1LLFA 3WKEA 3T4UA 4X91A 1J2EA 1OXMA 4JEIA 3PFCA 1MX1A 4KR0A 3LCRA 2OCIA 5DLPA 4B83A 2WUFA 4FNMA 2VAXA 4ZRDA 1JJFA 3IIIA 1DT3A 1F6WA 5EI5A 5FP0A 4YK7A 4N5IX 2C5FA 1VE7A 2YYSA 5K3DA 1ETHA 3MUOA 1SCIA 2GZRA 3FLAA 4Q3OA 4J0HA 2HA4A 5IVKA 1KEZA 2P8SA 4CI9A 3QPDA 1TIBA 4QLAA 4U2FA 3WA7A 3UMJA 2QM0A 4WFJA 4GXNA 4PW0A 5DYWA 1JMYA 2QJWA 2DCMA 3VJMA 2H9YA 2JF0A 3C45A 3I2JA 4LYDA 4KAAA 3I2HA 1K63A 3I1YA 1W75A 2PSEA 2HU8A 1F0PA 2QKYA 4DMCA 2XUAA 3HC7A 1B41A 1EINA 5CT4A 5AM0A 4UBIA 2WUGA 4S0XA 4ETWA 5I9IA 3WJ1A 3IB3A 4K6GA 3HYSA 3O0DA 4XX1A 1XRRA 2WHRA 2GBCA 1XZGA 4J0DA 1WOMA 3BXPA 1YB6A 3ED1A 3TEJA 1MNAA 2AJCA 3DOIA 5CT5A 2AJ8A 2XLCA 5FLKA 5IVIA 2JGLA 3NWOA 1YB7A 1IUNA 1A7UA 5FRDA 2BAGA 5HQ3B 2PKYX 3G9ZA 1EXWA 2G5PA 1S8OA 2EEPA 1QIJA 3D2BA 3DJYA 1N1MA 2GBFA 4LXIA 3DYVA 4OPMA 2HDWA 5AKEA 2I3DA 2V9ZA 4QLOA 4B0PA 4H7EA 3VJKA 4H7DA 3W06A 4QWWA 5I8PA 5ALPA 4QA9A 4WCVA 1PV1A 3DKRA 4UBOA 3W2TA 3R3UA 4V2IA 3O9MA 5IH7A 2BUAA 2O7VA 4EY8A 1CUAA 2HU5A 3C6YA 5DNUA 2DQYA 4BVKA 2EDAA 5K5EA 1THTA 4A23A 1H22A 1CUEA 1ZIXA 3K6KA 4OCZA 5AKLA 3LIPA 4X90A 3H18A 2DR0A 2PBLA 3CN7A 4HXGA 1N5RA 1H2WA 1Z68A 4H7HA 3IDAA 3AZOA 2WUDA 2RIPA 3AZQA 5ISMA 2VATA 2XUJA 1U8EA 2CUTA 4BP8A 1WHTA 2OGTA 1NX9A 5JANA 1HBJA 2FX5A 4WDQA 2Z8XA 1LZKA 1QTIA 5AHXA 5ALVA 2XQFA 1AZWA 1C7JA 3R3VA 3IBTA 2J4FA 4FWBA 5ALRA 4AXBA 5FPPA 1XZLA 2OGSA 3G0GA 4BTVA 4F5ZA 1ZI9A 3FVTA 4UBJA 5AI0A 3DCNA 1E8DA 4IHAA 2ACEA 4UBKA 4DGQA 4X92A 3RLIA 2QTBA 5EIAA 1G42A 1WCYA 1CRLA 4C87A 1YS1X 4C6HA 1JKMA 2WJ4A 2DSNA 5CT9A 2JGKA 1EK2A 1NU8A 4UBLA 3ICVA 3OTQA 5C8VA 5AKXA 2WTMA 1ZD3A 3WMRA 3VDXA 3HLKA 5D3ZA 1CQZA 1MX9A 1PJAA 3V1NA 1FFCA 3FYTA 2WIKA 3K2IA 1EDEA 2C0PA 3C5VA 4X00A 1IZ8A 4ZGBA 3L1JA 2VT6A 5JIBA 1WHSA 4TPKA 4FTWA 5BWCA 1R9MA 3ESCA 1SCKA 2YASA 4B7ZA 3M82A 4QDTA 3DNMA 1TK3A 5HF9A 4PSDA 2OCKA 1EDDA 2BKLA 4MQLA 2Y6UA 3BDIA 5HF5A 2VQ6A 4KE9A 4GECA 3N0TA 2OCLA 3FYUC 2WHPB 2CMFA 3DOHA 2XMGA 3SC2A 1BS9A 1CR6A 2XUHA 2VJDA 3R3ZA 1SCQA 1ACJA 1JJIA 4J3JA 1O6FA 4J0IA 1ORVA 1YCDA 3CN9A 1BN7A 4C89A 5AKHA 3A6ZA 1FFBA 2FJPA 4X6XA 2D0DA 1EH5A 3D7RA 4W1RA 5AI5A 3G0IA 3G8YA 2XI4A 3R40A 2LIPA 1L7RA 3WK9A 5A6VA 4PSCA 2HFJA 3PI6A 5AI6A 4K6HA 3UUEA 2GYWA 5BWBA 4BAZA 2O2IA 4AN0A 4C01A 1YS2X 3W9UA 4MWTA 4IQ4A 3QVMA 2WJ3A 3C5WP 4P92A 3KD2A 1GKLA 1BCSA 3H19A 4Y2TA 3UUFA 3V1MA 2EDCA 5HK9A 5CH5A 2JGMA 1BCRA 6YASA 5JAHA 1CFJA 5K3EA 1UKAA 5AM4A 1UOOA 2DFPA 5ALMA 2HA7A 4WY5A 5ALXA 3D0KA 3L1IA 2J3DA 3QMWA 5JASA 1BROA 3OM8A 4DNOA 1XKLA 5C81A 2Y2UA 4Y2QA 1XLWA 1QIEA 4M0MA 1JI3A 3FLEA 4UHBA 1GQSA 4H7IA 1QFMA 5JATA 3O95A 1TRHA 1ACLA 1J1IA 4KE8A 2FJ0A 3A2MA 5C8ZA 1CUBA 2XUDA 4F0JA 4G5XA 4DNQA 1FJ2A 1W76A 4EY4A 3RKSA 4GDMA 3H2JA 2CJPA 4FFWA 2XT0A 2WIFA 3G9TA 3GELA 3FLBA 2PU5A 2I78A 4FOLA 2HFKA 4HVTA 5K3CA 5LZ9A 3C6BA 4ZV7A 2WG0A 2ECFA 2IX9A 4C88A 4Y2YA 1W52X 3DLTA 3DL4A 2HM7A 1CVLA 1VZ2A 3W9BA 5LLSA 4G9EA 1CUJA 4W1QA 4HTAA 3D2CA 1HL7A 4L9AA 1JU4A 1EI9A 4X93A 4ZV9A 5JD6A 4AO6A 5LKAA 3G9XA 4H7FA 3NOXA 3IUJA 1G66A 2JEYA 1VE6A 3WK6A 3O4GA 3G0CA 2QJRA 2WILA 1GZ7A 1YA8A 5T4FA 3N2ZB 1CUDA 4RGYA 4EY7A 2QOEA 4X7BA 1KU6A 1CUIA 3STWA 4G9GA 2C5GA 1XRMA 1YR2A 3PDCA 4EHBA 3WKBA 2QXTA 5CXUA 1SC9A 1XFDA 2ES4A 3IURA 2BJHA 1CUHA 4HAIA 3V1KA 3WQHA 4RPCA 4UFPA 4GHWA 2HIHA 3D4LA 2CEKA 1USWA 3EQ9A 4E14A 1EVQA 1B6GA 1VA5A 1CUFA 1JU3A 2ZYRA 1DT5A 4QE3A 2FUKA 1QJ4A 1OILA 2JEZA 3QYJA 2XE4A 1A88A 4BATA 4J0KA 4B9AA 2GBGA 1F0NA 3CCCA 1K6EA 1L7AA 4DTCA 4XIIA 3EF3A 1GT6A 1XZAA 5AKZA 4B85A 3S8YA 2QVBA 5ALGA 5AM1A 4DMHA 5ALJA 1DX6A 1MAAA 2BUBA 1ZI8A 2NW6A 1SFRA 4RE5A 4OU4A 1H2XA 1XLVA 1XZJA 5JAOA 3SK0A 4EA6A 4WJLA 4MEBA 5CMLA 5D3KA 5AM2A 3ESBA 1M33A 2PVSA 2PM8A 4X6UA 3WIOA 4G4IA 1D07A 3M83A 3VVLA 4FLFA 5C8XA 4KE7A 2OPHA 2OG1A 2R8BA 1MTZA
chains in the Genus database with same CATH superfamily
2IDMA 3DE2X 4QOIA 2BKVA 2A58A 1Z6YA 3KE9A 5HW0A 5IJZA 1JQDA 2GD1O 1P5RA 1WM1A 2V3WA 3GRCA 1MGOA 1E99A 2PLAA 3LLCA 4I1RA 1L4FA 4EYEA 4BWVA 3PZBA 3QYAA 4A5SA 5C8YF 2VWQA 1LKZA 3K96A 3ZH2A 3MINB 3HL0A 2GXAA 2OO5A 3WA6A 4KR3A 5EFOA 1I1NA 1I30A 1Y1PA 3QH4A 4LXYA 4Q3KA 1W93A 1BDJA 2FSSA 5JCPA 3NORA 3G6WA 4XCQA 2UUPA 2W42A 1DAGA 1NBWB 3MTDA 1KDZA 2VJCA 5GVSA 3SJCA 1A3CA 5FPHA 3DZHA 1NUQA 1EVYA 2FF5A 2XWJI 2QT9A 2OCBA 1DU4A 3ASUA 4QDOA 1JEYA 1CDZA 1P2SA 1G98A 2WVAA 1YJAA 4G2NA 4MCIA 1DQRA 3AKZA 5LZ8A 1QSGA 4N5LA 5C0OE 2XKBA 3ZX4A 1P5ZB 5CX1A 2AKEA 3KWJA 3T3IA 4URZR 3MT7A 3PHGA 4YLGA 3GFPA 3U44A 1BRTA 4O2LA 1GZ6A 1RI5A 4IFTA 2DHDA 2GM9A 4I4TA 4P4SB 4Q9LA 1FXSA 2BKXA 5I7SA 1CS0B 3B1VA 1OYWA 4PCVA 2GTIA 1NUUA 1TUBB 1VLVA 2GR9A 4N76A 5BMVA 1YVRA 2P27A 2PQ6A 4TKLA 5F78A 1LQUA 2DAPA 3E2MA 1JJBA 1C3OA 4RPHA 4RZ3A 1WDTA 1K88A 2RDMA 2V7QD 4II3A 2B6HA 2X42A 4RHUA 3K8QA 3QFHA 1CQXA 3JQAA 4GYJA 2DZDA 3BVPA 1VBMA 3KAJA 5DISB 3MN1A 5MF6A 1ZZGA 4CTNA 1EFPA 5ALWA 4R3WA 1W35A 1R8XA 3M1IA 4FGKA 5BSVA 3U56A 5IUJC 3WDKA 5IWAB 3P97A 2NV0A 4RFLA 3GDGA 3RW9A 4W6QA 3LBNA 3NTLA 1XTTA 3F6SA 4G65A 4CIBA 2KWIA 2FXIA 2IXTA 1N6KA 1Y3FE 3QE3A 1F0KA 9ATCA 2R0QC 2H5JA 5LOVA 3DFUA 2JARA 4MYUA 3G0HA 1PUJA 1Y9EA 3MTGA 2OQIA 3WZMA 4ZO4A 3NHAA 4HAUA 1ZCZA 2ZVJA 1VC2A 4LCEA 2BR5A 4C4XA 1W5AA 2GF9A 3AEYA 1Z39A 3ZI7A 2ST1A 5K09A 1W1WA 1HE5A 2HSEA 3H9CA 4FINA 1TJ4A 2EARA 4MO2A 1NXVA 4QDKA 5DVZA 4B8ZA 1P1CA 1BHSA 1KDPA 4JLSA 2XNKA 2R8RA 2D1RA 4E5DA 1MJGM 3RU7A 4LVUA 2PGNA 1BZYA 4MYHA 4B3BA 1X7YB 1TM4E 2A0UA 1G5RA 2Q7DA 2R1ZA 1KKLA 1A76A 1ZCBA 1EP1B 4NMHA 3WMGA 4YAUA 1SOWA 1XVTA 1T9AA 1K2VN 5CHYA 3ZD7A 4ZOLA 2GFIA 4DC1A 5EKXA 1A9PA 1PFUA 2AD5A 2VUHB 3S55A 2PZFA 1PP4A 3NFYA 4TSFD 3IHWA 1FPQA 1HZZA 4Z8YA 1PJCA 2WWWA 2P3LA 4DJ5X 1Q83A 3P96A 4ON9A 1M7HA 3VO2A 3VM6A 3T5MA 2DT5A 2R7AA 4BNVA 3VGPA 4LV6A 1YFZA 3ZDEA 1LLDA 2PEYA 2SNIE 5HFNA 1XVVA 4QBKA 1DEAA 5AOAA 4I55A 4DLPA 3B38A 1Q22A 2XUZA 3FMOB 3G6KA 3EG5A 2C31A 4I6EA 5KVVA 3TTTA 1VJGA 3A1SA 3IODA 1EUDA 1W5TA 3AI2A 3BFKA 1R88A 1HKUA 4FIDA 4KQ6A 3X1WA 1F9EA 3EFEA 2FN3A 1ZUD1 1EK1A 2OC9A 4EY5A 4ND6A 1CNMA 3IFSA 5IG2A 2H0QA 4X85A 4AJ9A 4H7KA 4LJAA 2NXJA 3A6GA 2DU8A 2OG2A 5E2AA 1WUYA 3AT1A 1WHSB 2IEBA 4GZ3A 2QRHA 2J3JA 3CEJA 5CFPA 1KS9A 4XAQA 2HMSA 3TDMA 5TC4A 2G6BA 2UYQA 4MVJD 1KYIA 4RY0A 1WEKA 2V97A 4LC9A 4TWZA 5AIAA 5IJXA 3GT7A 3I92A 4YYZA 5B53A 2Q3CA 3QELB 1TA4A 4JX9A 1KO5A 1AXGA 2GFHA 3D3QA 3HSYA 3SOZA 4CM4A 5B55A 1WPQA 1ODLA 3ZD9A 1GGHA 4DIFA 3HU3A 2J67A 1PVDA 4OP2A 3PRYA 1Z4PX 1VKJA 4XKJA 4PR3A 3WLNA 5IVDA 5BV8A 4BJHB 9GPBA 3RAGA 1PTKA 1JG6A 1RMYA 3FJ1A 2YKGA 4JI0B 1WVIA 8OHMA 4UTOA 3LOQA 3ECAA 4YRMA 4P7GA 4KK3A 2JGEA 2NPFA 4EVIA 1NYQA 2ZULA 3WG9A 5ADHA 1TPZA 3BMNB 3O8NA 3QXSA 5CR9A 3GLQA 3GFFA 4JENA 3V1LA 3A6EA 1J39A 1DFIA 1OTHA 3M34A 1DJLA 4MUXA 3W2GA 1W4AA 1R6TA 2E37A 1NVBA 2C8VA 2NVOA 1UDRA 4Z86A 5KTNA 4BOYA 4RBNA 4Q03A 1P5FA 3ONWA 4TROA 1XKQA 2JAQA 3N2IA 4IDBA 4MPRA 1D2MA 2XZTA 3D1JA 1MN6A 4GICA 2NUAB 5DNCA 4BWGA 4YMLA 1AQ6A 3V4FA 3L46A 1O94D 3FDZA 1JPJA 2AQ8A 1HKHA 1CQIB 5LU8A 3A9VA 4GT1A 4GOJA 3L8EA 1A9YA 2ZPUA 2PY6A 4I3HA 2X9GA 4AZ3A 3LUAA 2MSKA 3ZK9A 1JT9A 3F6CA 4IUCS 4GEKA 3VKGA 3OE5A 3PXDA 5BOSB 3BF7A 1VJ1A 4OXXA 1TCBA 1AN0A 5K6TA 1MP0A 4REQB 1QP8A 5AH0A 1YAJA 4ZGGA 4QAQA 4FDMA 4Y7CA 4HYEA 2H7XA 5C18A 1SEPA 1JEAA 1P1BA 1RLTA 2BY4A 2MHCA 2P3SA 1C7IA 1JPNA 2A9VA 2VNHA 1LPMA 3IDZA 4PLHA 4HGPA 5ESRA 4FUQA 1REQB 2XQVA 5TV2A 6PFKA 4MP8A 2J0UB 1PZNA 2KBFA 1PGOA 1T1RA 3OCZA 5AHWA 4TS9A 3MTEA 2BGKA 4U7TB 5T3YA 4XWWA 1CNFA 1P7ZA 4ZEXA 2Q4RA 5KX5F 1YV9A 2ZPTX 4AYXA 2ZIZA 3M49A 1ECGA 3N07A 1LDGA 1AE1A 1KARA 3RS4A 4YUXA 2F8SA 3HB7A 1UT8A 3UW3A 3MWLA 5C7YA 3GF4A 4Y6PA 3TOZA 1I6WA 2CYBA 3GPBA 1DZ3A 1SXIA 4G0VA 1M8KA 3E0XA 3EC1A 4RXUA 1HOXA 4NHOA 3Q72A 4WGFA 1KJWA 3VDQA 4HLQB 4O2BA 2F43B 3K4QA 1RAFA 1BYIA 2PL5A 4ZZIA 3VPAA 2AOUB 2ZB7A 1Q0TA 4XGKA 1G5QA 2JLBA 4U0JA 1JIVA 1ZQ1A 4YRPA 3T3MB 4TMYA 2H1IA 3KQPA 3P9RA 3WV5A 2HCJB 4GQIA 4F2DA 5HRAA 3CYFA 1PG0A 3L8HA 1EG7A 3RO7A 1FW8A 1YKFA 3V2HA 1G5FA 1K7EB 4EGAA 1O58A 1R6AA 2PL1A 1HPLA 4GWGA 4JLUA 4QARA 3RSHA 3MHTA 4YTEA 4EHAA 3UV7A 5JZMA 4U7DA 3B1FA 3MPUA 2PJUA 2ZJ3A 1FB5A 3D8HA 2F90A 4FUTA 3WYCA 2NUTA 1EDOA 3EMDA 1V3TA 3QJYA 1JYFA 5EZYA 3H1AA 2V5VA 5JDIC 1YA6A 3ZZNA 4X97A 1N9ZA 3HQ4O 3KZXA 4RPKA 3K72B 4CMAA 4BNLA 5DN6D 4YAIA 2Q9CA 4YMIA 4M7PA 2X3FA 4JH0A 1AA9A 1KPGA 5FPQA 5CA1A 3I6MA 1QKIA 3LCCA 4MIKA 1JX6A 3M3DA 2WYIA 5IN4A 2QN7A 5EAIA 4DWVA 3Q98A 1PTJA 1Z5GA 1N9GA 4W1SA 2V4UA 3OCJA 4GC5A 4YRNA 5ALQA 3JWEA 3V3KA 2IP1A 1N6LA 3B89A 3DF9A 3ENQA 1UDWA 3EW9A 3QLVA 4WY8A 4FQ5A 3HXTA 4N4AA 2WZQA 1T9ZA 3LYAA 1R27A 1ZS9A 1RHMA 1MF7A 1U9CA 1ZM7A 2WTUA 1G8FA 3ZLTA 2HRQA 1ECPA 3ZBPA 3PDIB 1FU8A 1YS7A 5BVGA 3EEFA 1FMCA 2E2WA 3KKKA 2NUPB 3PT9A 4M2LA 1YRAA 3WADA 2OHHA 1VIVA 4F12A 5A5VA 3QE4A 3TJRA 2C9ZA 3UENA 2HAEA 3C5CA 3CB4A 3DR3A 4KVFA 4N0DA 4NEHB 3IE0A 2WD7B 5I9TA 4EF5A 1GLNA 1MO3A 4INOA 3S2ZA 3U5ZB 1SCUA 3EQ6A 3HPQA 4XARA 1TD1A 3DM5A 1CPYA 2CLSA 1ZISA 4BLVA 1ZOIA 1GGVA 1YS4A 2GILA 1J49A 1T6NA 3F7OA 4IZIA 1F20A 2DUWA 3S40A 1V5EA 3AB8A 5LQKA 3CVUA 2AN3A 1MIHA 1M9NA 2I99A 4BO7A 1T4GA 3ELBA 4XVCA 1OX4B 3A1EA 2XGOA 4JZKA 3B12A 2FGKA 5C51B 1F4LA 3GGGA 3I0MA 5K3SA 1N2BA 4E3WA 3MWGA 4X3OA 2RKOA 4CGZA 2IKQA 4MTLA 1YI8A 1KMCA 3GUUA 2VAVA 5FXMA 1D2GA 3UIEA 5K4HA 3CRQA 1LQ2A 3HL4A 2IEIA 5FBQB 4NDNE 4NCAA 4M9ZA 4ZKEA 1EWTA 1N8TA 4CV2A 1FDRA 1OFGA 4B6SA 2FX2A 4FGWA 2VH1A 5AXAA 2Q5EA 4G86A 1Z3CA 1OXVA 1UJ4A 2C4HA 3AR2A 4OVKA 4RQTA 2C2HA 4CXMA 4N12A 3M5DA 2VC2B 2VQFB 4DLLA 1J1UA 3OSZA 3ZJYA 3E7PA 1Y63A 3L77A 3WYGA 5JXIA 3RF7A 3BTUA 4OOFA 3R8XA 2DBVO 4CNQA 3BSWA 4F7DA 1GPLA 4X63A 2VXBA 1IHYA 4DDUA 2WOOA 1D1SA 3U39A 3ZWQA 3QMMA 4LVOA 5SZKB 1I10A 1NXSA 1P81A 2EJWA 3IIMA 4WBSA 2D1YA 1W4LA 2SHKA 4FN4A 3WJ2A 3UB3A 4LYFA 3T7EA 5GJVC 3AQ4A 1HYHA 4QODA 5FUQA 1B0UA 4N7MA 2ET6A 3JZAA 4HXFB 1CRZA 3UT5B 1TU4A 1MXFA 2QLJA 2DUNA 3FGNA 5KYNA 2QBYB 1E59A 3OQBA 5DNYB 2C57A 3O03A 3M33A 4Y0AA 1O7JA 5JCJA 4EATA 1YGYA 3OPMA 3PRHA 4DR2B 2DUUA 4AY5A 3KOMA 1HUQA 4MPPA 4QUEA 1KQPA 4U6NA 4PFKA 4C43A 4N5DA 4ZVQA 3WLAA 2Q6OA 1YCGA 3G0DA 1E2BA 3UT0A 4MUJA 3PXCX 1FA9A 2B4QA 2FWRA 4MQEB 3G2OA 5K99A 2AE2A 5I7RA 2JATA 1A50B 4I19A 2IV2X 2ZB8A 3P0FA 1QE0A 4NH0A 3UKDA 4BZZA 1IK4A 4HEJA 1GOTA 4H6WA 4Q37A 4YJ3F 4O4IA 3SXUA 5HP4A 2GXUA 3QSGA 4D43A 2JRLA 4DNFA 3ZIAD 3DBHB 1MA3A 5H9WA 3Q7RA 3K53A 1W0KA 3A32A 4G85A 4PZPA 3DV0A 5IAOA 2CHEA 2FA9A 2ACWA 3DLPX 4FVTA 1WR8A 2IHTA 4Q34A 2G4VA 1HT0A 3F5DA 3HBLA 1ISMA 3KKMA 2GNOA 3BT7A 2VT7A 3BCSA 3PFWO 1W6UA 2NU8A 5IJ0A 2PZGA 3FCCA 1DZIA 1QLJA 1QYIA 4LX0A 1Z0SA 4TXHA 3VNSA 4PGFA 3OCUA 1I3NA 2QQGA 3EPKA 3PQ5A 2HRZA 2QB5A 3QA3E 1PNTA 1J5EB 3BEOA 1E6MA 1TDJA 1SVLA 1XN4A 2DCUA 3GBVA 3MLBA 4TRJA 5LA6A 4D6PA 4YRSA 1F7VA 5T4HA 4CG1A 1G17A 3QOWA 3DBRB 4AO8A 1I01A 4EGJA 4MH0R 3TB6A 4HUQB 5B7QA 1M0EA 1RJEA 3FTDA 2WKPA 3EVTA 2ONZA 3HCNA 2RH4A 3I01M 1ECFA 4RD0A 5GM2A 3LUPA 4PZ0A 4Y2SA 3NVMB 2YWGA 3KKEA 4R3NA 1XCGB 2RG1A 1E2MA 4JUDX 4LXXA 4NI5A 4LHSA 4TWAA 2FU5C 3K9BA 1WXFA 1PZXA 1XIVA 1NJFA 3D6UA 4ZAVA 3IO5A 3ZPXA 4BU0A 2R60A 5K8UA 5CW2A 2NNWB 1RRFA 1CRQA 2IITA 2EATA 1KZ4A 1LPBB 2Q45A 3B82A 2I4MA 3HRIA 2WU4A 3FYDA 4MQFA 4PHFA 3T7TA 5HKLA 3QE0A 2D8MA 4BB6A 3KJXA 4EGQA 2CGEA 3V8PA 3T54A 2WNHA 2WUEA 4CCYA 5ESWA 5AW2A 2E4ZA 5JISA 2G09A 1XRNA 3IMKA 2VZ9A 4GOMD 1MPTA 4ICIA 3ORRA 4G25A 3UHAA 3SNHA 4FGLA 1A69A 5IFLA 1RMQA 1WNFA 2HR1A 2G9UA 3UAWA 4JC8A 1I32A 2XE7A 2JG3A 1A4IA 1ID1A 1M6WA 1R9NA 1Y7LA 2FPWA 2IYZA 3BWEA 3OC0A 4TWRA 2DWOA 5JJ5A 5D3QA 3SHTA 4UTRA 1K7XB 2WYUA 5I51A 5U1PA 2GKSA 4L4XA 4OKIA 3KZMA 1OFUX 4KAFA 3E48A 3HVKA 1SXGA 3I1FA 3AVYA 1X1SA 2VRCD 5CEEA 4UCQA 1MW9X 2WY2D 1AOXA 1UXOA 1H3FA 4KQ9A 4MK4A 4U5QA 4Y1GA 3W9YA 2Q3EA 4ND4A 2QUAA 3E9QA 4UDXX 1EQ2A 1T91A 2FW0A 3TRJA 3R24A 5HR5A 3BRCA 5IARA 3EJ6A 1NQVA 2OP1A 3DLAA 4GYWA 5T6MA 3W5CA 1W36B 1YRYE 5G53C 4YXWA 4KQ1A 3OLQA 4DUPA 4B3HA 2X13A 3PQ8A 4JX8A 3LQKA 2ZRCA 2GM4A 4C5CA 3DVSX 1EUDB 2ZAIA 4N0MA 4NE7A 1T2VA 1T9GS 3GCDA 4ZZ2A 2I2WA 4MROA 2I3BA 2OYRA 3EEOA 4KOAA 3W3AA 1CB0A 1XDWA 2D54A 1NUAA 2XQKA 1IB0A 1WF6A 1ANKA 2B2NA 2PNFA 4TTVA 4BFXA 5J2TF 2M32A 3N39C 4UHKA 3WK5A 5JWRA 1TM2A 1CG6A 2BRUC 2A78A 2EBFX 2PLFA 3H8VA 2X4LA 4X6LA 1DG9A 4NR0A 4YR7A 3NHMA 1Y1LA 3GEPA 1V71A 2C92A 3IC5A 2IYEA 3GT4A 2XD4A 5CB4F 1A8UA 1RYEA 3EUFA 4UDOA 3AF0A 2VHCA 3LO5A 3Q3HA 4BVJA 1ZCJA 3ENNA 2WSSA 1R3UA 1PR0A 1XLTC 4CMBA 4EG5A 4HGOA 2HHLA 4PQYA 1GGJA 1KORA 1OLUB 1Y37A 1SAYA 2E4XA 4QRHA 1IN5A 4CMIA 2GLUA 1PJRA 1E1MA 4LJ8A 4EW2A 4ZC1A 3IAEA 1OHHD 3EPLA 1OD6A 4PLTA 1JTFA 1UOEA 2B94A 2FZLA 3AGPA 1VSVA 4EUSA 5ICGA 1IB6A 1Z5ZA 1VB5A 3PE6A 5CK4A 2M6LA 1LPAB 3NMUF 3AU9A 2PBFA 3GDWA 4M1QA 2M2IA 4L76A 2N1MA 2CC2A 2POQX 3G5TA 5DH9A 4CTMA 1FYEA 3VPDA 5L45A 3CVVA 2B1QA 2JKZA 4TMXA 1PQ4A 4PLGA 2ZJ0A 4DQKA 2ZQZA 2XE8A 4TOIA 3WWYA 4HRYA 1P19A 1HR0B 1BEUB 2WKSA 4HAVA 1WOYA 5KDLA 2GVNA 5BRJA 1E1CA 3EBOA 3TTWA 1PN3A 4U2GA 2ZCVA 3FNIA 4MLDA 5T64A 2V0GA 3LC0A 1VE9A 3M81A 2ORYA 3RVQA 3THOA 3DDHA 1YONA 3KHKA 1TX4B 1YDFA 3EBLA 4L3OA 5KYWB 2PZEA 3KJQA 4QDJA 4B4OA 3LNTA 3M6FA 4J03A 2AHRA 5EHNA 4OATA 4QYTA 4DSZA 5LQDA 1Y6FA 2AZXA 3I3OA 4EUHA 4MVYA 4EELA 3F8TA 1WZCA 4YJ2F 6Q21A 3OC6A 4R31A 3Q8MA 3LKVA 2L2QA 4IEIA 5ADVA 4P9NA 5J58A 3DVRX 2FEPA 2GK6A 1NRIA 1UM8A 4FDAA 1NLYA 1X7XA 1ADGA 2PGOA 1KVSA 2ZRQA 4FW9A 1J0BA 3Q41A 3F49S 1BE6A 3T8YA 1MAUA 1NDHA 2ZWVA 2FPIA 5BUQA 2X0IA 1JFRA 1RABA 1ADYA 3NC1C 3CLVA 1QFYA 4MGEA 2FP4B 4O1HA 3MZ0A 5FH9A 3AVVA 2VHVA 3OQ1A 2XMZA 3L06A 4XIYA 1B8UA 2OBBA 1FBTA 3NVKI 2QUJA 2VF2A 1ZPDA 1VL0A 4ZMBA 3ZDDA 4GSLA 4KIWA 4ECAA 1O57A 1ADJA 3G5LA 3QOFA 4ROTA 3UCXA 4B3RB 3CZMA 1E2IA 1REQA 4UJ5A 3CLTD 5FFMA 1IJBA 1GD1O 3RS3A 4M4SA 4M76B 4XYBA 3WY9A 2HMUA 1YU9A 2AYXA 1YJXA 4IOMA 3V55A 2YZGA 1MRSA 3KU4A 4ZI2A 5I4IA 1AUOA 3V2GA 3K2QA 4WBNA 1IXKA 4PSVA 3GAFA 2C95A 2Y1LA 4J0EA 5KQRA 2OK8A 3NHSA 1TVMA 3M1LA 1V11A 3GH3A 2Q9UA 3PF9A 3VA7A 4J2TA 3QYPA 4Y7DA 1UC9A 2GKOA 1RRPA 4IWXA 1PL0A 4HAWA 1NUTA 4PPFA 1GV0A 3ZV7A 4EHLA 4JP3A 1WW8A 4G0QA 1Y81A 5EP1A 3WGVA 5AVSA 5FUMA 2I03A 2ILTA 4QPNA 5FOXA 1II8B 2CB9A 3HCOA 3C87A 4LXTA 4TZ0A 3TLJA 1BKSB 3T35A 5H7XA 2D6FA 3E2IA 3EFOA 1TF7A 1I8TA 1OAOC 2FFHA 2PKCA 4LNUA 1NN5A 1NQOA 1W9MA 2VK8A 3AXTA 3EXIB 1F8XA 3L2OB 4FFRA 4N8DA 1IDOA 3Q85A 3GEGA 1G1MA 3KHUA 4D0GA 3O73A 5JWOA 1YOBA 3WHIA 3GA5A 4JQCA 2XB2A 3SEFA 3D5EA 3LMKA 3I9LA 5AW6A 4EGCB 4EBBA 1G7TA 4EJSA 4WASA 2PZAA 3EARA 1F12A 3LP6A 2PFSA 4JQZA 3T7CA 3VHRA 1RVV1 4F6RA 1FVFA 1CIJA 1Z22A 4V1CA 3ZBTA 3PQ4A 2WPDA 1XL0A 4QM7A 2JGIA 2DH5A 3FFAA 2OGUA 5EXTA 4NBSA 4JNKA 2D2IA 2O0MA 3O7WA 3UT6A 1HNWB 2X8JB 4P34A 4EMUA 1KP3A 2NZ8A 4QXAA 4UCWA 1WAMA 5CA0A 3U1VA 3EMKA 1A77A 2AI3A 2PA0A 3A9TA 3OWHA 4TX1A 4Y9UA 5IJWA 1V26A 5K2OA 4BKPA 2OXEA 2W2LA 1VFNA 3PWZA 3ZZUA 4I5DA 2WYOA 4GOXA 3PTLA 1JHAA 1ZGAA 4GRAA 2BCEA 2Z08A 5M7EA 1XMQB 3L8MA 3P2JA 2ZTUA 4YJFA 4ZTUB 3AU8A 1SK9A 3WYNA 1ZK1A 1H4SA 3VTFA 3EH1A 1M34E 4RO0A 2HA0A 1PZHA 4WDRA 4TVSA 1S7GA 2XMCA 3QU5A 4EL0A 4HH1A 1LPOA 3FHTA 2XEDA 3B3GA 3AP3A 1J8QA 1N2CB 3BJEA 3Q8XB 2H4ZA 2JVKA 1KVQA 2YJ4A 4JEHA 4IJKA 3T7DA 1PW7A 3PP8A 4OI1A 3ZI4A 5LIPA 4Q3NA 3DDZX 3WYEA 4UC0A 1XZPA 1NL3A 3PXXA 5IM5A 2Y9MB 1P2VA 1DJNA 2JFNA 4LRUA 5FAKA 1EK5A 5I8WA 3ZWDA 4EGSA 1YI0A 4CDNA 5LXTB 4JMLA 1OXSC 3BL8A 2D1TA 1AQJA 3MMXA 2A9FA 4CIYA 3OQNA 4NYIQ 1JEQA 4UHHA 1SXJB 1CJSA 2GPBA 1NBOA 2O19A 1YZGA 1Z2AA 4UASA 2YJNA 3U7HB 4TTRA 1T9CA 2P2SA 4LBZA 3QHPA 1BMFD 4MB0A 1X7WA 1Z15A 2GD6A 2D5LA 3F67A 1S02A 3O47A 4LKOA 4PG6A 2Y0BA 4G56A 2B0CA 4JJIA 1T1IA 4RD4A 4BVHA 4F04A 3Q5EA 5KVSA 1NSFA 5F33A 3UH1A 1GITA 3EHDA 3K4PA 4OX9B 1UIMA 4LOKA 5BWOA 1A8IA 1LBIA 3VAAA 5SICE 2WSBA 4MRVA 2ZVDA 3W04A 5FOQA 5EE3A 1IUPA 1NHWA 3MIZA 4EF6A 2KJQA 1AU9A 1D0VA 3R3YA 2JI9A 4P7BA 5CLGA 2JCYA 2OFPA 2GN6A 4CV3A 1YZQA 3VPHA 2BI4A 1K4YA 4TVKA 3T4PA 1QGOA 2ZBDA 4HDRB 4L7QA 3JV7A 5AJVB 1Z35A 5LYJA 1DTEA 4AROA 4AN1A 3H8JA 3KYJB 3HJGA 4L27A 3USES 1HQDA 1QZUA 3ANNA 3CH4B 3PITA 4ENRA 4IX9A 5I7VA 2ZT8A 3PX7A 4IIYA 5JHHB 3EODA 2AFVA 3CSDA 4G07A 5E2IA 3N74A 1YZ3A 2FTKE 3CZ9A 3RYFA 4ZQFA 2XUKA 2CV1A 3RHZA 2JLCA 2C1ZA 3FNEA 3GRFA 2C7BA 1JAXA 2C82A 4Q4DA 3QXHA 1R15A 3OU6A 5E38A 3ET5A 3RHFA 5CFZA 2D4HA 4H7JA 4JVOA 2VCHA 1ODCA 4GMFA 4MXDA 1J90A 1W8IA 4MGKR 5CYFA 1W0KD 3UUGA 3U60B 2PX2A 4B4KA 1UBGA 4OQYA 1Q12A 4HWSA 2EGUA 2MWMA 3EZLA 3HVIA 3M70A 4FSHA 1E9AA 2UKDA 3O3MB 4KAJA 4O2AA 4Q3CA 3BMCB 1N3IA 1WW2A 3BIFA 1QO0A 4I8IA 5I8ZA 2OFFA 1CRWG 4MQ6A 4HMQA 3T3EA 2AJTA 4D3FA 2FF7A 4FSDA 5FPYA 5JSFA 4R8SA 4CG3A 3A27A 5EIXA 2XITA 3LT5A 3KQKA 4ZXFA 2PQ2A 3T7JA 5DJ5A 2GLXA 5JNSA 3WL3A 2RJ3A 3VZSA 2O8DB 1OKKA 1T8RA 3Q3GE 1A1SA 2F3RA 4PTLA 3RK4A 1P45A 5CVUA 5TQ2B 4UAGA 5L6MB 1DUSA 1R6XA 4LQDA 1OPRA 3UJ6A 3QQPA 4QBFA 5CA1F 1GFIA 2PMDA 2ZR0A 3GFBA 4GR4A 1RPTA 1NT4A 1P6XA 2GTHA 1G2QA 2ONKA 5EEHA 2QX8A 4OKSA 5FBRB 4RIEA 3HUDA 3ICPA 3EH2A 4FHGA 4ZVLA 4F3TA 1L5MA 4OB6A 3H1TA 1JMKC 1NXQA 2B8NA 3C70A 3ZE0B 5EMKA 4QGFA 4DY6A 2H2FA 1DDIA 3HXLA 1I2AA 2WJPA 3SS9X 2SCUA 1E0KA 2V0CA 3D2LA 4E4RA 1NM5C 4EO7A 3WAJA 4LYYA 1UDXA 1Z29A 2JNWA 1FS4A 1HDRA 1QOZA 4TV9A 1U6IA 3AUUA 3BMQB 1GGNA 2R8EA 1EUCB 5DHRA 3DUFB 1V4VA 4D25A 3QSYA 5CAEA 2UVQA 2C4NA 2FX3A 2YXDA 1QB7A 3I2KA 4NZYA 1RWBA 1ZJ4A 3HFSA 3C1AA 3BXEA 2EG9A 4IV5A 4Q9IA 5AI4A 5FV7A 4E22A 2BTOA 3ISJA 3DH0A 2Q5FA 4FFBA 5E8JA 3RROA 5E6RB 4FB4A 1P0QA 4PM4A 4GE0A 1CVIA 3KNZA 3H5WA 2OORC 1R64A 3RUAA 1QIHA 4LYEA 5IT0A 2XOEA 2OBMA 3WWEA 2VZLA 4RK4A 2JS7A 2YFYA 4X44A 1XJ5A 4PPNA 1Z8NA 2XMDA 3ETJA 4W63A 3WMEA 4B2PA 4ZVOA 5F52A 1XZBA 4XJSA 3UKJA 1Z6ZA 3IQIX 4BAUA 1DC4A 1G291 2ZEJA 2XIQA 2W22A 1O9BA 2OOKA 1T2DA 1YRWA 1BS2A 3GI1A 5EIFA 5EVJA 4MQFB 1Z0IA 4PLFA 4CYMA 4F91B 2GPYA 2VI5A 3F3KA 1NBME 2UYHA 3DWIA 4RF4A 4P0PB 3DTVB 4HDOB 5THKA 2XADA 3EIEA 4A15A 1DAKA 2QT1A 3TMAA 3O8RA 3B6KA 1J2UA 3QZUA 2H1SA 3AIIA 5E4JA 2VWGA 3HDYA 2FLKA 1K4MA 4HS4A 2OXRA 2BFOA 3IMFA 4BMVA 1EP3B 3DT9A 1VHQA 2O1SA 2ZSFA 4HMOA 4K6OA 1PKXA 1PFVA 2OHIA 3KRTA 3N8NA 1CY4A 3IB6A 3M5PA 1RYMA 1DX4A 1ZZEA 4HWRA 3W4JA 2H8KA 4GOND 3D02A 4BPBA 2NO9A 2BISA 4S24A 4UHFA 4M60A 5GJWC 5LM3A 2QZZA 3SBOA 2WA1A 1YVPA 3V3TA 4L5CA 4MRSA 4CMJA 4LZJA 3CV3A 4DIBA 5EHZA 3ZZ1A 1IRIA 4BRZA 2EOAA 2ENWA 1GDTA 1R0YA 1RLIA 2INGX 3QK7A 3QPWA 3LUHA 3BYZA 1J42A 5HKAA 4W5HA 4IUBS 1ZFNA 2FP3A 1XLUA 1Z2NX 2CMGA 3AEXA 4JBLA 3KSDO 4S35A 5F7OA 1M6EX 1ESCA 2P90A 3DOCA 4EB0A 2G83A 3I72A 2WJGA 1K8RA 3BS4A 3VR5H 1U5BB 1L1QA 1S89A 3VTKA 4QEKA 1DV2A 5JOQA 5JWHA 4H77A 3VDNB 4C4PA 3BZBA 4GBJA 1LW7A 1XEXB 4EB3A 2RHCA 2ZXUA 3K3PA 2YQ4A 1ZEJA 5FHQA 3GLGE 3WYBA 1PL8A 7MDHA 5E95A 3TK1A 3WWZA 4NG4A 3DMYA 2NSYA 5CJ2A 1WL8A 1PEDA 2WU3A 4PGHA 3HDVA 5CFNA 3GLRA 4ACAA 2QF7A 4OHYA 1I1OA 1FLAA 1B2RA 4YT4A 5CNIA 1NJ8A 1E79D 3M4JA 2GEDA 4WY2A 4DMFA 1Z73A 1P3JA 1ZRNA 2QPTA 3HA7A 4HPJB 2L0XA 4XDGA 1SB8A 1YGPA 5K20A 3ORQA 4RTRA 4MARA 5K3BA 4DYHA 3M9WA 4R68A 1VJDA 4KXXA 5BURA 5HIIA 3OBIA 1Y4AE 4D44A 3DDOA 5KTKA 3W7VA 4ARCA 3TQQA 2J5BA 1FJHA 1KIFA 2QSYA 4RAQA 2CUNA 3KYDA 4YCBA 5F1OA 5BNFA 2IPMA 3ZHXA 2HQOA 2ZJ6A 2O07A 3UBTA 4GO1A 3IEMA 1UK8A 5AJYA 10MHA 5DSXA 1NATA 2VJNA 5HK8A 1DL5A 5HCUA 3ZDAA 1CXZA 4DPKA 4JJEA 3RJTA 3UAVA 1P4SA 2IKSA 3CUVA 3HYNA 5H83A 1UWKA 4FX5A 1QG2A 5MGNA 1JXQA 2V7WA 2YYZA 4PLZA 3FMGA 1IFXA 3CB2A 3SHOA 4ZI7B 2QTHA 2W93A 1F8GA 3S3TA 1SG6A 2IHUA 4HBGA 2ZWIA 2PUVA 2HIMA 1CULC 4HDMB 2HCBA 1X14A 2XY4A 2W90A 2YN2A 4KRXA 3V8RA 3GRZA 1F48A 1I5EA 3E61A 4FSXA 3UXHA 5J40A 2O8FA 4LDJA 5JNUA 3KKZA 5D85A 1CC1S 1FQJA 2CF5A 1YR6A 3OHMA 4JA0A 3VTAA 4WZBA 3OPYA 3IJEB 5DULA 4YJKA 5C4MA 2FMTA 5C34B 2HL6A 2RHJA 3JZFA 5DXJA 4B09A 2VDWA 1WPXA 2DFKB 2XUGA 3LDGA 4BO9A 4CGYA 3UCFA 3IAXA 2G9RA 1AM4D 3KYIB 4FNOA 5F2EA 1G59A 1R8YA 4ZC8A 3GOQA 4WE3A 1VMEA 2PKQO 2QEQA 2V6MA 2JLRA 3N58A 3AY6A 4KNYA 2CUZA 3DQPA 2I4NA 4OHPA 2JI7A 3REQA 3ROPA 4Q82A 1W1IA 1KRXA 4IH1A 2B3DA 1VG9B 2COKA 1GZ4A 2Y71A 4JDUA 5E7QA 5AP9A 4QQ8A 4MMXB 2HW8A 2F64A 2RI0A 1FMJA 2YVAA 3A9CA 3ZZTA 1I4LD 3AIMA 3F5SA 4GYKA 1WG8A 3O4JA 3LLUA 4TQAA 1KHHA 1QF7A 3PCXA 2C9DA 3L0IB 5AD1A 2DR2A 4E15A 2YH2A 3G9UA 2C9BA 2W43A 4OXIA 2FPKA 2NWQA 3D5QA 4B7CA 2KYRA 1P2TA 3RVPA 4JJFA 4M7RA 2FWIA 2WM9B 3DBOB 1QAOA 4XGIA 2BMWA 2GEKA 5K0EA 3PD1A 1G4HA 1JWAB 2OAP1 3TQOA 2RGRA 1GY8A 2PXCA 4WNIA 3TMYA 5A7FA 1PYDA 2V7GA 1IBCA 4CQLB 4BNHA 2JLVA 4ZV4A 2FEMA 4JFRA 3BWXA 3F96A 2DTDA 1OV6A 3JYLA 3KPUA 3KP1A 1ZSVA 4ZT7A 5HPYB 5LP1A 1NUSA 3WRXA 4RPGA 2A8YA 4PBSA 1N25A 3O84A 4JOCA 4QNNA 4ZVRA 2PCJA 2EFGA 2IEZA 3WX0A 4EGFA 4F6RB 3H8WA 4C7XA 4D4JA 2PSHA 5JNLA 5C7LO 1ILEA 3OZTA 4DNPA 3NKVA 1ZAKA 2CN1A 4FONA 3JARB 4CKXA 5J3JA 1Q1GA 3RANA 3O2SB 3LYLA 1F0YA 3GVHA 4FE7A 1VA4A 3AFHA 3JTMA 2XYQA 3HUUA 5BSKA 1NULA 2H63A 3BGSA 2GCIA 3ZHSA 5ALKA 2H29A 3A1UA 2A5YB 3NBYC 4MA4A 5GIOE 4LZOA 1JKFA 1TAHA 4HYTA 4C0SA 4DCCA 1YVEI 3I8OA 2J9GA 3R41A 5BR1A 2R11A 2O8NA 3U3OA 1TKRA 2YV5A 1U2SA 1P1RA 3Q15C 4BX8A 4OHUA 3PRJA 4HZUB 4IHJB 2IXDA 1Z4OA 3EY9A 4OA5A 4P98A 5DHPA 5CXXA 1X1DA 3FOEC 3KJGA 1X87A 2OLJA 4D5EA 3GLIA 5E7IA 3CUUA 4LZNA 3CNNA 4M22A 4IINA 4CR8A 3OJCA 3HR8A 1FX0B 2OTCA 1IUOA 2ZS8A 1Y4SA 2J07A 1CZLA 2XTJA 3WFJA 4KLCA 1EQAA 3COYA 1VHDA 4HUJA 4KNVA 4IRXA 4YNBA 2C3MA 2MR6A 2J46A 3IPCA 1SXJC 5LMUB 1AA6A 5JS1A 3UV3A 4C0QC 1NF2A 5ALTA 3OOJA 4NE2A 2XOXA 5DCLA 1S8AA 1XRQA 3DD5A 4ARZA 5J59A 2XF2A 4AW9A 3DZBA 4HB3A 3G9QA 4FMCB 5L51A 2WHQA 4HYYA 5CYGA 1YFJA 5IMBA 4WA7A 1SXJA 1XRPA 1OF1A 1YKGA 3PFIA 2Q07A 2XVMA 2HYIC 2QTVA 1I4WA 1PJ8A 3DXXA 4PYQA 5D86A 1QIKA 1CEXA 4IG9A 4LJ5A 1Q1NA 2VNSA 2C9YA 3B7GA 3FSEA 4J29A 4B7UA 3AHHA 1Y89A 1X13A 4KMMA 2DOKA 5K3FA 4YAJA 4MS1B 1V45E 3U9TA 3HUEA 4A0GA 4NOMA 4AYWA 2DBRA 2JIDA 1HMPA 2CEAA 4B2YA 4KG7A 4G5GA 2G9ZA 3FNGA 1SA0A 2CY0A 1W2HA 4DWJA 4N39A 5COQA 4ZOBA 1G0NA 4F3NA 3L7YA 3SX4A 7REQB 1PHPA 3K5HA 2PUJA 4RV5A 1QQBA 4AL4A 1WA5A 2PFGA 1N0IA 5JAUA 2A1UA 1A27A 3RSCA 1N8SA 3WL5A 1EE1A 3WMFA 3ETEA 2IYFA 2XZOA 1LWOA 3QBEA 5DTQA 4CQJA 4E0BA 2Q29A 5I9SA 4N40A 3X1XA 3VNAA 4FYWA 4HWGA 4RE6A 4BL5A 5KC9A 4U63A 5HM8A 1E1KA 2B4YA 3SSAA 1MEEA 1PT6A 1RC0A 2D06A 3WDMA 4F1KA 3RSQA 3MGBA 3EIHA 2RKWA 2IUFA 4RVUA 5CX1B 1DBVO 2YIMA 1JR3D 5FBKA 4CRWB 1ADFA 2H3HA 1WW3A 3RFUA 3V7FA 3AQIA 3TZEA 1GPAA 2ECKA 3BIWA 1R0RE 3U7RA 3EXEA 1JF8A 2VTEA 3AINA 3HHPA 3QY9A 1QHNA 2OCPA 2W6PA 2Y1KA 5JXWA 2W6OA 3BMCA 1KO8A 2WABA 3KOOA 3FPSA 3PLRA 5AOBA 4AUMA 2HT1A 3FZQA 1EFAA 2WFMA 1BRMA 2ADOA 1B74A 4KEAA 4TMVA 4UUMA 4AKSA 3E7XA 1NW5A 5C7IO 1C3OB 5AVWA 4URUR 1EGAA 4XEHA 1UDCA 1UEJA 2BM1A 2FOXA 3TRFA 3N70A 2PO5A 1NJ1A 4C6RA 4DREA 1ADBA 1X8XA 1PJZA 2ATVA 3E8SA 4MWOA 2O8DA 3JQAB 4JOSA 1TVKA 2CLKB 3GEMA 4TS4A 2IDJA 1QBGA 1XQYA 5IVPA 4QOFA 1A1VA 3AVXA 4I9UA 1F2VA 2H7YA 1T25A 2B61A 2C7GA 4E4TA 1EDZA 1L5ZA 3IKLA 4N18A 3IHTA 3K0AB 2FQWA 3QPBA 4OXQA 3UH0A 4JR0A 2DPXA 1RXYA 4ZO7A 1WQ3A 4W8HA 4K9KA 4ZPXA 4B3JA 1JLRA 1W85A 1NW6A 3P94A 4P2BA 3DP9A 3MRXA 1S2NA 4YAOA 3WGJA 1N3BA 2Q6KA 4FD2A 2UV8A 4KN8A 4RTMA 3THRA 1NJGA 1SR8A 1TM5E 3GDOA 3T4UA 2BKEA 1TYCA 3WKEA 2I66A 3C7CB 2HZBA 3DUFA 3Q0EA 1OXMA 5A0FA 3K70B 1KBOA 3CLUC 5CAEB 3WQRA 3PFCA 3I01A 4YB8A 1RLOA 2JJQA 2PWAA 3FI9A 2B1IA 5HS6A 1JQJC 1LJLA 3QWBA 5KSZA 5E6RA 2FN9A 2F8LA 3TGWA 4KR6A 1JIKA 1P7CA 1WDWB 2NQTA 4EQ6A 1US8B 3G79A 4LISA 5IEBA 3NTXA 4OLBA 4ZRDA 5JJIA 1C4KA 2IU6A 4EB6A 1K8ZB 5EJFA 2BGWA 2JFUA 3I9FA 2P9YA 5ECYA 3KV3O 3QU4A 4P53A 3AVTA 3R4CA 3MWEA 4Y8VA 1EIWA 1P4RA 2P69A 1KZ7B 4AY3A 3P2KA 2HTEA 2XNDD 1BVUA 2GRAA 4O4LA 2E6UX 5JRJA 4I55B 5E0KB 4DBVO 3FB1A 1T8PA 1EM8A 2JK1A 1VE7A 2P6NA 4DY4A 4QECA 3DWFA 4UMVA 3GFQA 1HYGA 5BV1A 1F38A 5IF3A 4I6JA 1KJZA 3BD6A 3SR3A 4RTJA 2RSLA 1PF7E 1JHXA 3GJ8A 2LWIA 2GZRA 1WMDA 3KT6A 1I3LA 1WUTA 4YUVA 4HQKA 3G82C 5SZJA 1ZW1A 2P8SA 2QX6A 2QRPA 3KSUA 4GMXA 3JQBC 4M6WB 3ZUGA 2WHXA 3HB9A 2C88A 1EP2B 2ANCA 2QORA 3I76A 5KVAA 4ZYLA 5B1DA 3UG7A 3QPVA 2P5TB 3EE6A 2G17A 1M1XB 4EFKA 4CQNA 5P21A 1ZMBA 5DLDA 3WA7A 3UMJA 3WGIA 1IHOA 1ZM3A 3WRYA 3HFJA 4RETA 1RQGA 1UC5B 3UMSA 3QFRA 1KDVA 4HTFA 4A8JA 3BMOA 3LDUA 2BZGA 2QJWA 4WAUA 3WIEA 3KTFA 3CR8A 3VZBA 2OLKA 2BGGA 4ZICA 4QGGA 4G1UC 2I7XA 2HF9A 4FDTA 4OKNA 1UFRA 3WLTA 1TLLA 1Y5MA 3EULA 4LYDA 3CPJB 3HJHA 2FWJA 3KQNA 1X15A 1YB2A 2BBTA 5JH7F 2J9FB 1BVYF 2FZ4A 4LHWA 4NG5A 3WGKA 5JAIA 1NYRA 3FVQA 4G5QA 1YOVB 3L5KA 3R6LA 1T1JA 2ODPA 1SU7A 3DEHA 3BB1A 4JJ6A 4Y0NA 4Y1RB 2HZ7A 1NWHA 5E8RA 1Z7YA 5JVDA 1BFKA 4QJIA 3RV3A 1WQ1R 5DM2A 4WXRA 4BMDA 2ZZMA 4IDQA 2B78A 2QD5A 1OI4A 3I61A 1WKVA 3C4QA 3FPCA 5CT4A 4OJTA 13PKA 2HSDA 2CDBA 1INLA 1NI4B 4TTPA 1KK1A 4ER7A 2GN4A 1WXEA 4IJWA 3LP8A 2QLNA 3IB3A 3KT8A 3W0LB 1U7OA 1RFLA 3NG1A 4YS6A 1Z5NA 3O1IC 4BZXA 1HT3A 3P9IA 3HYSA 3KB2A 4TKUB 4YYEA 1B8PA 3Q7EA 1JA0A 3RRZA 4X7PA 3ZW8A 2AX4A 2HWYA 2IY9A 4ISBA 5JQWA 2HXGA 2JFYA 1EVKA 3OA0A 3DAFA 1WO8A 1VYVA 3CLUD 1RADA 5JRDS 3THYB 1SEVA 2RI1A 1Y48E 1UDAA 1IIBA 2R66A 3V33A 1XMJA 3ZJ4A 3SS7X 2GA9A 1XTBA 2XCSB 2R2GA 3GBPA 3ED1A 3C1OA 1KAQA 1U9IA 1PT7A 4ZP1A 4OLFA 5EWJA 3NHZA 5TARA 1TKCA 1GAWA 3LZCA 4ZI7A 3NXKA 2CE7A 3DOIA 3FHJA 1VP9A 2AJ8A 3IQDB 3OSUA 4JB8A 4MRAA 1E4OA 1Z5VA 2IUYA 2O2ZA 4XR4A 5FLKA 3U4CA 1LQTA 1SELA 5LQJA 1QK5A 2A4MA 2IVZA 4QREA 4RUKA 2W11A 4S2EA 3UAOA 3PXGA 3F9IA 4OJNA 1LTHR 2GAIA 1GDHA 4JP5A 4LS3A 4A82A 3BRQA 4CMEA 3OE1A 2DG2A 1RI1A 3MSCA 3M6XA 4HH0A 4MWGA 1T2AA 1G63A 2AFHB 1Z5UA 1JYEA 4LBVA 5HJ2A 4CT5A 2P0AA 1WZUA 4ND5A 3G9ZA 2G5PA 5CBPB 4YIHA 2B92A 5TF0A 2CXTA 2EEPA 1KK2A 1OYVA 4DXHA 1E4VA 1DIHA 1SBNE 1AD2A 2R87A 1N1MA 1WDMA 3QQ5A 2GBFA 4HB4A 4DQUA 2OO3A 4EW6A 4QJ3A 2XXAB 2RHRA 1PEKE 1I7LA 4OPMA 3RTBA 5J2TB 1JG1A 3BD9A 3C98A 4YQZA 1J8DA 521PA 3I9MA 1XDSA 3KSMA 2HO5A 4I9HA 3T1OA 4PG7A 4PN7A 4MYTA 3ZHOA 3F0TA 2HNBA 4GMKA 4I50F 1ZLXA 1GNLA 2SKCA 1AB5A 2Q6VA 3MLAA 3OY2A 4BBJA 4EYOA 1P2UA 4FS8A 1OI3A 3GRRA 5EZQA 1OUMA 3X44A 1KPIA 2Q5IA 1YZLA 4UBOA 1Q3HA 4AIRA 1X7HA 2ZOSA 4OQXA 4D5GA 2R6ZA 4KFTA 4YT8A 5BSUA 4F4CA 2FQQA 4BVGA 3FZGA 4F9GA 4HT3B 4X9XA 2IZ5A 1ZSYA 3ZWYA 1HETA 1TQ6A 2AD1A 2GS9A 3D8UA 2XB4A 2YWEA 1Q0HA 5EKTA 4POOA 1SB9A 1MJNA 3UQZA 3OE7D 2HU5A 3C6YA 3ZQ6A 4HXYA 3TBFA 5DNUA 5DI9A 3LA8A 1FFWA 2EBHX 2NO5A 3ZWNA 1U0RA 2PMCA 3I39X 4IDNA 1F2TB 4G26A 4R5MA 1R6DA 3HCAA 3FCUB 4L16A 3RFFA 4JR1A 1XK7A 3LHIA 4S3MA 4BMPB 4E5KA 4M0DA 1THTA 4A23A 5I4KA 1H22A 1ZIXA 3K6KA 5CM8B 3SJZA 2JA1A 1XCBA 1V3QE 4ZDWA 2ZI7A 1E3IA 1SUAA 1ZBDA 3H1PA 4KMSA 3VFDA 5TT0A 5FI5A 3H18A 1P72A 2FR0A 4A0FA 1EWKA 4ND7A 4OYRA 1IBMB 1A0OA 2BLNA 2GHRA 3GGJA 5T67A 1N5RA 3IEPA 4JASB 2VBCA 4YH1A 1WUKS 4L7VA 4XFDA 1RWWA 4BFLA 2ERYA 3AZOA 4XQEA 2WUDA 3I42A 5CHEA 1ONOA 1T29A 4ISCA 3JSAA 4ZJPA 1BXGB 4UE2A 3HI6A 1TJYA 5CVDA 1VQ1A 4ZIRB 5A4KA 5TQJA 3VC3A 4E1VA 2FFRA 1CP2A 5TLSA 1JUDA 1Y1KE 2O8CB 3L4KA 4ZAZA 1NRWA 1DBIA 1WHTA 2F62A 3A4NA 1VI2A 2H4WA 2I1WA 4HZUA 3QFCA 5JANA 1H8ED 4YJ3A 2J32A 2QTGA 2W7TA 2QMYA 3D8NA 3G23A 3QTLA 5KOHB 4MHSA 5HDQA 4LECA 4BO3A 3C7KA 3QIAA 1O97C 3W9SA 2WDPA 3PYMA 4J49A 4ARIA 1LZKA 3AETB 4DKXA 3WLPA 1N2CE 3IDQA 2OM6A 3NHKA 3OF3A 4KDEA 3IP5A 4P22A 3RABA 3AR6A 5ALVA 2ZJZA 2WNIA 1AZWA 1C7JA 1U8AA 2G0NA 5DU2A 3VR5D 4BS9A 4QGSA 4FZ5A 2JAXA 2EWVA 5KJEA 2O05A 1SUEA 4CETA 4TRMA 2DFNA 3Q2KA 1CETA 2J4FA 1XNRB 1UC4B 3IBCA 4FWBA 1IZ9A 4DARA 2QR2A 5H82A 1E96A 4JP2A 2WJAA 4EA7A 4YGYA 3LQ1A 5IF9A 5B3JA 3G0GA 1N6HA 4RULA 3RTCA 4BTVA 2O3JA 5HZMA 1L7XA 2J9ZB 1TT5B 3HKDB 1J8MF 3DCNA 2VPPA 4UBKA 1DARA 3HGQA 5HDBB 1RTTA 2R8PA 4IVQA 3KALA 3TRHA 3ACDA 3RLIA 2QTBA 2QBYA 4UUPA 2J7PA 5L3SA 2HMYB 2Q5OA 4AJNA 1WF3A 2RBKA 4KIGA 5IDVA 4CM1A 1JKMA 2WJ4A 4EI2A 4MPTA 4ZWNA 4US1R 3JCZA 2NPOA 4QG3A 3GLHB 1BNCA 3G0OA 2IZ0A 1Z2OX 3CRRA 4ZCRA 3F9RA 3KOZA 1BX1A 1OHHA 4ESVA 1HYBA 2WWRA 4KPUA 4UHJA 4FEYA 1AY0A 1OLOA 4FYKA 1CEQA 4KI7A 4NICA 4TMTA 1UBHS 1V47A 2I2DA 3M1AA 4GKBA 4PX9A 2E7ZA 4IRMA 1FTGA 1CY1A 5AKXA 4MYCA 4YMUA 4ZU6X 3P2EA 4AS3A 1D2HA 3L04A 5JEDA 1MBZA 3GMSA 4GKJB 2YZ7A 1P62B 1PRYA 1U5CA 2AFHE 2H2WA 2ZITA 3DDCA 5FTWA 2D13A 3EIFA 1GTG1 1UBTS 3TX6A 5GZ1A 3HLKA 2C1EA 4YUWA 1NVXQ 1E2QA 2YNMD 3FPJA 2WPNA 1RHRA 1KAMA 2BMFA 4MV4A 5CLFA 2Y67A 1U4OA 4WN9A 2W2TA 4R1QA 5IP5A 1Q6YA 3DMTA 3FIUA 4NU0A 3V1NA 3ZV5A 5JXJA 4DR7B 2V5UA 4C04A 1GSIA 4LK2A 3L7DA 1NHGA 1U02A 4NK5A 3C8MA 2Y4NA 4FZJA 3IV9A 2FUNB 1MJFA 1ICEA 2A5FA 5FR2A 4K0RA 4MO9A 4Q1AA 1GG8A 3EUWA 1MZPA 2JIQA 3Q88A 2WP0A 4ZEWA 3AHEA 5LA6B 3Q6NA 1G9TA 1UCFA 2W2XA 3LRXA 2VT6A 3CWQA 3HRKA 3KCNA 3IL2A 3A3KA 3GJ6A 3KS9A 5JIBA 5LBUA 4HUQA 3U62A 4PCLA 1PQWA 4M53A 1GAQA 2ZSKA 1LSJA 2H11A 3DE3X 5LXTF 2VHWA 3DCJA 4EJFA 4LJ6A 5B1EA 4M1WA 2AR7A 1DDGA 3OJOA 4D9HA 4L1KA 1UF9A 1WTAA 1SCKA 3IQHX 5TJ9A 3JU3A 1N2IA 4KXYA 1TI7A 4Q4AB 4X7RA 3W3AH 2YQ5A 3F46A 4YRZA 2YASA 2GJ9A 4P5EA 5AWFC 4D98A 1LK5A 3D64A 1ZK3A 2FHSA 5CDFA 4DJJA 1BO6A 2OCKA 1EDDA 4XQ9A 5EIBC 1YVUA 4O4JA 2BKLA 4EM6A 1AF4A 3WRXC 2QM7A 5LP6F 4QU9A 2B8WA 3S5UA 1JB1A 1F3OA 4GECA 3ECSA 2OUKA 2YZNA 3IPRA 2XNCA 2OAQ1 4U7WA 2C7OA 1V8DA 1MGPA 1NPYA 3O8OA 4XFKA 5EUMA 5FOWA 3DOHA 3KAQA 4RYDA 3KJNA 4YO7A 3RJ5A 3SC2A 4AN4A 3BREA 5FWYA 2HCTA 2G40A 3U17A 2WU0A 1HDCA 2XWSA 4K6CA 4FPXA 3N3AC 3UJPA 3LWZA 2PRYA 1MB9A 3MTJA 1L4LA 2WTBA 4GLJA 3GMTA 1DE0A 2COUA 2LTAA 3RRFA 3KJEA 3VR5A 1V16B 4DCTA 4D97A 2HCFA 1O6FA 1J23A 2C4VA 3P4XA 4J0IA 3NBAA 3EW7A 4S1OA 5CM9C 2PZBA 4BWYA 5B2FA 1XAJA 5A3SA 2NSHA 3VNQA 2VPTA 4A6XA 1QPGA 4Z53A 2C3YA 3ZWPA 1QAMA 4MV6A 4B6QA 4D0NA 4F6LA 2FJPA 2Q8QA 3R77A 4LGYA 2D0DA 3RUFA 4PWYA 1HG1A 4IFIA 4HHEA 1RWOA 2NG1A 4IKEA 5TS3A 2WYHA 3L1VA 4MW7A 4L6AA 4LNHA 2YRFA 1V6AA 1VDMA 4BJ1A 4KRFA 1GUAA 3FPEA 3FKQA 2Q28A 3ENKA 4W7IA 1N2JA 4MW2A 3CJQA 2YHAA 4TXMA 5KHAA 3CTMA 3HP4A 3Q3EA 1L7RA 4RQAA 4DR3B 4L6CA 1ZL0A 2ADMA 1K89A 1HL3A 5F9MA 5DBHX 3ZDFA 2AG0A 2HOQA 3ILXA 4PSCA 1DS6A 4UXJA 3TQFA 4ABYA 4LJRA 4C14A 1S4QA 4HVCA 1P2GA 2QRKA 2CJYA 2VSNA 2AEEA 1E9SA 4E3ZA 3OX2A 3E9CA 1VECA 5DHSA 2VA8A 1NP7A 3DEYX 2OV6A 4I0WB 4K6HA 1Z74A 3VPGA 4DZZA 2HY7A 2FE4A 1XAGA 1HDYA 2FPPA 2X5NA 3FCOA 4X1OA 1YBMA 1YU6A 2VJMA 2UYOA 3V7NA 2YNMC 4JI4B 1YS2X 5TMEA 3W9UA 1I7PA 1GJRA 1FW6A 3CW2A 1J22A 3IE2A 5GONB 1RAAA 1W48A 2NT3A 3QVMA 4G8JA 3T5AA 4D2IA 3VVCA 1NXPA 3WLLA 3IPAA 1E0JA 4DV6B 5LDGA 1B1AA 3K1YA 1COWD 3LUGA 3P0IA 3AR5A 4PONA 1GKLA 1GGKA 1O08A 5ITSA 1VPVA 2B8JA 3IH5A 3N2GA 4R83A 4TL6A 1ZK0A 1T10A 4Y2TA 2PLRA 4V0OA 4LNAA 4P84A 4R40A 5HIJA 3TAUA 3V1MA 4DR1B 1ZAYA 4Y98A 2JGMA 4KXLA 1BCRA 3FY4A 6YASA 1JHOA 3R0JA 5JAHA 2GO7A 3HXQA 3OLCX 2R44A 4Q1CA 4K1LA 3FPBA 1CFJA 1KSGA 1LC3A 5KYKA 1V1JA 5TGDA 4E03A 1VMAA 4AURA 4CCAA 3SR0A 2YHIA 4FQ8A 5K3EA 4RZSA 5ESDA 1UAAA 3R8CA 2CXHA 2I6QA 1VHJA 2DM6A 1DHTA 2DT8A 4LV5B 2C83A 1SBHA 3HDJA 4G5FA 4BFUA 4IIJF 2V8OA 4UXIA 1RNLA 3FUTA 4LN1A 4TRNA 5BVHB 1NI4A 1BROA 1NW7A 1U8CB 3OM8A 1M7BA 4IVPA 1NMYA 4P80A 3ONEA 3UJAA 4UVEA 1D04A 5M34A 2Y2UA 2XJ4A 3G2JA 4LGMA 2RGNA 4KKVA 2PHZA 1DOAA 4RHTA 3K9NA 1D1TA 3CBQA 3RYCA 1MC1A 4H1UA 4RY9A 1H2RS 3SCZA 1Z4LA 2VF5X 2X23A 4UU0A 3ZK7A 3IEVA 2Y0CA 3A7DA 3T0GA 1RRVA 4E7OA 4UHBA 4AQ7A 1TM1E 2EJVA 1CF4A 3SHVA 3HFRA 5JATA 1LX7A 4BFYA 1DMRA 1QQ6A 4IICA 2AZ4A 1J1IA 1FFGA 1H65A 3B9BA 1U4SA 5EJ9A 1J2YA 1D09A 2WZBA 4KN6A 1DO8A 2VWHA 1MT0A 2QJFA 4HNAB 4RZUA 4Q4JB 4M8NE 4U6QA 3KWMA 4V0KA 1R6UA 3PD0A 1YJ8A 2XUDA 2BDEA 5JAQA 3LRTA 4D8VA 4KWEA 4TZTA 3EHEA 2PGAA 4WADA 4ZOEA 2HCRA 3GRPA 2ZJOA 3OO0A 4M0PA 2X4DA 4BNDA 1Q1ZA 5A02A 4I1YA 1QQAA 4I99A 3VZDA 4GPD1 4MJXA 1EFCA 5FULA 3T1NA 2XT0A 3K9LA 3NHYA 3C3YA 3CF4A 5BYJA 1LRLA 1PT5A 3I12A 3ZHUA 2QL7A 1C9NA 4KQXA 1RE0A 3G49A 4EVQA 4YJHB 3RS5A 1II8A 5FD8A 3OWXA 5C3MA 5GPBA 2OENG 3JWJA 2I78A 3BFXA 3O6VA 1PZMA 3RC3A 2A14A 1QR6A 4XGQA 3SYLA 2ZUTA 1DLJA 3VPBA 1I6LA 3L0CA 3TW6A 3VR6D 2FWMX 3W8RA 4B5LA 1M7GA 4CKEA 4B35A 5J2TA 4ZV7A 2WG0A 2ECFA 3EVGA 3CR7A 2PSSA 3E27A 1M5UA 3GR6A 4H1TA 4V02A 2DFTA 1M2EA 2RB4A 4JROA 4XUDA 3KUKA 3BOSA 1FYVA 3KAPA 3RU3A 4M9UA 1CVLA 5CNMA 5LLSA 3N8IA 1GU1A 3DZCA 4IDPA 3RUIA 1CUJA 3KOWA 4W1QA 3RVNA 3LXXA 3U40A 4A3SA 2FDXA 4HTAA 5M2QA 1RI4A 4PIMA 3FTQA 3H16A 2UZ1B 3D2CA 2JFQA 4HB0A 4GZ5A 1JQAA 1M6YA 2I7CA 1HORA 1Y9DA 1W4BA 3OZDA 2YWXA 3KVRA 1RWXA 1AG9A 1BWSA 3SZMA 3U16A 2HBYA 1NR7A 4OXNA 1JU4A 4NPCA 2Z2ZA 4P4NA 3OIDA 4LMBA 2HX1A 3HR4A 4LCJA 1NF3A 2O2XA 2WTAA 1EZ1A 4Q7JB 3G9XA 2QL6A 3IA7A 1W1UA 2ZGVA 3KZVA 2H2HA 3OT1A 2ZRKA 3RVLA 3U3XA 3ZZ0A 1ISRA 3HYLA 3M6IA 2BGLA 2BONA 5C8YA 2BFCB 4F4IA 1RQPA 3CUEF 2W5UA 4P3YA 5LQRA 1KKUA 3RTDA 4BN5A 1ULSA 4S04A 1XDDA 1TQ8A 1Y8RA 3AEQA 4XD2A 3PKJA 3N2ZB 5T4FA 4NV3A 4JGGA 3VR6A 4CU2A 1ZEMA 3A2KA 2NV2B 1ODIA 5D5PA 1GRNA 1PO7A 1L4YA 4MAAA 4EY7A 2QTWB 4MKHA 3K8YA 5LP6A 2QOEA 1MHTA 5JFOA 3VYTB 1BYUA 4XFJA 5EJ5A 1G6KA 5AW9A 3STWA 4G9GA 1SIWA 1E2EA 2C5GA 3AWDA 3BBLA 5T41A 2E21A 3HJCA 4ETIA 1EVIA 3DB1A 3OQMA 2GNAA 3PDCA 4EHBA 2HF7A 1QK3A 2Z56A 1K5HA 1GZ5A 2ODNA 3C7TA 4N41A 2AN5A 2NYRA 1IN1A 4FNAA 1XFDA 2FRVA 4PC2A 4UOQA 4ZODA 4RANA 4TT8A 3TQRA 5CW1A 4B17A 4CMHA 3W6OA 7ABPA 3LT4A 1IHDA 5IK2A 4QOJA 2PT7A 2ES4A 4PRLA 2BJHA 1GQQA 2BFDB 3FUVA 1A5TA 1YQDA 2CNBA 1Y1QA 2VOEA 4RNDB 4UFPA 1ZKDA 1U11A 3CISA 1FFYA 3NW9A 4Z4EA 2CEKA 2RGCA 3HJTA 4KFUA 1M0WA 5D1HA 2RMKA 1BSVA 1FSPA 1EGQA 4WESA 1EVQA 3HB1A 2P8JA 4QFBA 4DV3B 4W5WA 1TW3A 4WW0A 4XPIA 3SFTA 1PR2A 1EXVA 2H9IA 2BKAA 4NEQA 3ZCSA 3AUXA 2QAGA 3LF2A 4CDRA 1J2RA 4C3ZA 1J8YF 1H5NA 3E18A 3KTDA 1FSZA 2D0PB 3AKDA 3BZUA 2PO7A 3O82A 3VSBA 1NBMD 1QPBA 2Y66A 1Q6ZA 3ZZMA 4HDRA 5LYJB 3DZ8A 4MW5A 3QYJA 2BFFB 2ZXEA 1M2HA 2C97A 2IOHA 2XE4A 1A88A 2C5SA 5TB5A 1N75A 1E6EA 1SBQA 2BFEB 2ZBVA 3AR7A 4FXOA 4J0KA 2WWXA 1AKMA 1D4OA 2YC4C 4B9AA 5CA0F 5KOIA 1PFWA 2EG5A 2XNHA 2HF2A 5K8IA 3FX2A 3OOYA 4NL4H 1F0NA 3IAHA 4P32A 2ZUFA 4MW6A 4TWJA 5HIAA 3VSDA 1GPBA 4IV0A 2ZATA 2PJRA 4R1UA 4MDFA 5EP3A 2J4DA 2EIXA 4DTCA 4CL2A 4CF4A 4WOBA