3NVWA

Crystal structure of bovine xanthine oxidase in complex with guanine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvwA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvwA01
2BT6A 2OHFA 1JWAD 1IUEA 3BIID 1A70A 1UWMA 5AUIA 1DOIA 1QOFA 3B2FA 1N62A 1PFDA 1YQ3B 2HTME 3B2GA 3L4PA 1CZPA 3HVZA 1VJKA 4C7YA 1SF0A 2CJNA 2AX5A 2WS3B 4KX6B 4N59A 1QOBA 1XLNA 3NVZA 4FXCA 5EE1A 1GPXA 2B76B 4JWUC 3AECB 2H89B 3DWMA 4US8A 3AE1B 1XLOA 1FRDA 1N5WA 3AE2B 2BS2B 2WDVB 2WU5B 2KAJA 2L52A 1JROA 1RWSA 1SB3C 2QIEB 1F0ZA 4USAA 1CJEA 1N63A 3AE4B 3B9JA 1KFYB 3RPFC 3AEFB 3AEAB 3FC4A 3AEBB 3P1MA 2K5PA 1FIQA 3AMZA 3SR6A 1NYRA 5H92C 1NENB 5G5GA 5AUKA 2DBYA 3EUB2 3FAHA 3PO0A 1I7HA 3VRBB 2K9XA 1XLPA 2WQYB 1L5PA 3P4SB 1FO4A 1L0VB 3VRAB 3LXFA 1E0ZA 3CWIA 1VLBA 4YTPB 1E10A 1ZOYB 2W3RA 2MH7A 4YXDB 1OQRA 1YJIA 3AEGB 2Y5CA 2PKOA 1L6UA 3SFDB 1NI3A 5C2TB 1PDXA 1FXIA 2MJDA 1FFVA 4JX1C 3AN1A 1FXAA 1JWBD 3AE7B 4P6VF 1DGJA 1WRIA 3ZYYX 5H8YE 1FRRA 4YTNB 1B9RA 4ITKA 3AE8B 2PVGC 1ZP0B 1FFUA 1JRPA 2CJOA 3KWLA 3NRZA 5GXGB 1JQ4A 4C80A 1R7SA 2DWQA 2WU2B 4YSYB 2K22A 3P4QB 3NVYA 3SFEB 2EKIA 1J7CA 1NYQA 1OQQA 1KF6B 1TKEA 2BS3B 4N58A 4YT0B 3AH7A 1WGKA 1NEKB 2PIAA 3ABVB 5MPOA 2BS4B 5G5HA 4US9A 2JQRB 2Q5WD 4IDIA 3VR9B 2CU3A 1OFFA 3W5UB 2FBWB 1GAQB 1E7PB 1ROEA 1TJEA 1XLQA 2H88B 3AB5A 1N61A 2PVOD 1DOYA 4HRSA 1JALA 1JW9D 2WDQB 4WQMA 2WDRB 4C7ZA 2M56B 2MJ3A 3CIRB 1N5XA 1WWTA 1RFKA 2N0SB 1ZUD2 2QJLA 4N6EB 2W54A 3P4PB 1J7BA 1RYJA 2JX5A 2W3SA 2G1EA 5EE0A 4ZHPA 4ZOHC 2LEKA 5EE9A 2W55A 1T3QA 4JWSC 1KRHA 5EE3A 1ZXIA 1E6EB 1XO3A 1YQ4B 3AEEB 2KMMA 2WLBA 1WYGA 4A9AA 2E3TA 1AYFA 3HUIA 5C3JB 1E9MA 4LTUA 1DOXA 1V97A 3AEDB 2MJEA 1V8CA 1TKYA 3AV8A 1PUTA 3NS1A 2WP9B 2M19A 3AE3B 1L6VA 1QT9A 1SIJA 3NVWA 2L83A 3AE6B 4WWMA 1QOGA 1VDVA 3AM9A 1WXQA 1AWDA 1TKGA 1QLBB 1TYGB 3VR8B 4ZHOA 3W9CB 4YSZB 3AE5B 3DWGC 4YSXB 1QF6A 3HRDD 3NVVA 3W5VB 1NVID 3ETRA 1J7AA 1EWYC 1N60A 1FMAD 1FM0D 3AE9B 1RM6C 3P63A 1YJJA 3P4RB 4YTMB 2ACZB 3WCQA 4HROA 1QOAA 3LB8C
chains in the Genus database with same CATH superfamily
2N1RA 1IUEA 2V4IB 1UWMA 2KTQA 2VZKB 5ALPA 3B2GA 1N62A 2G3QB 2CRXA 3HT3A 3ML8A 4NM2A 2XK5A 2V4QA 4DSKA 3BJYA 2ZTCA 4CRXA 1NK9A 2E8PA 4YMNA 1YIWA 4JWUC 1YZ7A 1PGAA 3KYCD 4AYBC 1LB2B 4DQPA 2KOBA 4UAZA 3MGVA 2BCVA 1UBQA 4GIBA 4OZAA 2ZIXB 2FPMA 2G09A 2WDVB 5KFSA 3LVVA 3PMLA 2QLTA 2WHIA 2Y1JA 1N63A 9ICBA 5KTQA 5AK6A 2JMGA 3MABA 4PZNA 1MHXA 4NAMA 4RQ2A 5B5EU 4MH0E 1TE2A 1ZW7A 3MDAA 3RNGC 1PK3A 4PHDA 3T5HA 1I7HA 2C5LC 3DBSA 2N9PC 3UF8A 1L5PA 5IIMA 2WFAA 1TK0A 1BMLC 4U7CA 4G3IA 2BQQA 1M94A 2Z8LA 1D3ZA 4C8KA 3N7PD 2W3RA 3OSNA 4KN4A 4YR0A 4R63A 1V1OA 1YOVB 3PSIA 3S2AA 4CHKA 2C22A 2BKEA 2IGGA 4W9LA 3H7IA 4RQMA 2CR5A 4TUUA 1K1QA 3AN1A 4I2AA 5KFIA 3RD2A 5DB8A 2XY5A 3H7PB 1CMXB 3ZUNA 9ICGA 2ZUCA 1F2RC 4ZDVA 2M17A 2NPTA 3V6HA 4Q43A 2KLCA 3GP7A 4YT0B 1D5XC 3ZW3A 1WGKA 2BYFA 2DZIA 4K4IA 5G5HA 4JV1A 2BS4B 2MQJA 3BK2A 2L0TA 3GV7B 2PKEA 5KNIA 3KFUF 4P1BC 4DL5A 5ALDA 1VRAB 3W5UB 4OVVA 1TJEA 1XLQA 5IILA 3ED5A 1WWUA 5DGAA 2JXTA 7ICLA 2WDQB 4WJPA 2MJ3A 2NO4A 1R4NB 2D10A 1ZD5A 3WU2U 4I2DA 1AW7A 1FNVA 1UH6A 3NG0A 4KDIC 4K4HA 4IR9A 1WM2A 3NHEB 4CO7A 4GB9A 5EE3A 4C8NA 3QEAZ 2IOHA 2E3TA 3HWTA 1ACCA 3D6JA 4QZGA 1ZQHA 3GQCA 3A9JB 1VR9A 1GUAB 1D4BA 5BOMA 5CEHA 3RB0A 1I4XA 1WG8A 7ICVA 1VZ8A 2PEAA 2LFIA 2VA8A 2KKCA 4K7UA 3JSVB 4MFCA 4RPZA 2UYZB 1TT5B 4LCDE 3VR8B 3RB3A 2HVIA 3M6KA 3THVA 3F5AA 1KN5A 4RU9A 4TMAB 3U52E 4O3NA 3HIZA 2KJ8A 3P63A 1XT9B 4QZDA 1SWWA 4J9RA 3D2QA 2FDRA 4RF0A 2K8CB 3GIKA 4AYBF 3Q3NC 3PO4A 1CUKA 1D8YA 7ICPA 3GS2A 3KHRA 4FADA 3QZ8A 2C2RA 3A9KA 5AI0A 1XLNA 2K39A 5IIKA 4XRHA 1ZGUB 4LJOB 1Q8KA 2NVUI 1O08A 5AM4A 4NLCA 1NBFC 1JI7A 3ZDAA 3V6KA 3QU5A 5J29A 1SIFA 3TARA 2K8BB 3MC9A 4L1BA 4W9IA 4IRKA 3AE4B 2CKHB 1UCVA 2BKFA 3CRXA 1FXTB 2K5PA 2GOWA 1U9LA 3CYMA 1L3TA 3VRBB 4O3QA 4C0ZA 2ASDA 2BR0A 1FO4A 3VXWA 4BKSA 2Z0DB 2I1JA 5L1MA 3W1YA 2CHZA 4RNOA 2PJHA 3M3JA 2FPLA 4ECZA 4R3DA 2GB1A 4K1RB 1OQRA 3AEGB 1ZQLA 1YX6B 4ANXA 2AGOA 3OJ4B 1YNTE 2KFZA 1WY8A 2ZIVA 5H2FU 2JZPA 1KRPA 3PZ8A 3SAHA 3A0HU 5J0XA 4IKGA 4DXAB 4EEYA 2KICA 3V7LA 4TURA 4RUCA 2WXLA 4Q8EA 4I2HA 3NVYA 3IVFA 4HCPB 2KVCA 4D2KA 2W9CA 1J7CA 3KW5B 3F2DA 4M9JA 9ICCA 1N56A 1WGYA 4IQVA 2L76A 4O5CA 2G4DB 2JEIA 2XY6A 2CU3A 4MM3B 2KVRA 4DBGA 4PGQA 1L8LA 5CJ7A 2DYMA 2DPJA 1E7PB 4E74A 1XF5L 5G2NA 3VTVA 3DCGA 3RYTA 3JPPA 4N9F4 2N9XA 3RZFA 1RYJA 4ECQA 2KJ5A 3TI0A 2LRWA 1RG6A 4RQ6A 4F7ZA 2HCFA 1AN8A 3DVNU 2PFPA 4DSJA 4XDDA 4FJZA 2PMZC 3AEDB 2O6KA 3ZDEA 2A5UA 4LVSA 1J97A 2QKQA 2MBQA 3HPOA 3AV8A 2XCPA 5J18A 1ZD3A 3EA6A 2FLNA 1MI0A 1SJHD 4XDCA 3MFHA 1I4RA 3MFGA 2BB6A 3TAQA 1ECWA 4M6WB 2PTLA 3KD3A 4IOIE 4C56C 2BCUA 3MFIA 2G4SA 4AP9A 1WR1A 2OEDA 4FJVB 4Y2VA 3TL5A 3V72A 2INCC 4LDTD 3AU6A 1YJJA 1JQ4A 1WFYA 2IOFA 1QOAA 5CRXA 2OHFA 3KUCB 3MJ5A 5LLIA 2IO2B 2BQ3A 2J6SA 3EFCA 3N1XC 1E7UA 2F44A 2BF8B 1XCQL 2N1VA 1UGJA 4CYEA 4KLTA 4EFOA 4IS7A 4MGIE 4DQIA 1KOTA 1BVSA 3K1RB 5DKWA 2R8HA 1GG3A 4R66A 3Q8LA 5TZVA 2FMPA 4PS7A 2F2AB 1BT0A 1I42A 2WF6A 3QAQA 1CQVA 2H5XA 3QZ7A 4L23A 2GO7A 5AEKB 3TUOA 4FHJA 7ICNA 5AIAA 3PZDA 2DAFA 3P1MA 4DXFA 8ICXA 4C8OA 4UB1A 2P6RA 2N9EB 4A6QA 2JHDA 4U6PA 3WANA 4BJQA 2BWES 2PI5A 1TY0A 2VRRB 1JRUA 3C28A 1SXEA 4P0QA 4PJ0U 5KFWA 2M8SA 1IIPA 1V9PA 4DFPA 2AU0A 4LZGA 1GO3F 2F77X 2D3BA 2EAPA 3ALRA 1DOQA 1HXYD 1MQ3A 4I28A 1MFWA 3KHGA 4EBCA 2XVTA 5DBAA 4RM9A 3G6XA 3AULA 3BY4B 4KN7A 3NY5A 4BWJA 2B6GA 2RLTA 3IRUA 1BPYA 7ICIA 3NOBA 1GC7A 3ZNZB 2M0AA 2L05A 4M9LA 4CNQA 2J0JA 1IBXB 1VD2A 4EYIB 2JZZA 4XE0A 2D8CA 3AH7A 5ALYA 3UQ0A 3RR8A 3DQVA 3PX6A 4KKJA 3ZJUA 5HP4A 2VA3A 2Q5WD 3ZTDA 4KZ0A 2RDBC 1NK7A 3H1UA 2H3QA 9ICUA 3MJWA 3MGIA 2IGDA 2H88B 3RAXA 1JCKB 2YN4A 4LZDA 2PVOD 1A76A 2LUEA 1PK1A 1ISNA 1WCNA 4NLNA 3L16A 2IDYA 4WWNA 5IO9A 1EF5A 3NZUA 4WAFA 1J7BA 4AP4C 3BS7A 3Q3OC 3LYSA 2J52A 2PMZF 2KWUB 1U45A 5F9LA 3E0FA 2I38A 1FEHA 1T3NA 1U4AA 3NUHB 4PH5A 4KSLC 4BAXA 5IA7A 4OCZA 5AZGA 3ONNA 3QUCA 2XCAA 3T3OA 5E6JA 4KLHA 3W2DA 1V97A 3LK9A 2HHUA 4C4VB 1TVAA 4DHZB 4R65A 4KGSA 3U2SC 3OHAA 2WP9B 1TS3A 4DL7A 3SD7A 4ZRPA 2BZFA 4J03A 4BKGA 3TBLD 3GE3C 4WWMA 3VDZA 2BGWA 2RDHA 4O3SA 4ECXA 2L0FA 4O3PA 1TK8A 3PTFC 1HIWA 1QTMA 2XBBC 3T5LA 3V6EB 2EMSA 4HWIB 2CPRA 9ICVA 3D32A 1P3QU 4MT5A 2KSOB 1YJ1A 4MGYE 3TSSA 1XO0A 8ICYA 2BPSA 4FXCA 1EF1A 4EUTA 4F5OA 3SU8X 1Q3VA 1MC8A 2UVWA 1V86A 2MBOA 2RMMA 3MC0B 5IN7A 1PUZA 4N59A 3DVGY 4REZA 2CXYA 3OG5A 2INPE 2KD0A 4DL2A 5D3IB 3K75D 2LHTA 2QB0A 2YMMA 3G6YA 4PT5A 4GSWA 3R2IA 2RHFA 9ICPA 1LXDA 3SV4A 2LYBA 4EYHB 3RH4A 5KFGA 2LVPA 4RH6A 2PXIA 2KKPA 2W8KA 4NJ6A 5GTIU 1VCBA 3NS8A 1X42A 2ZXIA 3RFAA 2ZIUB 4J9LA 3U4EG 3LDZE 3KHLA 3DVGX 1ZQSA 2WXQA 4NLGA 8ICHA 2KHWB 2ZCBA 3PO0A 5D6JB 3E2EA 9ICAA 4KSKC 2JSVX 1ZQEA 4KX5A 3TMPB 2IYDB 3ZRCA 2ZXHA 4L2YA 4F72A 5J0UA 5L1LA 2QSDA 2HDOA 2LGSA 2MRPA 5IKCM 2D3DA 3BQ1A 4B9VA 8ICAA 4LNOA 2KN4A 1ZETA 2KXJA 2VIXA 4LK0M 1SE2A 3OTQA 3I63C 1KLUD 1LKYA 2N7EA 4KDLB 1PDXA 3ISDA 3ONSA 4JX1C 1QZEA 3A1QA 2M9NA 2NRZA 4I6PA 5H8YE 3Q2AC 2K8HA 3FM9A 3BVZA 4ZRJA 1WX9A 4R8UA 4TSSA 5GXGB 3C2KA 1L0YB 3GIIA 2F76X 2AQ4A 3MR3A 5HHIA 2JZBA 2ZNVC 8ICIA 4IC7B 4J9NA 1YT3A 3QEBZ 7ICOA 1QSYA 3BK1A 4QZ9A 2G08A 4M01A 3SDLC 4OD0A 4ED0A 2DAJA 2BYEA 3C1ZA 3U26A 2FBWB 2ONQA 3AB5A 3WK4A 4PS3A 2GLEA 3TEZA 4YD2A 3RB4A 2W7OA 3BDPA 1OTRB 4QWBA 2HHTA 1ZQGA 2GI9A 3Q3JA 2QJLA 3AQEA 4MEXA 2KC1A 4MEMA 4OW0A 1NK0A 1LQBA 3Q69A 9ICWA 1Z2MA 2ODGA 2KWCA 5KT2A 1XO3A 1YQ4B 2KIVA 2QMTA 2C9WB 3I5JC 3V62A 4YMOA 5J2KA 3H8WA 4KLFA 2W11A 8ICQA 4HCNB 1U4BA 3WK6A 3NS1A 4ZYSA 5L9XA 4QZBA 4UDUC 1L6VA 4BOZB 2LGYA 1SIJA 4BXOB 5C1ZA 1N6ZA 5ALEA 1AWDA 3LYYA 3JPRA 4M0WB 4IRCA 3N1YC 2MA1A 4F8CB 1NVID 5D49A 4Q45A 4KLUA 4NNJB 3FYHA 5AM3A 1HEKA 2MAXA 3NRWA 1FM0D 3CSTA 4EX7A 5EWEA 3J81j 1Z4OA 2ZIXA 4F3OA 2WGSA 1GJZA 2K6QA 2KVSA 1SGHA 2RDIA 2MU2A 4M47A 1M4VA 5AUIA 1V5TA 4ED6A 1YN3A 1UGMA 2IGHA 5I4DA 5KG2A 1C76A 1VJKA 3QC8B 1UT5A 1Z5SB 2AQ2B 3APFA 3RN9C 3V6JA 1Y8RC 3UMBA 5HG2A 1V81A 4ECYA 1S3SG 3DBLI 4A8XC 2MP2B 2K4PA 2RGFA 3H8HA 2LXAA 3QU4A 5KT5A 4TQ0A 3B9JA 2MRLA 2AWTA 3FC4A 2BB5A 1NYRA 2BPCA 4PHPA 3UXPA 1ESFA 4NQLB 5DB9A 5KFXA 2I2YA 3H6NA 5IIJA 3CWIA 1NK6A 3H7PA 4BKTA 5B66U 3NZ3A 3SQIA 3NGDA 4C8MA 2IJ0A 3L3FX 4UB2A 1C20A 2WXGA 3IAS1 4J9QA 4DSLA 4Q44A 1FFVA 3L17A 4IUMB 4F4YA 3ZDMC 4BZAA 1SV0C 5ALRA 1ZQKA 3SV3A 3N97B 3ZDBA 3TACB 1WRDB 3GU3A 4ECVA 1EM7A 4MACA 3PSEB 3MR2A 4DSIA 3HM3A 4AUQC 4ZH4A 4QZAA 2AYOB 2KQ4X 2G06A 2K0PA 4DLGA 2PFNA 2LYHA 2HW3A 3ZD9A 5D46A 2F8KA 4RGOS 1KDHA 5D94A 2NYVA 4RNNA 1J8CA 2KZMA 3W1SC 1QQRA 3QXGA 9ICEA 1WR6E 1ZE3D 5JTIA 2X38A 3ZGZA 3F53A 3TFSA 1IG6A 4HRSA 1JALA 3GZNB 2DFLA 7ICUA 3IBEA 3N32A 3A9JA 1WGGA 3RFZB 2KANA 2KQSA 1T0RC 3P4PB 2PW9A 4ED8A 9ICHA 1K52A 5AKXA 2FIDA 3BQTA 3A0BU 1TTNA 2FAZA 3JSVA 1KRHA 5AM0A 1PZNA 3L5KA 2KMMA 4ECTA 4RPXA 1BXTA 1WCLA 9ICFA 4P4MA 7ICSA 4HEA1 4ARCA 2BW2A 3GIMA 5J0TA 1LO5D 1GB4A 1LV5A 3M6ZA 1HZ5A 3RRHA 5CHFA 8ICRA 1B1ZA 5JRTA 3CW2C 5C0YA 4MJSB 4TQSA 1R4NI 2K8CA 3H8SA 4II2B 5ALUA 4KLLA 3RJGA 2Z59B 3W9CB 4QW8A 1A77A 3WK5A 4FO6A 7ICTA 3C2LA 3RTVA 1EWYC 4IR1A 1SKRA 3UMCA 2JXJA 3C21A 3I76A 9ICXA 3MHZA 1T8EA 2AEHA 2BT6A 3N3KB 2K8BA 4MF8A 4LJPB 1R4MI 1WSPA 2OCEA 4Z6CA 3QQ8B 3B2FA 1LFDA 1UELA 4C7YA 1NKCA 2J0KA 1T0YA 5BYSA 5ALMA 4HAIA 4TKNA 2O2VB 2B76B 3PMNA 2XGPA 3AECB 3APCA 3K1ZA 2NO5A 2H89B 1SE4A 5KT7A 4NAWB 5AKEA 1S0VA 3IV6A 3JW0X 1J0GA 2HVHA 1A6SA 5AKZA 2I1QA 3WKCA 1JXLA 2I9GA 1CJEA 2HD5B 2V3SA 4K81A 1XCTL 4JWMA 3BS5B 3B0XA 3AEAB 4KLSA 8ICTA 3OLMD 3SR6A 2CN1A 3PW7A 2KDIA 3DOWA 3EUB2 4W9CA 1ZQWA 5KFVA 5BOLA 1ZQOA 3FAHA 1E5WA 2E8OA 2EH9A 4AWJA 2WQYB 3PZ7A 4PPXA 2HDEA 1C1YB 5KG7A 3ZDDA 5DB7A 1Y56A 4KLGA 5J2HA 2YEPF 4KIKB 3OJSA 1YX5B 1VLBA 5FR6A 3MP9A 1MVKA 4M04A 2ZUDA 3KZXA 2A1AA 4DEZA 3J9CA 3MC8A 1YJIA 3M9OB 2G45B 3N7RC 3WA0A 4GXBA 5J0YA 1Y88A 4DO9A 3AE7B 1EO6A 2KJHB 4KLMA 3KH0A 4BVUC 1FRRA 4YTNB 4MM3A 1SL1A 4GC6A 5ALTA 1KJTA 2HOIA 3ISCA 1ZP0B 2LJIA 2QHOA 4QJFB 1MHHE 2F1IA 3OPXA 4ELTA 2DZJA 2K22A 2QB1A 4HPMB 2MSNA 1KF6B 2G0AA 3M1YA 4Y2JA 3HX0A 9ICQA 2GMIC 4JIOU 1K53A 4ANUA 2ZVNA 1TGZB 1SE3A 2V3PA 2JRZA 4EZ6A 4MDKE 4NLKA 3OSPA 5KFKA 4A55A 4UBCA 1WGHA 2QC8A 3AEVA 3ZD8A 2PE9A 3Q8EA 4F4XA 5DCNA 2BYTA 4C7ZA 4MSMB 4IWPA 4QZIA 2KOXA 3RB6A 5ALXA 2EELA 2KNBA 4F4ZA 2W3SA 3QU9A 4LDTB 4LNIA 3UINB 3ZXRA 2HHSA 4GGQA 1UD7A 4W9GA 1SSNA 4M8NA 1T3QA 3HILA 2SEBD 4M6WA 2KIWA 4UATA 4I6NB 3HUIA 4LTUA 2LYAA 2FUHB 1UA0A 1U49A 3O0FA 2KHVA 2WNMA 5AICA 3L54A 5BO4B 2ZW0A 2HTHA 5FP0A 1QOGA 2NMQA 2V4LA 5EWFA 3AM9A 1L7NA 1CI4A 4C8LA 1QLBB 1IXRA 4F5PA 3V3XA 3EWAA 5J2FA 1D8LA 1KW4A 1S1QB 4B0EA 2RP5A 2E8NA 1C4PA 4BWMA 2RQ5A 2BYVE 2LHDA 1A70A 2MX2A 1C4AA 4EZ9A 1SF0A 4F71A 5J2IA 1F5SA 4DL3A 4DK5A 4B9MA 1FNUA 4DDID 2W7PA 4OVZA 4JV2A 2R61A 4QWEA 1Z1BA 5DPTA 4XZ4A 3JPTA 1F0ZA 2QIEB 2DF4B 1V5OA 4GFJA 4FFDA 4JMUA 2RPQA 3VHTC 2MSED 1NENB 2KK0A 1KH0A 2JU6X 5KG4A 3GE8C 1PYWD 2KDEB 3LDAA 3NUQA 4RM8A 3P4SB 4CGZA 1E0ZA 4WH4A 5FK9C 1RYSA 1FCLA 3JPQA 1WI0A 3DHHC 2BTEA 1IBXA 1YMHE 2HE7A 5AK3A 3WK9A 2C7HA 1F52A 4J9SA 1ZQNA 3VUXA 1V6EA 2JZ3B 4O5KA 2VA2A 4ITKA 3RJKA 1BPZA 3KWLA 2L1AA 4HPLB 2B3AA 2EQYA 4C80A 2BCQA 3C29A 4QWDA 2ICIA 4DF8A 1WIAA 3WK7A 5J0OA 2HHQA 2Z7JA 1LVHA 2E1EA 4AJYB 4G50A 3MR6A 4ACOA 4HYKA 2PIAA 2ISPA 3C8YA 3OJ3A 3OAWA 2GBMA 3UXNA 3Q8CA 3QA8A 3FDSA 3NTUA 5KFZA 1GAQB 3RJEA 8ICWA 2K4IA 4TUPA 5CP2A 4O3MA 4RMAA 1WF9A 2KD1A 2L7RA 4P4OA 2PFQA 2I6XA 5AI8A 2J42A 4C4VA 8ICKA 1RFKA 3KOOA 5DG9A 3VCBA 1KQQA 3RRGA 2GH1A 5BMIA 4KLEA 1STEA 1DXSA 5EE9A 1TZOA 3PW2A 2LD9A 3TFRA 3WAMA 2SAKA 4B9UA 5KFNA 1E9MA 3OGUA 3Q8AA 8ICOA 1TAUA 4M0AA 4GLSC 2PMVA 2KSOA 3N30A 3DEEA 2WXFA 3P42A 1WXAA 1JMSA 4PK1A 2L83A 3AE6B 1WZ3A 3Q3FA 3QWZB 2B0CA 4MGKE 3W1SA 2HSZA 2X8XX 3GB1A 3VH3B 2J4XA 3MC1A 5J8YA 2KLGA 3HRDD 3FILB 4MEYA 5DBCA 4P7IA 1WX7A 4XYCA 1C77A 1J7AA 4QZ8A 3C2MA 2ALZA 4UAWA 4I2BA 5J2GA 2L5YA 4F1SA 5CTRC 4UQGA 2LGIA 2Q0ZX 1QSSA 2WAQC 2HOQA 1L4DB 1Z3EB 2WS3B 5AKYA 4B9LA 1AARA 2WB1C 2ZIUA 3KBBA 5EE1A 2JT4B 2LRUA 3QHTA 4IWOA 1UNSA 3KKAC 2E8MA 2AJQA 1XO1A 3QCAA 5ALLA 1XLOA 5DG8A 4DS5A 2AQ3B 1N5WA 1MPEA 2O6VA 2JH7A 2BS2B 1WMHA 1RWSA 5IIIA 3IM1A 2DPIA 3CSFA 1KFYB 5J2RA 2PI4A 5CA7A 3IG8A 3ML9A 1RXWA 1YZ6A 5ALWA 1UPHA 2DBYA 1OGWA 2FCNA 2HBLA 1C78A 2ZNVB 2LBOA 4O1NA 2ZJDA 2F8LA 3TEYA 3ZLZA 2KFNA 3I3TB 5AK5A 2ZTDA 4YTPB 2W9AA 3Q8SB 4J9KA 1Z1VA 3IFWB 3T79A 2KE7A 2CHXA 1SV4A 5D4BA 4BDPA 4HVBA 2N7JA 1MN8A 4Y2PA 1L6UA 3MTNB 2AH5A 1FXIA 4RFBA 4Y2RA 4JV0A 1QQ7A 3I9V1 2YTUA 4F50A 1Z19A 5KFJA 2PVGC 4KLDA 2ZVOA 1ZQAA 4K4GA 2J7QB 1A5RA 1K50A 2HHXA 5KFAA 4OO1J 3RMKC 3CP8A 2AL6A 3PHXB 2ZTEA 1H4RA 1JXEA 2V0GA 2HMXA 3ETLA 4QZFA 1TKDA 1X40A 3SMVA 1DGSA 4M9GA 2YQEA 1T4GA 2KDMA 2ZW1A 4NPNA 2KTRB 1C4CA 4J3OD 5CB1A 5AZHA 2ASQA 2YMQA 3KQ4A 3B0AA 3KUZA 3PX0A 4N6EB 3UIPB 2JX5A 3RJJA 4LNKA 4BXOA 2H3VA 8ICVA 4GLXA 2LGDA 2LI5A 1ZXIA 2LGXA 3ZNHB 1MG8A 1Z4NA 4XX5A 5J0WA 3SEIA 2VH2A 4HKZE 4M0WA 1WJUA 1I4HA 1JUDA 2MBEA 5ALIA 1ZQ1C 4EX6A 3ZDTA 1V38A 9ICLA 3IG3A 3M9NB 3DHIC 1QT9A 5L83A 1Q1OA 4NZLB 5IOIA 3RCZA 1IP9A 4PL1A 4RNAA 1I4QA 3BQ0A 3E9SA 3AU4A 1S8OA 1NNLA 3AE5B 4YWGG 4UAUA 4I2CA 2WAQF 3ETRA 4BBNC 3Q8MA 1RM6C 4QZEA 2N7DA 3ZRFA 5AKJA 4MFAA 2MP2A 4F91B 3I57A 2WB1F 2ESEA 1L7PA 2P35A 1PQSA 2KMDA 1B22A 4DF4A 3EFUA 4YSXB 1L5UA 3EW9A 3H8MA 1CZPA 3K4GA 4Q8FA 2PLPA 4CCHA 5KFRA 4UW9A 4RQ7A 1XD3B 2YEPB 1QSLA 3A4RA 4AJWA 1L3UA 4AS1A 3PLVA 3PRZA 4B9SA 2K89A 1P98A 4JK1A 1ZQVA 2WXHA 4WIPA 1TFRA 5KL1B 3ZJVA 2JXXA 1AROP 1Z00B 2JY6A 2D5GA 1JROA 1KEJA 5ALFA 5L1KA 5CWRA 3PW5A 1OEYA 4ECRA 2FLLA 2MBBB 4DQOC 2WXPA 9ICNA 2WXRA 3U8ZA 1COKA 1RYUA 4KLQA 3QNMA 3QIJA 1SL2A 3QYPA 5DGBA 2AXTU 1I4PA 1PGXA 2BDUA 2AGQA 3DVNV 7ICQA 4QWCA 1HE8A 2IPKD 8ICGA 2WXJA 4B9KA 1X9XA 1D9DA 4YXMA 3ZIMA 3C23A 1ZQMA 4YXDB 5J0QA 1T5XD 2GBJA 5LNK1 1JWUD 2PKOA 4OJOA 4FBUA 4GDKB 2H3IA 4YFKA 2ISOA 1CRXA 2RR9A 4M00A 5F9NA 1F2RI 3NJTA 4K3BA 2MWSB 5DDYA 1MA7A 1WXVA 3H7SA 4NQKE 1V1PB 3N1ZC 4GXJA 4RGMA 2ASJA 1WUDA 4B0MA 3F2BA 1R7SA 2A4ZA 3UQAA 1ZRMA 2PE6B 1OW5A 4S17A 3R7QA 4ICVA 3VTWA 5MPOA 2W43A 2O6VB 4RUAA 3MBYA 4TQRA 1WMHB 5AHXA 4JUZA 8ICMA 3KZIU 1GNUA 3M62B 2LVQA 1SJED 4S0RA 5KAIU 1FNWA 1ZQIA 5KFCA 3GFKB 3JPSA 1ROEA 2IO1B 1RPLA 3MR5A 2LUMA 4XWWA 5JHBA 2WX0A 4EBEA 3BZDB 5DB6A 4CE6A 1E90A 1TV9A 8ICBA 5DQIA 1WYWB 4NL9C 3IAM1 2ATLA 2LM1A 1EXNA 1ZUD2 1B4FA 1L6NA 4AQ7A 1ZQFA 4KTQA 2G1EA 3N20C 1L0XB 5HR6A 4ED1A 2KZRA 3RNAC 4MJSA 2GRIA 4LJXA 8ICCA 2KG5A 3M9MB 2WLBA 4A9AA 5ALHA 2VJ5A 2K4EA 3D2NA 1SE9A 1QH9A 4IL6U 3VAWA 4QIWC 3RJIA 3RNFC 2EZYA 1RLFA 2XIDA 5BMGA 1UHUA 1E8YA 3H4DA 2MEKA 3IT4B 3ZQ4A 3VUWA 2A1JB 4P4PA 2GBRA 3GZNI 2MCNB 3DPDA 1GB1A 3NZSA 4EEWA 5ALKA 4OVUA 5KFEA 4HJKA 1BNPA 2HBJA 2G5HB 3E56A 4DL6A 4P0PA 3W5VB 2O2VA 5J2CA 3V7JA 4YTMB 3ICXA 1NZBA 4IWQA 4QNLA 2Y3AA 4HXDA 1BPEA 2KDBA 4NAWA 2DL0A 4HROA 3WCQA 1WX8A 4PYZA 5HKHA 4C4RA 1DOIA 4A8EA 3V60A 3GV5B 3BS5A 4JGHB 1HEZE 3BVGA 2QARB 4I27A 4O3RA 1GPXA 1NK5A 5GMVA 2JUOA 3EPGA 3DBRB 3PREA 2BDPA 5TSSA 4O9MA 1NKEA 2KVZA 4KIKA 2HI0A 2NV3A 4DLEA 3JPNA 2ZUBA 5KFHA 2Q4TA 2D6FC 2FE8A 3EGRA 4UARA 1C9FA 2BPGA 1FIQA 5DPRA 3KUDB 1SKSA 1KSPA 5BMHA 2E1FA 2NRWA 1H38A 1OEYJ 2KX3A 4GN1A 5ALZA 5JU5A 5DLGA 5KG0A 2FUG1 4RZRA 1MQ2A 3VRAB 1IGDA 3LVWA 2KACA 1ZOYB 2KWVB 4GOCA 4XWTA 4X57B 1WWVA 3JVZX 4FE3A 5AKIA 4ICUA 3LWLA 5HI1A 5AI4A 2Y5PA 2EAOA 2DGZA 4KLOA 1GC6A 2YB4A 2DZKA 2C2EA 2KJ6A 2JVCA 5HR7A 1KFSA 2BGFA 3K9OB 3PVXA 9ICOA 1SBBB 1ZDXA 4WWPA 4ECSA 1L8OA 4HLEA 2JYEA 4DDGD 5ALJA 5KFBA 4NLBA 3UQBA 3TQ1A 4F5NA 4YD1A 5AKGA 4B95A 4Z6DA 2DX5B 2HJ8A 2L32A 3N9YC 2ZJ8A 1T0SC 1KTKA 4UB5A 2IO0B 2MLBA 3C5FA 2M56B 4PS8A 3CIRB 5DG7A 2BQRA 1RZTA 2EANA 1F0MA 1S9FA 2N0SB 4BKSD 5EDSA 1X6IA 3QE9Y 1ZQQA 2CU1A 2RDJA 4IW0A 2C7NB 2BQUA 2LVOA 3L10B 4O0IA 4QIWF 2NCNA 2KN5A 3N4MB 1WGRA 2NTTA 3EHVA 4HDQA 1COOA 4OZCA 3H0RB 4DQSA 1SXTA 3GIJA 3SENA 4F4KA 2EMTA 1TKYA 1X66A 2IBKA 5AM5A 3PY8A 1RQLA 2V9HA 2OJRA 4DFDA 4FZLA 1QLNA 3NVWA 1O03A 8ICSA 3H0LB 2G5IB 2WF9A 1MG4A 4M8MA 2JV3A 1VZ7A 5CHVC 2F1JA 4EZJA 4ZHOA 4TUQA 3PW0A 5LXIB 4EKUA 1QF6A 3EYZA 5G55A 4A90A 4Y2TA 3HK0A 3QUTA 4FS2A 4YL8A 3P4RB 4RQ8A 1HTQA 1JX4A 4OJPA 1QCKA 4I2EA 4GDLB 2W03A 1KFTA 2IOFK 1PFDA 4B6WA 4JLCA 2AX5A 2J6UA 1J2NA 4WJ3B 1V85A 1QQ6A 1ET9A 2NBVB 1ZQZA 3KHHA 3TKAA 3PV1A 3Q6BA 3DBHB 3I28A 3PSTA 2HOFA 4G11A 3PPAA 3C0RB 1E8WA 2DYOA 3M63B 1XU4A 4KITB 3AEFB 2EDUA 5ALVA 4PHEA 4G0NB 2MW5A 1XXGA 5H92C 3AMZA 4YG2A 2DLBA 1MSWD 5AUKA 2AL3A 5KG6A 1BNOA 2K3UA 1WZ0A 3LXFA 1L7YA 1ZJMA 2K60A 3SI8A 3V05A 3SAGA 1E10A 1HJPA 1CEZA 4P0PB 5KG3A 2MH7A 3ORYA 4FBTA 3PHWB 4UB3A 1HZ6A 5FR3A 2JPHA 2KYWA 9ICIA 2V4RA 5DLFA 4W9DA 3EC8A 5J0SA 3RAQA 1RRBA 1ZRNA 1JWBD 1DGJA 1WRIA 4B6JA 3QUQA 2ZCCA 5DBBA 4MFFA 8ICEA 1FFUA 3X23A 2R18A 1ZQXA 2DWQA 3SFEB 1Q5WB 4W9FA 1X9MA 1VZ6A 3HVDA 2C60A 5AI9A 2WXKA 4FLHA 4N58A 3QK0A 2F1HA 4DHJD 4MGZE 4RQ3A 1KBUA 4HJGE 2FMQA 2NBWB 2C28A 3GV8B 3PS6A 4EENA 2IMWP 2HJ1A 9ICKA 2OJWA 1H8CA 4EEKA 1DOYA 4DXGA 1JW9D 3CF6E 4YP3A 2Y9TA 5HMMA 3KLSX 4ECUA 2IHMA 2UVUA 2OWOA 2C7MB 4BX9C 2OM6A 3M95A 4ZHPA 5T14A 3TADC 4ZOHC 5CHWA 1KLGD 2LEKA 4FN2A 1TS5A 4ANWA 1YQBA 1VJ5A 5CX3A 3AEEB 4M02A 2KP7A 2C2DA 5D7GA 3FILA 4DHZE 2LHEA 4CF4A 2ZEQA 4GMVA 4ECWA 2DNFA 4F5QA 2RD0A 4HK2A 1PUTA 5J0RA 3B1LX 5BPCA 5IIOA 3NASA 4KV2A 2NBUA 4UASA 3T3NA 1WGDA 2ZJAA 4M9HA 1IGCA 1J2MA 5KT6A 3T3FA 2BPFA 3C19A 2RRDA 3Q3MC 1B43A 4WAAA 4NL9A 2A3VA 3AXCA 1N60A 2FI1A 2M1MA 4RT2A 4RQ1A 1F44A 4GIVA 1PVPA 3LB8C 4YR3A 5E79U 3BIID 3URYA 4NXZA 1QOFA 4MH8A 4GXIA 3L4PA 1D5ZC 2EZXA 4W9KA 1C79A 4W9JA 2VH1A 3Q14C 2M0XA 2YMPA 1BUIC 4US8A 3HJEA 1TBEA 4KMOB 2WXOA 4F93B 5TR5A 1NJZA 5E6OA 2L52A 4G3XB 4C00A 5HFYA 1IV8A 1SB3C 1EWCA 3UI3A 1L3VA 2Y1IA 1YN5A 2JF5A 3RPFC 4P16A 2R8JA 2MUTA 1S0OA 2HHVA 4KVGB 2W9BA 2CS4A 4RGNA 2LXCA 3IXSA 1F77A 1KFDA 5AI6A 1CK1A 2BHNA 3OHBA 3QU2A 3Q8FA 1SGGA 4RCOA 3WKBA 3O65B 4II3B 3PZPA 3HP6A 2ZIWA 2F3NA 2Y5CA 4DQQA 2MA9B 2D3CA 4CDGA 1ZQBA 1E7VA 1ZQDA 3V61A 4ACFA 3QUBA 4WJOA 5C2TB 1U48A 4H2AA 4MELA 3ZYYX 4YN4A 2YB1A 4ZRQA 4IC9A 1JRPA 2WXMA 3NRZA 4KGRA 5FKAC 1ZOLA 5TISU 3R2TA 1PVRA 2KTRA 3QU7A 3PGEA 3Q8QB 1XEEA 2EKIA 3N7SC 1NYQA 2BS3B 5AZFA 3RI7C 1R4MB 2XC9A 5KFLA 2JYTA 3PNCA 2JQRB 4ARIA 1HUOA 4K7WA 5HHDG 5AM1A 1G6JA 5KFPA 4QZHA 5DQGA 1K1SA 2VANA 2I1KA 3O13A 5J2EA 1AQ6A 2WF8A 2AHOB 4KMUA 5JHAA 4IM3A 1P0RA 1WWTA 2KFKB 3R3MA 4PL2A 1OQYA 2N4FA 3V7KA 1L7OA 2KFJA 1BGXT 4MSQB 1UT8A 5DQHA 4O3OA 2R8IA 4NJ7A 1URJA 4YCXA 2YX8A 3T5KA 3RH5A 1TIFA 2XNAC 1AYFA 1L4ZB 1DOXA 1X9SA 1S77D 4KZCA 2L00B 2QCZA 1KLVA 3QARA 3QJZA 4OJLA 3RR7A 2K4HA 3D2SA 2LZ6A 2J0MA 4DOBA 5F3XB 2IY0B 1WE6A 1D5MC 4ELUA 1VDVA 3H9DA 2IA6A 1I35A 3Q8PB 3EECA 1S0NA 1YN4A 3ALBA 4YSZB 4I2JA 4DFKA 4CQNA 5AIBA 1NZPA 3TAPA 2GBNA 3GOEA 2QDFA 4IM2A 5J2BA 1QKZA 4NWIA 2EAMA 1SV0A 4PYUA 2MBHA 3BZCA 1EU3A 1Z00A 2Y5BB 3WKDA 1TAMA 4RQNA 4MHVA 4ED2A 5AKHA 4NY0A 2ASLA 4KX6B 1NOMA 4I2IA 3G6VA 2CJNA 2LJ5A 1XSLA 2NTSA 5KFDA 5J0PA 3HW8A 2J6TA 3BYYB 2KNJA 3KVFB 3UGBB 3L0WB 4DWFA 2BBCA 1JWMD 1XNSA 3ZJTA 1ED1A 5KFUA 5ALQA 4UAVA 1DRGA 3M8SA 1FRDA 4WURA 3TEXA 1E8XA 1RAXA 1D8BA 2XK5B 2ZPNA 3N28A 4P2HA 7ICFA 3UM9A 3AEBB 1EUVB 4DL4A 1X2IA 3WKEA 7ICKA 4GDKA 2ZPYA 3Q8BA 1YD8U 1ZXHA 4RGTA 2H3FA 2VZKD 8ICUA 1ZQTA 1V1PA 4NM1A 4GC7A 5IAAC 3JYUA 2JGAA 1OUQA 3FKYA 5BYQA 4BFRA 4FJYA 4BGDA 2BWFA 2INDC 4RF1A 5DPWA 1SZPA 4RQ5A 1OXJA 2FMSA 4YMMA 1L3SA 2OYYA 1TK5A 2K6DB 3PT2B 3PR5B 4HDOA 2V3NA 2NRTA 3GILA 3T8MA 7ICGA 1ZPSA 3QX1A 1IM4A 5EWGA 4F5RA 4W9HA 1SWVA 3HM6X 2WTFA 1F1HA 2HHWA 3H8JA 2D3AA 1NJXA 3PSPA 2VKQA 8ICZA 1GOZA 3ZXVA 4ICAA 4FA6A 1TAQA 2ES6A 1WXSA 3UIOB 1NJYA 3RJFA 8ICLA 3H40A 4IDIA 4BUGA 4NJCA 5E6PA 3VR9B 4E71A 1P7EA 5LXHA 2GOLA 3UQ2A 2MUTB 1N61A 1RDFA 4CF5A 1TS2A 2P6UA 3T5JA 4TQ1A 3SHQA 3F2CA 1Q3UA 2W9BB 5D2MB 2NPTB 2UU7A 1V2YA 2FLPA 3UPQA 1N5XA 2FIFA 4BOSC 3R7RA 2KWDA 2Y9UA 2A1JA 4F2RA 3AUOA 1LGRA 4YVZA 1XQQA 2W82A 3IN5A 4FHKA 2FJ6A 5KFMA 4JL9A 3IT6B 2ZIWB 3KYDD 1PGBA 1WYGA 4WWOA 5CHGA 2LASA 5ALNA 3ISBA 3EPIA 7ICJA 4PHAA 2WHEA 4KLIA 1ZQUA 3I1YA 4J9MA 7ICRA 1V8CA 2WXNA 2H3ZA 2JH1A 1ZQRA 3BYTB 3AE3B 4Y2QA 3DDHA 3PRMB 4F4WA 5KL8B 3BINA 2KZ3A 1WXMA 1C3TA 1K8RB 1ZQJA 5JZEB 4A3PA 4ASWC 4DOCA 4DQRA 1IPGA 2QARA 2YLMA 2NRVA 1TY2A 5D3DA 1FCCC 3NVVA 4ED3A 5EE0A 4Y2YA 3SZ2A 4F2SA 1FMAD 3AE9B 2PPHA 2W9NA 3ZO5B 1B0XA 1N48A 5AI5A 3TADA 1JWAD 4IQWA 1WJNA 3M8RA 2HBMA 3PX4A 1J19A 5AK4A 2JWZA 3V6CB 3CMMB 2R8KA 2IBIB 3Q8KA 3WKAA 1QOBA 1SEBD 3IHQB 3VFKA 3DDCB 4UB6U 3S6JA 2R2QA 3DWMA 4MF2A 1S5LU 1RQNA 4IQTA 5HMLA 4RT3A 2QILA 1V9JA 2WU5B 3OWEB 4WJNA 3CNHA 4QWAA 2KDFB 1SXDA 3A9KB 2HBKA 4RQ0A 4KLJA 4A3OA 2AQ0A 2XI9A 3TCAA 4GXKA 1XLPA 4EZLA 3C1YA 1E8ZA 1L0VB 2DUYA 3M7DA 8ICJA 1X1MA 2FCSA 4KX3A 3L13A 1RXVA 9ICMA 1FEZA 3ENEA 3DBRI 2K8AA 5L95C 4I2GA 1WE7A 1UF0A 3RNCC 1S10A 2G07A 2KTFA 4W9EA 1SL0A 2M0NA 1UUPA 3SFDB 5KFOA 3Q8RB 2MJDA 1KLNA 4JE3B 5ALOA 4P6VF 2V1YA 1DK3A 4XGAB 3B08A 4EBDA 5EOZA 1ZQCA 1NDDA 4ZRIA 2JWUA 1ET6A 1P9DU 1PVQA 7ICHA 2WU2B 3AI5A 2DZMA 4NV0A 2ZIVB 1NEKB 9ICRA 2EZZA 4AOFA 3AU2A 2ZJ5A 1UZXB 2NS5A 8ICNA 1Q0WB 1X9WA 1OFFA 1QQ5A 2KK8A 1K5OA 3VVWB 2XGQA 2WDTB 2E5SA 1UBIA 2W9CB 3T9LA 1L7MA 7ICMA 3RZWC 3RF9A 3DV9A 3RBDA 3PO5A 2IY1B 4FZMA 2NR2A 4E3CA 5AKKA 4F8RA 4DFMA 4O5EA 2W55A 3LWMA 1XSPA 3P2BA 3B0YA 3VQIA 3GDXA 9ICTA 5C3JB 1S97A 4DOAA 1HA5A 4M2YA 5KHQA 2CHWA 3VC8A 4WJQA 1EU4A 3HKZC 3U30A 2M19A 5HNKA 4K3CA 3VUYA 4A20A 4GDLA 4UB4A 3ZVVA 3BQ7A 3RUIB 4UB8U 5C23A 1MJDA 5J17A 1WXQA 1NKBA 2MHJA 1TKGA 2LPEA 3C5GA 5JXVA 3AL0B 2BVCA 3BVMA 3DWGC 3R66C 3HHMA 2GBKA 4JPSA 8ICFA 5KFFA 4EELA 2ACZB 2N1WA 3WALA 5DDMA 2D11A 5DPSA 2J53A 3DHGC 3HVZA 4Y2XA 4TUSA 2JEFA 2FCQA 2KKVA 3X0WA 5KG5A 2LMCA 1ZDVA 5C5JA 2IO3B 1ZD2P 3F5EA 1NK4A 2XN9C 3GZFA 2XO7A 1P7DA 3ZNGC 2DENB 1BPDA 3BWUD 5GTHU 1JWSD 3AE2B 3LJ3A 3MHSD 2KAJA 4BBNF 2KMCA 3EZ5A 1XS9D 2YMLA 5HHHA 5KT4A 2D07B 2DYBA 2WX1A 4K7SA 3WAOA 4ED7A 5L1IA 2RPVA 4Y2UA 2WF7A 4LLGM 1XSNA 4OZBA 2TSSA 1HQRD 4JB3A 1KM7A 1LM8B 4WQOB 4R64A 3MDCA 4EZKA 2REXA 4DHJB 2D2QA 3RNEC 2JR5A 4OJ5A 5KG1A 3ZI4A 5KFYA 2BCRA 1D6EC 4FZNA 1RFAA 4DS4A 4B9NA 3DBHI 2LMRA 2LM4A 2KHQA 1ZD4A 3E58A 1ZYQA 2D3GA 3RBEA 1S0MA 1FXAA 4OJ6A 3PVLA 4P0QB 3R9KA 1T7PA 4YR2A 3RULA 3ZKJC 1B9RA 1FD6A 2UVRA 3KTQA 9ICJA 3AE8B 2CJOA 2G9HD 1JIHA 2KJ9A 3UMGA 2ON8A 2FPKA 2I5HA 1XWLA 1OQQA 1P7FA 1TKEA 1TZ1A 4EOYA 3ABVB 4CF3A 3KWVA 4US9A 4P1CC 1TS4A 3PRPB 1DK2A 4LNFA 2KT7A 1KKXA 2LKYA 1HTOA 5J2DA 1V49A 2N9KA 4G9BA 3KKAA 1ZJNA 4WQMA 4FS1A 3ZTCA 2PFOA 1X6JA 1T94A 4C4TA 2KN7A 5JH5C 4B9TA 4HPPA 2W54A 2Y0SC 1NI2A 1WH3A 7ICEA 8ICPA 1M6YA 1ENFA 4JWSC 1UQVA 4UAYA 1E6EB 2XICA 3HKZF 4EE2A 4ANVA 4DFJA 2A19A 1PK1B 4RQ4A 2ZG6A 3PV8A 4XA5A 2MJEA 4TV3A 2FCMA 5ALSA 4URKA 1FPYA 3IG5A 3OJUA 2W04A 2DKZA 1UWXA 2XEWA 2ZZPB 4RPYA 3SAFA 1ZKHA 2E6XA 4IRDA 2BKRB 2YY6A 1TYGB 1UA1A 1HUZA 4ZYNA 1BPBA 3ECIA 2QEJC 3VTUA 3U7ZA 4I29A 2OXOA 4NY8A 3AU5A 4OHJA 3RNBC 3TJPA 3RH6A 2WWZA 2VJ4A 2LI6A 4C4SA 1WM3A 3K9PB 1BPXA 1Q10A 2W9MA 3MGHA 1YQ3B 2HTME 5A0LA 2KC2A 2KV2A 4IG7B 2UWQA 3NVZA 5L1JA 1D9FA 4ZRKA 3WAPA 3TANA 3AE1B 3AQFA 1T6BX 4X5VA 5KFQA 4YQWA 5KHOA 5IINA 4XQ8A 1SZHA 3PLUA 2KQ7A 3U7DA 3BZKA 4USAA 1T0QC 2OEHA 2BCSA 3SEBA 4PGXA 2M4NA 2RDGA 2WXIA 3WK8A 3SYZA 5E6NA 4F92B 2LWPA 5G5GA 1SKWA 2P66A 3A4SC 1WJ6A 3H0MB 1QILA 2QB0B 1V80A 2K9XA 1U47A 4J6IA 3BQ2A 1I4GA 2R2OA 2DKXA 4QZCA 2JRIB 3RT3B 3WIMA 3IHPC 3VH4B 4JQWC 3PSFA 5AM2A 2GLSA 1WJ4A 2EKEC 4DCCA 2INNE 4Q2JA 4IM0A 5K4LA 5J8YC 4RNMA 2DHZA 4LNNA 4J9PA 1NI3A 2XY7A 4J9OA 2GWSA 2AGPA 4NJ8A 4Z6FA 2Z0EB 1Q46A 2B21A 5JUMA 5BYRA 4FBJB 4E0DA 2V9WA 1RYRA 2RSUA 4QW9A 3PW4A 4ELVA 4JWNA 3QX7A 2KEYA 2YVCA 3TEWA 2IHNA 4I2FA 3A33B 4YSYB 3P4QB 4DSFA 1NK8A 3R8BA 3PR4A 4Y2SA 1K51A 4KKIA 2DQNB 1S76D 1LKYB 2KFKA 2O6VD 2OOBB 4GU2A 3A1QB 4M9NA 3UXOA 4FULA 3TIXA 3RJHA 4DWIA 3SD5A 4UBBA 4I6LB 3IDWA 1KL9A 4R8UB 4XUSA 2JEGA 2AQ1B 3JPOA 4PZOA 3L08A 2NRXA 2WDRB 3H4BA 2Y0SF 1A0PA 5IP4D 2WYQA 1XC9A 2KJRA 3APDA 4DSEA 2JZBB 1DYQA 1IYFA 2N9LA 2K25A 2OH2A 5ALGA 5J2JA 1ZQYA 5J2AA 1JMLA 2R8GA 2UVVA 9ICSA 2JEJA 2KX0A 1N2XA 2L3ZA 1JN3A 1KTQA 4XC2A 4NLZA 1ZQPA 2L8JA 2KMAA 5KT3A 2JRHA 5KFTA 3IP4B 3ZDCA 2IZVB 4IQUA 2K1FA 4QAYA 5T8IA 4PGYA 1F9JA 4KGTA 1NJWA 4HKQA 5AKLA 2WF5A 5KAFU 2KZZA 2W8LA 3DBLB 1C7YA 1L2NA 2FNJB 2FE9A 3ZNID 4YXJA 2KO3A 4Z6EA 1P1AA 5CR0A
chains in the Genus database with same CATH topology
3I57A 1IUEA 1M4VA 1UWMA 2V4IB 2VZKB 5AUIA 1YN3A 3B2GA 1N62A 2IGHA 4KX6B 4YSXB 5I4DA 1CZPA 1C76A 1VJKA 2CJNA 2PLPA 2NTSA 2AQ2B 2YEPB 3BYYB 2BBCA 1PGAA 4JWUC 5HG2A 1JWMD 4AS1A 3ZJTA 3ZJVA 1FRDA 2WXHA 4WIPA 4WURA 4OZAA 4A8XC 3TEXA 2WDVB 3H8HA 2D5GA 1JROA 1N63A 4TQ0A 3B9JA 4NAMA 1MHXA 3FC4A 4DQOC 2WXPA 3AEBB 2WXRA 2BB5A 1NYRA 1ESFA 1I4PA 1I7HA 1PGXA 3Q8BA 1ZXHA 4RGTA 1L5PA 2VZKD 2I2YA 2IPKD 3CWIA 1BMLC 1V1PA 2WXJA 3NZ3A 2Z8LA 5BYQA 2W3RA 4YXDB 1V1OA 2IJ0A 1T5XD 2IGGA 5LNK1 1JWUD 2WXGA 2PKOA 3IAS1 4RF1A 4GDKB 1FFVA 3AN1A 1F2RI 1V1PB 2V3NA 4RGMA 1ZPSA 1EM7A 4B0MA 4MACA 1R7SA 1F2RC 2KQ4X 1GOZA 2K0PA 3GP7A 1D5XC 4YT0B 1WGKA 5MPOA 2BS4B 5G5HA 3BK2A 4RGOS 4NJCA 4IDIA 3VR9B 1SJED 1VRAB 1P7EA 3W5UB 1FNWA 1QQRA 1ROEA 1TJEA 1XLQA 1ZE3D 2LUMA 1N61A 2X38A 3ZGZA 1TS2A 4TQ1A 4XWWA 4HRSA 1JALA 2JXTA 2WDQB 3BZDB 2MJ3A 1AW7A 3IAM1 1N5XA 1FNVA 3RFZB 1ZUD2 3P4PB 4AQ7A 2KWDA 2PW9A 2G1EA 1K52A 1L0XB 2W82A 2GRIA 1KRHA 5EE3A 3IT6B 2KMMA 2WLBA 1PGBA 1WYGA 1BXTA 4HEA1 2E3TA 4A9AA 4ARCA 1ACCA 2BW2A 1LO5D 1GB4A 1VR9A 1V8CA 1D4BA 1I4XA 1HZ5A 2WXNA 5BMGA 3BYTB 2MEKA 3AE3B 3IT4B 3ZQ4A 1VZ8A 1B1ZA 2LFIA 1GB1A 3VR8B 3W9CB 3E56A 1TY2A 5D3DA 1FCCC 3NVVA 3W5VB 1EWYC 4TMAB 1FMAD 5EE0A 3U52E 3AE9B 3P63A 4YTMB 2Y3AA 3WCQA 4HROA 3MHZA 2BT6A 1JWAD 1WSPA 4RF0A 1DOIA 3B2FA 3GS2A 4C7YA 1HEZE 3BVGA 1QOBA 1SEBD 1XLNA 5BYSA 1GPXA 2B76B 3AECB 2H89B 3DWMA 1SE4A 4NAWB 2QILA 5TSSA 2WU5B 4L1BA 3OWEB 1CJEA 3AE4B 3EGRA 2FE8A 1XCTL 1C9FA 3AEAB 2K5PA 1FIQA 3SR6A 3EUB2 5BMHA 3FAHA 3VRBB 1XLPA 2WQYB 3PZ7A 2FUG1 1FO4A 1L0VB 2HDEA 3VRAB 1IGDA 1Y56A 2YEPF 1VLBA 2KACA 3MP9A 1MVKA 1ZOYB 3J9CA 4R3DA 2GB1A 4XWTA 1OQRA 1YJIA 3AEGB 1YNTE 5HI1A 1UUPA 3SFDB 2Y5PA 2JZPA 2MJDA 4JE3B 3PZ8A 3AE7B 4P6VF 4IKGA 1FRRA 4YTNB 1ZP0B 2LJIA 2WXLA 2JWUA 1ET6A 1MHHE 1SBBB 1ZDXA 2K22A 3NVYA 2WU2B 4D2KA 1J7CA 1KF6B 2JYEA 1K53A 1NEKB 1SE3A 2V3PA 4MM3B 2CU3A 1OFFA 2DYMA 1E7PB 3N9YC 2L32A 4A55A 1XF5L 1KTKA 2BYTA 3Q8EA 4DXFA 4C7ZA 2M56B 3CIRB 2N0SB 2EELA 1RYJA 2W3SA 2W55A 1SSNA 1T3QA 3VQIA 1AN8A 2SEBD 2NTTA 3HUIA 5C3JB 4LTUA 4OZCA 4XDDA 1SXTA 3AEDB 1HA5A 1TKYA 3AV8A 1EU4A 2WNMA 2M19A 3EA6A 1MI0A 1SJHD 4XDCA 3NVWA 1I4RA 3MFGA 2BB6A 2ZW0A 1QOGA 2NMQA 3AM9A 1WXQA 1VZ7A 2PTLA 4C56C 1TKGA 1QLBB 4IOIE 4ZHOA 5JXVA 1QF6A 3BVMA 3DWGC 2OEDA 3V3XA 4A90A 4JPSA 4B0EA 1YJJA 3P4RB 2ACZB 1JQ4A 1C4PA 3MJ5A 1QOAA 2OHFA 4GDLB 2LHDA 1A70A 2J53A 1PFDA 3HVZA 1C4AA 1SF0A 1XCQL 2AX5A 2LMCA 1UGJA 1ZDVA 1FNUA 2XN9C 1ET9A 4OVZA 2R61A 3BWUD 1JWSD 3AE2B 2KAJA 1F0ZA 1CQVA 2QIEB 4L23A 2DYOA 3TUOA 2RPVA 3AEFB 3P1MA 4LLGM 1XXGA 5H92C 3AMZA 4OZBA 2TSSA 4A6QA 1HQRD 1NENB 1KH0A 2DLBA 5AUKA 2JU6X 1PYWD 1TY0A 2K3UA 3P4SB 3LXFA 1E0ZA 1D6EC 4WH4A 5FK9C 3V05A 1FCLA 1E10A 2MH7A 1HXYD 2BTEA 1IBXA 1HZ6A 1YMHE 5FR3A 1FXAA 1JWBD 1DGJA 1WRIA 1B9RA 1FD6A 4ITKA 3AE8B 2CJOA 1FFUA 2G9HD 2L1AA 3KWLA 2M0AA 4C80A 2DWQA 3SFEB 2ICIA 1VZ6A 2ON8A 1IBXB 3HVDA 2WXKA 1OQQA 1P7FA 1TKEA 4N58A 4XE0A 3AH7A 2PIAA 4HJGE 3ABVB 3KWVA 4US9A 3C8YA 4KKJA 3ZJUA 1TS4A 2Q5WD 3Q8CA 2IGDA 1GAQB 2H88B 1JCKB 2PVOD 2N9KA 1DOYA 4DXGA 1JW9D 4WQMA 2J42A 3KLSX 1RFKA 2IDYA 2W54A 4WAFA 1J7BA 4ZHPA 4ZOHC 1STEA 1KLGD 5BMIA 2LEKA 1TZOA 5EE9A 2J52A 1ENFA 1TS5A 4JWSC 2I38A 1FEHA 3NUHB 1E6EB 2SAKA 3AEEB 4EE2A 3T3OA 5D7GA 3FILA 1E9MA 3Q8AA 5E6JA 3W2DA 1V97A 2LHEA 2MJEA 4GLSC 2PMVA 4KGSA 3U2SC 2WXFA 1PUTA 2WP9B 1TS3A 3P42A 4ZRPA 1UWXA 2L83A 3AE6B 3W1SA 4WWMA 2E6XA 2RDHA 3GB1A 3T3NA 1IGCA 1TYGB 2J4XA 3HRDD 3FILB 2QEJC 1C77A 1J7AA 3U7ZA 1N60A 4MT5A 3TSSA 4OHJA 3LB8C 4FXCA 2LGIA 3BIID 1Q10A 3URYA 1L4DB 1QOFA 2RMMA 3MC0B 1YQ3B 4MH8A 2HTME 1D5ZC 3L4PA 2WS3B 4N59A 4REZA 5EE1A 3NVZA 1C79A 2INPE 1UNSA 5D3IB 1BUIC 4US8A 3AE1B 1XLOA 1T6BX 4PT5A 2AQ3B 3R2IA 1N5WA 1MPEA 2WXOA 2BS2B 2L52A 1RWSA 1SB3C 5HFYA 1EWCA 3UI3A 4USAA 1YN5A 4RH6A 1KFYB 3SEBA 3RPFC 4P16A 2RDGA 2WXIA 3U4EG 5G5GA 2DBYA 2WXQA 1C78A 4O1NA 3PO0A 1QILA 2K9XA 4RGNA 1I4GA 3IXSA 1F77A 2JSVX 3TEYA 1CK1A 3Q8FA 4RCOA 4L2YA 4YTPB 2QSDA 2INNE 2KN4A 2Y5CA 4Q2JA 4LK0M 1SE2A 1KLUD 1L6UA 2N7JA 1NI3A 5C2TB 1PDXA 1FXIA 4H2AA 4JX1C 4RFBA 3I9V1 3ZYYX 5H8YE 5BYRA 3BVZA 4ZRQA 3TEWA 2PVGC 1JRPA 2WXMA 4TSSA 3NRZA 4KGRA 5FKAC 3R2TA 5GXGB 4YSYB 3P4QB 3R8BA 1L0YB 2EKIA 1XEEA 1K51A 1NYQA 2BS3B 4KKIA 1K50A 2JYTA 2JQRB 2V0GA 4ARIA 5HHDG 3BK1A 2FBWB 2ONQA 3AB5A 3O13A 2AQ1B 2KDMA 2ZW1A 3TEZA 1C4CA 2WDRB 4J3OD 2GI9A 3KQ4A 1WWTA 2QJLA 4N6EB 1DYQA 2JX5A 4OW0A 2N9LA 3Q69A 1JMLA 1ZXIA 1XO3A 1YQ4B 2QMTA 2XNAC 4HKZE 4M0WA 1AYFA 1L4ZB 1I4HA 1DOXA 5T8IA 3NS1A 4ZYSA 4UDUC 1L6VA 1QT9A 1SIJA 4KGTA 4NZLB 4HKQA 4RNAA 1D5MC 1I4QA 1VDVA 1AWDA 3E9SA 3LYYA 4YSZB 3AE5B 1YN4A 4YWGG 4CQNA 1NVID 1QKZA 3ETRA 1FM0D 1RM6C 1EU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BT6 A;  2OHF A;  1JWA D;  1IUE A;  3BII D;  1A70 A;  1UWM A;  5AUI A;  1DOI A;  1QOF A;  3B2F A;  1N62 A;  1PFD A;  1YQ3 B;  2HTM E;  3B2G A;  3L4P A;  1CZP A;  3HVZ A;  1VJK A;  4C7Y A;  1SF0 A;  2CJN A;  2AX5 A;  2WS3 B;  4KX6 B;  4N59 A;  1QOB A;  1XLN A;  3NVZ A;  4FXC A;  5EE1 A;  1GPX A;  2B76 B;  4JWU C;  3AEC B;  2H89 B;  3DWM A;  4US8 A;  3AE1 B;  1XLO A;  1FRD A;  1N5W A;  3AE2 B;  2BS2 B;  2WDV B;  2WU5 B;  2KAJ A;  2L52 A;  1JRO A;  1RWS A;  1SB3 C;  2QIE B;  1F0Z A;  4USA A;  1CJE A;  1N63 A;  3AE4 B;  3B9J A;  1KFY B;  3RPF C;  3AEF B;  3AEA B;  3FC4 A;  3AEB B;  3P1M A;  2K5P A;  1FIQ A;  3AMZ A;  3SR6 A;  1NYR A;  5H92 C;  1NEN B;  5G5G A;  5AUK A;  2DBY A;  3EUB 2;  3FAH A;  3PO0 A;  1I7H A;  3VRB B;  2K9X A;  1XLP A;  2WQY B;  1L5P A;  3P4S B;  1FO4 A;  1L0V B;  3VRA B;  3LXF A;  1E0Z A;  3CWI A;  1VLB A;  4YTP B;  1E10 A;  1ZOY B;  2W3R A;  2MH7 A;  4YXD B;  1OQR A;  1YJI A;  3AEG B;  2Y5C A;  2PKO A;  1L6U A;  3SFD B;  1NI3 A;  5C2T B;  1PDX A;  1FXI A;  2MJD A;  1FFV A;  4JX1 C;  3AN1 A;  1FXA A;  1JWB D;  3AE7 B;  4P6V F;  1DGJ A;  1WRI A;  3ZYY X;  5H8Y E;  1FRR A;  4YTN B;  1B9R A;  4ITK A;  3AE8 B;  2PVG C;  1ZP0 B;  1FFU A;  1JRP A;  2CJO A;  3KWL A;  3NRZ A;  5GXG B;  1JQ4 A;  4C80 A;  1R7S A;  2DWQ A;  2WU2 B;  4YSY B;  2K22 A;  3P4Q B;  3NVY A;  3SFE B;  2EKI A;  1J7C A;  1NYQ A;  1OQQ A;  1KF6 B;  1TKE A;  2BS3 B;  4N58 A;  4YT0 B;  3AH7 A;  1WGK A;  1NEK B;  2PIA A;  3ABV B;  5MPO A;  2BS4 B;  5G5H A;  4US9 A;  2JQR B;  2Q5W D;  4IDI A;  3VR9 B;  2CU3 A;  1OFF A;  3W5U B;  2FBW B;  1GAQ B;  1E7P B;  1ROE A;  1TJE A;  1XLQ A;  2H88 B;  3AB5 A;  1N61 A;  2PVO D;  1DOY A;  4HRS A;  1JAL A;  1JW9 D;  2WDQ B;  4WQM A;  2WDR B;  4C7Z A;  2M56 B;  2MJ3 A;  3CIR B;  1N5X A;  1WWT A;  1RFK A;  2N0S B;  1ZUD 2;  2QJL A;  4N6E B;  2W54 A;  3P4P B;  1J7B A;  1RYJ A;  2JX5 A;  2W3S A;  2G1E A;  5EE0 A;  4ZHP A;  4ZOH C;  2LEK A;  5EE9 A;  2W55 A;  1T3Q A;  4JWS C;  1KRH A;  5EE3 A;  1ZXI A;  1E6E B;  1XO3 A;  1YQ4 B;  3AEE B;  2KMM A;  2WLB A;  1WYG A;  4A9A A;  2E3T A;  1AYF A;  3HUI A;  5C3J B;  1E9M A;  4LTU A;  1DOX A;  1V97 A;  3AED B;  2MJE A;  1V8C A;  1TKY A;  3AV8 A;  1PUT A;  3NS1 A;  2WP9 B;  2M19 A;  3AE3 B;  1L6V A;  1QT9 A;  1SIJ A;  3NVW A;  2L83 A;  3AE6 B;  4WWM A;  1QOG A;  1VDV A;  3AM9 A;  1WXQ A;  1AWD A;  1TKG A;  1QLB B;  1TYG B;  3VR8 B;  4ZHO A;  3W9C B;  4YSZ B;  3AE5 B;  3DWG C;  4YSX B;  1QF6 A;  3HRD D;  3NVV A;  3W5V B;  1NVI D;  3ETR A;  1J7A A;  1EWY C;  1N60 A;  1FMA D;  1FM0 D;  3AE9 B;  1RM6 C;  3P63 A;  1YJJ A;  3P4R B;  4YTM B;  2ACZ B;  3WCQ A;  4HRO A;  1QOA A;  3LB8 C; 
#chains in the Genus database with same CATH topology
 2N1R A;  1IUE A;  2V4I B;  1UWM A;  2KTQ A;  2VZK B;  5ALP A;  3B2G A;  1N62 A;  2G3Q B;  2CRX A;  3HT3 A;  3ML8 A;  4NM2 A;  2XK5 A;  2V4Q A;  4DSK A;  3BJY A;  2ZTC A;  4CRX A;  1NK9 A;  2E8P A;  4YMN A;  1YIW A;  4JWU C;  1YZ7 A;  1PGA A;  3KYC D;  4AYB C;  1LB2 B;  4DQP A;  2KOB A;  4UAZ A;  3MGV A;  2BCV A;  1UBQ A;  4GIB A;  4OZA A;  2ZIX B;  2FPM A;  2G09 A;  2WDV B;  5KFS A;  3LVV A;  3PML A;  2QLT A;  2WHI A;  2Y1J A;  1N63 A;  9ICB A;  5KTQ A;  5AK6 A;  2JMG A;  3MAB A;  4PZN A;  1MHX A;  4NAM A;  4RQ2 A;  5B5E U;  4MH0 E;  1TE2 A;  1ZW7 A;  3MDA A;  3RNG C;  1PK3 A;  4PHD A;  3T5H A;  1I7H A;  2C5L C;  3DBS A;  2N9P C;  3UF8 A;  1L5P A;  5IIM A;  2WFA A;  1TK0 A;  1BML C;  4U7C A;  4G3I A;  2BQQ A;  1M94 A;  2Z8L A;  1D3Z A;  4C8K A;  3N7P D;  2W3R A;  3OSN A;  4KN4 A;  4YR0 A;  4R63 A;  1V1O A;  1YOV B;  3PSI A;  3S2A A;  4CHK A;  2C22 A;  2BKE A;  2IGG A;  4W9L A;  3H7I A;  4RQM A;  2CR5 A;  4TUU A;  1K1Q A;  3AN1 A;  4I2A A;  5KFI A;  3RD2 A;  5DB8 A;  2XY5 A;  3H7P B;  1CMX B;  3ZUN A;  9ICG A;  2ZUC A;  1F2R C;  4ZDV A;  2M17 A;  2NPT A;  3V6H A;  4Q43 A;  2KLC A;  3GP7 A;  4YT0 B;  1D5X C;  3ZW3 A;  1WGK A;  2BYF A;  2DZI A;  4K4I A;  5G5H A;  4JV1 A;  2BS4 B;  2MQJ A;  3BK2 A;  2L0T A;  3GV7 B;  2PKE A;  5KNI A;  3KFU F;  4P1B C;  4DL5 A;  5ALD A;  1VRA B;  3W5U B;  4OVV A;  1TJE A;  1XLQ A;  5IIL A;  3ED5 A;  1WWU A;  5DGA A;  2JXT A;  7ICL A;  2WDQ B;  4WJP A;  2MJ3 A;  2NO4 A;  1R4N B;  2D10 A;  1ZD5 A;  3WU2 U;  4I2D A;  1AW7 A;  1FNV A;  1UH6 A;  3NG0 A;  4KDI C;  4K4H A;  4IR9 A;  1WM2 A;  3NHE B;  4CO7 A;  4GB9 A;  5EE3 A;  4C8N A;  3QEA Z;  2IOH A;  2E3T A;  3HWT A;  1ACC A;  3D6J A;  4QZG A;  1ZQH A;  3GQC A;  3A9J B;  1VR9 A;  1GUA B;  1D4B A;  5BOM A;  5CEH A;  3RB0 A;  1I4X A;  1WG8 A;  7ICV A;  1VZ8 A;  2PEA A;  2LFI A;  2VA8 A;  2KKC A;  4K7U A;  3JSV B;  4MFC A;  4RPZ A;  2UYZ B;  1TT5 B;  4LCD E;  3VR8 B;  3RB3 A;  2HVI A;  3M6K A;  3THV A;  3F5A A;  1KN5 A;  4RU9 A;  4TMA B;  3U52 E;  4O3N A;  3HIZ A;  2KJ8 A;  3P63 A;  1XT9 B;  4QZD A;  1SWW A;  4J9R A;  3D2Q A;  2FDR A;  4RF0 A;  2K8C B;  3GIK A;  4AYB F;  3Q3N C;  3PO4 A;  1CUK A;  1D8Y A;  7ICP A;  3GS2 A;  3KHR A;  4FAD A;  3QZ8 A;  2C2R A;  3A9K A;  5AI0 A;  1XLN A;  2K39 A;  5IIK A;  4XRH A;  1ZGU B;  4LJO B;  1Q8K A;  2NVU I;  1O08 A;  5AM4 A;  4NLC A;  1NBF C;  1JI7 A;  3ZDA A;  3V6K A;  3QU5 A;  5J29 A;  1SIF A;  3TAR A;  2K8B B;  3MC9 A;  4L1B A;  4W9I A;  4IRK A;  3AE4 B;  2CKH B;  1UCV A;  2BKF A;  3CRX A;  1FXT B;  2K5P A;  2GOW A;  1U9L A;  3CYM A;  1L3T A;  3VRB B;  4O3Q A;  4C0Z A;  2ASD A;  2BR0 A;  1FO4 A;  3VXW A;  4BKS A;  2Z0D B;  2I1J A;  5L1M A;  3W1Y A;  2CHZ A;  4RNO A;  2PJH A;  3M3J A;  2FPL A;  4ECZ A;  4R3D A;  2GB1 A;  4K1R B;  1OQR A;  3AEG B;  1ZQL A;  1YX6 B;  4ANX A;  2AGO A;  3OJ4 B;  1YNT E;  2KFZ A;  1WY8 A;  2ZIV A;  5H2F U;  2JZP A;  1KRP A;  3PZ8 A;  3SAH A;  3A0H U;  5J0X A;  4IKG A;  4DXA B;  4EEY A;  2KIC A;  3V7L A;  4TUR A;  4RUC A;  2WXL A;  4Q8E A;  4I2H A;  3NVY A;  3IVF A;  4HCP B;  2KVC A;  4D2K A;  2W9C A;  1J7C A;  3KW5 B;  3F2D A;  4M9J A;  9ICC A;  1N56 A;  1WGY A;  4IQV A;  2L76 A;  4O5C A;  2G4D B;  2JEI A;  2XY6 A;  2CU3 A;  4MM3 B;  2KVR A;  4DBG A;  4PGQ A;  1L8L A;  5CJ7 A;  2DYM A;  2DPJ A;  1E7P B;  4E74 A;  1XF5 L;  5G2N A;  3VTV A;  3DCG A;  3RYT A;  3JPP A;  4N9F 4;  2N9X A;  3RZF A;  1RYJ A;  4ECQ A;  2KJ5 A;  3TI0 A;  2LRW A;  1RG6 A;  4RQ6 A;  4F7Z A;  2HCF A;  1AN8 A;  3DVN U;  2PFP A;  4DSJ A;  4XDD A;  4FJZ A;  2PMZ C;  3AED B;  2O6K A;  3ZDE A;  2A5U A;  4LVS A;  1J97 A;  2QKQ A;  2MBQ A;  3HPO A;  3AV8 A;  2XCP A;  5J18 A;  1ZD3 A;  3EA6 A;  2FLN A;  1MI0 A;  1SJH D;  4XDC A;  3MFH A;  1I4R A;  3MFG A;  2BB6 A;  3TAQ A;  1ECW A;  4M6W B;  2PTL A;  3KD3 A;  4IOI E;  4C56 C;  2BCU A;  3MFI A;  2G4S A;  4AP9 A;  1WR1 A;  2OED A;  4FJV B;  4Y2V A;  3TL5 A;  3V72 A;  2INC C;  4LDT D;  3AU6 A;  1YJJ A;  1JQ4 A;  1WFY A;  2IOF A;  1QOA A;  5CRX A;  2OHF A;  3KUC B;  3MJ5 A;  5LLI A;  2IO2 B;  2BQ3 A;  2J6S A;  3EFC A;  3N1X C;  1E7U A;  2F44 A;  2BF8 B;  1XCQ L;  2N1V A;  1UGJ A;  4CYE A;  4KLT A;  4EFO A;  4IS7 A;  4MGI E;  4DQI A;  1KOT A;  1BVS A;  3K1R B;  5DKW A;  2R8H A;  1GG3 A;  4R66 A;  3Q8L A;  5TZV A;  2FMP A;  4PS7 A;  2F2A B;  1BT0 A;  1I42 A;  2WF6 A;  3QAQ A;  1CQV A;  2H5X A;  3QZ7 A;  4L23 A;  2GO7 A;  5AEK B;  3TUO A;  4FHJ A;  7ICN A;  5AIA A;  3PZD A;  2DAF A;  3P1M A;  4DXF A;  8ICX A;  4C8O A;  4UB1 A;  2P6R A;  2N9E B;  4A6Q A;  2JHD A;  4U6P A;  3WAN A;  4BJQ A;  2BWE S;  2PI5 A;  1TY0 A;  2VRR B;  1JRU A;  3C28 A;  1SXE A;  4P0Q A;  4PJ0 U;  5KFW A;  2M8S A;  1IIP A;  1V9P A;  4DFP A;  2AU0 A;  4LZG A;  1GO3 F;  2F77 X;  2D3B A;  2EAP A;  3ALR A;  1DOQ A;  1HXY D;  1MQ3 A;  4I28 A;  1MFW A;  3KHG A;  4EBC A;  2XVT A;  5DBA A;  4RM9 A;  3G6X A;  3AUL A;  3BY4 B;  4KN7 A;  3NY5 A;  4BWJ A;  2B6G A;  2RLT A;  3IRU A;  1BPY A;  7ICI A;  3NOB A;  1GC7 A;  3ZNZ B;  2M0A A;  2L05 A;  4M9L A;  4CNQ A;  2J0J A;  1IBX B;  1VD2 A;  4EYI B;  2JZZ A;  4XE0 A;  2D8C A;  3AH7 A;  5ALY A;  3UQ0 A;  3RR8 A;  3DQV A;  3PX6 A;  4KKJ A;  3ZJU A;  5HP4 A;  2VA3 A;  2Q5W D;  3ZTD A;  4KZ0 A;  2RDB C;  1NK7 A;  3H1U A;  2H3Q A;  9ICU A;  3MJW A;  3MGI A;  2IGD A;  2H88 B;  3RAX A;  1JCK B;  2YN4 A;  4LZD A;  2PVO D;  1A76 A;  2LUE A;  1PK1 A;  1ISN A;  1WCN A;  4NLN A;  3L16 A;  2IDY A;  4WWN A;  5IO9 A;  1EF5 A;  3NZU A;  4WAF A;  1J7B A;  4AP4 C;  3BS7 A;  3Q3O C;  3LYS A;  2J52 A;  2PMZ F;  2KWU B;  1U45 A;  5F9L A;  3E0F A;  2I38 A;  1FEH A;  1T3N A;  1U4A A;  3NUH B;  4PH5 A;  4KSL C;  4BAX A;  5IA7 A;  4OCZ A;  5AZG A;  3ONN A;  3QUC A;  2XCA A;  3T3O A;  5E6J A;  4KLH A;  3W2D A;  1V97 A;  3LK9 A;  2HHU A;  4C4V B;  1TVA A;  4DHZ B;  4R65 A;  4KGS A;  3U2S C;  3OHA A;  2WP9 B;  1TS3 A;  4DL7 A;  3SD7 A;  4ZRP A;  2BZF A;  4J03 A;  4BKG A;  3TBL D;  3GE3 C;  4WWM A;  3VDZ A;  2BGW A;  2RDH A;  4O3S A;  4ECX A;  2L0F A;  4O3P A;  1TK8 A;  3PTF C;  1HIW A;  1QTM A;  2XBB C;  3T5L A;  3V6E B;  2EMS A;  4HWI B;  2CPR A;  9ICV A;  3D32 A;  1P3Q U;  4MT5 A;  2KSO B;  1YJ1 A;  4MGY E;  3TSS A;  1XO0 A;  8ICY A;  2BPS A;  4FXC A;  1EF1 A;  4EUT A;  4F5O A;  3SU8 X;  1Q3V A;  1MC8 A;  2UVW A;  1V86 A;  2MBO A;  2RMM A;  3MC0 B;  5IN7 A;  1PUZ A;  4N59 A;  3DVG Y;  4REZ A;  2CXY A;  3OG5 A;  2INP E;  2KD0 A;  4DL2 A;  5D3I B;  3K75 D;  2LHT A;  2QB0 A;  2YMM A;  3G6Y A;  4PT5 A;  4GSW A;  3R2I A;  2RHF A;  9ICP A;  1LXD A;  3SV4 A;  2LYB A;  4EYH B;  3RH4 A;  5KFG A;  2LVP A;  4RH6 A;  2PXI A;  2KKP A;  2W8K A;  4NJ6 A;  5GTI U;  1VCB A;  3NS8 A;  1X42 A;  2ZXI A;  3RFA A;  2ZIU B;  4J9L A;  3U4E G;  3LDZ E;  3KHL A;  3DVG X;  1ZQS A;  2WXQ A;  4NLG A;  8ICH A;  2KHW B;  2ZCB A;  3PO0 A;  5D6J B;  3E2E A;  9ICA A;  4KSK C;  2JSV X;  1ZQE A;  4KX5 A;  3TMP B;  2IYD B;  3ZRC A;  2ZXH A;  4L2Y A;  4F72 A;  5J0U A;  5L1L A;  2QSD A;  2HDO A;  2LGS A;  2MRP A;  5IKC M;  2D3D A;  3BQ1 A;  4B9V A;  8ICA A;  4LNO A;  2KN4 A;  1ZET A;  2KXJ A;  2VIX A;  4LK0 M;  1SE2 A;  3OTQ A;  3I63 C;  1KLU D;  1LKY A;  2N7E A;  4KDL B;  1PDX A;  3ISD A;  3ONS A;  4JX1 C;  1QZE A;  3A1Q A;  2M9N A;  2NRZ A;  4I6P A;  5H8Y E;  3Q2A C;  2K8H A;  3FM9 A;  3BVZ A;  4ZRJ A;  1WX9 A;  4R8U A;  4TSS A;  5GXG B;  3C2K A;  1L0Y B;  3GII A;  2F76 X;  2AQ4 A;  3MR3 A;  5HHI A;  2JZB A;  2ZNV C;  8ICI A;  4IC7 B;  4J9N A;  1YT3 A;  3QEB Z;  7ICO A;  1QSY A;  3BK1 A;  4QZ9 A;  2G08 A;  4M01 A;  3SDL C;  4OD0 A;  4ED0 A;  2DAJ A;  2BYE A;  3C1Z A;  3U26 A;  2FBW B;  2ONQ A;  3AB5 A;  3WK4 A;  4PS3 A;  2GLE A;  3TEZ A;  4YD2 A;  3RB4 A;  2W7O A;  3BDP A;  1OTR B;  4QWB A;  2HHT A;  1ZQG A;  2GI9 A;  3Q3J A;  2QJL A;  3AQE A;  4MEX A;  2KC1 A;  4MEM A;  4OW0 A;  1NK0 A;  1LQB A;  3Q69 A;  9ICW A;  1Z2M A;  2ODG A;  2KWC A;  5KT2 A;  1XO3 A;  1YQ4 B;  2KIV A;  2QMT A;  2C9W B;  3I5J C;  3V62 A;  4YMO A;  5J2K A;  3H8W A;  4KLF A;  2W11 A;  8ICQ A;  4HCN B;  1U4B A;  3WK6 A;  3NS1 A;  4ZYS A;  5L9X A;  4QZB A;  4UDU C;  1L6V A;  4BOZ B;  2LGY A;  1SIJ A;  4BXO B;  5C1Z A;  1N6Z A;  5ALE A;  1AWD A;  3LYY A;  3JPR A;  4M0W B;  4IRC A;  3N1Y C;  2MA1 A;  4F8C B;  1NVI D;  5D49 A;  4Q45 A;  4KLU A;  4NNJ B;  3FYH A;  5AM3 A;  1HEK A;  2MAX A;  3NRW A;  1FM0 D;  3CST A;  4EX7 A;  5EWE A;  3J81 j;  1Z4O A;  2ZIX A;  4F3O A;  2WGS A;  1GJZ A;  2K6Q A;  2KVS A;  1SGH A;  2RDI A;  2MU2 A;  4M47 A;  1M4V A;  5AUI A;  1V5T A;  4ED6 A;  1YN3 A;  1UGM A;  2IGH A;  5I4D A;  5KG2 A;  1C76 A;  1VJK A;  3QC8 B;  1UT5 A;  1Z5S B;  2AQ2 B;  3APF A;  3RN9 C;  3V6J A;  1Y8R C;  3UMB A;  5HG2 A;  1V81 A;  4ECY A;  1S3S G;  3DBL I;  4A8X C;  2MP2 B;  2K4P A;  2RGF A;  3H8H A;  2LXA A;  3QU4 A;  5KT5 A;  4TQ0 A;  3B9J A;  2MRL A;  2AWT A;  3FC4 A;  2BB5 A;  1NYR A;  2BPC A;  4PHP A;  3UXP A;  1ESF A;  4NQL B;  5DB9 A;  5KFX A;  2I2Y A;  3H6N A;  5IIJ A;  3CWI A;  1NK6 A;  3H7P A;  4BKT A;  5B66 U;  3NZ3 A;  3SQI A;  3NGD A;  4C8M A;  2IJ0 A;  3L3F X;  4UB2 A;  1C20 A;  2WXG A;  3IAS 1;  4J9Q A;  4DSL A;  4Q44 A;  1FFV A;  3L17 A;  4IUM B;  4F4Y A;  3ZDM C;  4BZA A;  1SV0 C;  5ALR A;  1ZQK A;  3SV3 A;  3N97 B;  3ZDB A;  3TAC B;  1WRD B;  3GU3 A;  4ECV A;  1EM7 A;  4MAC A;  3PSE B;  3MR2 A;  4DSI A;  3HM3 A;  4AUQ C;  4ZH4 A;  4QZA A;  2AYO B;  2KQ4 X;  2G06 A;  2K0P A;  4DLG A;  2PFN A;  2LYH A;  2HW3 A;  3ZD9 A;  5D46 A;  2F8K A;  4RGO S;  1KDH A;  5D94 A;  2NYV A;  4RNN A;  1J8C A;  2KZM A;  3W1S C;  1QQR A;  3QXG A;  9ICE A;  1WR6 E;  1ZE3 D;  5JTI A;  2X38 A;  3ZGZ A;  3F53 A;  3TFS A;  1IG6 A;  4HRS A;  1JAL A;  3GZN B;  2DFL A;  7ICU A;  3IBE A;  3N32 A;  3A9J A;  1WGG A;  3RFZ B;  2KAN A;  2KQS A;  1T0R C;  3P4P B;  2PW9 A;  4ED8 A;  9ICH A;  1K52 A;  5AKX A;  2FID A;  3BQT A;  3A0B U;  1TTN A;  2FAZ A;  3JSV A;  1KRH A;  5AM0 A;  1PZN A;  3L5K A;  2KMM A;  4ECT A;  4RPX A;  1BXT A;  1WCL A;  9ICF A;  4P4M A;  7ICS A;  4HEA 1;  4ARC A;  2BW2 A;  3GIM A;  5J0T A;  1LO5 D;  1GB4 A;  1LV5 A;  3M6Z A;  1HZ5 A;  3RRH A;  5CHF A;  8ICR A;  1B1Z A;  5JRT A;  3CW2 C;  5C0Y A;  4MJS B;  4TQS A;  1R4N I;  2K8C A;  3H8S A;  4II2 B;  5ALU A;  4KLL A;  3RJG A;  2Z59 B;  3W9C B;  4QW8 A;  1A77 A;  3WK5 A;  4FO6 A;  7ICT A;  3C2L A;  3RTV A;  1EWY C;  4IR1 A;  1SKR A;  3UMC A;  2JXJ A;  3C21 A;  3I76 A;  9ICX A;  3MHZ A;  1T8E A;  2AEH A;  2BT6 A;  3N3K B;  2K8B A;  4MF8 A;  4LJP B;  1R4M I;  1WSP A;  2OCE A;  4Z6C A;  3QQ8 B;  3B2F A;  1LFD A;  1UEL A;  4C7Y A;  1NKC A;  2J0K A;  1T0Y A;  5BYS A;  5ALM A;  4HAI A;  4TKN A;  2O2V B;  2B76 B;  3PMN A;  2XGP A;  3AEC B;  3APC A;  3K1Z A;  2NO5 A;  2H89 B;  1SE4 A;  5KT7 A;  4NAW B;  5AKE A;  1S0V A;  3IV6 A;  3JW0 X;  1J0G A;  2HVH A;  1A6S A;  5AKZ A;  2I1Q A;  3WKC A;  1JXL A;  2I9G A;  1CJE A;  2HD5 B;  2V3S A;  4K81 A;  1XCT L;  4JWM A;  3BS5 B;  3B0X A;  3AEA B;  4KLS A;  8ICT A;  3OLM D;  3SR6 A;  2CN1 A;  3PW7 A;  2KDI A;  3DOW A;  3EUB 2;  4W9C A;  1ZQW A;  5KFV A;  5BOL A;  1ZQO A;  3FAH A;  1E5W A;  2E8O A;  2EH9 A;  4AWJ A;  2WQY B;  3PZ7 A;  4PPX A;  2HDE A;  1C1Y B;  5KG7 A;  3ZDD A;  5DB7 A;  1Y56 A;  4KLG A;  5J2H A;  2YEP F;  4KIK B;  3OJS A;  1YX5 B;  1VLB A;  5FR6 A;  3MP9 A;  1MVK A;  4M04 A;  2ZUD A;  3KZX A;  2A1A A;  4DEZ A;  3J9C A;  3MC8 A;  1YJI A;  3M9O B;  2G45 B;  3N7R C;  3WA0 A;  4GXB A;  5J0Y A;  1Y88 A;  4DO9 A;  3AE7 B;  1EO6 A;  2KJH B;  4KLM A;  3KH0 A;  4BVU C;  1FRR A;  4YTN B;  4MM3 A;  1SL1 A;  4GC6 A;  5ALT A;  1KJT A;  2HOI A;  3ISC A;  1ZP0 B;  2LJI A;  2QHO A;  4QJF B;  1MHH E;  2F1I A;  3OPX A;  4ELT A;  2DZJ A;  2K22 A;  2QB1 A;  4HPM B;  2MSN A;  1KF6 B;  2G0A A;  3M1Y A;  4Y2J A;  3HX0 A;  9ICQ A;  2GMI C;  4JIO U;  1K53 A;  4ANU A;  2ZVN A;  1TGZ B;  1SE3 A;  2V3P A;  2JRZ A;  4EZ6 A;  4MDK E;  4NLK A;  3OSP A;  5KFK A;  4A55 A;  4UBC A;  1WGH A;  2QC8 A;  3AEV A;  3ZD8 A;  2PE9 A;  3Q8E A;  4F4X A;  5DCN A;  2BYT A;  4C7Z A;  4MSM B;  4IWP A;  4QZI A;  2KOX A;  3RB6 A;  5ALX A;  2EEL A;  2KNB A;  4F4Z A;  2W3S A;  3QU9 A;  4LDT B;  4LNI A;  3UIN B;  3ZXR A;  2HHS A;  4GGQ A;  1UD7 A;  4W9G A;  1SSN A;  4M8N A;  1T3Q A;  3HIL A;  2SEB D;  4M6W A;  2KIW A;  4UAT A;  4I6N B;  3HUI A;  4LTU A;  2LYA A;  2FUH B;  1UA0 A;  1U49 A;  3O0F A;  2KHV A;  2WNM A;  5AIC A;  3L54 A;  5BO4 B;  2ZW0 A;  2HTH A;  5FP0 A;  1QOG A;  2NMQ A;  2V4L A;  5EWF A;  3AM9 A;  1L7N A;  1CI4 A;  4C8L A;  1QLB B;  1IXR A;  4F5P A;  3V3X A;  3EWA A;  5J2F A;  1D8L A;  1KW4 A;  1S1Q B;  4B0E A;  2RP5 A;  2E8N A;  1C4P A;  4BWM A;  2RQ5 A;  2BYV E;  2LHD A;  1A70 A;  2MX2 A;  1C4A A;  4EZ9 A;  1SF0 A;  4F71 A;  5J2I A;  1F5S A;  4DL3 A;  4DK5 A;  4B9M A;  1FNU A;  4DDI D;  2W7P A;  4OVZ A;  4JV2 A;  2R61 A;  4QWE A;  1Z1B A;  5DPT A;  4XZ4 A;  3JPT A;  1F0Z A;  2QIE B;  2DF4 B;  1V5O A;  4GFJ A;  4FFD A;  4JMU A;  2RPQ A;  3VHT C;  2MSE D;  1NEN B;  2KK0 A;  1KH0 A;  2JU6 X;  5KG4 A;  3GE8 C;  1PYW D;  2KDE B;  3LDA A;  3NUQ A;  4RM8 A;  3P4S B;  4CGZ A;  1E0Z A;  4WH4 A;  5FK9 C;  1RYS A;  1FCL A;  3JPQ A;  1WI0 A;  3DHH C;  2BTE A;  1IBX A;  1YMH E;  2HE7 A;  5AK3 A;  3WK9 A;  2C7H A;  1F52 A;  4J9S A;  1ZQN A;  3VUX A;  1V6E A;  2JZ3 B;  4O5K A;  2VA2 A;  4ITK A;  3RJK A;  1BPZ A;  3KWL A;  2L1A A;  4HPL B;  2B3A A;  2EQY A;  4C80 A;  2BCQ A;  3C29 A;  4QWD A;  2ICI A;  4DF8 A;  1WIA A;  3WK7 A;  5J0O A;  2HHQ A;  2Z7J A;  1LVH A;  2E1E A;  4AJY B;  4G50 A;  3MR6 A;  4ACO A;  4HYK A;  2PIA A;  2ISP A;  3C8Y A;  3OJ3 A;  3OAW A;  2GBM A;  3UXN A;  3Q8C A;  3QA8 A;  3FDS A;  3NTU A;  5KFZ A;  1GAQ B;  3RJE A;  8ICW A;  2K4I A;  4TUP A;  5CP2 A;  4O3M A;  4RMA A;  1WF9 A;  2KD1 A;  2L7R A;  4P4O A;  2PFQ A;  2I6X A;  5AI8 A;  2J42 A;  4C4V A;  8ICK A;  1RFK A;  3KOO A;  5DG9 A;  3VCB A;  1KQQ A;  3RRG A;  2GH1 A;  5BMI A;  4KLE A;  1STE A;  1DXS A;  5EE9 A;  1TZO A;  3PW2 A;  2LD9 A;  3TFR A;  3WAM A;  2SAK A;  4B9U A;  5KFN A;  1E9M A;  3OGU A;  3Q8A A;  8ICO A;  1TAU A;  4M0A A;  4GLS C;  2PMV A;  2KSO A;  3N30 A;  3DEE A;  2WXF A;  3P42 A;  1WXA A;  1JMS A;  4PK1 A;  2L83 A;  3AE6 B;  1WZ3 A;  3Q3F A;  3QWZ B;  2B0C A;  4MGK E;  3W1S A;  2HSZ A;  2X8X X;  3GB1 A;  3VH3 B;  2J4X A;  3MC1 A;  5J8Y A;  2KLG A;  3HRD D;  3FIL B;  4MEY A;  5DBC A;  4P7I A;  1WX7 A;  4XYC A;  1C77 A;  1J7A A;  4QZ8 A;  3C2M A;  2ALZ A;  4UAW A;  4I2B A;  5J2G A;  2L5Y A;  4F1S A;  5CTR C;  4UQG A;  2LGI A;  2Q0Z X;  1QSS A;  2WAQ C;  2HOQ A;  1L4D B;  1Z3E B;  2WS3 B;  5AKY A;  4B9L A;  1AAR A;  2WB1 C;  2ZIU A;  3KBB A;  5EE1 A;  2JT4 B;  2LRU A;  3QHT A;  4IWO A;  1UNS A;  3KKA C;  2E8M A;  2AJQ A;  1XO1 A;  3QCA A;  5ALL A;  1XLO A;  5DG8 A;  4DS5 A;  2AQ3 B;  1N5W A;  1MPE A;  2O6V A;  2JH7 A;  2BS2 B;  1WMH A;  1RWS A;  5III A;  3IM1 A;  2DPI A;  3CSF A;  1KFY B;  5J2R A;  2PI4 A;  5CA7 A;  3IG8 A;  3ML9 A;  1RXW A;  1YZ6 A;  5ALW A;  1UPH A;  2DBY A;  1OGW A;  2FCN A;  2HBL A;  1C78 A;  2ZNV B;  2LBO A;  4O1N A;  2ZJD A;  2F8L A;  3TEY A;  3ZLZ A;  2KFN A;  3I3T B;  5AK5 A;  2ZTD A;  4YTP B;  2W9A A;  3Q8S B;  4J9K A;  1Z1V A;  3IFW B;  3T79 A;  2KE7 A;  2CHX A;  1SV4 A;  5D4B A;  4BDP A;  4HVB A;  2N7J A;  1MN8 A;  4Y2P A;  1L6U A;  3MTN B;  2AH5 A;  1FXI A;  4RFB A;  4Y2R A;  4JV0 A;  1QQ7 A;  3I9V 1;  2YTU A;  4F50 A;  1Z19 A;  5KFJ A;  2PVG C;  4KLD A;  2ZVO A;  1ZQA A;  4K4G A;  2J7Q B;  1A5R A;  1K50 A;  2HHX A;  5KFA A;  4OO1 J;  3RMK C;  3CP8 A;  2AL6 A;  3PHX B;  2ZTE A;  1H4R A;  1JXE A;  2V0G A;  2HMX A;  3ETL A;  4QZF A;  1TKD A;  1X40 A;  3SMV A;  1DGS A;  4M9G A;  2YQE A;  1T4G A;  2KDM A;  2ZW1 A;  4NPN A;  2KTR B;  1C4C A;  4J3O D;  5CB1 A;  5AZH A;  2ASQ A;  2YMQ A;  3KQ4 A;  3B0A A;  3KUZ A;  3PX0 A;  4N6E B;  3UIP B;  2JX5 A;  3RJJ A;  4LNK A;  4BXO A;  2H3V A;  8ICV A;  4GLX A;  2LGD A;  2LI5 A;  1ZXI A;  2LGX A;  3ZNH B;  1MG8 A;  1Z4N A;  4XX5 A;  5J0W A;  3SEI A;  2VH2 A;  4HKZ E;  4M0W A;  1WJU A;  1I4H A;  1JUD A;  2MBE A;  5ALI A;  1ZQ1 C;  4EX6 A;  3ZDT A;  1V38 A;  9ICL A;  3IG3 A;  3M9N B;  3DHI C;  1QT9 A;  5L83 A;  1Q1O A;  4NZL B;  5IOI A;  3RCZ A;  1IP9 A;  4PL1 A;  4RNA A;  1I4Q A;  3BQ0 A;  3E9S A;  3AU4 A;  1S8O A;  1NNL A;  3AE5 B;  4YWG G;  4UAU A;  4I2C A;  2WAQ F;  3ETR A;  4BBN C;  3Q8M A;  1RM6 C;  4QZE A;  2N7D A;  3ZRF A;  5AKJ A;  4MFA A;  2MP2 A;  4F91 B;  3I57 A;  2WB1 F;  2ESE A;  1L7P A;  2P35 A;  1PQS A;  2KMD A;  1B22 A;  4DF4 A;  3EFU A;  4YSX B;  1L5U A;  3EW9 A;  3H8M A;  1CZP A;  3K4G A;  4Q8F A;  2PLP A;  4CCH A;  5KFR A;  4UW9 A;  4RQ7 A;  1XD3 B;  2YEP B;  1QSL A;  3A4R A;  4AJW A;  1L3U A;  4AS1 A;  3PLV A;  3PRZ A;  4B9S A;  2K89 A;  1P98 A;  4JK1 A;  1ZQV A;  2WXH A;  4WIP A;  1TFR A;  5KL1 B;  3ZJV A;  2JXX A;  1ARO P;  1Z00 B;  2JY6 A;  2D5G A;  1JRO A;  1KEJ A;  5ALF A;  5L1K A;  5CWR A;  3PW5 A;  1OEY A;  4ECR A;  2FLL A;  2MBB B;  4DQO C;  2WXP A;  9ICN A;  2WXR A;  3U8Z A;  1COK A;  1RYU A;  4KLQ A;  3QNM A;  3QIJ A;  1SL2 A;  3QYP A;  5DGB A;  2AXT U;  1I4P A;  1PGX A;  2BDU A;  2AGQ A;  3DVN V;  7ICQ A;  4QWC A;  1HE8 A;  2IPK D;  8ICG A;  2WXJ A;  4B9K A;  1X9X A;  1D9D A;  4YXM A;  3ZIM A;  3C23 A;  1ZQM A;  4YXD B;  5J0Q A;  1T5X D;  2GBJ A;  5LNK 1;  1JWU D;  2PKO A;  4OJO A;  4FBU A;  4GDK B;  2H3I A;  4YFK A;  2ISO A;  1CRX A;  2RR9 A;  4M00 A;  5F9N A;  1F2R I;  3NJT A;  4K3B A;  2MWS B;  5DDY A;  1MA7 A;  1WXV A;  3H7S A;  4NQK E;  1V1P B;  3N1Z C;  4GXJ A;  4RGM A;  2ASJ A;  1WUD A;  4B0M A;  3F2B A;  1R7S A;  2A4Z A;  3UQA A;  1ZRM A;  2PE6 B;  1OW5 A;  4S17 A;  3R7Q A;  4ICV A;  3VTW A;  5MPO A;  2W43 A;  2O6V B;  4RUA A;  3MBY A;  4TQR A;  1WMH B;  5AHX A;  4JUZ A;  8ICM A;  3KZI U;  1GNU A;  3M62 B;  2LVQ A;  1SJE D;  4S0R A;  5KAI U;  1FNW A;  1ZQI A;  5KFC A;  3GFK B;  3JPS A;  1ROE A;  2IO1 B;  1RPL A;  3MR5 A;  2LUM A;  4XWW A;  5JHB A;  2WX0 A;  4EBE A;  3BZD B;  5DB6 A;  4CE6 A;  1E90 A;  1TV9 A;  8ICB A;  5DQI A;  1WYW B;  4NL9 C;  3IAM 1;  2ATL A;  2LM1 A;  1EXN A;  1ZUD 2;  1B4F A;  1L6N A;  4AQ7 A;  1ZQF A;  4KTQ A;  2G1E A;  3N20 C;  1L0X B;  5HR6 A;  4ED1 A;  2KZR A;  3RNA C;  4MJS A;  2GRI A;  4LJX A;  8ICC A;  2KG5 A;  3M9M B;  2WLB A;  4A9A A;  5ALH A;  2VJ5 A;  2K4E A;  3D2N A;  1SE9 A;  1QH9 A;  4IL6 U;  3VAW A;  4QIW C;  3RJI A;  3RNF C;  2EZY A;  1RLF A;  2XID A;  5BMG A;  1UHU A;  1E8Y A;  3H4D A;  2MEK A;  3IT4 B;  3ZQ4 A;  3VUW A;  2A1J B;  4P4P A;  2GBR A;  3GZN I;  2MCN B;  3DPD A;  1GB1 A;  3NZS A;  4EEW A;  5ALK A;  4OVU A;  5KFE A;  4HJK A;  1BNP A;  2HBJ A;  2G5H B;  3E56 A;  4DL6 A;  4P0P A;  3W5V B;  2O2V A;  5J2C A;  3V7J A;  4YTM B;  3ICX A;  1NZB A;  4IWQ A;  4QNL A;  2Y3A A;  4HXD A;  1BPE A;  2KDB A;  4NAW A;  2DL0 A;  4HRO A;  3WCQ A;  1WX8 A;  4PYZ A;  5HKH A;  4C4R A;  1DOI A;  4A8E A;  3V60 A;  3GV5 B;  3BS5 A;  4JGH B;  1HEZ E;  3BVG A;  2QAR B;  4I27 A;  4O3R A;  1GPX A;  1NK5 A;  5GMV A;  2JUO A;  3EPG A;  3DBR B;  3PRE A;  2BDP A;  5TSS A;  4O9M A;  1NKE A;  2KVZ A;  4KIK A;  2HI0 A;  2NV3 A;  4DLE A;  3JPN A;  2ZUB A;  5KFH A;  2Q4T A;  2D6F C;  2FE8 A;  3EGR A;  4UAR A;  1C9F A;  2BPG A;  1FIQ A;  5DPR A;  3KUD B;  1SKS A;  1KSP A;  5BMH A;  2E1F A;  2NRW A;  1H38 A;  1OEY J;  2KX3 A;  4GN1 A;  5ALZ A;  5JU5 A;  5DLG A;  5KG0 A;  2FUG 1;  4RZR A;  1MQ2 A;  3VRA B;  1IGD A;  3LVW A;  2KAC A;  1ZOY B;  2KWV B;  4GOC A;  4XWT A;  4X57 B;  1WWV A;  3JVZ X;  4FE3 A;  5AKI A;  4ICU A;  3LWL A;  5HI1 A;  5AI4 A;  2Y5P A;  2EAO A;  2DGZ A;  4KLO A;  1GC6 A;  2YB4 A;  2DZK A;  2C2E A;  2KJ6 A;  2JVC A;  5HR7 A;  1KFS A;  2BGF A;  3K9O B;  3PVX A;  9ICO A;  1SBB B;  1ZDX A;  4WWP A;  4ECS A;  1L8O A;  4HLE A;  2JYE A;  4DDG D;  5ALJ A;  5KFB A;  4NLB A;  3UQB A;  3TQ1 A;  4F5N A;  4YD1 A;  5AKG A;  4B95 A;  4Z6D A;  2DX5 B;  2HJ8 A;  2L32 A;  3N9Y C;  2ZJ8 A;  1T0S C;  1KTK A;  4UB5 A;  2IO0 B;  2MLB A;  3C5F A;  2M56 B;  4PS8 A;  3CIR B;  5DG7 A;  2BQR A;  1RZT A;  2EAN A;  1F0M A;  1S9F A;  2N0S B;  4BKS D;  5EDS A;  1X6I A;  3QE9 Y;  1ZQQ A;  2CU1 A;  2RDJ A;  4IW0 A;  2C7N B;  2BQU A;  2LVO A;  3L10 B;  4O0I A;  4QIW F;  2NCN A;  2KN5 A;  3N4M B;  1WGR A;  2NTT A;  3EHV A;  4HDQ A;  1COO A;  4OZC A;  3H0R B;  4DQS A;  1SXT A;  3GIJ A;  3SEN A;  4F4K A;  2EMT A;  1TKY A;  1X66 A;  2IBK A;  5AM5 A;  3PY8 A;  1RQL A;  2V9H A;  2OJR A;  4DFD A;  4FZL A;  1QLN A;  3NVW A;  1O03 A;  8ICS A;  3H0L B;  2G5I B;  2WF9 A;  1MG4 A;  4M8M A;  2JV3 A;  1VZ7 A;  5CHV C;  2F1J A;  4EZJ A;  4ZHO A;  4TUQ A;  3PW0 A;  5LXI B;  4EKU A;  1QF6 A;  3EYZ A;  5G55 A;  4A90 A;  4Y2T A;  3HK0 A;  3QUT A;  4FS2 A;  4YL8 A;  3P4R B;  4RQ8 A;  1HTQ A;  1JX4 A;  4OJP A;  1QCK A;  4I2E A;  4GDL B;  2W03 A;  1KFT A;  2IOF K;  1PFD A;  4B6W A;  4JLC A;  2AX5 A;  2J6U A;  1J2N A;  4WJ3 B;  1V85 A;  1QQ6 A;  1ET9 A;  2NBV B;  1ZQZ A;  3KHH A;  3TKA A;  3PV1 A;  3Q6B A;  3DBH B;  3I28 A;  3PST A;  2HOF A;  4G11 A;  3PPA A;  3C0R B;  1E8W A;  2DYO A;  3M63 B;  1XU4 A;  4KIT B;  3AEF B;  2EDU A;  5ALV A;  4PHE A;  4G0N B;  2MW5 A;  1XXG A;  5H92 C;  3AMZ A;  4YG2 A;  2DLB A;  1MSW D;  5AUK A;  2AL3 A;  5KG6 A;  1BNO A;  2K3U A;  1WZ0 A;  3LXF A;  1L7Y A;  1ZJM A;  2K60 A;  3SI8 A;  3V05 A;  3SAG A;  1E10 A;  1HJP A;  1CEZ A;  4P0P B;  5KG3 A;  2MH7 A;  3ORY A;  4FBT A;  3PHW B;  4UB3 A;  1HZ6 A;  5FR3 A;  2JPH A;  2KYW A;  9ICI A;  2V4R A;  5DLF A;  4W9D A;  3EC8 A;  5J0S A;  3RAQ A;  1RRB A;  1ZRN A;  1JWB D;  1DGJ A;  1WRI A;  4B6J A;  3QUQ A;  2ZCC A;  5DBB A;  4MFF A;  8ICE A;  1FFU A;  3X23 A;  2R18 A;  1ZQX A;  2DWQ A;  3SFE B;  1Q5W B;  4W9F A;  1X9M A;  1VZ6 A;  3HVD A;  2C60 A;  5AI9 A;  2WXK A;  4FLH A;  4N58 A;  3QK0 A;  2F1H A;  4DHJ D;  4MGZ E;  4RQ3 A;  1KBU A;  4HJG E;  2FMQ A;  2NBW B;  2C28 A;  3GV8 B;  3PS6 A;  4EEN A;  2IMW P;  2HJ1 A;  9ICK A;  2OJW A;  1H8C A;  4EEK A;  1DOY A;  4DXG A;  1JW9 D;  3CF6 E;  4YP3 A;  2Y9T A;  5HMM A;  3KLS X;  4ECU A;  2IHM A;  2UVU A;  2OWO A;  2C7M B;  4BX9 C;  2OM6 A;  3M95 A;  4ZHP A;  5T14 A;  3TAD C;  4ZOH C;  5CHW A;  1KLG D;  2LEK A;  4FN2 A;  1TS5 A;  4ANW A;  1YQB A;  1VJ5 A;  5CX3 A;  3AEE B;  4M02 A;  2KP7 A;  2C2D A;  5D7G A;  3FIL A;  4DHZ E;  2LHE A;  4CF4 A;  2ZEQ A;  4GMV A;  4ECW A;  2DNF A;  4F5Q A;  2RD0 A;  4HK2 A;  1PUT A;  5J0R A;  3B1L X;  5BPC A;  5IIO A;  3NAS A;  4KV2 A;  2NBU A;  4UAS A;  3T3N A;  1WGD A;  2ZJA A;  4M9H A;  1IGC A;  1J2M A;  5KT6 A;  3T3F A;  2BPF A;  3C19 A;  2RRD A;  3Q3M C;  1B43 A;  4WAA A;  4NL9 A;  2A3V A;  3AXC A;  1N60 A;  2FI1 A;  2M1M A;  4RT2 A;  4RQ1 A;  1F44 A;  4GIV A;  1PVP A;  3LB8 C;  4YR3 A;  5E79 U;  3BII D;  3URY A;  4NXZ A;  1QOF A;  4MH8 A;  4GXI A;  3L4P A;  1D5Z C;  2EZX A;  4W9K A;  1C79 A;  4W9J A;  2VH1 A;  3Q14 C;  2M0X A;  2YMP A;  1BUI C;  4US8 A;  3HJE A;  1TBE A;  4KMO B;  2WXO A;  4F93 B;  5TR5 A;  1NJZ A;  5E6O A;  2L52 A;  4G3X B;  4C00 A;  5HFY A;  1IV8 A;  1SB3 C;  1EWC A;  3UI3 A;  1L3V A;  2Y1I A;  1YN5 A;  2JF5 A;  3RPF C;  4P16 A;  2R8J A;  2MUT A;  1S0O A;  2HHV A;  4KVG B;  2W9B A;  2CS4 A;  4RGN A;  2LXC A;  3IXS A;  1F77 A;  1KFD A;  5AI6 A;  1CK1 A;  2BHN A;  3OHB A;  3QU2 A;  3Q8F A;  1SGG A;  4RCO A;  3WKB A;  3O65 B;  4II3 B;  3PZP A;  3HP6 A;  2ZIW A;  2F3N A;  2Y5C A;  4DQQ A;  2MA9 B;  2D3C A;  4CDG A;  1ZQB A;  1E7V A;  1ZQD A;  3V61 A;  4ACF A;  3QUB A;  4WJO A;  5C2T B;  1U48 A;  4H2A A;  4MEL A;  3ZYY X;  4YN4 A;  2YB1 A;  4ZRQ A;  4IC9 A;  1JRP A;  2WXM A;  3NRZ A;  4KGR A;  5FKA C;  1ZOL A;  5TIS U;  3R2T A;  1PVR A;  2KTR A;  3QU7 A;  3PGE A;  3Q8Q B;  1XEE A;  2EKI A;  3N7S C;  1NYQ A;  2BS3 B;  5AZF A;  3RI7 C;  1R4M B;  2XC9 A;  5KFL A;  2JYT A;  3PNC A;  2JQR B;  4ARI A;  1HUO A;  4K7W A;  5HHD G;  5AM1 A;  1G6J A;  5KFP A;  4QZH A;  5DQG A;  1K1S A;  2VAN A;  2I1K A;  3O13 A;  5J2E A;  1AQ6 A;  2WF8 A;  2AHO B;  4KMU A;  5JHA A;  4IM3 A;  1P0R A;  1WWT A;  2KFK B;  3R3M A;  4PL2 A;  1OQY A;  2N4F A;  3V7K A;  1L7O A;  2KFJ A;  1BGX T;  4MSQ B;  1UT8 A;  5DQH A;  4O3O A;  2R8I A;  4NJ7 A;  1URJ A;  4YCX A;  2YX8 A;  3T5K A;  3RH5 A;  1TIF A;  2XNA C;  1AYF A;  1L4Z B;  1DOX A;  1X9S A;  1S77 D;  4KZC A;  2L00 B;  2QCZ A;  1KLV A;  3QAR A;  3QJZ A;  4OJL A;  3RR7 A;  2K4H A;  3D2S A;  2LZ6 A;  2J0M A;  4DOB A;  5F3X B;  2IY0 B;  1WE6 A;  1D5M C;  4ELU A;  1VDV A;  3H9D A;  2IA6 A;  1I35 A;  3Q8P B;  3EEC A;  1S0N A;  1YN4 A;  3ALB A;  4YSZ B;  4I2J A;  4DFK A;  4CQN A;  5AIB A;  1NZP A;  3TAP A;  2GBN A;  3GOE A;  2QDF A;  4IM2 A;  5J2B A;  1QKZ A;  4NWI A;  2EAM A;  1SV0 A;  4PYU A;  2MBH A;  3BZC A;  1EU3 A;  1Z00 A;  2Y5B B;  3WKD A;  1TAM A;  4RQN A;  4MHV A;  4ED2 A;  5AKH A;  4NY0 A;  2ASL A;  4KX6 B;  1NOM A;  4I2I A;  3G6V A;  2CJN A;  2LJ5 A;  1XSL A;  2NTS A;  5KFD A;  5J0P A;  3HW8 A;  2J6T A;  3BYY B;  2KNJ A;  3KVF B;  3UGB B;  3L0W B;  4DWF A;  2BBC A;  1JWM D;  1XNS A;  3ZJT A;  1ED1 A;  5KFU A;  5ALQ A;  4UAV A;  1DRG A;  3M8S A;  1FRD A;  4WUR A;  3TEX A;  1E8X A;  1RAX A;  1D8B A;  2XK5 B;  2ZPN A;  3N28 A;  4P2H A;  7ICF A;  3UM9 A;  3AEB B;  1EUV B;  4DL4 A;  1X2I A;  3WKE A;  7ICK A;  4GDK A;  2ZPY A;  3Q8B A;  1YD8 U;  1ZXH A;  4RGT A;  2H3F A;  2VZK D;  8ICU A;  1ZQT A;  1V1P A;  4NM1 A;  4GC7 A;  5IAA C;  3JYU A;  2JGA A;  1OUQ A;  3FKY A;  5BYQ A;  4BFR A;  4FJY A;  4BGD A;  2BWF A;  2IND C;  4RF1 A;  5DPW A;  1SZP A;  4RQ5 A;  1OXJ A;  2FMS A;  4YMM A;  1L3S A;  2OYY A;  1TK5 A;  2K6D B;  3PT2 B;  3PR5 B;  4HDO A;  2V3N A;  2NRT A;  3GIL A;  3T8M A;  7ICG A;  1ZPS A;  3QX1 A;  1IM4 A;  5EWG A;  4F5R A;  4W9H A;  1SWV A;  3HM6 X;  2WTF A;  1F1H A;  2HHW A;  3H8J A;  2D3A A;  1NJX A;  3PSP A;  2VKQ A;  8ICZ A;  1GOZ A;  3ZXV A;  4ICA A;  4FA6 A;  1TAQ A;  2ES6 A;  1WXS A;  3UIO B;  1NJY A;  3RJF A;  8ICL A;  3H40 A;  4IDI A;  4BUG A;  4NJC A;  5E6P A;  3VR9 B;  4E71 A;  1P7E A;  5LXH A;  2GOL A;  3UQ2 A;  2MUT B;  1N61 A;  1RDF A;  4CF5 A;  1TS2 A;  2P6U A;  3T5J A;  4TQ1 A;  3SHQ A;  3F2C A;  1Q3U A;  2W9B B;  5D2M B;  2NPT B;  2UU7 A;  1V2Y A;  2FLP A;  3UPQ A;  1N5X A;  2FIF A;  4BOS C;  3R7R A;  2KWD A;  2Y9U A;  2A1J A;  4F2R A;  3AUO A;  1LGR A;  4YVZ A;  1XQQ A;  2W82 A;  3IN5 A;  4FHK A;  2FJ6 A;  5KFM A;  4JL9 A;  3IT6 B;  2ZIW B;  3KYD D;  1PGB A;  1WYG A;  4WWO A;  5CHG A;  2LAS A;  5ALN A;  3ISB A;  3EPI A;  7ICJ A;  4PHA A;  2WHE A;  4KLI A;  1ZQU A;  3I1Y A;  4J9M A;  7ICR A;  1V8C A;  2WXN A;  2H3Z A;  2JH1 A;  1ZQR A;  3BYT B;  3AE3 B;  4Y2Q A;  3DDH A;  3PRM B;  4F4W A;  5KL8 B;  3BIN A;  2KZ3 A;  1WXM A;  1C3T A;  1K8R B;  1ZQJ A;  5JZE B;  4A3P A;  4ASW C;  4DOC A;  4DQR A;  1IPG A;  2QAR A;  2YLM A;  2NRV A;  1TY2 A;  5D3D A;  1FCC C;  3NVV A;  4ED3 A;  5EE0 A;  4Y2Y A;  3SZ2 A;  4F2S A;  1FMA D;  3AE9 B;  2PPH A;  2W9N A;  3ZO5 B;  1B0X A;  1N48 A;  5AI5 A;  3TAD A;  1JWA D;  4IQW A;  1WJN A;  3M8R A;  2HBM A;  3PX4 A;  1J19 A;  5AK4 A;  2JWZ A;  3V6C B;  3CMM B;  2R8K A;  2IBI B;  3Q8K A;  3WKA A;  1QOB A;  1SEB D;  3IHQ B;  3VFK A;  3DDC B;  4UB6 U;  3S6J A;  2R2Q A;  3DWM A;  4MF2 A;  1S5L U;  1RQN A;  4IQT A;  5HML A;  4RT3 A;  2QIL A;  1V9J A;  2WU5 B;  3OWE B;  4WJN A;  3CNH A;  4QWA A;  2KDF B;  1SXD A;  3A9K B;  2HBK A;  4RQ0 A;  4KLJ A;  4A3O A;  2AQ0 A;  2XI9 A;  3TCA A;  4GXK A;  1XLP A;  4EZL A;  3C1Y A;  1E8Z A;  1L0V B;  2DUY A;  3M7D A;  8ICJ A;  1X1M A;  2FCS A;  4KX3 A;  3L13 A;  1RXV A;  9ICM A;  1FEZ A;  3ENE A;  3DBR I;  2K8A A;  5L95 C;  4I2G A;  1WE7 A;  1UF0 A;  3RNC C;  1S10 A;  2G07 A;  2KTF A;  4W9E A;  1SL0 A;  2M0N A;  1UUP A;  3SFD B;  5KFO A;  3Q8R B;  2MJD A;  1KLN A;  4JE3 B;  5ALO A;  4P6V F;  2V1Y A;  1DK3 A;  4XGA B;  3B08 A;  4EBD A;  5EOZ A;  1ZQC A;  1NDD A;  4ZRI A;  2JWU A;  1ET6 A;  1P9D U;  1PVQ A;  7ICH A;  2WU2 B;  3AI5 A;  2DZM A;  4NV0 A;  2ZIV B;  1NEK B;  9ICR A;  2EZZ A;  4AOF A;  3AU2 A;  2ZJ5 A;  1UZX B;  2NS5 A;  8ICN A;  1Q0W B;  1X9W A;  1OFF A;  1QQ5 A;  2KK8 A;  1K5O A;  3VVW B;  2XGQ A;  2WDT B;  2E5S A;  1UBI A;  2W9C B;  3T9L A;  1L7M A;  7ICM A;  3RZW C;  3RF9 A;  3DV9 A;  3RBD A;  3PO5 A;  2IY1 B;  4FZM A;  2NR2 A;  4E3C A;  5AKK A;  4F8R A;  4DFM A;  4O5E A;  2W55 A;  3LWM A;  1XSP A;  3P2B A;  3B0Y A;  3VQI A;  3GDX A;  9ICT A;  5C3J B;  1S97 A;  4DOA A;  1HA5 A;  4M2Y A;  5KHQ A;  2CHW A;  3VC8 A;  4WJQ A;  1EU4 A;  3HKZ C;  3U30 A;  2M19 A;  5HNK A;  4K3C A;  3VUY A;  4A20 A;  4GDL A;  4UB4 A;  3ZVV A;  3BQ7 A;  3RUI B;  4UB8 U;  5C23 A;  1MJD A;  5J17 A;  1WXQ A;  1NKB A;  2MHJ A;  1TKG A;  2LPE A;  3C5G A;  5JXV A;  3AL0 B;  2BVC A;  3BVM A;  3DWG C;  3R66 C;  3HHM A;  2GBK A;  4JPS A;  8ICF A;  5KFF A;  4EEL A;  2ACZ B;  2N1W A;  3WAL A;  5DDM A;  2D11 A;  5DPS A;  2J53 A;  3DHG C;  3HVZ A;  4Y2X A;  4TUS A;  2JEF A;  2FCQ A;  2KKV A;  3X0W A;  5KG5 A;  2LMC A;  1ZDV A;  5C5J A;  2IO3 B;  1ZD2 P;  3F5E A;  1NK4 A;  2XN9 C;  3GZF A;  2XO7 A;  1P7D A;  3ZNG C;  2DEN B;  1BPD A;  3BWU D;  5GTH U;  1JWS D;  3AE2 B;  3LJ3 A;  3MHS D;  2KAJ A;  4BBN F;  2KMC A;  3EZ5 A;  1XS9 D;  2YML A;  5HHH A;  5KT4 A;  2D07 B;  2DYB A;  2WX1 A;  4K7S A;  3WAO A;  4ED7 A;  5L1I A;  2RPV A;  4Y2U A;  2WF7 A;  4LLG M;  1XSN A;  4OZB A;  2TSS A;  1HQR D;  4JB3 A;  1KM7 A;  1LM8 B;  4WQO B;  4R64 A;  3MDC A;  4EZK A;  2REX A;  4DHJ B;  2D2Q A;  3RNE C;  2JR5 A;  4OJ5 A;  5KG1 A;  3ZI4 A;  5KFY A;  2BCR A;  1D6E C;  4FZN A;  1RFA A;  4DS4 A;  4B9N A;  3DBH I;  2LMR A;  2LM4 A;  2KHQ A;  1ZD4 A;  3E58 A;  1ZYQ A;  2D3G A;  3RBE A;  1S0M A;  1FXA A;  4OJ6 A;  3PVL A;  4P0Q B;  3R9K A;  1T7P A;  4YR2 A;  3RUL A;  3ZKJ C;  1B9R A;  1FD6 A;  2UVR A;  3KTQ A;  9ICJ A;  3AE8 B;  2CJO A;  2G9H D;  1JIH A;  2KJ9 A;  3UMG A;  2ON8 A;  2FPK A;  2I5H A;  1XWL A;  1OQQ A;  1P7F A;  1TKE A;  1TZ1 A;  4EOY A;  3ABV B;  4CF3 A;  3KWV A;  4US9 A;  4P1C C;  1TS4 A;  3PRP B;  1DK2 A;  4LNF A;  2KT7 A;  1KKX A;  2LKY A;  1HTO A;  5J2D A;  1V49 A;  2N9K A;  4G9B A;  3KKA A;  1ZJN A;  4WQM A;  4FS1 A;  3ZTC A;  2PFO A;  1X6J A;  1T94 A;  4C4T A;  2KN7 A;  5JH5 C;  4B9T A;  4HPP A;  2W54 A;  2Y0S C;  1NI2 A;  1WH3 A;  7ICE A;  8ICP A;  1M6Y A;  1ENF A;  4JWS C;  1UQV A;  4UAY A;  1E6E B;  2XIC A;  3HKZ F;  4EE2 A;  4ANV A;  4DFJ A;  2A19 A;  1PK1 B;  4RQ4 A;  2ZG6 A;  3PV8 A;  4XA5 A;  2MJE A;  4TV3 A;  2FCM A;  5ALS A;  4URK A;  1FPY A;  3IG5 A;  3OJU A;  2W04 A;  2DKZ A;  1UWX A;  2XEW A;  2ZZP B;  4RPY A;  3SAF A;  1ZKH A;  2E6X A;  4IRD A;  2BKR B;  2YY6 A;  1TYG B;  1UA1 A;  1HUZ A;  4ZYN A;  1BPB A;  3ECI A;  2QEJ C;  3VTU A;  3U7Z A;  4I29 A;  2OXO A;  4NY8 A;  3AU5 A;  4OHJ A;  3RNB C;  3TJP A;  3RH6 A;  2WWZ A;  2VJ4 A;  2LI6 A;  4C4S A;  1WM3 A;  3K9P B;  1BPX A;  1Q10 A;  2W9M A;  3MGH A;  1YQ3 B;  2HTM E;  5A0L A;  2KC2 A;  2KV2 A;  4IG7 B;  2UWQ A;  3NVZ A;  5L1J A;  1D9F A;  4ZRK A;  3WAP A;  3TAN A;  3AE1 B;  3AQF A;  1T6B X;  4X5V A;  5KFQ A;  4YQW A;  5KHO A;  5IIN A;  4XQ8 A;  1SZH A;  3PLU A;  2KQ7 A;  3U7D A;  3BZK A;  4USA A;  1T0Q C;  2OEH A;  2BCS A;  3SEB A;  4PGX A;  2M4N A;  2RDG A;  2WXI A;  3WK8 A;  3SYZ A;  5E6N A;  4F92 B;  2LWP A;  5G5G A;  1SKW A;  2P66 A;  3A4S C;  1WJ6 A;  3H0M B;  1QIL A;  2QB0 B;  1V80 A;  2K9X A;  1U47 A;  4J6I A;  3BQ2 A;  1I4G A;  2R2O A;  2DKX A;  4QZC A;  2JRI B;  3RT3 B;  3WIM A;  3IHP C;  3VH4 B;  4JQW C;  3PSF A;  5AM2 A;  2GLS A;  1WJ4 A;  2EKE C;  4DCC A;  2INN E;  4Q2J A;  4IM0 A;  5K4L A;  5J8Y C;  4RNM A;  2DHZ A;  4LNN A;  4J9P A;  1NI3 A;  2XY7 A;  4J9O A;  2GWS A;  2AGP A;  4NJ8 A;  4Z6F A;  2Z0E B;  1Q46 A;  2B21 A;  5JUM A;  5BYR A;  4FBJ B;  4E0D A;  2V9W A;  1RYR A;  2RSU A;  4QW9 A;  3PW4 A;  4ELV A;  4JWN A;  3QX7 A;  2KEY A;  2YVC A;  3TEW A;  2IHN A;  4I2F A;  3A33 B;  4YSY B;  3P4Q B;  4DSF A;  1NK8 A;  3R8B A;  3PR4 A;  4Y2S A;  1K51 A;  4KKI A;  2DQN B;  1S76 D;  1LKY B;  2KFK A;  2O6V D;  2OOB B;  4GU2 A;  3A1Q B;  4M9N A;  3UXO A;  4FUL A;  3TIX A;  3RJH A;  4DWI A;  3SD5 A;  4UBB A;  4I6L B;  3IDW A;  1KL9 A;  4R8U B;  4XUS A;  2JEG A;  2AQ1 B;  3JPO A;  4PZO A;  3L08 A;  2NRX A;  2WDR B;  3H4B A;  2Y0S F;  1A0P A;  5IP4 D;  2WYQ A;  1XC9 A;  2KJR A;  3APD A;  4DSE A;  2JZB B;  1DYQ A;  1IYF A;  2N9L A;  2K25 A;  2OH2 A;  5ALG A;  5J2J A;  1ZQY A;  5J2A A;  1JML A;  2R8G A;  2UVV A;  9ICS A;  2JEJ A;  2KX0 A;  1N2X A;  2L3Z A;  1JN3 A;  1KTQ A;  4XC2 A;  4NLZ A;  1ZQP A;  2L8J A;  2KMA A;  5KT3 A;  2JRH A;  5KFT A;  3IP4 B;  3ZDC A;  2IZV B;  4IQU A;  2K1F A;  4QAY A;  5T8I A;  4PGY A;  1F9J A;  4KGT A;  1NJW A;  4HKQ A;  5AKL A;  2WF5 A;  5KAF U;  2KZZ A;  2W8L A;  3DBL B;  1C7Y A;  1L2N A;  2FNJ B;  2FE9 A;  3ZNI D;  4YXJ A;  2KO3 A;  4Z6E A;  1P1A A;  5CR0 A; 
#chains in the Genus database with same CATH homology
 3I57 A;  1IUE A;  1M4V A;  1UWM A;  2V4I B;  2VZK B;  5AUI A;  1YN3 A;  3B2G A;  1N62 A;  2IGH A;  4KX6 B;  4YSX B;  5I4D A;  1CZP A;  1C76 A;  1VJK A;  2CJN A;  2PLP A;  2NTS A;  2AQ2 B;  2YEP B;  3BYY B;  2BBC A;  1PGA A;  4JWU C;  5HG2 A;  1JWM D;  4AS1 A;  3ZJT A;  3ZJV A;  1FRD A;  2WXH A;  4WIP A;  4WUR A;  4OZA A;  4A8X C;  3TEX A;  2WDV B;  3H8H A;  2D5G A;  1JRO A;  1N63 A;  4TQ0 A;  3B9J A;  4NAM A;  1MHX A;  3FC4 A;  4DQO C;  2WXP A;  3AEB B;  2WXR A;  2BB5 A;  1NYR A;  1ESF A;  1I4P A;  1I7H A;  1PGX A;  3Q8B A;  1ZXH A;  4RGT A;  1L5P A;  2VZK D;  2I2Y A;  2IPK D;  3CWI A;  1BML C;  1V1P A;  2WXJ A;  3NZ3 A;  2Z8L A;  5BYQ A;  2W3R A;  4YXD B;  1V1O A;  2IJ0 A;  1T5X D;  2IGG A;  5LNK 1;  1JWU D;  2WXG A;  2PKO A;  3IAS 1;  4RF1 A;  4GDK B;  1FFV A;  3AN1 A;  1F2R I;  1V1P B;  2V3N A;  4RGM A;  1ZPS A;  1EM7 A;  4B0M A;  4MAC A;  1R7S A;  1F2R C;  2KQ4 X;  1GOZ A;  2K0P A;  3GP7 A;  1D5X C;  4YT0 B;  1WGK A;  5MPO A;  2BS4 B;  5G5H A;  3BK2 A;  4RGO S;  4NJC A;  4IDI A;  3VR9 B;  1SJE D;  1VRA B;  1P7E A;  3W5U B;  1FNW A;  1QQR A;  1ROE A;  1TJE A;  1XLQ A;  1ZE3 D;  2LUM A;  1N61 A;  2X38 A;  3ZGZ A;  1TS2 A;  4TQ1 A;  4XWW A;  4HRS A;  1JAL A;  2JXT A;  2WDQ B;  3BZD B;  2MJ3 A;  1AW7 A;  3IAM 1;  1N5X A;  1FNV A;  3RFZ B;  1ZUD 2;  3P4P B;  4AQ7 A;  2KWD A;  2PW9 A;  2G1E A;  1K52 A;  1L0X B;  2W82 A;  2GRI A;  1KRH A;  5EE3 A;  3IT6 B;  2KMM A;  2WLB A;  1PGB A;  1WYG A;  1BXT A;  4HEA 1;  2E3T A;  4A9A A;  4ARC A;  1ACC A;  2BW2 A;  1LO5 D;  1GB4 A;  1VR9 A;  1V8C A;  1D4B A;  1I4X A;  1HZ5 A;  2WXN A;  5BMG A;  3BYT B;  2MEK A;  3AE3 B;  3IT4 B;  3ZQ4 A;  1VZ8 A;  1B1Z A;  2LFI A;  1GB1 A;  3VR8 B;  3W9C B;  3E56 A;  1TY2 A;  5D3D A;  1FCC C;  3NVV A;  3W5V B;  1EWY C;  4TMA B;  1FMA D;  5EE0 A;  3U52 E;  3AE9 B;  3P63 A;  4YTM B;  2Y3A A;  3WCQ A;  4HRO A;  3MHZ A;  2BT6 A;  1JWA D;  1WSP A;  4RF0 A;  1DOI A;  3B2F A;  3GS2 A;  4C7Y A;  1HEZ E;  3BVG A;  1QOB A;  1SEB D;  1XLN A;  5BYS A;  1GPX A;  2B76 B;  3AEC B;  2H89 B;  3DWM A;  1SE4 A;  4NAW B;  2QIL A;  5TSS A;  2WU5 B;  4L1B A;  3OWE B;  1CJE A;  3AE4 B;  3EGR A;  2FE8 A;  1XCT L;  1C9F A;  3AEA B;  2K5P A;  1FIQ A;  3SR6 A;  3EUB 2;  5BMH A;  3FAH A;  3VRB B;  1XLP A;  2WQY B;  3PZ7 A;  2FUG 1;  1FO4 A;  1L0V B;  2HDE A;  3VRA B;  1IGD A;  1Y56 A;  2YEP F;  1VLB A;  2KAC A;  3MP9 A;  1MVK A;  1ZOY B;  3J9C A;  4R3D A;  2GB1 A;  4XWT A;  1OQR A;  1YJI A;  3AEG B;  1YNT E;  5HI1 A;  1UUP A;  3SFD B;  2Y5P A;  2JZP A;  2MJD A;  4JE3 B;  3PZ8 A;  3AE7 B;  4P6V F;  4IKG A;  1FRR A;  4YTN B;  1ZP0 B;  2LJI A;  2WXL A;  2JWU A;  1ET6 A;  1MHH E;  1SBB B;  1ZDX A;  2K22 A;  3NVY A;  2WU2 B;  4D2K A;  1J7C A;  1KF6 B;  2JYE A;  1K53 A;  1NEK B;  1SE3 A;  2V3P A;  4MM3 B;  2CU3 A;  1OFF A;  2DYM A;  1E7P B;  3N9Y C;  2L32 A;  4A55 A;  1XF5 L;  1KTK A;  2BYT A;  3Q8E A;  4DXF A;  4C7Z A;  2M56 B;  3CIR B;  2N0S B;  2EEL A;  1RYJ A;  2W3S A;  2W55 A;  1SSN A;  1T3Q A;  3VQI A;  1AN8 A;  2SEB D;  2NTT A;  3HUI A;  5C3J B;  4LTU A;  4OZC A;  4XDD A;  1SXT A;  3AED B;  1HA5 A;  1TKY A;  3AV8 A;  1EU4 A;  2WNM A;  2M19 A;  3EA6 A;  1MI0 A;  1SJH D;  4XDC A;  3NVW A;  1I4R A;  3MFG A;  2BB6 A;  2ZW0 A;  1QOG A;  2NMQ A;  3AM9 A;  1WXQ A;  1VZ7 A;  2PTL A;  4C56 C;  1TKG A;  1QLB B;  4IOI E;  4ZHO A;  5JXV A;  1QF6 A;  3BVM A;  3DWG C;  2OED A;  3V3X A;  4A90 A;  4JPS A;  4B0E A;  1YJJ A;  3P4R B;  2ACZ B;  1JQ4 A;  1C4P A;  3MJ5 A;  1QOA A;  2OHF A;  4GDL B;  2LHD A;  1A70 A;  2J53 A;  1PFD A;  3HVZ A;  1C4A A;  1SF0 A;  1XCQ L;  2AX5 A;  2LMC A;  1UGJ A;  1ZDV A;  1FNU A;  2XN9 C;  1ET9 A;  4OVZ A;  2R61 A;  3BWU D;  1JWS D;  3AE2 B;  2KAJ A;  1F0Z A;  1CQV A;  2QIE B;  4L23 A;  2DYO A;  3TUO A;  2RPV A;  3AEF B;  3P1M A;  4LLG M;  1XXG A;  5H92 C;  3AMZ A;  4OZB A;  2TSS A;  4A6Q A;  1HQR D;  1NEN B;  1KH0 A;  2DLB A;  5AUK A;  2JU6 X;  1PYW D;  1TY0 A;  2K3U A;  3P4S B;  3LXF A;  1E0Z A;  1D6E C;  4WH4 A;  5FK9 C;  3V05 A;  1FCL A;  1E10 A;  2MH7 A;  1HXY D;  2BTE A;  1IBX A;  1HZ6 A;  1YMH E;  5FR3 A;  1FXA A;  1JWB D;  1DGJ A;  1WRI A;  1B9R A;  1FD6 A;  4ITK A;  3AE8 B;  2CJO A;  1FFU A;  2G9H D;  2L1A A;  3KWL A;  2M0A A;  4C80 A;  2DWQ A;  3SFE B;  2ICI A;  1VZ6 A;  2ON8 A;  1IBX B;  3HVD A;  2WXK A;  1OQQ A;  1P7F A;  1TKE A;  4N58 A;  4XE0 A;  3AH7 A;  2PIA A;  4HJG E;  3ABV B;  3KWV A;  4US9 A;  3C8Y A;  4KKJ A;  3ZJU A;  1TS4 A;  2Q5W D;  3Q8C A;  2IGD A;  1GAQ B;  2H88 B;  1JCK B;  2PVO D;  2N9K A;  1DOY A;  4DXG A;  1JW9 D;  4WQM A;  2J42 A;  3KLS X;  1RFK A;  2IDY A;  2W54 A;  4WAF A;  1J7B A;  4ZHP A;  4ZOH C;  1STE A;  1KLG D;  5BMI A;  2LEK A;  1TZO A;  5EE9 A;  2J52 A;  1ENF A;  1TS5 A;  4JWS C;  2I38 A;  1FEH A;  3NUH B;  1E6E B;  2SAK A;  3AEE B;  4EE2 A;  3T3O A;  5D7G A;  3FIL A;  1E9M A;  3Q8A A;  5E6J A;  3W2D A;  1V97 A;  2LHE A;  2MJE A;  4GLS C;  2PMV A;  4KGS A;  3U2S C;  2WXF A;  1PUT A;  2WP9 B;  1TS3 A;  3P42 A;  4ZRP A;  1UWX A;  2L83 A;  3AE6 B;  3W1S A;  4WWM A;  2E6X A;  2RDH A;  3GB1 A;  3T3N A;  1IGC A;  1TYG B;  2J4X A;  3HRD D;  3FIL B;  2QEJ C;  1C77 A;  1J7A A;  3U7Z A;  1N60 A;  4MT5 A;  3TSS A;  4OHJ A;  3LB8 C;  4FXC A;  2LGI A;  3BII D;  1Q10 A;  3URY A;  1L4D B;  1QOF A;  2RMM A;  3MC0 B;  1YQ3 B;  4MH8 A;  2HTM E;  1D5Z C;  3L4P A;  2WS3 B;  4N59 A;  4REZ A;  5EE1 A;  3NVZ A;  1C79 A;  2INP E;  1UNS A;  5D3I B;  1BUI C;  4US8 A;  3AE1 B;  1XLO A;  1T6B X;  4PT5 A;  2AQ3 B;  3R2I A;  1N5W A;  1MPE A;  2WXO A;  2BS2 B;  2L52 A;  1RWS A;  1SB3 C;  5HFY A;  1EWC A;  3UI3 A;  4USA A;  1YN5 A;  4RH6 A;  1KFY B;  3SEB A;  3RPF C;  4P16 A;  2RDG A;  2WXI A;  3U4E G;  5G5G A;  2DBY A;  2WXQ A;  1C78 A;  4O1N A;  3PO0 A;  1QIL A;  2K9X A;  4RGN A;  1I4G A;  3IXS A;  1F77 A;  2JSV X;  3TEY A;  1CK1 A;  3Q8F A;  4RCO A;  4L2Y A;  4YTP B;  2QSD A;  2INN E;  2KN4 A;  2Y5C A;  4Q2J A;  4LK0 M;  1SE2 A;  1KLU D;  1L6U A;  2N7J A;  1NI3 A;  5C2T B;  1PDX A;  1FXI A;  4H2A A;  4JX1 C;  4RFB A;  3I9V 1;  3ZYY X;  5H8Y E;  5BYR A;  3BVZ A;  4ZRQ A;  3TEW A;  2PVG C;  1JRP A;  2WXM A;  4TSS A;  3NRZ A;  4KGR A;  5FKA C;  3R2T A;  5GXG B;  4YSY B;  3P4Q B;  3R8B A;  1L0Y B;  2EKI A;  1XEE A;  1K51 A;  1NYQ A;  2BS3 B;  4KKI A;  1K50 A;  2JYT A;  2JQR B;  2V0G A;  4ARI A;  5HHD G;  3BK1 A;  2FBW B;  2ONQ A;  3AB5 A;  3O13 A;  2AQ1 B;  2KDM A;  2ZW1 A;  3TEZ A;  1C4C A;  2WDR B;  4J3O D;  2GI9 A;  3KQ4 A;  1WWT A;  2QJL A;  4N6E B;  1DYQ A;  2JX5 A;  4OW0 A;  2N9L A;  3Q69 A;  1JML A;  1ZXI A;  1XO3 A;  1YQ4 B;  2QMT A;  2XNA C;  4HKZ E;  4M0W A;  1AYF A;  1L4Z B;  1I4H A;  1DOX A;  5T8I A;  3NS1 A;  4ZYS A;  4UDU C;  1L6V A;  1QT9 A;  1SIJ A;  4KGT A;  4NZL B;  4HKQ A;  4RNA A;  1D5M C;  1I4Q A;  1VDV A;  1AWD A;  3E9S A;  3LYY A;  4YSZ B;  3AE5 B;  1YN4 A;  4YWG G;  4CQN A;  1NVI D;  1QKZ A;  3ETR A;  1FM0 D;  1RM6 C;  1EU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...