3NVWA

Crystal structure of bovine xanthine oxidase in complex with guanine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvwA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvwA01
1TJEA 1YQ4B 1J7CA 1XLQA 1VDVA 4HROA 4A9AA 2WDRB 2AX5A 3VRBB 4ZHOA 3ETRA 1FFVA 2PVOD 4USAA 3NVYA 3LXFA 3AEAB 3AE7B 1FIQA 5C2TB 1JWAD 3AE9B 1FM0D 1KF6B 3ABVB 3B2FA 3AV8A 3VRAB 1QOFA 5G5GA 4YSYB 1JWBD 1XLPA 1FMAD 2K9XA 4LTUA 4US9A 4IDIA 2W55A 2KMMA 4JX1C 2WP9B 4C7ZA 2H89B 4WQMA 1R7SA 3HRDD 2JX5A 2QJLA 2WDQB 1SIJA 2KAJA 3HUIA 1WRIA 3P4SB 1WYGA 5EE1A 1XLOA 5AUIA 1E0ZA 1WGKA 4N59A 1DGJA 4N6EB 1GPXA 1L6UA 1JRPA 2WU2B 1E9MA 3PO0A 1TKGA 1J7BA 3RPFC 1E7PB 3KWLA 1N60A 2E3TA 5G5HA 3AECB 4HRSA 1QLBB 2HTME 3AE4B 2EKIA 2Q5WD 3L4PA 3AEBB 1WXQA 1CZPA 5EE3A 2QIEB 2CJOA 3NVZA 2K22A 1F0ZA 1E6EB 1VLBA 4ZHPA 3EUB2 2DWQA 4FXCA 5C3JB 3AB5A 1EWYC 1J7AA 1L6VA 3P4PB 1IUEA 1QOBA 3P4RB 4JWUC 1DOXA 4C7YA 2MJDA 1GAQB 3AE5B 3FAHA 1YJIA 1RM6C 2WQYB 3AE8B 1TKYA 1OQRA 1JW9D 3AE1B 3B2GA 1A70A 5MPOA 1B9RA 1FFUA 3NRZA 1ZUD2 2WDVB 2BS3B 5H92C 3AMZA 3SFDB 1T3QA 3WCQA 2H88B 2L52A 4YT0B 2PVGC 1KRHA 1UWMA 2OHFA 3W9CB 2MJEA 2JQRB 3AH7A 1FXAA 3VR9B 1DOIA 1DOYA 4KX6B 1FO4A 1ZXIA 1NI3A 1RYJA 3NVWA 1NVID 3W5VB 3ZYYX 1QOGA 2K5PA 1YQ3B 2PKOA 2W3SA 3CIRB 2CU3A 3HVZA 4YTPB 4ZOHC 4JWSC 3VR8B 1FRRA 2BS4B 3B9JA 4P6VF 3W5UB 2BT6A 1QT9A 1AWDA 1FRDA 1L5PA 2L83A 1CJEA 5EE9A 4C80A 1NYQA 1SB3C 3P63A 3BIID 3SFEB 3AEEB 1QF6A 3NS1A 3SR6A 3AE3B 4YSZB 2MJ3A 5AUKA 1JQ4A 1L0VB 3P4QB 1OFFA 1PUTA 2M56B 3NVVA 2MH7A 2W54A 1N61A 1PDXA 1XLNA 4N58A 4YXDB 1JALA 1V97A 2G1EA 4YTMB 1N63A 3AE6B 1NEKB 3CWIA 1QOAA 1WWTA 2M19A 2LEKA 4ITKA 1PFDA 2WS3B 2Y5CA 4YTNB 1N5WA 2N0SB 1JROA 3DWMA 1ZOYB 4YSXB 1ROEA 2W3RA 3P1MA 1AYFA 3LB8C 2FBWB 3AE2B 2CJNA 5GXGB 2ACZB 1TKEA 2PIAA 3DWGC 1V8CA 1N62A 1ZP0B 2WU5B 1I7HA 1TYGB 1XO3A 3AEFB 3FC4A 1E10A 2DBYA 4US8A 1RWSA 1NYRA 1N5XA 3AM9A 1SF0A 3AN1A 1YJJA 1VJKA 3AEDB 1KFYB 2BS2B 1FXIA 1OQQA 4WWMA 5H8YE 3AEGB 5EE0A 2WLBA 2B76B 1NENB 1RFKA
chains in the Genus database with same CATH superfamily
3DBLI 1SL0A 2NCNA 4A9AA 3MTNB 1ZD4A 1PVQA 3ZTCA 5AZFA 1L3UA 2BHNA 4OJLA 5KFBA 4C4SA 4A20A 5D7GA 2LFIA 1TGZB 3ZIMA 4QWCA 8ICMA 1SGHA 3NOBA 4DDID 3KYDD 3VRAB 4UB3A 2R2OA 2HD5B 5KFUA 2VZKB 2SEBD 4C7ZA 1R4NI 2WF5A 2L1AA 2MX2A 3ONSA 1TZOA 1NI2A 4J9LA 4KIKB 1OGWA 1U48A 2KVZA 7ICEA 1UH6A 4J03A 2RGFA 4G0NB 4C4VB 5AK6A 2KTQA 2AJQA 4HPLB 1YJ1A 2QMTA 2L32A 5AHXA 2NO4A 4OW0A 3GE3C 3L17A 3ZDCA 1URJA 4B9SA 4E74A 1Z3EB 1TY2A 5AZHA 4KLLA 3KWVA 2KTFA 4H2AA 3TARA 3UXPA 2UVWA 4KLMA 4W9LA 1STEA 1I4QA 3WK8A 2FCMA 3LWMA 7ICRA 4RQNA 4LNOA 5TR5A 3SAHA 3ISDA 3LJ3A 3AU2A 3NZ3A 3DHHC 5H2FU 3GIIA 8ICOA 2MJDA 4I6LB 2CHXA 4PHPA 5HHDG 3R7QA 4A3PA 1J0GA 3RBEA 3KLSX 1UUPA 2YMQA 3Q8EA 7ICJA 1WYWB 4CGZA 3RRGA 1TE2A 1FFUA 3C5FA 1N56A 2KZ3A 2BPGA 1EO6A 4KLSA 2E6XA 3WCQA 2K4HA 1YD8U 2K89A 2INDC 1QQ5A 1T4GA 2FLNA 4I2DA 2XY5A 3I76A 3AH7A 2AEHA 2AU0A 1Z4OA 1SXDA 2QB0B 4IR1A 1JIHA 3TADA 1ZXIA 3UMBA 3EFCA 2KQSA 4ANUA 5L95C 4WAAA 2DZKA 2CU3A 4ZRJA 3Q8CA 4YTPB 3Q8KA 3JSVB 3GP7A 3UQ0A 5CTRC 5KG4A 1HXYD 4P6VF 4CO7A 3DHIC 3CP8A 2AQ4A 2NVUI 1AROP 2AGQA 2K0PA 2WXRA 1X66A 4NJCA 1FNUA 3UIOB 3VH3B 3PR5B 5IP4D 4IWQA 4PK1A 3JYUA 3ZNHB 4F1SA 1PDXA 2I1QA 3PGEA 2JV3A 5DG7A 4M02A 2JUOA 2OEDA 2MCNB 1NK5A 3DDCB 1KLVA 3ZVVA 3R66C 3WKDA 1ZQ1C 2BPFA 3NASA 2NMQA 2KC1A 1D9FA 4EOYA 2C28A 4UBCA 3TIXA 4DQPA 1D6EC 2KZRA 2W8LA 2B0CA 2EH9A 4NQKE 4P0PA 2Z7JA 3DVNU 5JHBA 5KAFU 4RNOA 5J0YA 4C8KA 1P9DU 4L2YA 2AL6A 4RGTA 2M0XA 2KO3A 1BPXA 4LDTB 1MQ3A 4Z6FA 1OQQA 5CHVC 2BF8B 5EE0A 1WZ0A 4URKA 2ZIXB 4OD0A 2M0AA 1XS9D 3L5KA 3G6YA 1UT5A 4KV2A 1D8LA 1SV4A 1C77A 1KLGD 4BKSD 3VVWB 2BCUA 1ZE3D 3QU7A 4TQSA 1MJDA 1JWAD 2MQJA 9ICTA 2HHXA 4MSMB 3N97B 5HI1A 2IGHA 2CHZA 4CF5A 2K4EA 3RNAC 4O5CA 2VZKD 3H0MB 1LKYB 1ZQSA 2AQ3B 2QB1A 8ICZA 4RUAA 9ICWA 5JH5C 4A6QA 4JUZA 3PW4A 2LUMA 1S0VA 2HJ1A 2WXPA 3OSNA 5J17A 2L0FA 3Q8LA 1H38A 9ICHA 4CF4A 4IOIE 3SYZA 3M9OB 1Y88A 4J9OA 2Q5WD 3QX7A 1JX4A 1S1QB 1V86A 9ICXA 5GTHU 1E7UA 4RQ3A 4P4PA 1KDHA 3DV9A 4DHZE 3HWTA 5D3DA 4O5KA 4YVZA 4EBEA 4C4RA 8ICRA 2DWQA 4MELA 4L23A 5C3JB 1WRDB 1I42A 5CHGA 2XCPA 8ICWA 3V72A 4WJQA 4I2JA 1ZQBA 1WX7A 1B9RA 3B0XA 5KT5A 4RNMA 5E6OA 1MSWD 4QZBA 2HBLA 2H3QA 9ICPA 1UA0A 1UA1A 1JUDA 3UQBA 2OHFA 2PXIA 2BZFA 1K50A 2K1FA 4A55A 2BYTA 2NO5A 4K7WA 2KSOB 3RFAA 4P7IA 2KHQA 2F1JA 1WX8A 2ON8A 1MI0A 2JH7A 1D8BA 4HJKA 2BB6A 4GDLB 5KNIA 3DBHI 2KD0A 2J6TA 4PS3A 3ZO5B 4HKQA 2LYHA 3AEEB 4TV3A 4ANXA 4F5OA 2E8NA 4TKNA 3R9KA 5CHFA 5J2CA 3GZNB 1JQ4A 3E0FA 2DZIA 4DQIA 1TS2A 3A0HU 1OEYA 1XLNA 5BO4B 2IGGA 3BDPA 1SZPA 1P7EA 1QTMA 7ICMA 2E1EA 5FP0A 3RAXA 3CWIA 3Q6BA 3VRBB 5ALXA 5KFKA 1QILA 2X8XX 1N5WA 2F44A 3ZLZA 1V1OA 3T9LA 4UAZA 2DHZA 2KZZA 3U7ZA 2OWOA 1YT3A 3WK9A 4REZA 5KT2A 3NZSA 1WY8A 5DLFA 8ICUA 2BPCA 2XIDA 4F2RA 2F1HA 1E8WA 5J2FA 1WMHB 5ALSA 7ICUA 1DYQA 2BKEA 1HTOA 4LDTD 3W9CB 1JXEA 2HI0A 2FNJB 1Q3UA 5CRXA 3H4BA 2WDRB 2EAOA 4RQ5A 4CCHA 1XT9B 2PVOD 2UVUA 2QSDA 4HPMB 3TACB 4RPZA 4FBTA 1ET6A 5J18A 3JPPA 2WXHA 3JVZX 5AZGA 1S8OA 4JV1A 4JPSA 1DK3A 4DOAA 3KW5B 3VH4B 2JPHA 3TL5A 4DSIA 3KUZA 4CDGA 2KAJA 2KN5A 2JZBB 1SKSA 2N4FA 3A9JB 2K8CA 3B08A 3MFGA 5TISU 5AK3A 4DWFA 2JXXA 2G5HB 3RJHA 1J2MA 2E5SA 2VJ5A 2WHEA 1E7PB 4YP3A 8ICSA 4IWOA 1DXSA 4M2YA 4F92B 4Y2JA 2EKIA 3PX4A 4RQ7A 2BQ3A 1EM7A 1SJHD 4OJPA 1A6SA 4R63A 1T6BX 4IUMB 5ALFA 4JLCA 2KTRA 5BMHA 9ICEA 1Q1OA 1X6IA 4CE6A 4DQQA 2BQQA 3QIJA 4KN4A 3P4PB 5J2GA 4R8UA 2EAPA 5ALYA 3RZWC 2BYVE 1F5SA 4GDKB 1XF5L 2KK0A 3NZUA 4FBJB 3JPSA 4O5EA 3QQ8B 4IQWA 2W9CA 4PS8A 3F2CA 1T7PA 2DYBA 2H88B 4JB3A 4CF3A 3Q69A 4JL9A 5ALWA 4I2IA 4XZ4A 1X6JA 4GC7A 2G9HD 5J0SA 4GXKA 2OXOA 4QJFB 4DS5A 2KDIA 3PSPA 2W9MA 2KDBA 1IXRA 4J6IA 1JMSA 1WG8A 2G06A 4NPNA 1EUVB 2CU1A 5DG9A 4AYBC 4F8CB 2GO7A 4BBNC 2HBMA 1MFWA 2F8LA 4IL6U 3PRMB 2FAZA 4BKGA 2GRIA 1QT9A 1AN8A 2AYOB 3V6HA 2NTSA 9ICRA 3DBSA 3M9NB 2AQ2B 2K8BB 2YEPF 3Q8RB 1I4GA 5KL8B 2XVTA 3Q8AA 2XICA 3VFKA 4R65A 1HZ6A 2KWCA 3MDCA 1J19A 1UCVA 4O9MA 5BMIA 1WX9A 2K6QA 1OXJA 1T94A 2CR5A 1RYUA 2HOFA 4PYUA 4WJ3B 2LEKA 4UATA 2RDGA 3JPTA 1VCBA 3H1UA 2XI9A 1JROA 3DWMA 2RD0A 3IP4B 1WE7A 1OQYA 4O3RA 3UI3A 1WUDA 2QCZA 4XWTA 1KLUD 2DKZA 4ELUA 2REXA 5KG2A 1WJNA 2E1FA 4LJXA 2BKRB 5AKHA 4XX5A 2GH1A 1UHUA 4DEZA 4DO9A 2F2AB 8ICHA 1I7HA 2WU5B 5KFHA 5EWGA 2HW3A 1E8XA 2PE6B 2RR9A 3ZRCA 2LM4A 1JRUA 2IO3B 3NUQA 1MG8A 4KGRA 4WWMA 4G3IA 1ESFA 1UGJA 1KOTA 2AL3A 3T79A 4HROA 3N20C 4FBUA 5EOZA 2A3VA 1C4AA 4NNJB 4FZNA 1QQ6A 4EZ6A 3KZIU 2IOFK 8ICIA 2O6VB 3SU8X 1K51A 1KF6B 4RM9A 3PVXA 3BS5A 2JY6A 5G5GA 2DNFA 5JRTA 4ED8A 4DL4A 1XLPA 1FMAD 2KT7A 2YEPB 5IILA 4JX1C 4DBGA 3ZD9A 1BMLC 4RPXA 3C21A 3RFZB 2WDQB 4TMAB 3IAM1 2AHOB 4UBBA 3R2IA 2RHFA 3WKAA 2ZUDA 1SE2A 2ZTEA 2PMZC 3TAQA 4BKSA 3RPFC 3F53A 2W03A 1SXTA 1F52A 1N60A 1QLBB 2MP2B 2M4NA 1WR6E 3L4PA 2W9BB 2HTHA 2IO0B 4WWOA 4S17A 3DCGA 3HT3A 1Y8RC 5HMLA 4G11A 5AM5A 4HDOA 4K1RB 1K52A 5D94A 1L7YA 1QZEA 4GLSC 2R2QA 3P4RB 4KIKA 3LK9A 4GGQA 1K1QA 3FAHA 1WGYA 4C4VA 2BWES 2HJ8A 2WX1A 1NJXA 3CMMB 5KHOA 3HP6A 2IO1B 3SENA 4EYHB 4I6NB 3KHGA 9ICQA 2JRZA 4J9NA 5CJ7A 2EZZA 2BGFA 3BVZA 2K60A 4RQ4A 3PLVA 1BNOA 1UWMA 3UIPB 4Y2PA 1TKDA 3DVNV 3RNCC 2R8IA 1Z5SB 2EKEC 2KZMA 1U4AA 3OJUA 5J0TA 1OEYJ 1KFSA 4RQ6A 1ZQTA 3MJWA 4X57B 2KHVA 2K5PA 3C2KA 2HCFA 3CIRB 3HVZA 4KLTA 4DS4A 3PRZA 3RAQA 4TUUA 4PHEA 3NRWA 2JYTA 5ALHA 1L7MA 3KH0A 1U49A 3M95A 4RQ1A 2I1KA 3QYPA 1C78A 2MSNA 4II3B 4XDDA 3NS1A 2XBBC 2KVSA 3UXOA 2BYFA 5KG5A 1OFFA 3P42A 1CRXA 2NBWB 2FI1A 1ECWA 2W54A 3VUYA 5DGAA 4N58A 4YXDB 5C0YA 2LI6A 4NAWA 2QB0A 2LGDA 4JIOU 3HVDA 1TS3A 4IM0A 4QWEA 2LJ5A 4ITKA 4YTNB 5L1MA 1PYWD 2ISPA 4KLHA 4HJGE 2YB4A 9ICCA 3W1SC 3RJKA 2FBWB 5ALNA 3PR4A 2PIAA 4DSEA 2N1VA 2XEWA 4YFKA 2KK8A 3BK2A 4M01A 5I4DA 4MSQB 1WFYA 3GDXA 1XO3A 3MGVA 1E7VA 2ZW1A 3GFKB 1RWSA 5DPWA 3PREA 3A33B 4OVZA 1KL9A 1WZ3A 1DOYA 3KBBA 2YLMA 5G55A 4QZIA 3M8RA 2YMMA 5DGBA 1K8RB 3V6JA 1D5ZC 1MHXA 4P1BC 3J81j 1FIQA 2D5GA 2IYDB 1OUQA 2FMQA 1HUOA 3IG5A 2MA9B 9ICMA 2O6VD 1DRGA 3IT4B 4ZDVA 8ICKA 4F91B 2EAMA 4BZAA 4IQTA 1Q0WB 2JX5A 5EE1A 1TV9A 5AUIA 8ICVA 4IRKA 3TEWA 2BR0A 2WXQA 2IMWP 4RNNA 4IKGA 3TMPB 4FA6A 4KX6B 2KIWA 4W9IA 2E8OA 4L1BA 2DPIA 3D6JA 1XSNA 4NV0A 2KOXA 4FJYA 5ALEA 7ICIA 8ICJA 1HQRD 2QIEB 1WF9A 4DOBA 5DBAA 3I28A 2IA6A 1FNWA 3T8MA 4PGYA 4IRDA 3P2BA 1M4VA 4MGZE 3MGHA 2G09A 5KFIA 2Z59B 3SD5A 1T3NA 2FMSA 3TEZA 3MR5A 2D2QA 5AKEA 4UB5A 2VIXA 2L0TA 1WCLA 1YJIA 4KX5A 2J0JA 3AE8B 3OG5A 2V3NA 3N32A 4FZMA 3SV3A 3Q8BA 2O2VA 3NRZA 5G2NA 1ZUD2 1WJ6A 1WI0A 1LQBA 1YNTE 5DDYA 4R3DA 5HFYA 4C4TA 1V1PA 3DBRI 3QUBA 5GMVA 2AQ0A 4TQRA 1LV5A 2L3ZA 2JGAA 3LYYA 4YN4A 1H8CA 3V61A 3ZDBA 1ZQZA 4BGDA 2AH5A 1WIAA 2JHDA 4IR9A 4QZFA 1I4RA 1N6ZA 2SAKA 5AK5A 4ECUA 3MC1A 2W9AA 2MA1A 4M9HA 3HM6X 3ZQ4A 2LXCA 1SSNA 3VR8B 3M6ZA 1FRRA 1UD7A 4OO1J 3VTVA 3BYYB 5E6JA 2FPLA 3SDLC 3TEYA 4EZJA 2J0KA 4QZHA 1L7OA 1NKBA 2ZJ8A 1HEKA 4JWMA 3AXCA 3WAMA 3BWUD 3WIMA 1TAMA 3E56A 3ECIA 2ISOA 3I5JC 4I6PA 3VUXA 4DSLA 2ZNVB 4CRXA 4RPYA 1CK1A 1JALA 1X1MA 2YTUA 5BYRA 2PLPA 3BQ2A 5KFVA 3RYTA 3AE6B 2UVVA 2DLBA 3Q14C 7ICTA 4GDLA 5DLGA 2Z0DB 2KACA 4BJQA 1KKXA 4EELA 3KVFB 4NY0A 2MW5A 3N1ZC 9ICNA 1P7FA 4PZNA 3ONNA 2GI9A 2DF4B 3RH6A 2OJRA 4EZLA 3PSIA 5ALGA 8ICPA 4AYBF 4RM8A 3I57A 4BBNF 3BZDB 2YMLA 5L1JA 1IIPA 4I2EA 5AKGA 3KKAA 4P4MA 4NLKA 2O6KA 4B0MA 3N1YC 4ANWA 4ICVA 4AQ7A 2Y9UA 3OHAA 3KD3A 3WALA 2ZXIA 2WAQF 3GV7B 4Z6CA 2N9KA 5JU5A 2MEKA 3D2SA 1YMHE 1WXMA 1D9DA 3ZXVA 2V4RA 2A19A 3Q8QB 1U47A 4LJPB 4KTQA 3ZUNA 3UMGA 3MC9A 3TFSA 3F2DA 3P4SB 4ZRQA 4BFRA 3PW0A 1WMHA 5J2RA 4GC6A 4XC2A 1GJZA 4N59A 1DGJA 3RJJA 2AGPA 1OW5A 4ZRPA 1TKGA 3FDSA 5KFZA 4KLGA 4DQOC 2EQYA 1C79A 1IBXA 2DYOA 1VD2A 3PLUA 4UB1A 1R4MB 3TADC 3ZI4A 3NHEB 4QW9A 2OOBB 4K4IA 3QHTA 3UF8A 4FXCA 4HAIA 5ALUA 3A9JA 5JZEB 2JSVX 2C9WB 3AE5B 1K5OA 3PZ7A 3H8WA 4MFAA 2WWZA 1V49A 3T3FA 2RSUA 5BYQA 1FEZA 5L9XA 5KT7A 2WYQA 3IN5A 5AI6A 2YMPA 1NK9A 3NUHB 4EZKA 3NGDA 2NV3A 1P1AA 4KLOA 1RFAA 4MEMA 4PPXA 5CWRA 4K4GA 1XCTL 3FKYA 4Y2YA 2JQRB 3VR9B 3WK6A 1PGXA 1KSPA 1FO4A 3BZKA 2KFZA 2PMZF 4KLEA 1SEBD 5AKZA 1WM3A 4EBCA 2ASDA 4HVBA 2F77X 3QU4A 4GDKA 1WGGA 2BT6A 1CJEA 1C4CA 4RUCA 1PGAA 4W9DA 1HZ5A 1ZJMA 2JR5A 3KUCB 1L2NA 1ENFA 1NKEA 3SR6A 2MSED 4J9MA 2FPMA 3SEBA 3V7LA 5L1KA 2DQNB 1ZDXA 3MHZA 4RF0A 1E8ZA 4DWIA 2CS4A 5KFAA 5CHWA 1BGXT 2FJ6A 2WXMA 4DSJA 2G1EA 1ZQWA 1NEKB 3IVFA 1PFDA 2WS3B 2LWPA 1UWXA 3V05A 2HBJA 1D4BA 4C00A 5KFXA 3VTWA 2F76X 5KFWA 2N7DA 5JUMA 3P1MA 3LB8C 1MQ2A 2CJNA 4UB8U 3JPQA 3GIJA 2K8BA 3Q8PB 5AM1A 8ICQA 3VCBA 8ICFA 4EUTA 4F7ZA 2INCC 4PGQA 1GC6A 3PSFA 2BCQA 2R8KA 4I2AA 5KL1B 4GSWA 3T5JA 1ZQAA 1NBFC 1VDVA 5J2JA 2AX5A 2RDJA 3MJ5A 4PH5A 1SL2A 3AI5A 2IO2B 3EGRA 1JWSD 4Y2RA 4UQGA 4AJYB 4YQWA 4M9JA 4DFDA 4YSYB 4P4OA 1JWBD 1BT0A 3H6NA 5GTIU 4DK5A 3IRUA 4WQMA 1R7SA 2IHNA 7ICHA 1QQ7A 1WGDA 1E0ZA 3QU5A 2Q4TA 3PSEB 4N6EB 2WXNA 4DQSA 1ED1A 2KX0A 4RMAA 1VZ6A 1X42A 1TK8A 2GLEA 3SHQA 3IDWA 2KE7A 5J2DA 5E6NA 2WB1C 2O6VA 2JH1A 2DPJA 3IFWB 4LCDE 1L7NA 2ZVNA 4F4ZA 1J8CA 4ACOA 2KANA 2Y1IA 4ED3A 2AGOA 4ECYA 3RRHA 3TKAA 4MHVA 2KMCA 3ML8A 3FILB 1SZHA 2DZMA 3IXSA 4B95A 1A0PA 5AKYA 4LK0M 1S0NA 3EPGA 1V80A 1CI4A 2D11A 1V38A 4QWAA 2KWUB 2MP2A 3THVA 3PO5A 5AIAA 2IBKA 1KRHA 1SXEA 4IRCA 4EE2A 4WH4A 1O08A 5F9NA 2PTLA 4KITB 2HBKA 4KLFA 3PPAA 4E0DA 4XYCA 4J9KA 4EEWA 3AU4A 1NI3A 4ECSA 1NVID 1QOGA 2BW2A 1V2YA 4PGXA 4KMUA 3QARA 4AWJA 3RULA 1KM7A 1YOVB 2KN7A 3APDA 4LNFA 4MGYE 1S0OA 2QARB 2K6DB 5AM0A 2KFKB 4HPPA 3ZW3A 2JYEA 1ZQDA 2MHJA 4MF2A 5J2KA 1LO5D 3BS7A 4N9F4 4XDCA 5DPTA 3AE3B 3WKEA 3K9PB 3N9YC 1IGCA 1V6EA 5HNKA 1ZQOA 4RGNA 5DDMA 4PHAA 1N61A 1T5XD 1WH3A 3PW5A 2GOLA 3N7PD 4QIWC 4K7UA 4Q2JA 1L0YB 3K4GA 5FR3A 2ZJ5A 1ZQMA 2BCRA 2INNE 4Q44A 4YR0A 3IHPC 1F77A 4DL2A 4I2HA 2M9NA 3PZ8A 1JI7A 4XGAB 5E79U 1SL1A 4NM1A 4R66A 5IOIA 1M6YA 3HJEA 4AP9A 5J2EA 2NRXA 2IJ0A 3FC4A 4KDIC 1NK4A 2IOFA 4US8A 1M94A 4NL9C 3GV5B 3AN1A 2I9GA 4GU2A 2KN4A 4BXOA 5ALLA 1BPYA 1F2RC 1Z00A 1NJYA 1XLQA 5ALKA 1XSPA 4OVVA 1UBIA 1FFVA 5KFDA 1L7PA 3H40A 2ZVOA 3W1YA 1ZRNA 4C8MA 5CR0A 1SWWA 3M8SA 4MFCA 4B6JA 2EMTA 1B0XA 1S77D 4DHZB 2PI5A 3GB1A 3NS8A 1D5MC 4PYZA 3BINA 2H89B 1ZGUB 4PZOA 1BPZA 9ICOA 2LVPA 5C5JA 4A8XC 2DKXA 4XRHA 2KJ9A 1U4BA 2JRHA 2JVCA 2MWSB 2WXJA 3HUIA 4Z6EA 1NNLA 2V9HA 2D10A 4UASA 3LYSA 2NR2A 3T5KA 3AQFA 5HR7A 4DFKA 4CNQA 1PK1B 3QXGA 5IIIA 5AI5A 3PW7A 1ZETA 4HDQA 1HJPA 1QLNA 1L0XB 3H7IA 4O3NA 3RUIB 3IT6B 3MC8A 2C7NB 4LNIA 5ALZA 2FLPA 2N7JA 2WXOA 1WXAA 4F5RA 3Q3OC 3T3NA 4JGHB 1F0ZA 4FHKA 2EMSA 4IC9A 1ZQNA 1ET9A 2PFQA 4M8MA 4O3QA 3BYTB 1ZQEA 2HE7A 5ALDA 4BUGA 3H8SA 3PRPB 5L1LA 4IC7B 2W82A 4ED6A 4G3XB 3N30A 2ESEA 1A77A 4NL9A 5DCNA 2BS3B 4G50A 4BX9C 9ICGA 2YY6A 4ED0A 3VUWA 4JWNA 3M9MB 2DZJA 2MJEA 1NK6A 3VQIA 5IIOA 4BWJA 4IQVA 1DOIA 2ZEQA 4EKUA 3GIMA 2WNMA 3L13A 4W9GA 3BK1A 3WAOA 3RH4A 2KFNA 1WM2A 1C9FA 3EWAA 1WGHA 1PUZA 1PGBA 3A0BU 2I5HA 1YZ7A 5BMGA 1AWDA 2KKPA 2VRRB 2L8JA 1TAUA 2KWVB 2D6FC 4NZLB 3SFEB 3L3FX 5AI0A 2XO7A 2WF6A 4YMNA 2KMDA 3WKBA 3U2SC 2JF5A 1C3TA 9ICUA 4B9KA 4NLNA 3NVVA 3I3TB 4A90A 3UPQA 5AM2A 1UT8A 3CRXA 4XE0A 5F3XB 2Y0SC 3AU6A 1T0RC 4ARCA 1WJUA 4NLCA 4P0QB 2AXTU 1KLNA 4Y2UA 1L4ZB 3F2BA 4UB2A 1ROEA 4EEYA 3WKCA 1WR1A 4GXIA 4GMVA 3RCZA 4M9GA 3M62B 4DDGD 9ICKA 8ICBA 1ZQGA 1PK3A 4E3CA 2ZTCA 4XUSA 2VA2A 3AM9A 1Z4NA 3QE9Y 3EPIA 1ZQHA 4P16A 1CUKA 2XGQA 2ZCCA 3KTQA 4WQOB 4RQ2A 4B9NA 2B76B 1ZJNA 4DCCA 2DX5B 5HR6A 4NJ8A 4ED7A 3RN9C 2FCQA 3V3XA 5KTQA 3H0RB 4J9RA 2ZIWA 3PY8A 1N2XA 3NG0A 2A1JA 9ICSA 3GS2A 2WXGA 2LASA 2BQUA 4DQRA 1LM8B 1ZKHA 3PNCA 4US9A 3TANA 1OTRB 4F5PA 4M6WB 4X5VA 4E71A 5AEKB 3MFIA 1XQQA 1X9WA 2ZIVB 3H8JA 3RH5A 2V1YA 1UZXB 2D3BA 5KT6A 2V0GA 2KG5A 3AULA 3BQ7A 4RZRA 7ICSA 5KAIU 3EW9A 4KLQA 5JHAA 2FIDA 2E3TA 2JZPA 1SBBB 2HTME 5AKJA 1GNUA 4JK1A 3GQCA 1CZPA 3N3KB 4LJOB 4ECWA 5KG0A 4DLEA 1F9JA 3X0WA 1COKA 3SMVA 2WXKA 3PZDA 1YZ6A 1ZQCA 2MUTB 1L6VA 3LVWA 1MG4A 4ZRIA 1DOXA 2KMAA 3C5GA 1L3SA 4JE3B 1KW4A 8ICXA 1SE4A 5ALTA 3JPRA 3QCAA 5KFPA 3ISCA 1XU4A 3PSTA 2D3CA 4YWGG 4F93B 3RNFC 2DAFA 2F1IA 2K4IA 4NJ7A 4GLXA 3Q8MA 2VH2A 2LJIA 3LDAA 4RH6A 4AP4C 3VDZA 5D4BA 2PKOA 2N1WA 1EXNA 2DUYA 4ED1A 2WB1F 9ICAA 1TIFA 5IINA 2CPRA 1SKWA 1IYFA 2L83A 3MP9A 3Q2AC 2RP5A 3ICXA 1HTQA 1SB3C 4IM3A 2ZUCA 5CB1A 3H8HA 2P6UA 5J0OA 5KFTA 5KHQA 3MFHA 3HW8A 1UELA 2D3GA 1PUTA 3RMKC 1T8EA 4FS2A 3TI0A 4KX3A 5L1IA 2GB1A 3GIKA 1I35A 2NYVA 4AOFA 2GBKA 4RQ0A 2B6GA 2A4ZA 1T0SC 3RR7A 2BDUA 2AQ1B 1JCKB 4BOSC 3TAPA 1S10A 3Q8FA 1LGRA 4JV2A 4MEYA 4MT5A 1J97A 2FCNA 4A8EA 3EA6A 2NRWA 3SQIA 4P1CC 3DWGC 3ZJVA 1N62A 2G5IB 4UW9A 1ZP0B 3DVGX 1WGRA 9ICIA 3QNMA 1F2RI 1NDDA 4LZDA 1FXIA 4O3SA 2BKFA 2ODGA 3AEGB 1TS4A 2G0AA 2YX8A 2ZJAA 1ZOLA 3M6KA 1GC7A 2YQEA 3C29A 1FCLA 1BNPA 4ZYNA 3HKZC 3C23A 4F3OA 4D2KA 2C7MB 2XGPA 3MBYA 4DFJA 2UU7A 4OZCA 3AE7B 1TK5A 1FM0D 2JU6X 3JSVA 3AV8A 2GBNA 2KQ4X 4GN1A 5IO9A 1SJED 2ZIUB 3DQVA 2BBCA 2PEAA 3AL0B 2GWSA 4AJWA 2QJLA 4QIWF 2ZXHA 5HHIA 4EFOA 3VAWA 3WK7A 3T5LA 1V81A 2KLCA 3IHQB 5AM3A 3ZD8A 4DSKA 1ZQKA 1NOMA 8ICEA 1EWCA 3I9V1 4OZAA 2F8KA 3HHMA 2HDOA 5AKKA 5AIBA 4NLGA 4W9EA 2WTFA 3MR3A 4PL1A 1VJ5A 2YB1A 2LD9A 4A3OA 2LRWA 4DXAB 4KLDA 2EDUA 3QZ8A 1QH9A 5D6JB 2FUG1 4HWIB 1ZRMA 3PV8A 4ELTA 2MBBB 2LVQA 4WWNA 2FE8A 2CXYA 3JPOA 3D2QA 4LNNA 4QZEA 3I1YA 2R8GA 2J6UA 1S5LU 4QNLA 3GZFA 4KMOB 4I27A 1ZQIA 2VJ4A 2NBVB 4EENA 2P35A 2V4QA 1CEZA 1DGSA 2ZCBA 2WF9A 2B3AA 5J2BA 1UQVA 2KJ5A 4NLBA 2TSSA 2ZIXA 1EU4A 2KC2A 2UVRA 2MAXA 5IIMA 5EWFA 3MGIA 2L00B 3RNEC 2WGSA 3SD7A 2RRDA 2E8PA 1EF5A 4F2SA 5IN7A 4FJVB 3NVWA 4YXMA 1NK8A 3E9SA 3L0WB 2RDIA 4PS7A 4PHDA 3FILA 1LKYA 1ZQJA 1SIFA 4R64A 4Y2QA 5J0WA 2R18A 5J0UA 1TT5B 3W5UB 5KFSA 2QHOA 1ZXHA 4ARIA 5HKHA 5EE9A 4LNKA 7ICGA 3GE8C 4RQ8A 2JMGA 1ZQYA 2RDHA 4YR3A 2QILA 5ALOA 4M47A 1RXWA 1YIWA 2LM1A 2K39A 3KKAC 2MH7A 3PT2B 3BVMA 2LRUA 2KOBA 3ZRFA 1NJZA 4ED2A 2HHVA 1BUIC 2GOWA 2IPKD 1N63A 1ZD2P 2KNJA 2G3QB 4UAVA 3MR6A 4PL2A 4OCZA 1KRPA 2PFPA 2Y5CA 2K8AA 2W8KA 2X38A 3G6VA 4Q8FA 2KFKA 2QARA 1X9SA 4J9SA 2B21A 1Z2MA 1PVPA 3O13A 5DB9A 4RQMA 3S2AA 4R8UB 1TS5A 4JMUA 3AEFB 1R4MI 2OYYA 5C1ZA 2D07B 4UAUA 2ALZA 3EC8A 1WXVA 4Y2VA 5KFJA 2VA8A 2WLBA 3V7JA 4B9LA 2D3DA 3Q3MC 4HKZE 3RI7C 5AKXA 4ECZA 2NBUA 4ZHOA 3D32A 3ETRA 4I29A 2KSOA 5DQGA 3PVLA 3C2LA 1KEJA 4M8NA 2H5XA 2GBJA 2FDRA 5C2TB 1I4XA 2BTEA 2W11A 1VR9A 1TFRA 2GBRA 3O65B 2KDFB 4WJOA 4GXBA 1WRIA 2HDEA 4DF4A 3GILA 1B43A 1WGKA 4K7SA 4EYIB 1L6UA 4DFPA 2IY1B 1E5WA 4PT5A 4I2BA 1ZW7A 4BWMA 4J9PA 5KFCA 3F5AA 5J8YA 4FADA 2J42A 4HRSA 1Z19A 3RTVA 3ZNGC 2AWTA 3OGUA 4TQ1A 3R7RA 4J3OD 4OJ6A 1XNSA 1GB4A 4KZ0A 3RB6A 3RB3A 1IG6A 3NVZA 2C2DA 3CSFA 2KICA 3BJYA 1ZD5A 1ZQXA 4I2CA 3AB5A 1EWYC 4QZCA 3OSPA 3PHXB 4F5NA 2WXFA 3ZGZA 4IG7B 3TUOA 2ASQA 2JRIB 1ZQUA 5KFMA 5ALQA 4EZ9A 3A1QB 3BVGA 1COOA 1PK1A 5DB7A 2L52A 2XNAC 4GFJA 1KH0A 5LXHA 4IS7A 3B0AA 4RT2A 4OZBA 3PO4A 3ZDAA 1F44A 3N7RC 3CF6E 3DHGC 1FCCC 2KJRA 1GOZA 2M8SA 4PJ0U 4NAMA 2K25A 4TSSA 3PX0A 1G6JA 4M0WB 2W3SA 3BS5B 1P98A 2JZBA 1L5PA 2EZXA 2HHWA 2G4SA 1QF6A 3EZ5A 4II2B 3B0YA 3P4QB 2WDTB 1V9PA 2IGDA 4ECTA 1KBUA 4MM3B 8ICAA 4HCPB 1P7DA 1YN5A 3KHLA 3PMNA 3URYA 1FEHA 2BVCA 2VKQA 4WURA 3QUQA 4MF8A 4WWPA 2RQ5A 2ZUBA 4YD1A 5JTIA 4F8RA 2MBHA 4CYEA 4YSXB 2CRXA 5AK4A 2Z8LA 5AKIA 2ACZB 1KFTA 2XK5B 3V7KA 4QZ9A 1AW7A 4ECQA 1RYRA 1SE9A 2DBYA 3TFRA 2LBOA 3OJSA 4ELVA 3ORYA 2JZZA 3AUOA 3PW2A 2WHIA 4ECVA 7ICOA 5C23A 3HX0A 4B9VA 5KFEA 8ICTA 5T14A 4P0QA 4FS1A 3O0FA 1LFDA 3EECA 3RF9A 2JZ3B 4B9UA 4ICAA 1XXGA 1NK7A 4MFFA 2K4PA 9ICLA 3RZFA 5ALJA 3N4MB 1ACCA 2FIFA 1E10A 7ICFA 1IV8A 3HK0A 2ZTDA 4YCXA 1JWMD 5TZVA 1KTKA 5IKCM 1SIJA 4UAYA 1XLOA 3WU2U 3E2EA 3UMCA 4C8NA 4OHJA 4W9KA 3UM9A 2LUEA 2W7OA 3ZTDA 2H3IA 1E9MA 5DBBA 3RB4A 2QEJC 3HM3A 4DXGA 2ATLA 2ICIA 1L4DB 8ICGA 3GU3A 3AECB 3ML9A 3C19A 5ALRA 2PW9A 3Q8SB 4NAWB 3AEBB 1CQVA 4TUSA 5CX3A 3A9KB 4KKIA 5LLIA 1S9FA 2JWZA 2MU2A 1D3ZA 3QUCA 2CJOA 3R2TA 2UYZB 2Y3AA 1X2IA 2ZPYA 3K9OB 4M6WA 3OWEB 1SV0C 3EUB2 2JT4B 2OCEA 3DBLB 3WA0A 1FNVA 4AS1A 2ZIVA 5CA7A 4GXJA 4BDPA 3HKZF 1XC9A 3KHHA 1RM6C 1Q10A 2ZJDA 4C8OA 4QZGA 1A76A 2LPEA 2KDMA 3B2GA 3AMZA 2LXAA 3QA8A 3DOWA 5A0LA 2NPTB 4J9QA 4B9TA 4YR2A 2XCAA 1R4NB 3BY4B 3C8YA 1V85A 5KFLA 3ALBA 4MDKE 3ZKJC 7ICNA 2KJ6A 3W5VB 2MUTA 1MPEA 1YQ3B 3GZNI 5IAAC 2PJHA 1RZTA 3UGBB 3RJIA 3V6CB 4O3OA 1YN3A 4DF8A 3H7PB 2G07A 4TQ0A 4KZCA 4M04A 1CMXB 3TJPA 1NYQA 2FLLA 4YXJA 4KN7A 3D2NA 2L76A 4YD2A 2WXLA 5AUKA 3ZJTA 1E90A 1L0VB 2LGYA 1V5OA 2J7QB 4IQUA 1L5UA 5JXVA 2FPKA 3TBLD 2HOQA 2C2EA 2W9BA 1V97A 4B9MA 2LMCA 4YTMB 5IIKA 1IPGA 1HEZE 1QOAA 2OH2A 4KLJA 2M19A 4XWWA 3UQ2A 1Z1VA 4UARA 1JXLA 3DEEA 4EX6A 2CKHB 3BQ1A 5GXGB 5T8IA 3SZ2A 1SV0A 4K4HA 1A5RA 3AEVA 5AI9A 2BCVA 1VRAB 2LZ6A 3W2DA 1BPDA 4DL6A 3KQ4A 3QUTA 1MA7A 1C1YB 3CYMA 1YJJA 2NRTA 3Q3JA 2OM6A 4B6WA 3FYHA 4DSFA 2I6XA 2O2VB 4GIBA 1NENB 1RFKA 2BB5A 4MEXA 2DAJA 2R8HA 7ICVA 4MH0E 1KN5A 1J2NA 1TTNA 1U9LA 4ANVA 2VH1A 2C5LC 3ZNID 1V1PB 3VHTC 4U7CA 1ZD3A 4WJPA 3SV4A 3PX6A 4LVSA 1WWVA 3PTFC 2M1MA 3OAWA 1PQSA 1MN8A 3ZDEA 4BOZB 2GLSA 3JPNA 4YT0B 2DL0A 2W55A 3CW2C 4O3PA 2KMMA 3A4RA 5DQIA 3PV1A 4HEA1 1TZ1A 1SE3A 1X9XA 4RT3A 2UWQA 3ETLA 1Q8KA 3IAS1 3Q3NC 4FJZA 1QQRA 3A4SC 4QWBA 4MJSB 3UXNA 4ZRKA 3PO0A 3K1RB 1PVRA 1C20A 5HG2A 3RJEA 1RQLA 1DK2A 3APFA 3KFUF 5AKLA 5KG3A 2W04A 1BVSA 3AE4B 2E8MA 2JEGA 4OJOA 1QKZA 2YVCA 5ALVA 1NK0A 2MRLA 3HILA 2ZIUA 1MHHE 2ZG6A 2N1RA 4KSKC 3QX1A 4DHJB 5KFGA 2LGXA 1E6EB 5J2HA 1K53A 3EFUA 8ICLA 2IY0B 5KT3A 2KWDA 2PMVA 2WQYB 9ICVA 2Y5PA 4IWPA 4Q43A 1JW9D 1A70A 2M0NA 5ALMA 4I28A 3GV8B 2KYWA 2L7RA 4RF1A 3DVGY 1ZQPA 4I2GA 4NJ6A 4HLEA 9ICFA 3L16A 1RDFA 3SI8A 2KKCA 2PE9A 1YX5B 2MLBA 1NZPA 3RBDA 4NQLB 9ICBA 5B5EU 2JWUA 1K1SA 2NRZA 2BS4B 3WANA 3LWLA 1FRDA 3C0RB 3EYZA 5J29A 3BIID 2XY6A 2ZNVC 4KKJA 1IP9A 2LYBA 5CEHA 1SKRA 2MJ3A 3QC8B 4HCNB 4C8LA 2LHTA 8ICCA 2J0MA 2N9XA 2MBOA 4KGSA 2G4DB 4CHKA 3QZ7A 2KKVA 2ASLA 3QJZA 1WWTA 1IBXB 4TURA 3APCA 2FMPA 1GG3A 2N0SB 3LDZE 7ICQA 4Y2XA 2RLTA 2NTTA 5HHHA 5ALIA 3OTQA 4DL3A 1RQNA 1EU3A 2PPHA 4FHJA 1UBQA 4ASWC 3MABA 1C4PA 5D46A 3RD2A 3OPXA 3H8MA 2D3AA 2KHWB 3R8BA 2L5YA 2Y9TA 1N5XA 2JEIA 3N1XC 3NJTA 3M7DA 2LHEA 5E6PA 3BQTA 2N7EA 4DOCA 3OJ3A 4Y2TA 3MDAA 1FXTB 3DBHB 1J7CA 3U4EG 2C7HA 3QK0A 1EF1A 4BVUC 3RNBC 3TCAA 3IG3A 3ZJUA 1F0MA 1MC8A 4USAA 2HHUA 3AE9B 2KDEB 3ABVB 3B2FA 1QOFA 5D49A 1T0YA 2KNBA 1RAXA 2K9XA 2WX0A 5KFNA 7ICPA 4K81A 2WP9B 2EZYA 3ED5A 4AUQC 5KFFA 1HIWA 1X9MA 4RCOA 2J52A 3RR8A 2R61A 4LLGM 2V3PA 3MR2A 2H3FA 2IDYA 4FE3A 2C22A 4YL8A 5TSSA 4YMMA 3ISBA 1WSPA 2VANA 1BPEA 4HK2A 2KLGA 1T0QC 1UGMA 3HPOA 1WXQA 4FO6A 4RGOS 2H3ZA 1RG6A 3KOOA 1B22A 3H9DA 2KJHB 5AI8A 2LGIA 2KIVA 2LKYA 2PKEA 1VLBA 2HHQA 4ZHPA 4DHJD 5DPRA 1J7AA 1BXTA 1QOBA 2QKQA 4EEKA 3H4DA 2HHTA 2HVHA 1E8YA 4C7YA 1GAQB 1RLFA 2DYMA 2WAQC 1WWUA 2IOHA 9ICJA 3AE1B 3U7DA 3V6KA 4W9JA 3CNHA 2V3SA 4NY8A 4QW8A 3QU9A 1GB1A 3RNGC 3S6JA 5DB6A 4ECRA 4DXFA 4FZLA 4KLIA 2N9LA 5J2AA 3KUDB 2IHMA 1UF0A 1YN4A 7ICKA 4FFDA 1TBEA 3ZYYX 5LNK1 4ACFA 5ALPA 5KG6A 4KLUA 1ZQQA 2V4IB 1Q5WB 3RJFA 1AQ6A 3VXWA 2F3NA 5BOMA 5AICA 2JXJA 3A1QA 3CSTA 2WXIA 3I63C 2BCSA 3RT3B 3TSSA 3OJ4B 4P0PB 2ZW0A 4DL7A 1LXDA 3AU5A 2JEFA 5KG7A 1HA5A 4WAFA 3U52E 5KT4A 2KEYA 2M56B 1I4PA 2FUHB 2FE9A 3SEIA 1LVHA 2HOIA 4YG2A 5J0XA 1L3TA 2INPE 5DB8A 2RMMA 1QCKA 3U26A 4DL5A 2MBQA 2WFAA 2LHDA 4LZGA 4M0WA 4DLGA 3MHSD 3U8ZA 4K3CA 3KHRA 3ZDDA 2KP7A 2G08A 2QLTA 1IGDA 3BQ0A 2K8HA 1GO3F 1O03A 4QAYA 1VZ8A 2RPVA 1V8CA 3ZNZB 2N9EB 4F4KA 2Y5BB 4ICUA 1L8OA 3R3MA 2BGWA 2J53A 8ICNA 3F5EA 1NYRA 2LMRA 1SF0A 3RB0A 4MM3A 3KYCD 2WF8A 5FR6A 4Q8EA 1KFYB 2WF7A 4WJNA 2I38A 5H8YE 2CHWA 3OHBA 1TJEA 1RYSA 4QZDA 1YQ4B 3SAFA 1L6NA 5D2MB 2A5UA 4I2FA 3ALRA 5KFRA 2K3UA 1ZDVA 3UINB 2I2YA 2D8CA 2XK5A 3L10B 1Z1BA 4ZYSA 1BPBA 3H0LB 4JV0A 1S0MA 4RNAA 1IM4A 4IDIA 1QSSA 4F4WA 3HRDD 2KXJA 5HP4A 1D5XC 1WYGA 3QEBZ 1V5TA 3WK5A 5DKWA 3PMLA 1TY0A 2HSZA 1RRBA 2WU2B 2G45B 2KVRA 3K1ZA 5EWEA 1GUAB 1WXSA 3V6EB 1B4FA 2P6RA 3VTUA 1B1ZA 3MC0B 4C56C 1RPLA 4F5QA 5G5HA 1ZQRA 4RFBA 4W9FA 5BOLA 5J0RA 2W9NA 4XA5A 5EE3A 3TEXA 3G6XA 1I4HA 2ASJA 3V60A 4O3MA 1XD3B 1HUZA 2QDFA 2R8JA 2KD1A 2DENB 3QEAZ 1IUEA 2HMXA 1YQBA 3GOEA 4JWUC 5L83A 3FM9A 4O0IA 1XEEA 1FD6A 2V9WA 4ZH4A 4KSLC 1X40A 1OQRA 5MPOA 2H3VA 5AI4A 1VZ7A 2J6SA 3SFDB 2WDVB 1TAQA 5H92C 5BYSA 2LVOA 1T3QA 5KFQA 1YX6B 3ENEA 4F4XA 2RDBC 5K4LA 2W43A 1N48A 4BXOB 3A9KA 3K75D 1L8LA 4QZAA 3AQEA 1NZBA 1Z00B 5HMMA 1ZQVA 2QC8A 2V4LA 4Y2SA 3DPDA 2OJWA 1RYJA 2JXTA 3Q3FA 4BAXA 4HYKA 1UNSA 4ZOHC 4DFMA 2KX3A 2N9PC 3JW0X 5IA7A 5LXIB 5DBCA 2PFOA 1LB2B 3NTUA 1L3VA 3P63A 4CQNA 2NPTA 2XY7A 4IM2A 4QZ8A 4YSZB 1HE8A 4YMOA 8ICYA 4GOCA 4FULA 4TUQA 2BQRA 2KQ7A 3WK4A 2Y1JA 4UDUC 3T3OA 3ZDTA 3E58A 1UPHA 3C1YA 4Q45A 4FLHA 2MRPA 2J4XA 2Q0ZX 1ZOYB 2A1AA 4QWDA 3EHVA 3H7PA 1KQQA 3PZPA 4EBDA 2YN4A 4EX7A 1WCNA 1SWVA 2P66A 4K3BA 3ZXRA 4NWIA 2KV2A 1AARA 2W7PA 1RXVA 5IIJA 1SGGA 3C2MA 1XSLA 4O1NA 5D3IB 1VJKA 4ECXA 5J0PA 2K8CB 4MACA 2I1JA 1DOQA 4GB9A 5J8YC 3UQAA 3N28A 3QU2A 2FCSA 3NVYA 3LXFA 3AEAB 3TQ1A 2L05A 2NS5A 1KFDA 4OJ5A 3W1SA 4F4YA 4KGTA 3V62A 1XWLA 4LTUA 1NKCA 3QAQA 5B66U 4JQWC 2ZZPB 2KTRB 3T5HA 1Q3VA 4C0ZA 1ZQFA 4FN2A 3B1LX 3C1ZA 3ZDMC 1U45A 1JMLA 1GPXA 1JRPA 3VC8A 1P0RA 1F1HA 3X23A 4M9NA 4NM2A 1J7BA 1WE6A 4KVGB 4RU9A 3IV6A 3KWLA 2W9CB 3NY5A 2XC9A 1ZPSA 2EANA 4NLZA 4BKTA 3H7SA 5KG1A 1C7YA 1JWUD 2KFJA 1FPYA 2BPSA 1Q46A 1NJWA 4M00A 2K22A 2RPQA 4UB6U 1C76A 4W9CA 2OEHA 3L54A 2Y0SF 1D8YA 7ICLA 5F9LA 1XO0A 2VA3A 4MJSA 1JN3A 1ZYQA 2LGSA 1TKYA 1XCQL 4W9HA 2HHSA 2DFLA 3PHWB 4RGMA 1PZNA 2Z0EB 4UAWA 3L08A 2PI4A 4MH8A 1V9JA 4S0RA 5FKAC 4F72A 3N7SC 3IBEA 5KFYA 2PVGC 5EDSA 4F71A 3RJGA 4U6PA 2NRVA 4M9LA 1FXAA 4F50A 2C60A 2IBIB 3IG8A 4XQ8A 2BDPA 1KJTA 2PFNA 5J0QA 3IM1A 2MBEA 1ZQLA 1S76D 1MVKA 3DDHA 3LVVA 2GBMA 3M3JA 3U30A 2ZIWB 3SAGA 2IZVB 2A1JB 5J2IA 4M0AA 2LYAA 4TUPA 5DPSA 5FK9C 2LI5A 3M1YA 4JWSC 4HXDA 4G9BA 3B9JA 5DG8A 4P2HA 4MGKE 2JEJA 1XO1A 4C80A 4MGIE 3M63B 4B0EA 2ES6A 4UB4A 2DGZA 2ONQA 5AM4A 3OLMD 4IW0A 2KJ8A 4OVUA 2XN9C 1ISNA 4WIPA 1P3QU 1QSLA 4KDLB 3HIZA 4Z6DA 4GIVA 4NXZA 1H4RA 2BWFA 5BPCA 3BZCA 1TVAA 2M17A 3PS6A 1WJ4A 2EELA 2W3RA 1S97A 1QSYA 1AYFA 3WAPA 3AE2B 2HVIA 1TKEA 5KFOA 3QWZB 2C2RA 1S3SG 3DBRB 3KZXA 5DQHA 2GMIC 2BYEA 1TYGB 2KVCA 1TK0A 2ZPNA 2CN1A 3C28A 5CP2A 3AEDB 1KTQA 2BS2B 1Y56A 3J9CA
chains in the Genus database with same CATH topology
4A9AA 3V3XA 1V1PB 1D5ZC 1MHXA 5D7GA 2LFIA 3GS2A 1FIQA 2D5GA 2WXGA 3VRAB 3IT4B 2VZKB 2SEBD 4US9A 4YT0B 2W55A 2KMMA 4HEA1 4C7ZA 2JX5A 2L1AA 1SE3A 1TZOA 5EE1A 5AUIA 3IAS1 1QQRA 3TEWA 2WXQA 3PO0A 4IKGA 2V0GA 5HG2A 2QMTA 2L32A 4OW0A 2E3TA 4L1BA 2JZPA 1SBBB 2HTME 3AE4B 1QKZA 1TY2A 3KWVA 4H2AA 1CZPA 1HQRD 1MHHE 1STEA 1I4QA 2QIEB 1FNWA 1RFKA 1M4VA 1E6EB 2WXKA 1K53A 1L6VA 3TEZA 1DOXA 3NZ3A 2MJDA 2KWDA 4JE3B 2PMVA 1YJIA 2WQYB 5HHDG 1SE4A 2Y5PA 1UUPA 3AE8B 3KLSX 3Q8EA 2V3NA 1JW9D 1A70A 3Q8BA 1FFUA 3NRZA 2E6XA 1ZUD2 1YNTE 3WCQA 4RF1A 4YWGG 4R3DA 5HFYA 1V1PA 3AH7A 3LYYA 2LJIA 4RH6A 1ZXIA 1I4RA 2SAKA 2PKOA 3ZQ4A 2JWUA 2CU3A 3Q8CA 4YTPB 1SSNA 3GP7A 3VR8B 1FRRA 2BS4B 1HXYD 4P6VF 3BYYB 2L83A 3MP9A 1FRDA 5E6JA 3TEYA 1SB3C 3BIID 2K0PA 2WXRA 4KKJA 3BWUD 4NJCA 3H8HA 1FNUA 2MJ3A 3E56A 1PUTA 1CK1A 1PDXA 2GB1A 1JALA 4KGSA 5BYRA 2PLPA 3AE6B 2DLBA 1WWTA 1IBXB 2OEDA 2AQ1B 1JCKB 2N0SB 2KACA 2NMQA 3Q8FA 2NTTA 4MT5A 1P7FA 1D6EC 1EU3A 3EA6A 2GI9A 3DWGC 1C4PA 3ZJVA 1N62A 1ZP0B 3R8BA 1F2RI 4L2YA 4RGTA 1N5XA 3I57A 3BZDB 2LHEA 1FXIA 1OQQA 3AEGB 3J9CA 5EE0A 4B0MA 1TS4A 4AQ7A 1J7CA 3U4EG 1FCLA 2M0AA 1C77A 1KLGD 3ZJUA 2N9KA 4D2KA 4USAA 1ZE3D 2MEKA 4OZCA 3AE7B 1YMHE 1JWAD 3AE9B 1FM0D 2JU6X 3ABVB 3B2FA 3AV8A 2KQ4X 1QOFA 5HI1A 1SJED 2IGHA 2K9XA 2BBCA 2WP9B 2VZKD 2QJLA 2AQ3B 3P4SB 4RCOA 4ZRQA 2J52A 4A6QA 2R61A 4LLGM 4N59A 2LUMA 2V3PA 1DGJA 2WXPA 1EWCA 4ZRPA 2IDYA 1TKGA 3I9V1 4OZAA 4DQOC 5TSSA 1WSPA 1C79A 4IOIE 1IBXA 2DYOA 2Q5WD 2FUG1 1WXQA 4RGOS 2FE8A 5D3DA 2LGIA 1VLBA 4ZHPA 5C3JB 2DWQA 4FXCA 4L23A 1J7AA 1BXTA 1QOBA 2JSVX 4C7YA 1GAQB 3AE5B 3PZ7A 2DYMA 3AE1B 5BYQA 1B9RA 2TSSA 3NUHB 1EU4A 1GB1A 1XCTL 2OHFA 2JQRB 3VR9B 4DXFA 1K50A 2N9LA 1PGXA 4A55A 2BYTA 1YN4A 1FO4A 1SEBD 3NVWA 3E9SA 3ZYYX 5LNK1 2ON8A 1MI0A 2BB6A 4GDLB 3FILA 2V4IB 3W5UB 2BT6A 1ZXHA 1CJEA 1C4CA 1PGAA 2WXIA 4ARIA 4HKQA 5EE9A 1HZ5A 3TSSA 3AEEB 1ENFA 2ZW0A 3SR6A 2RDHA 1HA5A 4WAFA 3U52E 2QILA 3SEBA 1JQ4A 1ZDXA 3MHZA 2M56B 4RF0A 1I4PA 1TS2A 2MH7A 1XLNA 3BVMA 2IGGA 2INPE 1BUIC 2IPKD 2WXMA 1P7EA 2RMMA 2G1EA 1N63A 1NEKB 3CWIA 3VRBB 1QILA 1PFDA 2LHDA 2WS3B 1UWXA 2Y5CA 4M0WA 1N5WA 3V05A 1D4BA 1V1OA 3U7ZA 2X38A 3P1MA 1IGDA 3LB8C 2CJNA 4REZA 1VZ8A 2RPVA 1V8CA 3O13A 2J53A 1TS5A 3AEFB 1NYRA 1SF0A 1KFYB 5H8YE 1DYQA 2I38A 2WLBA 3W9CB 1TJEA 1YQ4B 1VDVA 4HKZE 2WDRB 2AX5A 4ZHOA 3ETRA 3MJ5A 2K3UA 2PVOD 2QSDA 3EGRA 1JWSD 1ET6A 1ZDVA 5C2TB 2I2YA 1I4XA 2WXHA 4ZYSA 2BTEA 1VR9A 4YSYB 1JWBD 4JPSA 4RNAA 4IDIA 4WQMA 1R7SA 3HRDD 2KAJA 1E0ZA 1D5XC 1WRIA 1WYGA 2HDEA 3MFGA 1WGKA 4N6EB 1L6UA 1TY0A 4PT5A 2WU2B 2WXNA 1VZ6A 1E7PB 1B1ZA 2J42A 3MC0B 4C56C 4HRSA 5G5HA 2EKIA 1SJHD 4RFBA 1EM7A 4TQ1A 4J3OD 1GB4A 5EE3A 1T6BX 3TEXA 3NVZA 1I4HA 5BMHA 3AB5A 1EWYC 3P4PB 1IUEA 4JWUC 2WXFA 3ZGZA 3TUOA 3FILB 4GDKB 1XEEA 1XF5L 1FD6A 3IXSA 1OQRA 5MPOA 3BVGA 4LK0M 1VZ7A 3SFDB 2WDVB 5H92C 5BYSA 1T3QA 2H88B 2L52A 3Q69A 2XNAC 1KH0A 1KRHA 2G9HD 4OZBA 4EE2A 4WH4A 2PTLA 1FCCC 1GOZA 1NI3A 1RYJA 2JXTA 1NVID 4NAMA 1QOGA 2BW2A 4TSSA 2W3SA 1UNSA 4ZOHC 2GRIA 1QT9A 1AN8A 1L5PA 2NTSA 2JYEA 4CQNA 2AQ2B 3P63A 1LO5D 2YEPF 4XDCA 1QF6A 1I4GA 3AE3B 3N9YC 4YSZB 1IGCA 3Q8AA 3P4QB 1HZ6A 2IGDA 4RGNA 1N61A 1T5XD 4MM3B 4UDUC 3T3OA 5BMIA 1YN5A 3URYA 1FEHA 4WURA 2LEKA 4Q2JA 2RDGA 1L0YB 2J4XA 5FR3A 1JROA 2INNE 1ZOYB 3DWMA 4YSXB 1F77A 3UI3A 3PZ8A 2Z8LA 4XWTA 1KLUD 2ACZB 1AW7A 2WU5B 1I7HA 2IJ0A 3FC4A 2DBYA 4US8A 4O1NA 3AN1A 5D3IB 1VJKA 2KN4A 4WWMA 4KGRA 1ESFA 1UGJA 4MACA 1F2RC 1XLQA 4HROA 1C4AA 1FFVA 3NVYA 1XXGA 3AEAB 3LXFA 1K51A 1KF6B 3W1SA 4KGTA 5G5GA 1XLPA 1ACCA 1FMAD 2YEPB 3GB1A 4JX1C 4LTUA 1D5MC 1E10A 2H89B 1BMLC 1JWMD 1KTKA 3RFZB 2WDQB 1SIJA 3HUIA 4TMAB 4A8XC 2WXJA 3IAM1 3R2IA 1XLOA 4OHJA 1GPXA 1JMLA 1JRPA 1SE2A 1E9MA 2QEJC 1J7BA 3RPFC 4DXGA 3KWLA 2ICIA 1L4DB 1SXTA 1ZPSA 1N60A 3AECB 2PW9A 1QLBB 4NAWB 3L4PA 3AEBB 1CQVA 1JWUD 1L0XB 4KKIA 3IT6B 3R2TA 2CJOA 2N7JA 2K22A 2Y3AA 2WXOA 1C76A 1K52A 3T3NA 1F0ZA 3OWEB 3EUB2 4AS1A 1ET9A 4GLSC 1FNVA 3P4RB 3BYTB 3FAHA 1Q10A 1RM6C 1TKYA 1XCQL 2W82A 2KDMA 3B2GA 4RGMA 2BS3B 3AMZA 4MH8A 5FKAC 3BVZA 2PVGC 1UWMA 2MJEA 3C8YA 3VQIA 1FXAA 1DOIA 4KX6B 1MVKA 2WNMA 3BK1A 3W5VB 1C9FA 2K5PA 1MPEA 1YQ3B 3CIRB 3HVZA 5FK9C 4JWSC 1PGBA 1YN3A 3B9JA 5BMGA 4TQ0A 1AWDA 2JYTA 4NZLB 4C80A 1NYQA 3SFEB 4B0EA 1C78A 4XDDA 3NS1A 2WXLA 3U2SC 5AUKA 3ZJTA 1L0VB 1OFFA 2ONQA 3P42A 3NVVA 2W54A 4N58A 4A90A 2XN9C 4YXDB 4WIPA 5JXVA 4XE0A 2LMCA 1V97A 4YTMB 4ARCA 3HVDA 1TS3A 1HEZE 1QOAA 2M19A 4ITKA 4XWWA 4YTNB 1PYWD 1L4ZB 1ROEA 2EELA 4HJGE 2W3RA 1AYFA 2FBWB 3AE2B 5GXGB 5T8IA 1TKEA 2PIAA 1VRAB 3BK2A 3W2DA 5I4DA 1TYGB 1XO3A 3KQ4A 2ZW1A 1RWSA 3AM9A 3AEDB 1YJJA 2BS2B 4P16A 4OVZA 1Y56A 1DOYA 2B76B 1NENB 2BB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJE A;  1YQ4 B;  1J7C A;  1XLQ A;  1VDV A;  4HRO A;  4A9A A;  2WDR B;  2AX5 A;  3VRB B;  4ZHO A;  3ETR A;  1FFV A;  2PVO D;  4USA A;  3NVY A;  3LXF A;  3AEA B;  3AE7 B;  1FIQ A;  5C2T B;  1JWA D;  3AE9 B;  1FM0 D;  1KF6 B;  3ABV B;  3B2F A;  3AV8 A;  3VRA B;  1QOF A;  5G5G A;  4YSY B;  1JWB D;  1XLP A;  1FMA D;  2K9X A;  4LTU A;  4US9 A;  4IDI A;  2W55 A;  2KMM A;  4JX1 C;  2WP9 B;  4C7Z A;  2H89 B;  4WQM A;  1R7S A;  3HRD D;  2JX5 A;  2QJL A;  2WDQ B;  1SIJ A;  2KAJ A;  3HUI A;  1WRI A;  3P4S B;  1WYG A;  5EE1 A;  1XLO A;  5AUI A;  1E0Z A;  1WGK A;  4N59 A;  1DGJ A;  4N6E B;  1GPX A;  1L6U A;  1JRP A;  2WU2 B;  1E9M A;  3PO0 A;  1TKG A;  1J7B A;  3RPF C;  1E7P B;  3KWL A;  1N60 A;  2E3T A;  5G5H A;  3AEC B;  4HRS A;  1QLB B;  2HTM E;  3AE4 B;  2EKI A;  2Q5W D;  3L4P A;  3AEB B;  1WXQ A;  1CZP A;  5EE3 A;  2QIE B;  2CJO A;  3NVZ A;  2K22 A;  1F0Z A;  1E6E B;  1VLB A;  4ZHP A;  3EUB 2;  2DWQ A;  4FXC A;  5C3J B;  3AB5 A;  1EWY C;  1J7A A;  1L6V A;  3P4P B;  1IUE A;  1QOB A;  3P4R B;  4JWU C;  1DOX A;  4C7Y A;  2MJD A;  1GAQ B;  3AE5 B;  3FAH A;  1YJI A;  1RM6 C;  2WQY B;  3AE8 B;  1TKY A;  1OQR A;  1JW9 D;  3AE1 B;  3B2G A;  1A70 A;  5MPO A;  1B9R A;  1FFU A;  3NRZ A;  1ZUD 2;  2WDV B;  2BS3 B;  5H92 C;  3AMZ A;  3SFD B;  1T3Q A;  3WCQ A;  2H88 B;  2L52 A;  4YT0 B;  2PVG C;  1KRH A;  1UWM A;  2OHF A;  3W9C B;  2MJE A;  2JQR B;  3AH7 A;  1FXA A;  3VR9 B;  1DOI A;  1DOY A;  4KX6 B;  1FO4 A;  1ZXI A;  1NI3 A;  1RYJ A;  3NVW A;  1NVI D;  3W5V B;  3ZYY X;  1QOG A;  2K5P A;  1YQ3 B;  2PKO A;  2W3S A;  3CIR B;  2CU3 A;  3HVZ A;  4YTP B;  4ZOH C;  4JWS C;  3VR8 B;  1FRR A;  2BS4 B;  3B9J A;  4P6V F;  3W5U B;  2BT6 A;  1QT9 A;  1AWD A;  1FRD A;  1L5P A;  2L83 A;  1CJE A;  5EE9 A;  4C80 A;  1NYQ A;  1SB3 C;  3P63 A;  3BII D;  3SFE B;  3AEE B;  1QF6 A;  3NS1 A;  3SR6 A;  3AE3 B;  4YSZ B;  2MJ3 A;  5AUK A;  1JQ4 A;  1L0V B;  3P4Q B;  1OFF A;  1PUT A;  2M56 B;  3NVV A;  2MH7 A;  2W54 A;  1N61 A;  1PDX A;  1XLN A;  4N58 A;  4YXD B;  1JAL A;  1V97 A;  2G1E A;  4YTM B;  1N63 A;  3AE6 B;  1NEK B;  3CWI A;  1QOA A;  1WWT A;  2M19 A;  2LEK A;  4ITK A;  1PFD A;  2WS3 B;  2Y5C A;  4YTN B;  1N5W A;  2N0S B;  1JRO A;  3DWM A;  1ZOY B;  4YSX B;  1ROE A;  2W3R A;  3P1M A;  1AYF A;  3LB8 C;  2FBW B;  3AE2 B;  2CJN A;  5GXG B;  2ACZ B;  1TKE A;  2PIA A;  3DWG C;  1V8C A;  1N62 A;  1ZP0 B;  2WU5 B;  1I7H A;  1TYG B;  1XO3 A;  3AEF B;  3FC4 A;  1E10 A;  2DBY A;  4US8 A;  1RWS A;  1NYR A;  1N5X A;  3AM9 A;  1SF0 A;  3AN1 A;  1YJJ A;  1VJK A;  3AED B;  1KFY B;  2BS2 B;  1FXI A;  1OQQ A;  4WWM A;  5H8Y E;  3AEG B;  5EE0 A;  2WLB A;  2B76 B;  1NEN B;  1RFK A; 
#chains in the Genus database with same CATH topology
 3DBL I;  1SL0 A;  2NCN A;  4A9A A;  3MTN B;  1ZD4 A;  1PVQ A;  3ZTC A;  5AZF A;  1L3U A;  2BHN A;  4OJL A;  5KFB A;  4C4S A;  4A20 A;  5D7G A;  2LFI A;  1TGZ B;  3ZIM A;  4QWC A;  8ICM A;  1SGH A;  3NOB A;  4DDI D;  3KYD D;  3VRA B;  4UB3 A;  2R2O A;  2HD5 B;  5KFU A;  2VZK B;  2SEB D;  4C7Z A;  1R4N I;  2WF5 A;  2L1A A;  2MX2 A;  3ONS A;  1TZO A;  1NI2 A;  4J9L A;  4KIK B;  1OGW A;  1U48 A;  2KVZ A;  7ICE A;  1UH6 A;  4J03 A;  2RGF A;  4G0N B;  4C4V B;  5AK6 A;  2KTQ A;  2AJQ A;  4HPL B;  1YJ1 A;  2QMT A;  2L32 A;  5AHX A;  2NO4 A;  4OW0 A;  3GE3 C;  3L17 A;  3ZDC A;  1URJ A;  4B9S A;  4E74 A;  1Z3E B;  1TY2 A;  5AZH A;  4KLL A;  3KWV A;  2KTF A;  4H2A A;  3TAR A;  3UXP A;  2UVW A;  4KLM A;  4W9L A;  1STE A;  1I4Q A;  3WK8 A;  2FCM A;  3LWM A;  7ICR A;  4RQN A;  4LNO A;  5TR5 A;  3SAH A;  3ISD A;  3LJ3 A;  3AU2 A;  3NZ3 A;  3DHH C;  5H2F U;  3GII A;  8ICO A;  2MJD A;  4I6L B;  2CHX A;  4PHP A;  5HHD G;  3R7Q A;  4A3P A;  1J0G A;  3RBE A;  3KLS X;  1UUP A;  2YMQ A;  3Q8E A;  7ICJ A;  1WYW B;  4CGZ A;  3RRG A;  1TE2 A;  1FFU A;  3C5F A;  1N56 A;  2KZ3 A;  2BPG A;  1EO6 A;  4KLS A;  2E6X A;  3WCQ A;  2K4H A;  1YD8 U;  2K89 A;  2IND C;  1QQ5 A;  1T4G A;  2FLN A;  4I2D A;  2XY5 A;  3I76 A;  3AH7 A;  2AEH A;  2AU0 A;  1Z4O A;  1SXD A;  2QB0 B;  4IR1 A;  1JIH A;  3TAD A;  1ZXI A;  3UMB A;  3EFC A;  2KQS A;  4ANU A;  5L95 C;  4WAA A;  2DZK A;  2CU3 A;  4ZRJ A;  3Q8C A;  4YTP B;  3Q8K A;  3JSV B;  3GP7 A;  3UQ0 A;  5CTR C;  5KG4 A;  1HXY D;  4P6V F;  4CO7 A;  3DHI C;  3CP8 A;  2AQ4 A;  2NVU I;  1ARO P;  2AGQ A;  2K0P A;  2WXR A;  1X66 A;  4NJC A;  1FNU A;  3UIO B;  3VH3 B;  3PR5 B;  5IP4 D;  4IWQ A;  4PK1 A;  3JYU A;  3ZNH B;  4F1S A;  1PDX A;  2I1Q A;  3PGE A;  2JV3 A;  5DG7 A;  4M02 A;  2JUO A;  2OED A;  2MCN B;  1NK5 A;  3DDC B;  1KLV A;  3ZVV A;  3R66 C;  3WKD A;  1ZQ1 C;  2BPF A;  3NAS A;  2NMQ A;  2KC1 A;  1D9F A;  4EOY A;  2C28 A;  4UBC A;  3TIX A;  4DQP A;  1D6E C;  2KZR A;  2W8L A;  2B0C A;  2EH9 A;  4NQK E;  4P0P A;  2Z7J A;  3DVN U;  5JHB A;  5KAF U;  4RNO A;  5J0Y A;  4C8K A;  1P9D U;  4L2Y A;  2AL6 A;  4RGT A;  2M0X A;  2KO3 A;  1BPX A;  4LDT B;  1MQ3 A;  4Z6F A;  1OQQ A;  5CHV C;  2BF8 B;  5EE0 A;  1WZ0 A;  4URK A;  2ZIX B;  4OD0 A;  2M0A A;  1XS9 D;  3L5K A;  3G6Y A;  1UT5 A;  4KV2 A;  1D8L A;  1SV4 A;  1C77 A;  1KLG D;  4BKS D;  3VVW B;  2BCU A;  1ZE3 D;  3QU7 A;  4TQS A;  1MJD A;  1JWA D;  2MQJ A;  9ICT A;  2HHX A;  4MSM B;  3N97 B;  5HI1 A;  2IGH A;  2CHZ A;  4CF5 A;  2K4E A;  3RNA C;  4O5C A;  2VZK D;  3H0M B;  1LKY B;  1ZQS A;  2AQ3 B;  2QB1 A;  8ICZ A;  4RUA A;  9ICW A;  5JH5 C;  4A6Q A;  4JUZ A;  3PW4 A;  2LUM A;  1S0V A;  2HJ1 A;  2WXP A;  3OSN A;  5J17 A;  2L0F A;  3Q8L A;  1H38 A;  9ICH A;  4CF4 A;  4IOI E;  3SYZ A;  3M9O B;  1Y88 A;  4J9O A;  2Q5W D;  3QX7 A;  1JX4 A;  1S1Q B;  1V86 A;  9ICX A;  5GTH U;  1E7U A;  4RQ3 A;  4P4P A;  1KDH A;  3DV9 A;  4DHZ E;  3HWT A;  5D3D A;  4O5K A;  4YVZ A;  4EBE A;  4C4R A;  8ICR A;  2DWQ A;  4MEL A;  4L23 A;  5C3J B;  1WRD B;  1I42 A;  5CHG A;  2XCP A;  8ICW A;  3V72 A;  4WJQ A;  4I2J A;  1ZQB A;  1WX7 A;  1B9R A;  3B0X A;  5KT5 A;  4RNM A;  5E6O A;  1MSW D;  4QZB A;  2HBL A;  2H3Q A;  9ICP A;  1UA0 A;  1UA1 A;  1JUD A;  3UQB A;  2OHF A;  2PXI A;  2BZF A;  1K50 A;  2K1F A;  4A55 A;  2BYT A;  2NO5 A;  4K7W A;  2KSO B;  3RFA A;  4P7I A;  2KHQ A;  2F1J A;  1WX8 A;  2ON8 A;  1MI0 A;  2JH7 A;  1D8B A;  4HJK A;  2BB6 A;  4GDL B;  5KNI A;  3DBH I;  2KD0 A;  2J6T A;  4PS3 A;  3ZO5 B;  4HKQ A;  2LYH A;  3AEE B;  4TV3 A;  4ANX A;  4F5O A;  2E8N A;  4TKN A;  3R9K A;  5CHF A;  5J2C A;  3GZN B;  1JQ4 A;  3E0F A;  2DZI A;  4DQI A;  1TS2 A;  3A0H U;  1OEY A;  1XLN A;  5BO4 B;  2IGG A;  3BDP A;  1SZP A;  1P7E A;  1QTM A;  7ICM A;  2E1E A;  5FP0 A;  3RAX A;  3CWI A;  3Q6B A;  3VRB B;  5ALX A;  5KFK A;  1QIL A;  2X8X X;  1N5W A;  2F44 A;  3ZLZ A;  1V1O A;  3T9L A;  4UAZ A;  2DHZ A;  2KZZ A;  3U7Z A;  2OWO A;  1YT3 A;  3WK9 A;  4REZ A;  5KT2 A;  3NZS A;  1WY8 A;  5DLF A;  8ICU A;  2BPC A;  2XID A;  4F2R A;  2F1H A;  1E8W A;  5J2F A;  1WMH B;  5ALS A;  7ICU A;  1DYQ A;  2BKE A;  1HTO A;  4LDT D;  3W9C B;  1JXE A;  2HI0 A;  2FNJ B;  1Q3U A;  5CRX A;  3H4B A;  2WDR B;  2EAO A;  4RQ5 A;  4CCH A;  1XT9 B;  2PVO D;  2UVU A;  2QSD A;  4HPM B;  3TAC B;  4RPZ A;  4FBT A;  1ET6 A;  5J18 A;  3JPP A;  2WXH A;  3JVZ X;  5AZG A;  1S8O A;  4JV1 A;  4JPS A;  1DK3 A;  4DOA A;  3KW5 B;  3VH4 B;  2JPH A;  3TL5 A;  4DSI A;  3KUZ A;  4CDG A;  2KAJ A;  2KN5 A;  2JZB B;  1SKS A;  2N4F A;  3A9J B;  2K8C A;  3B08 A;  3MFG A;  5TIS U;  5AK3 A;  4DWF A;  2JXX A;  2G5H B;  3RJH A;  1J2M A;  2E5S A;  2VJ5 A;  2WHE A;  1E7P B;  4YP3 A;  8ICS A;  4IWO A;  1DXS A;  4M2Y A;  4F92 B;  4Y2J A;  2EKI A;  3PX4 A;  4RQ7 A;  2BQ3 A;  1EM7 A;  1SJH D;  4OJP A;  1A6S A;  4R63 A;  1T6B X;  4IUM B;  5ALF A;  4JLC A;  2KTR A;  5BMH A;  9ICE A;  1Q1O A;  1X6I A;  4CE6 A;  4DQQ A;  2BQQ A;  3QIJ A;  4KN4 A;  3P4P B;  5J2G A;  4R8U A;  2EAP A;  5ALY A;  3RZW C;  2BYV E;  1F5S A;  4GDK B;  1XF5 L;  2KK0 A;  3NZU A;  4FBJ B;  3JPS A;  4O5E A;  3QQ8 B;  4IQW A;  2W9C A;  4PS8 A;  3F2C A;  1T7P A;  2DYB A;  2H88 B;  4JB3 A;  4CF3 A;  3Q69 A;  4JL9 A;  5ALW A;  4I2I A;  4XZ4 A;  1X6J A;  4GC7 A;  2G9H D;  5J0S A;  4GXK A;  2OXO A;  4QJF B;  4DS5 A;  2KDI A;  3PSP A;  2W9M A;  2KDB A;  1IXR A;  4J6I A;  1JMS A;  1WG8 A;  2G06 A;  4NPN A;  1EUV B;  2CU1 A;  5DG9 A;  4AYB C;  4F8C B;  2GO7 A;  4BBN C;  2HBM A;  1MFW A;  2F8L A;  4IL6 U;  3PRM B;  2FAZ A;  4BKG A;  2GRI A;  1QT9 A;  1AN8 A;  2AYO B;  3V6H A;  2NTS A;  9ICR A;  3DBS A;  3M9N B;  2AQ2 B;  2K8B B;  2YEP F;  3Q8R B;  1I4G A;  5KL8 B;  2XVT A;  3Q8A A;  2XIC A;  3VFK A;  4R65 A;  1HZ6 A;  2KWC A;  3MDC A;  1J19 A;  1UCV A;  4O9M A;  5BMI A;  1WX9 A;  2K6Q A;  1OXJ A;  1T94 A;  2CR5 A;  1RYU A;  2HOF A;  4PYU A;  4WJ3 B;  2LEK A;  4UAT A;  2RDG A;  3JPT A;  1VCB A;  3H1U A;  2XI9 A;  1JRO A;  3DWM A;  2RD0 A;  3IP4 B;  1WE7 A;  1OQY A;  4O3R A;  3UI3 A;  1WUD A;  2QCZ A;  4XWT A;  1KLU D;  2DKZ A;  4ELU A;  2REX A;  5KG2 A;  1WJN A;  2E1F A;  4LJX A;  2BKR B;  5AKH A;  4XX5 A;  2GH1 A;  1UHU A;  4DEZ A;  4DO9 A;  2F2A B;  8ICH A;  1I7H A;  2WU5 B;  5KFH A;  5EWG A;  2HW3 A;  1E8X A;  2PE6 B;  2RR9 A;  3ZRC A;  2LM4 A;  1JRU A;  2IO3 B;  3NUQ A;  1MG8 A;  4KGR A;  4WWM A;  4G3I A;  1ESF A;  1UGJ A;  1KOT A;  2AL3 A;  3T79 A;  4HRO A;  3N20 C;  4FBU A;  5EOZ A;  2A3V A;  1C4A A;  4NNJ B;  4FZN A;  1QQ6 A;  4EZ6 A;  3KZI U;  2IOF K;  8ICI A;  2O6V B;  3SU8 X;  1K51 A;  1KF6 B;  4RM9 A;  3PVX A;  3BS5 A;  2JY6 A;  5G5G A;  2DNF A;  5JRT A;  4ED8 A;  4DL4 A;  1XLP A;  1FMA D;  2KT7 A;  2YEP B;  5IIL A;  4JX1 C;  4DBG A;  3ZD9 A;  1BML C;  4RPX A;  3C21 A;  3RFZ B;  2WDQ B;  4TMA B;  3IAM 1;  2AHO B;  4UBB A;  3R2I A;  2RHF A;  3WKA A;  2ZUD A;  1SE2 A;  2ZTE A;  2PMZ C;  3TAQ A;  4BKS A;  3RPF C;  3F53 A;  2W03 A;  1SXT A;  1F52 A;  1N60 A;  1QLB B;  2MP2 B;  2M4N A;  1WR6 E;  3L4P A;  2W9B B;  2HTH A;  2IO0 B;  4WWO A;  4S17 A;  3DCG A;  3HT3 A;  1Y8R C;  5HML A;  4G11 A;  5AM5 A;  4HDO A;  4K1R B;  1K52 A;  5D94 A;  1L7Y A;  1QZE A;  4GLS C;  2R2Q A;  3P4R B;  4KIK A;  3LK9 A;  4GGQ A;  1K1Q A;  3FAH A;  1WGY A;  4C4V A;  2BWE S;  2HJ8 A;  2WX1 A;  1NJX A;  3CMM B;  5KHO A;  3HP6 A;  2IO1 B;  3SEN A;  4EYH B;  4I6N B;  3KHG A;  9ICQ A;  2JRZ A;  4J9N A;  5CJ7 A;  2EZZ A;  2BGF A;  3BVZ A;  2K60 A;  4RQ4 A;  3PLV A;  1BNO A;  1UWM A;  3UIP B;  4Y2P A;  1TKD A;  3DVN V;  3RNC C;  2R8I A;  1Z5S B;  2EKE C;  2KZM A;  1U4A A;  3OJU A;  5J0T A;  1OEY J;  1KFS A;  4RQ6 A;  1ZQT A;  3MJW A;  4X57 B;  2KHV A;  2K5P A;  3C2K A;  2HCF A;  3CIR B;  3HVZ A;  4KLT A;  4DS4 A;  3PRZ A;  3RAQ A;  4TUU A;  4PHE A;  3NRW A;  2JYT A;  5ALH A;  1L7M A;  3KH0 A;  1U49 A;  3M95 A;  4RQ1 A;  2I1K A;  3QYP A;  1C78 A;  2MSN A;  4II3 B;  4XDD A;  3NS1 A;  2XBB C;  2KVS A;  3UXO A;  2BYF A;  5KG5 A;  1OFF A;  3P42 A;  1CRX A;  2NBW B;  2FI1 A;  1ECW A;  2W54 A;  3VUY A;  5DGA A;  4N58 A;  4YXD B;  5C0Y A;  2LI6 A;  4NAW A;  2QB0 A;  2LGD A;  4JIO U;  3HVD A;  1TS3 A;  4IM0 A;  4QWE A;  2LJ5 A;  4ITK A;  4YTN B;  5L1M A;  1PYW D;  2ISP A;  4KLH A;  4HJG E;  2YB4 A;  9ICC A;  3W1S C;  3RJK A;  2FBW B;  5ALN A;  3PR4 A;  2PIA A;  4DSE A;  2N1V A;  2XEW A;  4YFK A;  2KK8 A;  3BK2 A;  4M01 A;  5I4D A;  4MSQ B;  1WFY A;  3GDX A;  1XO3 A;  3MGV A;  1E7V A;  2ZW1 A;  3GFK B;  1RWS A;  5DPW A;  3PRE A;  3A33 B;  4OVZ A;  1KL9 A;  1WZ3 A;  1DOY A;  3KBB A;  2YLM A;  5G55 A;  4QZI A;  3M8R A;  2YMM A;  5DGB A;  1K8R B;  3V6J A;  1D5Z C;  1MHX A;  4P1B C;  3J81 j;  1FIQ A;  2D5G A;  2IYD B;  1OUQ A;  2FMQ A;  1HUO A;  3IG5 A;  2MA9 B;  9ICM A;  2O6V D;  1DRG A;  3IT4 B;  4ZDV A;  8ICK A;  4F91 B;  2EAM A;  4BZA A;  4IQT A;  1Q0W B;  2JX5 A;  5EE1 A;  1TV9 A;  5AUI A;  8ICV A;  4IRK A;  3TEW A;  2BR0 A;  2WXQ A;  2IMW P;  4RNN A;  4IKG A;  3TMP B;  4FA6 A;  4KX6 B;  2KIW A;  4W9I A;  2E8O A;  4L1B A;  2DPI A;  3D6J A;  1XSN A;  4NV0 A;  2KOX A;  4FJY A;  5ALE A;  7ICI A;  8ICJ A;  1HQR D;  2QIE B;  1WF9 A;  4DOB A;  5DBA A;  3I28 A;  2IA6 A;  1FNW A;  3T8M A;  4PGY A;  4IRD A;  3P2B A;  1M4V A;  4MGZ E;  3MGH A;  2G09 A;  5KFI A;  2Z59 B;  3SD5 A;  1T3N A;  2FMS A;  3TEZ A;  3MR5 A;  2D2Q A;  5AKE A;  4UB5 A;  2VIX A;  2L0T A;  1WCL A;  1YJI A;  4KX5 A;  2J0J A;  3AE8 B;  3OG5 A;  2V3N A;  3N32 A;  4FZM A;  3SV3 A;  3Q8B A;  2O2V A;  3NRZ A;  5G2N A;  1ZUD 2;  1WJ6 A;  1WI0 A;  1LQB A;  1YNT E;  5DDY A;  4R3D A;  5HFY A;  4C4T A;  1V1P A;  3DBR I;  3QUB A;  5GMV A;  2AQ0 A;  4TQR A;  1LV5 A;  2L3Z A;  2JGA A;  3LYY A;  4YN4 A;  1H8C A;  3V61 A;  3ZDB A;  1ZQZ A;  4BGD A;  2AH5 A;  1WIA A;  2JHD A;  4IR9 A;  4QZF A;  1I4R A;  1N6Z A;  2SAK A;  5AK5 A;  4ECU A;  3MC1 A;  2W9A A;  2MA1 A;  4M9H A;  3HM6 X;  3ZQ4 A;  2LXC A;  1SSN A;  3VR8 B;  3M6Z A;  1FRR A;  1UD7 A;  4OO1 J;  3VTV A;  3BYY B;  5E6J A;  2FPL A;  3SDL C;  3TEY A;  4EZJ A;  2J0K A;  4QZH A;  1L7O A;  1NKB A;  2ZJ8 A;  1HEK A;  4JWM A;  3AXC A;  3WAM A;  3BWU D;  3WIM A;  1TAM A;  3E56 A;  3ECI A;  2ISO A;  3I5J C;  4I6P A;  3VUX A;  4DSL A;  2ZNV B;  4CRX A;  4RPY A;  1CK1 A;  1JAL A;  1X1M A;  2YTU A;  5BYR A;  2PLP A;  3BQ2 A;  5KFV A;  3RYT A;  3AE6 B;  2UVV A;  2DLB A;  3Q14 C;  7ICT A;  4GDL A;  5DLG A;  2Z0D B;  2KAC A;  4BJQ A;  1KKX A;  4EEL A;  3KVF B;  4NY0 A;  2MW5 A;  3N1Z C;  9ICN A;  1P7F A;  4PZN A;  3ONN A;  2GI9 A;  2DF4 B;  3RH6 A;  2OJR A;  4EZL A;  3PSI A;  5ALG A;  8ICP A;  4AYB F;  4RM8 A;  3I57 A;  4BBN F;  3BZD B;  2YML A;  5L1J A;  1IIP A;  4I2E A;  5AKG A;  3KKA A;  4P4M A;  4NLK A;  2O6K A;  4B0M A;  3N1Y C;  4ANW A;  4ICV A;  4AQ7 A;  2Y9U A;  3OHA A;  3KD3 A;  3WAL A;  2ZXI A;  2WAQ F;  3GV7 B;  4Z6C A;  2N9K A;  5JU5 A;  2MEK A;  3D2S A;  1YMH E;  1WXM A;  1D9D A;  3ZXV A;  2V4R A;  2A19 A;  3Q8Q B;  1U47 A;  4LJP B;  4KTQ A;  3ZUN A;  3UMG A;  3MC9 A;  3TFS A;  3F2D A;  3P4S B;  4ZRQ A;  4BFR A;  3PW0 A;  1WMH A;  5J2R A;  4GC6 A;  4XC2 A;  1GJZ A;  4N59 A;  1DGJ A;  3RJJ A;  2AGP A;  1OW5 A;  4ZRP A;  1TKG A;  3FDS A;  5KFZ A;  4KLG A;  4DQO C;  2EQY A;  1C79 A;  1IBX A;  2DYO A;  1VD2 A;  3PLU A;  4UB1 A;  1R4M B;  3TAD C;  3ZI4 A;  3NHE B;  4QW9 A;  2OOB B;  4K4I A;  3QHT A;  3UF8 A;  4FXC A;  4HAI A;  5ALU A;  3A9J A;  5JZE B;  2JSV X;  2C9W B;  3AE5 B;  1K5O A;  3PZ7 A;  3H8W A;  4MFA A;  2WWZ A;  1V49 A;  3T3F A;  2RSU A;  5BYQ A;  1FEZ A;  5L9X A;  5KT7 A;  2WYQ A;  3IN5 A;  5AI6 A;  2YMP A;  1NK9 A;  3NUH B;  4EZK A;  3NGD A;  2NV3 A;  1P1A A;  4KLO A;  1RFA A;  4MEM A;  4PPX A;  5CWR A;  4K4G A;  1XCT L;  3FKY A;  4Y2Y A;  2JQR B;  3VR9 B;  3WK6 A;  1PGX A;  1KSP A;  1FO4 A;  3BZK A;  2KFZ A;  2PMZ F;  4KLE A;  1SEB D;  5AKZ A;  1WM3 A;  4EBC A;  2ASD A;  4HVB A;  2F77 X;  3QU4 A;  4GDK A;  1WGG A;  2BT6 A;  1CJE A;  1C4C A;  4RUC A;  1PGA A;  4W9D A;  1HZ5 A;  1ZJM A;  2JR5 A;  3KUC B;  1L2N A;  1ENF A;  1NKE A;  3SR6 A;  2MSE D;  4J9M A;  2FPM A;  3SEB A;  3V7L A;  5L1K A;  2DQN B;  1ZDX A;  3MHZ A;  4RF0 A;  1E8Z A;  4DWI A;  2CS4 A;  5KFA A;  5CHW A;  1BGX T;  2FJ6 A;  2WXM A;  4DSJ A;  2G1E A;  1ZQW A;  1NEK B;  3IVF A;  1PFD A;  2WS3 B;  2LWP A;  1UWX A;  3V05 A;  2HBJ A;  1D4B A;  4C00 A;  5KFX A;  3VTW A;  2F76 X;  5KFW A;  2N7D A;  5JUM A;  3P1M A;  3LB8 C;  1MQ2 A;  2CJN A;  4UB8 U;  3JPQ A;  3GIJ A;  2K8B A;  3Q8P B;  5AM1 A;  8ICQ A;  3VCB A;  8ICF A;  4EUT A;  4F7Z A;  2INC C;  4PGQ A;  1GC6 A;  3PSF A;  2BCQ A;  2R8K A;  4I2A A;  5KL1 B;  4GSW A;  3T5J A;  1ZQA A;  1NBF C;  1VDV A;  5J2J A;  2AX5 A;  2RDJ A;  3MJ5 A;  4PH5 A;  1SL2 A;  3AI5 A;  2IO2 B;  3EGR A;  1JWS D;  4Y2R A;  4UQG A;  4AJY B;  4YQW A;  4M9J A;  4DFD A;  4YSY B;  4P4O A;  1JWB D;  1BT0 A;  3H6N A;  5GTI U;  4DK5 A;  3IRU A;  4WQM A;  1R7S A;  2IHN A;  7ICH A;  1QQ7 A;  1WGD A;  1E0Z A;  3QU5 A;  2Q4T A;  3PSE B;  4N6E B;  2WXN A;  4DQS A;  1ED1 A;  2KX0 A;  4RMA A;  1VZ6 A;  1X42 A;  1TK8 A;  2GLE A;  3SHQ A;  3IDW A;  2KE7 A;  5J2D A;  5E6N A;  2WB1 C;  2O6V A;  2JH1 A;  2DPJ A;  3IFW B;  4LCD E;  1L7N A;  2ZVN A;  4F4Z A;  1J8C A;  4ACO A;  2KAN A;  2Y1I A;  4ED3 A;  2AGO A;  4ECY A;  3RRH A;  3TKA A;  4MHV A;  2KMC A;  3ML8 A;  3FIL B;  1SZH A;  2DZM A;  3IXS A;  4B95 A;  1A0P A;  5AKY A;  4LK0 M;  1S0N A;  3EPG A;  1V80 A;  1CI4 A;  2D11 A;  1V38 A;  4QWA A;  2KWU B;  2MP2 A;  3THV A;  3PO5 A;  5AIA A;  2IBK A;  1KRH A;  1SXE A;  4IRC A;  4EE2 A;  4WH4 A;  1O08 A;  5F9N A;  2PTL A;  4KIT B;  2HBK A;  4KLF A;  3PPA A;  4E0D A;  4XYC A;  4J9K A;  4EEW A;  3AU4 A;  1NI3 A;  4ECS A;  1NVI D;  1QOG A;  2BW2 A;  1V2Y A;  4PGX A;  4KMU A;  3QAR A;  4AWJ A;  3RUL A;  1KM7 A;  1YOV B;  2KN7 A;  3APD A;  4LNF A;  4MGY E;  1S0O A;  2QAR B;  2K6D B;  5AM0 A;  2KFK B;  4HPP A;  3ZW3 A;  2JYE A;  1ZQD A;  2MHJ A;  4MF2 A;  5J2K A;  1LO5 D;  3BS7 A;  4N9F 4;  4XDC A;  5DPT A;  3AE3 B;  3WKE A;  3K9P B;  3N9Y C;  1IGC A;  1V6E A;  5HNK A;  1ZQO A;  4RGN A;  5DDM A;  4PHA A;  1N61 A;  1T5X D;  1WH3 A;  3PW5 A;  2GOL A;  3N7P D;  4QIW C;  4K7U A;  4Q2J A;  1L0Y B;  3K4G A;  5FR3 A;  2ZJ5 A;  1ZQM A;  2BCR A;  2INN E;  4Q44 A;  4YR0 A;  3IHP C;  1F77 A;  4DL2 A;  4I2H A;  2M9N A;  3PZ8 A;  1JI7 A;  4XGA B;  5E79 U;  1SL1 A;  4NM1 A;  4R66 A;  5IOI A;  1M6Y A;  3HJE A;  4AP9 A;  5J2E A;  2NRX A;  2IJ0 A;  3FC4 A;  4KDI C;  1NK4 A;  2IOF A;  4US8 A;  1M94 A;  4NL9 C;  3GV5 B;  3AN1 A;  2I9G A;  4GU2 A;  2KN4 A;  4BXO A;  5ALL A;  1BPY A;  1F2R C;  1Z00 A;  1NJY A;  1XLQ A;  5ALK A;  1XSP A;  4OVV A;  1UBI A;  1FFV A;  5KFD A;  1L7P A;  3H40 A;  2ZVO A;  3W1Y A;  1ZRN A;  4C8M A;  5CR0 A;  1SWW A;  3M8S A;  4MFC A;  4B6J A;  2EMT A;  1B0X A;  1S77 D;  4DHZ B;  2PI5 A;  3GB1 A;  3NS8 A;  1D5M C;  4PYZ A;  3BIN A;  2H89 B;  1ZGU B;  4PZO A;  1BPZ A;  9ICO A;  2LVP A;  5C5J A;  4A8X C;  2DKX A;  4XRH A;  2KJ9 A;  1U4B A;  2JRH A;  2JVC A;  2MWS B;  2WXJ A;  3HUI A;  4Z6E A;  1NNL A;  2V9H A;  2D10 A;  4UAS A;  3LYS A;  2NR2 A;  3T5K A;  3AQF A;  5HR7 A;  4DFK A;  4CNQ A;  1PK1 B;  3QXG A;  5III A;  5AI5 A;  3PW7 A;  1ZET A;  4HDQ A;  1HJP A;  1QLN A;  1L0X B;  3H7I A;  4O3N A;  3RUI B;  3IT6 B;  3MC8 A;  2C7N B;  4LNI A;  5ALZ A;  2FLP A;  2N7J A;  2WXO A;  1WXA A;  4F5R A;  3Q3O C;  3T3N A;  4JGH B;  1F0Z A;  4FHK A;  2EMS A;  4IC9 A;  1ZQN A;  1ET9 A;  2PFQ A;  4M8M A;  4O3Q A;  3BYT B;  1ZQE A;  2HE7 A;  5ALD A;  4BUG A;  3H8S A;  3PRP B;  5L1L A;  4IC7 B;  2W82 A;  4ED6 A;  4G3X B;  3N30 A;  2ESE A;  1A77 A;  4NL9 A;  5DCN A;  2BS3 B;  4G50 A;  4BX9 C;  9ICG A;  2YY6 A;  4ED0 A;  3VUW A;  4JWN A;  3M9M B;  2DZJ A;  2MJE A;  1NK6 A;  3VQI A;  5IIO A;  4BWJ A;  4IQV A;  1DOI A;  2ZEQ A;  4EKU A;  3GIM A;  2WNM A;  3L13 A;  4W9G A;  3BK1 A;  3WAO A;  3RH4 A;  2KFN A;  1WM2 A;  1C9F A;  3EWA A;  1WGH A;  1PUZ A;  1PGB A;  3A0B U;  2I5H A;  1YZ7 A;  5BMG A;  1AWD A;  2KKP A;  2VRR B;  2L8J A;  1TAU A;  2KWV B;  2D6F C;  4NZL B;  3SFE B;  3L3F X;  5AI0 A;  2XO7 A;  2WF6 A;  4YMN A;  2KMD A;  3WKB A;  3U2S C;  2JF5 A;  1C3T A;  9ICU A;  4B9K A;  4NLN A;  3NVV A;  3I3T B;  4A90 A;  3UPQ A;  5AM2 A;  1UT8 A;  3CRX A;  4XE0 A;  5F3X B;  2Y0S C;  3AU6 A;  1T0R C;  4ARC A;  1WJU A;  4NLC A;  4P0Q B;  2AXT U;  1KLN A;  4Y2U A;  1L4Z B;  3F2B A;  4UB2 A;  1ROE A;  4EEY A;  3WKC A;  1WR1 A;  4GXI A;  4GMV A;  3RCZ A;  4M9G A;  3M62 B;  4DDG D;  9ICK A;  8ICB A;  1ZQG A;  1PK3 A;  4E3C A;  2ZTC A;  4XUS A;  2VA2 A;  3AM9 A;  1Z4N A;  3QE9 Y;  3EPI A;  1ZQH A;  4P16 A;  1CUK A;  2XGQ A;  2ZCC A;  3KTQ A;  4WQO B;  4RQ2 A;  4B9N A;  2B76 B;  1ZJN A;  4DCC A;  2DX5 B;  5HR6 A;  4NJ8 A;  4ED7 A;  3RN9 C;  2FCQ A;  3V3X A;  5KTQ A;  3H0R B;  4J9R A;  2ZIW A;  3PY8 A;  1N2X A;  3NG0 A;  2A1J A;  9ICS A;  3GS2 A;  2WXG A;  2LAS A;  2BQU A;  4DQR A;  1LM8 B;  1ZKH A;  3PNC A;  4US9 A;  3TAN A;  1OTR B;  4F5P A;  4M6W B;  4X5V A;  4E71 A;  5AEK B;  3MFI A;  1XQQ A;  1X9W A;  2ZIV B;  3H8J A;  3RH5 A;  2V1Y A;  1UZX B;  2D3B A;  5KT6 A;  2V0G A;  2KG5 A;  3AUL A;  3BQ7 A;  4RZR A;  7ICS A;  5KAI U;  3EW9 A;  4KLQ A;  5JHA A;  2FID A;  2E3T A;  2JZP A;  1SBB B;  2HTM E;  5AKJ A;  1GNU A;  4JK1 A;  3GQC A;  1CZP A;  3N3K B;  4LJO B;  4ECW A;  5KG0 A;  4DLE A;  1F9J A;  3X0W A;  1COK A;  3SMV A;  2WXK A;  3PZD A;  1YZ6 A;  1ZQC A;  2MUT B;  1L6V A;  3LVW A;  1MG4 A;  4ZRI A;  1DOX A;  2KMA A;  3C5G A;  1L3S A;  4JE3 B;  1KW4 A;  8ICX A;  1SE4 A;  5ALT A;  3JPR A;  3QCA A;  5KFP A;  3ISC A;  1XU4 A;  3PST A;  2D3C A;  4YWG G;  4F93 B;  3RNF C;  2DAF A;  2F1I A;  2K4I A;  4NJ7 A;  4GLX A;  3Q8M A;  2VH2 A;  2LJI A;  3LDA A;  4RH6 A;  4AP4 C;  3VDZ A;  5D4B A;  2PKO A;  2N1W A;  1EXN A;  2DUY A;  4ED1 A;  2WB1 F;  9ICA A;  1TIF A;  5IIN A;  2CPR A;  1SKW A;  1IYF A;  2L83 A;  3MP9 A;  3Q2A C;  2RP5 A;  3ICX A;  1HTQ A;  1SB3 C;  4IM3 A;  2ZUC A;  5CB1 A;  3H8H A;  2P6U A;  5J0O A;  5KFT A;  5KHQ A;  3MFH A;  3HW8 A;  1UEL A;  2D3G A;  1PUT A;  3RMK C;  1T8E A;  4FS2 A;  3TI0 A;  4KX3 A;  5L1I A;  2GB1 A;  3GIK A;  1I35 A;  2NYV A;  4AOF A;  2GBK A;  4RQ0 A;  2B6G A;  2A4Z A;  1T0S C;  3RR7 A;  2BDU A;  2AQ1 B;  1JCK B;  4BOS C;  3TAP A;  1S10 A;  3Q8F A;  1LGR A;  4JV2 A;  4MEY A;  4MT5 A;  1J97 A;  2FCN A;  4A8E A;  3EA6 A;  2NRW A;  3SQI A;  4P1C C;  3DWG C;  3ZJV A;  1N62 A;  2G5I B;  4UW9 A;  1ZP0 B;  3DVG X;  1WGR A;  9ICI A;  3QNM A;  1F2R I;  1NDD A;  4LZD A;  1FXI A;  4O3S A;  2BKF A;  2ODG A;  3AEG B;  1TS4 A;  2G0A A;  2YX8 A;  2ZJA A;  1ZOL A;  3M6K A;  1GC7 A;  2YQE A;  3C29 A;  1FCL A;  1BNP A;  4ZYN A;  3HKZ C;  3C23 A;  4F3O A;  4D2K A;  2C7M B;  2XGP A;  3MBY A;  4DFJ A;  2UU7 A;  4OZC A;  3AE7 B;  1TK5 A;  1FM0 D;  2JU6 X;  3JSV A;  3AV8 A;  2GBN A;  2KQ4 X;  4GN1 A;  5IO9 A;  1SJE D;  2ZIU B;  3DQV A;  2BBC A;  2PEA A;  3AL0 B;  2GWS A;  4AJW A;  2QJL A;  4QIW F;  2ZXH A;  5HHI A;  4EFO A;  3VAW A;  3WK7 A;  3T5L A;  1V81 A;  2KLC A;  3IHQ B;  5AM3 A;  3ZD8 A;  4DSK A;  1ZQK A;  1NOM A;  8ICE A;  1EWC A;  3I9V 1;  4OZA A;  2F8K A;  3HHM A;  2HDO A;  5AKK A;  5AIB A;  4NLG A;  4W9E A;  2WTF A;  3MR3 A;  4PL1 A;  1VJ5 A;  2YB1 A;  2LD9 A;  4A3O A;  2LRW A;  4DXA B;  4KLD A;  2EDU A;  3QZ8 A;  1QH9 A;  5D6J B;  2FUG 1;  4HWI B;  1ZRM A;  3PV8 A;  4ELT A;  2MBB B;  2LVQ A;  4WWN A;  2FE8 A;  2CXY A;  3JPO A;  3D2Q A;  4LNN A;  4QZE A;  3I1Y A;  2R8G A;  2J6U A;  1S5L U;  4QNL A;  3GZF A;  4KMO B;  4I27 A;  1ZQI A;  2VJ4 A;  2NBV B;  4EEN A;  2P35 A;  2V4Q A;  1CEZ A;  1DGS A;  2ZCB A;  2WF9 A;  2B3A A;  5J2B A;  1UQV A;  2KJ5 A;  4NLB A;  2TSS A;  2ZIX A;  1EU4 A;  2KC2 A;  2UVR A;  2MAX A;  5IIM A;  5EWF A;  3MGI A;  2L00 B;  3RNE C;  2WGS A;  3SD7 A;  2RRD A;  2E8P A;  1EF5 A;  4F2S A;  5IN7 A;  4FJV B;  3NVW A;  4YXM A;  1NK8 A;  3E9S A;  3L0W B;  2RDI A;  4PS7 A;  4PHD A;  3FIL A;  1LKY A;  1ZQJ A;  1SIF A;  4R64 A;  4Y2Q A;  5J0W A;  2R18 A;  5J0U A;  1TT5 B;  3W5U B;  5KFS A;  2QHO A;  1ZXH A;  4ARI A;  5HKH A;  5EE9 A;  4LNK A;  7ICG A;  3GE8 C;  4RQ8 A;  2JMG A;  1ZQY A;  2RDH A;  4YR3 A;  2QIL A;  5ALO A;  4M47 A;  1RXW A;  1YIW A;  2LM1 A;  2K39 A;  3KKA C;  2MH7 A;  3PT2 B;  3BVM A;  2LRU A;  2KOB A;  3ZRF A;  1NJZ A;  4ED2 A;  2HHV A;  1BUI C;  2GOW A;  2IPK D;  1N63 A;  1ZD2 P;  2KNJ A;  2G3Q B;  4UAV A;  3MR6 A;  4PL2 A;  4OCZ A;  1KRP A;  2PFP A;  2Y5C A;  2K8A A;  2W8K A;  2X38 A;  3G6V A;  4Q8F A;  2KFK A;  2QAR A;  1X9S A;  4J9S A;  2B21 A;  1Z2M A;  1PVP A;  3O13 A;  5DB9 A;  4RQM A;  3S2A A;  4R8U B;  1TS5 A;  4JMU A;  3AEF B;  1R4M I;  2OYY A;  5C1Z A;  2D07 B;  4UAU A;  2ALZ A;  3EC8 A;  1WXV A;  4Y2V A;  5KFJ A;  2VA8 A;  2WLB A;  3V7J A;  4B9L A;  2D3D A;  3Q3M C;  4HKZ E;  3RI7 C;  5AKX A;  4ECZ A;  2NBU A;  4ZHO A;  3D32 A;  3ETR A;  4I29 A;  2KSO A;  5DQG A;  3PVL A;  3C2L A;  1KEJ A;  4M8N A;  2H5X A;  2GBJ A;  2FDR A;  5C2T B;  1I4X A;  2BTE A;  2W11 A;  1VR9 A;  1TFR A;  2GBR A;  3O65 B;  2KDF B;  4WJO A;  4GXB A;  1WRI A;  2HDE A;  4DF4 A;  3GIL A;  1B43 A;  1WGK A;  4K7S A;  4EYI B;  1L6U A;  4DFP A;  2IY1 B;  1E5W A;  4PT5 A;  4I2B A;  1ZW7 A;  4BWM A;  4J9P A;  5KFC A;  3F5A A;  5J8Y A;  4FAD A;  2J42 A;  4HRS A;  1Z19 A;  3RTV A;  3ZNG C;  2AWT A;  3OGU A;  4TQ1 A;  3R7R A;  4J3O D;  4OJ6 A;  1XNS A;  1GB4 A;  4KZ0 A;  3RB6 A;  3RB3 A;  1IG6 A;  3NVZ A;  2C2D A;  3CSF A;  2KIC A;  3BJY A;  1ZD5 A;  1ZQX A;  4I2C A;  3AB5 A;  1EWY C;  4QZC A;  3OSP A;  3PHX B;  4F5N A;  2WXF A;  3ZGZ A;  4IG7 B;  3TUO A;  2ASQ A;  2JRI B;  1ZQU A;  5KFM A;  5ALQ A;  4EZ9 A;  3A1Q B;  3BVG A;  1COO A;  1PK1 A;  5DB7 A;  2L52 A;  2XNA C;  4GFJ A;  1KH0 A;  5LXH A;  4IS7 A;  3B0A A;  4RT2 A;  4OZB A;  3PO4 A;  3ZDA A;  1F44 A;  3N7R C;  3CF6 E;  3DHG C;  1FCC C;  2KJR A;  1GOZ A;  2M8S A;  4PJ0 U;  4NAM A;  2K25 A;  4TSS A;  3PX0 A;  1G6J A;  4M0W B;  2W3S A;  3BS5 B;  1P98 A;  2JZB A;  1L5P A;  2EZX A;  2HHW A;  2G4S A;  1QF6 A;  3EZ5 A;  4II2 B;  3B0Y A;  3P4Q B;  2WDT B;  1V9P A;  2IGD A;  4ECT A;  1KBU A;  4MM3 B;  8ICA A;  4HCP B;  1P7D A;  1YN5 A;  3KHL A;  3PMN A;  3URY A;  1FEH A;  2BVC A;  2VKQ A;  4WUR A;  3QUQ A;  4MF8 A;  4WWP A;  2RQ5 A;  2ZUB A;  4YD1 A;  5JTI A;  4F8R A;  2MBH A;  4CYE A;  4YSX B;  2CRX A;  5AK4 A;  2Z8L A;  5AKI A;  2ACZ B;  1KFT A;  2XK5 B;  3V7K A;  4QZ9 A;  1AW7 A;  4ECQ A;  1RYR A;  1SE9 A;  2DBY A;  3TFR A;  2LBO A;  3OJS A;  4ELV A;  3ORY A;  2JZZ A;  3AUO A;  3PW2 A;  2WHI A;  4ECV A;  7ICO A;  5C23 A;  3HX0 A;  4B9V A;  5KFE A;  8ICT A;  5T14 A;  4P0Q A;  4FS1 A;  3O0F A;  1LFD A;  3EEC A;  3RF9 A;  2JZ3 B;  4B9U A;  4ICA A;  1XXG A;  1NK7 A;  4MFF A;  2K4P A;  9ICL A;  3RZF A;  5ALJ A;  3N4M B;  1ACC A;  2FIF A;  1E10 A;  7ICF A;  1IV8 A;  3HK0 A;  2ZTD A;  4YCX A;  1JWM D;  5TZV A;  1KTK A;  5IKC M;  1SIJ A;  4UAY A;  1XLO A;  3WU2 U;  3E2E A;  3UMC A;  4C8N A;  4OHJ A;  4W9K A;  3UM9 A;  2LUE A;  2W7O A;  3ZTD A;  2H3I A;  1E9M A;  5DBB A;  3RB4 A;  2QEJ C;  3HM3 A;  4DXG A;  2ATL A;  2ICI A;  1L4D B;  8ICG A;  3GU3 A;  3AEC B;  3ML9 A;  3C19 A;  5ALR A;  2PW9 A;  3Q8S B;  4NAW B;  3AEB B;  1CQV A;  4TUS A;  5CX3 A;  3A9K B;  4KKI A;  5LLI A;  1S9F A;  2JWZ A;  2MU2 A;  1D3Z A;  3QUC A;  2CJO A;  3R2T A;  2UYZ B;  2Y3A A;  1X2I A;  2ZPY A;  3K9O B;  4M6W A;  3OWE B;  1SV0 C;  3EUB 2;  2JT4 B;  2OCE A;  3DBL B;  3WA0 A;  1FNV A;  4AS1 A;  2ZIV A;  5CA7 A;  4GXJ A;  4BDP A;  3HKZ F;  1XC9 A;  3KHH A;  1RM6 C;  1Q10 A;  2ZJD A;  4C8O A;  4QZG A;  1A76 A;  2LPE A;  2KDM A;  3B2G A;  3AMZ A;  2LXA A;  3QA8 A;  3DOW A;  5A0L A;  2NPT B;  4J9Q A;  4B9T A;  4YR2 A;  2XCA A;  1R4N B;  3BY4 B;  3C8Y A;  1V85 A;  5KFL A;  3ALB A;  4MDK E;  3ZKJ C;  7ICN A;  2KJ6 A;  3W5V B;  2MUT A;  1MPE A;  1YQ3 B;  3GZN I;  5IAA C;  2PJH A;  1RZT A;  3UGB B;  3RJI A;  3V6C B;  4O3O A;  1YN3 A;  4DF8 A;  3H7P B;  2G07 A;  4TQ0 A;  4KZC A;  4M04 A;  1CMX B;  3TJP A;  1NYQ A;  2FLL A;  4YXJ A;  4KN7 A;  3D2N A;  2L76 A;  4YD2 A;  2WXL A;  5AUK A;  3ZJT A;  1E90 A;  1L0V B;  2LGY A;  1V5O A;  2J7Q B;  4IQU A;  1L5U A;  5JXV A;  2FPK A;  3TBL D;  2HOQ A;  2C2E A;  2W9B A;  1V97 A;  4B9M A;  2LMC A;  4YTM B;  5IIK A;  1IPG A;  1HEZ E;  1QOA A;  2OH2 A;  4KLJ A;  2M19 A;  4XWW A;  3UQ2 A;  1Z1V A;  4UAR A;  1JXL A;  3DEE A;  4EX6 A;  2CKH B;  3BQ1 A;  5GXG B;  5T8I A;  3SZ2 A;  1SV0 A;  4K4H A;  1A5R A;  3AEV A;  5AI9 A;  2BCV A;  1VRA B;  2LZ6 A;  3W2D A;  1BPD A;  4DL6 A;  3KQ4 A;  3QUT A;  1MA7 A;  1C1Y B;  3CYM A;  1YJJ A;  2NRT A;  3Q3J A;  2OM6 A;  4B6W A;  3FYH A;  4DSF A;  2I6X A;  2O2V B;  4GIB A;  1NEN B;  1RFK A;  2BB5 A;  4MEX A;  2DAJ A;  2R8H A;  7ICV A;  4MH0 E;  1KN5 A;  1J2N A;  1TTN A;  1U9L A;  4ANV A;  2VH1 A;  2C5L C;  3ZNI D;  1V1P B;  3VHT C;  4U7C A;  1ZD3 A;  4WJP A;  3SV4 A;  3PX6 A;  4LVS A;  1WWV A;  3PTF C;  2M1M A;  3OAW A;  1PQS A;  1MN8 A;  3ZDE A;  4BOZ B;  2GLS A;  3JPN A;  4YT0 B;  2DL0 A;  2W55 A;  3CW2 C;  4O3P A;  2KMM A;  3A4R A;  5DQI A;  3PV1 A;  4HEA 1;  1TZ1 A;  1SE3 A;  1X9X A;  4RT3 A;  2UWQ A;  3ETL A;  1Q8K A;  3IAS 1;  3Q3N C;  4FJZ A;  1QQR A;  3A4S C;  4QWB A;  4MJS B;  3UXN A;  4ZRK A;  3PO0 A;  3K1R B;  1PVR A;  1C20 A;  5HG2 A;  3RJE A;  1RQL A;  1DK2 A;  3APF A;  3KFU F;  5AKL A;  5KG3 A;  2W04 A;  1BVS A;  3AE4 B;  2E8M A;  2JEG A;  4OJO A;  1QKZ A;  2YVC A;  5ALV A;  1NK0 A;  2MRL A;  3HIL A;  2ZIU A;  1MHH E;  2ZG6 A;  2N1R A;  4KSK C;  3QX1 A;  4DHJ B;  5KFG A;  2LGX A;  1E6E B;  5J2H A;  1K53 A;  3EFU A;  8ICL A;  2IY0 B;  5KT3 A;  2KWD A;  2PMV A;  2WQY B;  9ICV A;  2Y5P A;  4IWP A;  4Q43 A;  1JW9 D;  1A70 A;  2M0N A;  5ALM A;  4I28 A;  3GV8 B;  2KYW A;  2L7R A;  4RF1 A;  3DVG Y;  1ZQP A;  4I2G A;  4NJ6 A;  4HLE A;  9ICF A;  3L16 A;  1RDF A;  3SI8 A;  2KKC A;  2PE9 A;  1YX5 B;  2MLB A;  1NZP A;  3RBD A;  4NQL B;  9ICB A;  5B5E U;  2JWU A;  1K1S A;  2NRZ A;  2BS4 B;  3WAN A;  3LWL A;  1FRD A;  3C0R B;  3EYZ A;  5J29 A;  3BII D;  2XY6 A;  2ZNV C;  4KKJ A;  1IP9 A;  2LYB A;  5CEH A;  1SKR A;  2MJ3 A;  3QC8 B;  4HCN B;  4C8L A;  2LHT A;  8ICC A;  2J0M A;  2N9X A;  2MBO A;  4KGS A;  2G4D B;  4CHK A;  3QZ7 A;  2KKV A;  2ASL A;  3QJZ A;  1WWT A;  1IBX B;  4TUR A;  3APC A;  2FMP A;  1GG3 A;  2N0S B;  3LDZ E;  7ICQ A;  4Y2X A;  2RLT A;  2NTT A;  5HHH A;  5ALI A;  3OTQ A;  4DL3 A;  1RQN A;  1EU3 A;  2PPH A;  4FHJ A;  1UBQ A;  4ASW C;  3MAB A;  1C4P A;  5D46 A;  3RD2 A;  3OPX A;  3H8M A;  2D3A A;  2KHW B;  3R8B A;  2L5Y A;  2Y9T A;  1N5X A;  2JEI A;  3N1X C;  3NJT A;  3M7D A;  2LHE A;  5E6P A;  3BQT A;  2N7E A;  4DOC A;  3OJ3 A;  4Y2T A;  3MDA A;  1FXT B;  3DBH B;  1J7C A;  3U4E G;  2C7H A;  3QK0 A;  1EF1 A;  4BVU C;  3RNB C;  3TCA A;  3IG3 A;  3ZJU A;  1F0M A;  1MC8 A;  4USA A;  2HHU A;  3AE9 B;  2KDE B;  3ABV B;  3B2F A;  1QOF A;  5D49 A;  1T0Y A;  2KNB A;  1RAX A;  2K9X A;  2WX0 A;  5KFN A;  7ICP A;  4K81 A;  2WP9 B;  2EZY A;  3ED5 A;  4AUQ C;  5KFF A;  1HIW A;  1X9M A;  4RCO A;  2J52 A;  3RR8 A;  2R61 A;  4LLG M;  2V3P A;  3MR2 A;  2H3F A;  2IDY A;  4FE3 A;  2C22 A;  4YL8 A;  5TSS A;  4YMM A;  3ISB A;  1WSP A;  2VAN A;  1BPE A;  4HK2 A;  2KLG A;  1T0Q C;  1UGM A;  3HPO A;  1WXQ A;  4FO6 A;  4RGO S;  2H3Z A;  1RG6 A;  3KOO A;  1B22 A;  3H9D A;  2KJH B;  5AI8 A;  2LGI A;  2KIV A;  2LKY A;  2PKE A;  1VLB A;  2HHQ A;  4ZHP A;  4DHJ D;  5DPR A;  1J7A A;  1BXT A;  1QOB A;  2QKQ A;  4EEK A;  3H4D A;  2HHT A;  2HVH A;  1E8Y A;  4C7Y A;  1GAQ B;  1RLF A;  2DYM A;  2WAQ C;  1WWU A;  2IOH A;  9ICJ A;  3AE1 B;  3U7D A;  3V6K A;  4W9J A;  3CNH A;  2V3S A;  4NY8 A;  4QW8 A;  3QU9 A;  1GB1 A;  3RNG C;  3S6J A;  5DB6 A;  4ECR A;  4DXF A;  4FZL A;  4KLI A;  2N9L A;  5J2A A;  3KUD B;  2IHM A;  1UF0 A;  1YN4 A;  7ICK A;  4FFD A;  1TBE A;  3ZYY X;  5LNK 1;  4ACF A;  5ALP A;  5KG6 A;  4KLU A;  1ZQQ A;  2V4I B;  1Q5W B;  3RJF A;  1AQ6 A;  3VXW A;  2F3N A;  5BOM A;  5AIC A;  2JXJ A;  3A1Q A;  3CST A;  2WXI A;  3I63 C;  2BCS A;  3RT3 B;  3TSS A;  3OJ4 B;  4P0P B;  2ZW0 A;  4DL7 A;  1LXD A;  3AU5 A;  2JEF A;  5KG7 A;  1HA5 A;  4WAF A;  3U52 E;  5KT4 A;  2KEY A;  2M56 B;  1I4P A;  2FUH B;  2FE9 A;  3SEI A;  1LVH A;  2HOI A;  4YG2 A;  5J0X A;  1L3T A;  2INP E;  5DB8 A;  2RMM A;  1QCK A;  3U26 A;  4DL5 A;  2MBQ A;  2WFA A;  2LHD A;  4LZG A;  4M0W A;  4DLG A;  3MHS D;  3U8Z A;  4K3C A;  3KHR A;  3ZDD A;  2KP7 A;  2G08 A;  2QLT A;  1IGD A;  3BQ0 A;  2K8H A;  1GO3 F;  1O03 A;  4QAY A;  1VZ8 A;  2RPV A;  1V8C A;  3ZNZ B;  2N9E B;  4F4K A;  2Y5B B;  4ICU A;  1L8O A;  3R3M A;  2BGW A;  2J53 A;  8ICN A;  3F5E A;  1NYR A;  2LMR A;  1SF0 A;  3RB0 A;  4MM3 A;  3KYC D;  2WF8 A;  5FR6 A;  4Q8E A;  1KFY B;  2WF7 A;  4WJN A;  2I38 A;  5H8Y E;  2CHW A;  3OHB A;  1TJE A;  1RYS A;  4QZD A;  1YQ4 B;  3SAF A;  1L6N A;  5D2M B;  2A5U A;  4I2F A;  3ALR A;  5KFR A;  2K3U A;  1ZDV A;  3UIN B;  2I2Y A;  2D8C A;  2XK5 A;  3L10 B;  1Z1B A;  4ZYS A;  1BPB A;  3H0L B;  4JV0 A;  1S0M A;  4RNA A;  1IM4 A;  4IDI A;  1QSS A;  4F4W A;  3HRD D;  2KXJ A;  5HP4 A;  1D5X C;  1WYG A;  3QEB Z;  1V5T A;  3WK5 A;  5DKW A;  3PML A;  1TY0 A;  2HSZ A;  1RRB A;  2WU2 B;  2G45 B;  2KVR A;  3K1Z A;  5EWE A;  1GUA B;  1WXS A;  3V6E B;  1B4F A;  2P6R A;  3VTU A;  1B1Z A;  3MC0 B;  4C56 C;  1RPL A;  4F5Q A;  5G5H A;  1ZQR A;  4RFB A;  4W9F A;  5BOL A;  5J0R A;  2W9N A;  4XA5 A;  5EE3 A;  3TEX A;  3G6X A;  1I4H A;  2ASJ A;  3V60 A;  4O3M A;  1XD3 B;  1HUZ A;  2QDF A;  2R8J A;  2KD1 A;  2DEN B;  3QEA Z;  1IUE A;  2HMX A;  1YQB A;  3GOE A;  4JWU C;  5L83 A;  3FM9 A;  4O0I A;  1XEE A;  1FD6 A;  2V9W A;  4ZH4 A;  4KSL C;  1X40 A;  1OQR A;  5MPO A;  2H3V A;  5AI4 A;  1VZ7 A;  2J6S A;  3SFD B;  2WDV B;  1TAQ A;  5H92 C;  5BYS A;  2LVO A;  1T3Q A;  5KFQ A;  1YX6 B;  3ENE A;  4F4X A;  2RDB C;  5K4L A;  2W43 A;  1N48 A;  4BXO B;  3A9K A;  3K75 D;  1L8L A;  4QZA A;  3AQE A;  1NZB A;  1Z00 B;  5HMM A;  1ZQV A;  2QC8 A;  2V4L A;  4Y2S A;  3DPD A;  2OJW A;  1RYJ A;  2JXT A;  3Q3F A;  4BAX A;  4HYK A;  1UNS A;  4ZOH C;  4DFM A;  2KX3 A;  2N9P C;  3JW0 X;  5IA7 A;  5LXI B;  5DBC A;  2PFO A;  1LB2 B;  3NTU A;  1L3V A;  3P63 A;  4CQN A;  2NPT A;  2XY7 A;  4IM2 A;  4QZ8 A;  4YSZ B;  1HE8 A;  4YMO A;  8ICY A;  4GOC A;  4FUL A;  4TUQ A;  2BQR A;  2KQ7 A;  3WK4 A;  2Y1J A;  4UDU C;  3T3O A;  3ZDT A;  3E58 A;  1UPH A;  3C1Y A;  4Q45 A;  4FLH A;  2MRP A;  2J4X A;  2Q0Z X;  1ZOY B;  2A1A A;  4QWD A;  3EHV A;  3H7P A;  1KQQ A;  3PZP A;  4EBD A;  2YN4 A;  4EX7 A;  1WCN A;  1SWV A;  2P66 A;  4K3B A;  3ZXR A;  4NWI A;  2KV2 A;  1AAR A;  2W7P A;  1RXV A;  5IIJ A;  1SGG A;  3C2M A;  1XSL A;  4O1N A;  5D3I B;  1VJK A;  4ECX A;  5J0P A;  2K8C B;  4MAC A;  2I1J A;  1DOQ A;  4GB9 A;  5J8Y C;  3UQA A;  3N28 A;  3QU2 A;  2FCS A;  3NVY A;  3LXF A;  3AEA B;  3TQ1 A;  2L05 A;  2NS5 A;  1KFD A;  4OJ5 A;  3W1S A;  4F4Y A;  4KGT A;  3V62 A;  1XWL A;  4LTU A;  1NKC A;  3QAQ A;  5B66 U;  4JQW C;  2ZZP B;  2KTR B;  3T5H A;  1Q3V A;  4C0Z A;  1ZQF A;  4FN2 A;  3B1L X;  3C1Z A;  3ZDM C;  1U45 A;  1JML A;  1GPX A;  1JRP A;  3VC8 A;  1P0R A;  1F1H A;  3X23 A;  4M9N A;  4NM2 A;  1J7B A;  1WE6 A;  4KVG B;  4RU9 A;  3IV6 A;  3KWL A;  2W9C B;  3NY5 A;  2XC9 A;  1ZPS A;  2EAN A;  4NLZ A;  4BKT A;  3H7S A;  5KG1 A;  1C7Y A;  1JWU D;  2KFJ A;  1FPY A;  2BPS A;  1Q46 A;  1NJW A;  4M00 A;  2K22 A;  2RPQ A;  4UB6 U;  1C76 A;  4W9C A;  2OEH A;  3L54 A;  2Y0S F;  1D8Y A;  7ICL A;  5F9L A;  1XO0 A;  2VA3 A;  4MJS A;  1JN3 A;  1ZYQ A;  2LGS A;  1TKY A;  1XCQ L;  4W9H A;  2HHS A;  2DFL A;  3PHW B;  4RGM A;  1PZN A;  2Z0E B;  4UAW A;  3L08 A;  2PI4 A;  4MH8 A;  1V9J A;  4S0R A;  5FKA C;  4F72 A;  3N7S C;  3IBE A;  5KFY A;  2PVG C;  5EDS A;  4F71 A;  3RJG A;  4U6P A;  2NRV A;  4M9L A;  1FXA A;  4F50 A;  2C60 A;  2IBI B;  3IG8 A;  4XQ8 A;  2BDP A;  1KJT A;  2PFN A;  5J0Q A;  3IM1 A;  2MBE A;  1ZQL A;  1S76 D;  1MVK A;  3DDH A;  3LVV A;  2GBM A;  3M3J A;  3U30 A;  2ZIW B;  3SAG A;  2IZV B;  2A1J B;  5J2I A;  4M0A A;  2LYA A;  4TUP A;  5DPS A;  5FK9 C;  2LI5 A;  3M1Y A;  4JWS C;  4HXD A;  4G9B A;  3B9J A;  5DG8 A;  4P2H A;  4MGK E;  2JEJ A;  1XO1 A;  4C80 A;  4MGI E;  3M63 B;  4B0E A;  2ES6 A;  4UB4 A;  2DGZ A;  2ONQ A;  5AM4 A;  3OLM D;  4IW0 A;  2KJ8 A;  4OVU A;  2XN9 C;  1ISN A;  4WIP A;  1P3Q U;  1QSL A;  4KDL B;  3HIZ A;  4Z6D A;  4GIV A;  4NXZ A;  1H4R A;  2BWF A;  5BPC A;  3BZC A;  1TVA A;  2M17 A;  3PS6 A;  1WJ4 A;  2EEL A;  2W3R A;  1S97 A;  1QSY A;  1AYF A;  3WAP A;  3AE2 B;  2HVI A;  1TKE A;  5KFO A;  3QWZ B;  2C2R A;  1S3S G;  3DBR B;  3KZX A;  5DQH A;  2GMI C;  2BYE A;  1TYG B;  2KVC A;  1TK0 A;  2ZPN A;  2CN1 A;  3C28 A;  5CP2 A;  3AED B;  1KTQ A;  2BS2 B;  1Y56 A;  3J9C A; 
#chains in the Genus database with same CATH homology
 4A9A A;  3V3X A;  1V1P B;  1D5Z C;  1MHX A;  5D7G A;  2LFI A;  3GS2 A;  1FIQ A;  2D5G A;  2WXG A;  3VRA B;  3IT4 B;  2VZK B;  2SEB D;  4US9 A;  4YT0 B;  2W55 A;  2KMM A;  4HEA 1;  4C7Z A;  2JX5 A;  2L1A A;  1SE3 A;  1TZO A;  5EE1 A;  5AUI A;  3IAS 1;  1QQR A;  3TEW A;  2WXQ A;  3PO0 A;  4IKG A;  2V0G A;  5HG2 A;  2QMT A;  2L32 A;  4OW0 A;  2E3T A;  4L1B A;  2JZP A;  1SBB B;  2HTM E;  3AE4 B;  1QKZ A;  1TY2 A;  3KWV A;  4H2A A;  1CZP A;  1HQR D;  1MHH E;  1STE A;  1I4Q A;  2QIE B;  1FNW A;  1RFK A;  1M4V A;  1E6E B;  2WXK A;  1K53 A;  1L6V A;  3TEZ A;  1DOX A;  3NZ3 A;  2MJD A;  2KWD A;  4JE3 B;  2PMV A;  1YJI A;  2WQY B;  5HHD G;  1SE4 A;  2Y5P A;  1UUP A;  3AE8 B;  3KLS X;  3Q8E A;  2V3N A;  1JW9 D;  1A70 A;  3Q8B A;  1FFU A;  3NRZ A;  2E6X A;  1ZUD 2;  1YNT E;  3WCQ A;  4RF1 A;  4YWG G;  4R3D A;  5HFY A;  1V1P A;  3AH7 A;  3LYY A;  2LJI A;  4RH6 A;  1ZXI A;  1I4R A;  2SAK A;  2PKO A;  3ZQ4 A;  2JWU A;  2CU3 A;  3Q8C A;  4YTP B;  1SSN A;  3GP7 A;  3VR8 B;  1FRR A;  2BS4 B;  1HXY D;  4P6V F;  3BYY B;  2L83 A;  3MP9 A;  1FRD A;  5E6J A;  3TEY A;  1SB3 C;  3BII D;  2K0P A;  2WXR A;  4KKJ A;  3BWU D;  4NJC A;  3H8H A;  1FNU A;  2MJ3 A;  3E56 A;  1PUT A;  1CK1 A;  1PDX A;  2GB1 A;  1JAL A;  4KGS A;  5BYR A;  2PLP A;  3AE6 B;  2DLB A;  1WWT A;  1IBX B;  2OED A;  2AQ1 B;  1JCK B;  2N0S B;  2KAC A;  2NMQ A;  3Q8F A;  2NTT A;  4MT5 A;  1P7F A;  1D6E C;  1EU3 A;  3EA6 A;  2GI9 A;  3DWG C;  1C4P A;  3ZJV A;  1N62 A;  1ZP0 B;  3R8B A;  1F2R I;  4L2Y A;  4RGT A;  1N5X A;  3I57 A;  3BZD B;  2LHE A;  1FXI A;  1OQQ A;  3AEG B;  3J9C A;  5EE0 A;  4B0M A;  1TS4 A;  4AQ7 A;  1J7C A;  3U4E G;  1FCL A;  2M0A A;  1C77 A;  1KLG D;  3ZJU A;  2N9K A;  4D2K A;  4USA A;  1ZE3 D;  2MEK A;  4OZC A;  3AE7 B;  1YMH E;  1JWA D;  3AE9 B;  1FM0 D;  2JU6 X;  3ABV B;  3B2F A;  3AV8 A;  2KQ4 X;  1QOF A;  5HI1 A;  1SJE D;  2IGH A;  2K9X A;  2BBC A;  2WP9 B;  2VZK D;  2QJL A;  2AQ3 B;  3P4S B;  4RCO A;  4ZRQ A;  2J52 A;  4A6Q A;  2R61 A;  4LLG M;  4N59 A;  2LUM A;  2V3P A;  1DGJ A;  2WXP A;  1EWC A;  4ZRP A;  2IDY A;  1TKG A;  3I9V 1;  4OZA A;  4DQO C;  5TSS A;  1WSP A;  1C79 A;  4IOI E;  1IBX A;  2DYO A;  2Q5W D;  2FUG 1;  1WXQ A;  4RGO S;  2FE8 A;  5D3D A;  2LGI A;  1VLB A;  4ZHP A;  5C3J B;  2DWQ A;  4FXC A;  4L23 A;  1J7A A;  1BXT A;  1QOB A;  2JSV X;  4C7Y A;  1GAQ B;  3AE5 B;  3PZ7 A;  2DYM A;  3AE1 B;  5BYQ A;  1B9R A;  2TSS A;  3NUH B;  1EU4 A;  1GB1 A;  1XCT L;  2OHF A;  2JQR B;  3VR9 B;  4DXF A;  1K50 A;  2N9L A;  1PGX A;  4A55 A;  2BYT A;  1YN4 A;  1FO4 A;  1SEB D;  3NVW A;  3E9S A;  3ZYY X;  5LNK 1;  2ON8 A;  1MI0 A;  2BB6 A;  4GDL B;  3FIL A;  2V4I B;  3W5U B;  2BT6 A;  1ZXH A;  1CJE A;  1C4C A;  1PGA A;  2WXI A;  4ARI A;  4HKQ A;  5EE9 A;  1HZ5 A;  3TSS A;  3AEE B;  1ENF A;  2ZW0 A;  3SR6 A;  2RDH A;  1HA5 A;  4WAF A;  3U52 E;  2QIL A;  3SEB A;  1JQ4 A;  1ZDX A;  3MHZ A;  2M56 B;  4RF0 A;  1I4P A;  1TS2 A;  2MH7 A;  1XLN A;  3BVM A;  2IGG A;  2INP E;  1BUI C;  2IPK D;  2WXM A;  1P7E A;  2RMM A;  2G1E A;  1N63 A;  1NEK B;  3CWI A;  3VRB B;  1QIL A;  1PFD A;  2LHD A;  2WS3 B;  1UWX A;  2Y5C A;  4M0W A;  1N5W A;  3V05 A;  1D4B A;  1V1O A;  3U7Z A;  2X38 A;  3P1M A;  1IGD A;  3LB8 C;  2CJN A;  4REZ A;  1VZ8 A;  2RPV A;  1V8C A;  3O13 A;  2J53 A;  1TS5 A;  3AEF B;  1NYR A;  1SF0 A;  1KFY B;  5H8Y E;  1DYQ A;  2I38 A;  2WLB A;  3W9C B;  1TJE A;  1YQ4 B;  1VDV A;  4HKZ E;  2WDR B;  2AX5 A;  4ZHO A;  3ETR A;  3MJ5 A;  2K3U A;  2PVO D;  2QSD A;  3EGR A;  1JWS D;  1ET6 A;  1ZDV A;  5C2T B;  2I2Y A;  1I4X A;  2WXH A;  4ZYS A;  2BTE A;  1VR9 A;  4YSY B;  1JWB D;  4JPS A;  4RNA A;  4IDI A;  4WQM A;  1R7S A;  3HRD D;  2KAJ A;  1E0Z A;  1D5X C;  1WRI A;  1WYG A;  2HDE A;  3MFG A;  1WGK A;  4N6E B;  1L6U A;  1TY0 A;  4PT5 A;  2WU2 B;  2WXN A;  1VZ6 A;  1E7P B;  1B1Z A;  2J42 A;  3MC0 B;  4C56 C;  4HRS A;  5G5H A;  2EKI A;  1SJH D;  4RFB A;  1EM7 A;  4TQ1 A;  4J3O D;  1GB4 A;  5EE3 A;  1T6B X;  3TEX A;  3NVZ A;  1I4H A;  5BMH A;  3AB5 A;  1EWY C;  3P4P B;  1IUE A;  4JWU C;  2WXF A;  3ZGZ A;  3TUO A;  3FIL B;  4GDK B;  1XEE A;  1XF5 L;  1FD6 A;  3IXS A;  1OQR A;  5MPO A;  3BVG A;  4LK0 M;  1VZ7 A;  3SFD B;  2WDV B;  5H92 C;  5BYS A;  1T3Q A;  2H88 B;  2L52 A;  3Q69 A;  2XNA C;  1KH0 A;  1KRH A;  2G9H D;  4OZB A;  4EE2 A;  4WH4 A;  2PTL A;  1FCC C;  1GOZ A;  1NI3 A;  1RYJ A;  2JXT A;  1NVI D;  4NAM A;  1QOG A;  2BW2 A;  4TSS A;  2W3S A;  1UNS A;  4ZOH C;  2GRI A;  1QT9 A;  1AN8 A;  1L5P A;  2NTS A;  2JYE A;  4CQN A;  2AQ2 B;  3P63 A;  1LO5 D;  2YEP F;  4XDC A;  1QF6 A;  1I4G A;  3AE3 B;  3N9Y C;  4YSZ B;  1IGC A;  3Q8A A;  3P4Q B;  1HZ6 A;  2IGD A;  4RGN A;  1N61 A;  1T5X D;  4MM3 B;  4UDU C;  3T3O A;  5BMI A;  1YN5 A;  3URY A;  1FEH A;  4WUR A;  2LEK A;  4Q2J A;  2RDG A;  1L0Y B;  2J4X A;  5FR3 A;  1JRO A;  2INN E;  1ZOY B;  3DWM A;  4YSX B;  1F77 A;  3UI3 A;  3PZ8 A;  2Z8L A;  4XWT A;  1KLU D;  2ACZ B;  1AW7 A;  2WU5 B;  1I7H A;  2IJ0 A;  3FC4 A;  2DBY A;  4US8 A;  4O1N A;  3AN1 A;  5D3I B;  1VJK A;  2KN4 A;  4WWM A;  4KGR A;  1ESF A;  1UGJ A;  4MAC A;  1F2R C;  1XLQ A;  4HRO A;  1C4A A;  1FFV A;  3NVY A;  1XXG A;  3AEA B;  3LXF A;  1K51 A;  1KF6 B;  3W1S A;  4KGT A;  5G5G A;  1XLP A;  1ACC A;  1FMA D;  2YEP B;  3GB1 A;  4JX1 C;  4LTU A;  1D5M C;  1E10 A;  2H89 B;  1BML C;  1JWM D;  1KTK A;  3RFZ B;  2WDQ B;  1SIJ A;  3HUI A;  4TMA B;  4A8X C;  2WXJ A;  3IAM 1;  3R2I A;  1XLO A;  4OHJ A;  1GPX A;  1JML A;  1JRP A;  1SE2 A;  1E9M A;  2QEJ C;  1J7B A;  3RPF C;  4DXG A;  3KWL A;  2ICI A;  1L4D B;  1SXT A;  1ZPS A;  1N60 A;  3AEC B;  2PW9 A;  1QLB B;  4NAW B;  3L4P A;  3AEB B;  1CQV A;  1JWU D;  1L0X B;  4KKI A;  3IT6 B;  3R2T A;  2CJO A;  2N7J A;  2K22 A;  2Y3A A;  2WXO A;  1C76 A;  1K52 A;  3T3N A;  1F0Z A;  3OWE B;  3EUB 2;  4AS1 A;  1ET9 A;  4GLS C;  1FNV A;  3P4R B;  3BYT B;  3FAH A;  1Q10 A;  1RM6 C;  1TKY A;  1XCQ L;  2W82 A;  2KDM A;  3B2G A;  4RGM A;  2BS3 B;  3AMZ A;  4MH8 A;  5FKA C;  3BVZ A;  2PVG C;  1UWM A;  2MJE A;  3C8Y A;  3VQI A;  1FXA A;  1DOI A;  4KX6 B;  1MVK A;  2WNM A;  3BK1 A;  3W5V B;  1C9F A;  2K5P A;  1MPE A;  1YQ3 B;  3CIR B;  3HVZ A;  5FK9 C;  4JWS C;  1PGB A;  1YN3 A;  3B9J A;  5BMG A;  4TQ0 A;  1AWD A;  2JYT A;  4NZL B;  4C80 A;  1NYQ A;  3SFE B;  4B0E A;  1C78 A;  4XDD A;  3NS1 A;  2WXL A;  3U2S C;  5AUK A;  3ZJT A;  1L0V B;  1OFF A;  2ONQ A;  3P42 A;  3NVV A;  2W54 A;  4N58 A;  4A90 A;  2XN9 C;  4YXD B;  4WIP A;  5JXV A;  4XE0 A;  2LMC A;  1V97 A;  4YTM B;  4ARC A;  3HVD A;  1TS3 A;  1HEZ E;  1QOA A;  2M19 A;  4ITK A;  4XWW A;  4YTN B;  1PYW D;  1L4Z B;  1ROE A;  2EEL A;  4HJG E;  2W3R A;  1AYF A;  2FBW B;  3AE2 B;  5GXG B;  5T8I A;  1TKE A;  2PIA A;  1VRA B;  3BK2 A;  3W2D A;  5I4D A;  1TYG B;  1XO3 A;  3KQ4 A;  2ZW1 A;  1RWS A;  3AM9 A;  3AED B;  1YJJ A;  2BS2 B;  4P16 A;  4OVZ A;  1Y56 A;  1DOY A;  2B76 B;  1NEN B;  2BB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...