3NVWA

Crystal structure of bovine xanthine oxidase in complex with guanine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvwA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvwA01
3P63A 2DWQA 1V97A 1VDVA 4HROA 2HTME 3NVZA 1YQ4B 1JQ4A 3AEDB 3NS1A 1J7BA 2WDQB 1A70A 4IDIA 1VJKA 1OQQA 1N61A 1OFFA 3P4RB 1F0ZA 2WQYB 1L6VA 2MJDA 1L6UA 4N58A 2OHFA 1SIJA 3LXFA 5AUIA 5G5HA 1FM0D 1RFKA 4ITKA 3FC4A 1NYRA 4YT0B 4WWMA 4YTNB 3L4PA 1QOGA 1QOAA 1WXQA 1QOBA 3B2FA 3AECB 1JRPA 3W5UB 3P4SB 1DOXA 1ZUD2 1JWBD 2W54A 4US8A 4FXCA 1GPXA 4USAA 2WDVB 3BIID 4US9A 2L83A 4JX1C 5EE0A 1RM6C 2JQRB 2KMMA 1CZPA 2W3RA 4ZHPA 3P4QB 4YSYB 1EWYC 1KF6B 1N62A 3AE7B 1XLQA 3VR8B 1RYJA 1ZXIA 3FAHA 3DWMA 1NEKB 1XO3A 1N5WA 2AX5A 2DBYA 1NYQA 2M56B 3LB8C 1FIQA 1L0VB 1TKYA 1XLPA 5C2TB 3P4PB 1ZOYB 1FXIA 3B9JA 4C7ZA 5H92C 4JWSC 3AM9A 1N63A 1V8CA 1WWTA 5EE9A 3VR9B 1QT9A 3DWGC 4YTPB 2WU2B 1N60A 1WGKA 2BS2B 3AE9B 1E10A 3AEAB 2MJ3A 2MH7A 3AEEB 3CWIA 2QJLA 3AE2B 3VRAB 3B2GA 1FO4A 2CJNA 4JWUC 4YSZB 1JROA 2WDRB 1FRDA 3AE5B 5H8YE 3NRZA 1L5PA 1R7SA 1WRIA 1NI3A 1E6EB 1XLOA 3PO0A 4C80A 1NVID 3SFEB 1N5XA 1YQ3B 2Y5CA 5EE3A 3AH7A 5G5GA 1FXAA 3W9CB 1TYGB 3RPFC 1RWSA 2LEKA 3P1MA 5C3JB 3AN1A 1B9RA 3AB5A 2FBWB 3ZYYX 1PFDA 3AEBB 1QOFA 1DGJA 1AYFA 1FRRA 1SF0A 2K22A 1NENB 1DOIA 2BT6A 2PKOA 3AE8B 1VLBA 1I7HA 1E7PB 1KFYB 3VRBB 4ZHOA 1QF6A 1TKGA 4YXDB 2WLBA 1TJEA 2E3TA 1J7CA 2MJEA 3AEFB 5EE1A 4YSXB 2EKIA 4KX6B 1XLNA 4N6EB 1ROEA 5MPOA 2Q5WD 3CIRB 5GXGB 1QLBB 2N0SB 2W3SA 3NVWA 2G1EA 2H88B 4YTMB 1JW9D 4ZOHC 3AE4B 3KWLA 1FFUA 1GAQB 2PVOD 1AWDA 2BS3B 3SFDB 1T3QA 2WP9B 1FFVA 3ETRA 1ZP0B 4HRSA 1YJIA 3AE3B 1FMAD 3AMZA 2PVGC 1SB3C 3NVYA 1TKEA 1JWAD 3NVVA 1JALA 3AE1B 3EUB2 1PDXA 2K5PA 1PUTA 3SR6A 5AUKA 2WU5B 4WQMA 1DOYA 2M19A 1E9MA 3AV8A 2CU3A 4C7YA 2QIEB 1KRHA 2BS4B 3W5VB 4A9AA 1OQRA 2KAJA 3HUIA 1UWMA 2W55A 3AE6B 2WS3B 2H89B 4LTUA 2B76B 2L52A 1WYGA 4P6VF 3WCQA 4N59A 2ACZB 2CJOA 3ABVB 1J7AA 3AEGB 2PIAA 3HVZA 3HRDD 1E0ZA 1YJJA 2K9XA 2JX5A 1CJEA 1IUEA
chains in the Genus database with same CATH superfamily
3SZ2A 3HWTA 1D8LA 4Y2PA 5ALSA 3QZ7A 4B9TA 4MF8A 3QJZA 2GLEA 3H8SA 3MC1A 1S9FA 5FKAC 3MR3A 3APDA 1OTRB 4ELTA 2HHQA 4C8OA 1HIWA 1RYRA 1DK2A 4CRXA 3BINA 2ZTDA 4TUSA 1LV5A 3Q8EA 1N56A 2KD0A 1WIAA 2MBEA 4RMAA 4FBTA 2WXIA 4NY8A 1RFKA 1UT8A 3ZXVA 5F9NA 3HK0A 4NL9A 2UU7A 3KQ4A 3B2FA 2KN4A 4BWJA 4BGDA 4US8A 3UQ2A 2AGQA 2EZXA 2FPLA 1SJHD 1D6EC 1YNTE 2RR9A 2JSVX 2JR5A 2K4PA 5J0SA 3MR5A 2Z8LA 3H7PB 2LFIA 1TTNA 3K1ZA 5DB9A 3Q8RB 1NEKB 3VQIA 3ZNZB 4FS1A 1ZQAA 1L6NA 1XLPA 4W9DA 4KLJA 2Z0DB 5JHBA 1GC6A 3DWGC 2AQ4A 9ICHA 4OZBA 5DGAA 4Q44A 4Z6EA 1IP9A 3VRAB 3ONNA 3HKZF 4KZCA 3PLVA 1U9LA 1N48A 1R4NB 4C0ZA 2KVSA 2AU0A 1TIFA 4YFKA 2RDGA 4IWQA 2DYBA 2EAMA 2VIXA 4PZOA 2KOBA 2JZBB 2CRXA 1K51A 3AN1A 2CR5A 2OYYA 3EW9A 1S77D 5AKXA 3QWZB 4GDKA 4M9NA 2XK5A 3A1QA 1P9DU 2M1MA 3AE8B 3L16A 1UBQA 4I6PA 5KFNA 4M00A 3UIPB 1JUDA 3BWUD 4MH0E 2MBQA 2M17A 3PR5B 4BBNC 2JT4B 4EBEA 4DSFA 2BPGA 4ZYSA 4CHKA 1M6YA 4FZNA 3ISDA 2HHTA 3DEEA 1WGHA 1QLBB 3BZDB 3R2IA 4OW0A 4JWMA 2KKPA 2H88B 4R63A 2RLTA 2KQSA 1ZQOA 1Q8KA 3MHZA 4YMMA 2PMZF 4F5NA 2HHXA 2BB6A 1JN3A 4UASA 1ZGUB 2LM4A 3C29A 4HRSA 4P1BC 1FNUA 3OAWA 1FCCC 1A77A 4TUQA 3NVVA 1UPHA 3EUB2 5ALYA 5JXVA 2DZJA 3B0AA 3CRXA 4RGTA 5HP4A 5CWRA 4ZRKA 3AI5A 5BYSA 2W04A 4NM1A 4DL6A 1RRBA 4F92B 3BYYB 1J2NA 4LDTD 3W5VB 4DFPA 1CI4A 2HJ1A 3PR4A 3AE6B 3URYA 4YR2A 5EWGA 4M04A 2EH9A 3KWVA 4QZFA 2ACZB 4A20A 4UB8U 2FMQA 2JX5A 4DHZE 2HHVA 3ZI4A 3OSNA 1YZ6A 1HZ5A 2QARA 3IP4B 1E8WA 4L1BA 2YMMA 1J2MA 2G45B 2OOBB 4FULA 4EBDA 1LKYB 3KTQA 4B9SA 1Z2MA 1KSPA 2LZ6A 2QILA 3RJKA 2L0FA 4EEKA 7ICVA 2BW2A 3IT4B 4RQ8A 4TUPA 2K8BA 1SXEA 2B3AA 2DZIA 3APFA 3T8MA 5AM1A 3W5UB 2AL6A 4IS7A 2W54A 1NNLA 3K75D 1UQVA 3I76A 1C20A 1M94A 1KTQA 1B0XA 2LASA 1WM3A 2WXLA 3HIZA 3QK0A 1I4QA 3GZNB 5IIIA 2KN7A 3CF6E 3PSFA 3H0RB 2XCAA 3NZ3A 3VFKA 4ED6A 8ICFA 4U6PA 2GRIA 3MC0B 4QIWF 2NBVB 2KE7A 1L0VB 4RQNA 5DPSA 2KLCA 2RSUA 5C23A 1Q0WB 2UVWA 4NPNA 4I2FA 4GMVA 2JH1A 5ALKA 4B6WA 2WXMA 4KVGB 4JWUC 2CJNA 3QE9Y 2KJHB 3WAPA 4GU2A 1ZQEA 3Q8MA 2AQ1B 1UT5A 2WNMA 1GB1A 5KL1B 2HBMA 4DSIA 1IM4A 2Y3AA 1T7PA 4I2EA 2R2OA 4GC6A 4PGYA 1NBFC 3PW4A 2RDIA 4PK1A 3H7SA 1P98A 2E1EA 5HI1A 3WANA 1VZ8A 3TUOA 1I42A 1HQRD 4K3BA 3PVXA 1PGBA 1WCNA 1C79A 1Z1BA 1QF6A 1FPYA 5KFHA 5AK6A 2MJEA 3GIJA 5KFFA 3LYYA 1V85A 2AXTU 1KJTA 3TEZA 4O3NA 5JTIA 1DRGA 3NRWA 1BNPA 3PVLA 2DKXA 2KXJA 3HM3A 3MFGA 2C28A 3PHXB 1FCLA 2W3SA 1XWLA 5KAIU 2HW3A 3QUQA 2AJQA 2H5XA 4RH6A 5D7GA 2ONQA 4I2DA 4BJQA 4TSSA 1XO0A 2JEJA 4B9VA 3PSEB 2LUEA 2J0MA 1LXDA 3A9KA 1SB3C 3N7SC 2LMRA 2K5PA 1EWCA 4IQUA 2RMMA 3RRHA 2NYVA 4F1SA 5IIKA 4J9MA 4CDGA 2LD9A 2B6GA 2KHVA 2KFJA 1P3QU 4DQRA 5J17A 3M6ZA 3DHHC 4HJKA 1SE2A 3SQIA 3WCQA 1COKA 3IAS1 5KHQA 1C4AA 3RBDA 2M4NA 1VDVA 3Q8LA 1M4VA 2QB0B 2DENB 4UAUA 3I57A 4X5VA 5KNIA 2LJ5A 1BPBA 2ZJAA 2XGQA 1D8YA 4BXOB 3GE3C 4WQOB 4UBBA 1LO5D 3BVZA 1L6VA 2V9WA 2L0TA 2NO5A 3R2TA 5J0RA 3H4DA 1UWXA 4I28A 2PE6B 3R7QA 1WG8A 4XWWA 4ED1A 3PO4A 2JPHA 3BZKA 3Q3OC 1VZ7A 2KVZA 4UB1A 4NLCA 1XU4A 1MQ2A 1F77A 1WCLA 3Q3MC 2YMQA 4CF5A 4HDQA 1P7DA 4Q45A 1F1HA 5J0TA 1YN4A 2IBIB 5KG6A 1SE3A 4R65A 5L1IA 4KTQA 2C5LC 5AM2A 4MT5A 2WHEA 4L23A 2NRXA 2EQYA 4QNLA 3NY5A 4BX9C 1SZHA 4O5EA 2FLPA 3ZXRA 3P4PB 4HPMB 1Z00A 1ESFA 2AGPA 4PL2A 2BS2B 3QNMA 2OEHA 4C8LA 1X2IA 1WYWB 4GN1A 3UXNA 1WGGA 3RZWC 4KSKC 4QZBA 2IBKA 2MQJA 3HILA 3CMMB 8ICPA 3KVFB 5D3DA 1NI3A 1STEA 5AICA 4C80A 3SFEB 1GO3F 4DXAB 1ZQLA 2BPCA 2HVIA 5KFOA 3A4RA 4KLFA 4G3XB 2C7MB 5IN7A 1TYGB 4XRHA 3BQ0A 1RWSA 2DLBA 4M47A 4EFOA 2G0AA 1V38A 4P0QA 3GB1A 4K81A 8ICVA 2JYEA 4ICUA 3UQAA 1WGDA 4LDTB 2HTHA 1WJ4A 4GLXA 1VLBA 3KYCD 2C7NB 4OO1J 2F44A 1QZEA 2KC1A 2NTSA 1A5RA 2ESEA 2FDRA 3AULA 1WGRA 4J9NA 5T8IA 5MPOA 1Z19A 1WXMA 3DHIC 3R8BA 4AQ7A 3IAM1 2OCEA 1MN8A 4NM2A 5CP2A 1UZXB 1V1PA 2MSED 1V81A 3C5GA 1BGXT 3PT2B 1AWDA 2GBKA 4HKQA 5E6NA 2EAOA 5AKZA 3L17A 4M0WB 4KMUA 1IBXA 4HDOA 4RQ1A 1X9XA 3ICXA 2W9BB 8ICBA 3UMBA 5AUKA 1T5XD 3F53A 5AIAA 3RH6A 2QDFA 4MGKE 3H4BA 3N3KB 4WJ3B 2ZIWB 2QHOA 3KOOA 2AWTA 2BYVE 2BWFA 2PMZC 4GB9A 5J8YA 4KLUA 1WYGA 2Z7JA 1UGJA 2IPKD 4EUTA 1TV9A 4NJ6A 1Q5WB 1KOTA 3SU8X 1XXGA 3PS6A 4RQMA 4OJLA 3SI8A 3P63A 1HE8A 5AEKB 2MEKA 2BDPA 2V4LA 3RJEA 1P1AA 3TFRA 3DQVA 2AL3A 1A70A 4UQGA 4KLIA 2LVOA 2F1JA 3RMKC 1F0ZA 4M6WB 4IM2A 3S2AA 3NASA 2ZW1A 2GH1A 4KLHA 1WFYA 2KMCA 3IM1A 5AUIA 2V0GA 4YT0B 4UDUC 1WXQA 1VR9A 2WF7A 5DG9A 3AUOA 3B0XA 2INNE 3EECA 2OXOA 5EE0A 3FM9A 5J2JA 4F5RA 4Q43A 2KMMA 2GI9A 1JX4A 5IOIA 1N62A 4ECSA 5DQIA 3VR8B 1HUZA 2FIDA 4S17A 1N5WA 2JRHA 5IILA 1X6IA 1ZD2P 3U8ZA 1N63A 4TURA 5E6OA 3RCZA 5HHDG 1TZOA 2IA6A 4TQRA 1Z1VA 3B2GA 3C2KA 2WDTB 3ZTCA 1ZQKA 2N9PC 3AE5B 2N1WA 4QIWC 2RHFA 2KDIA 3U52E 5EE3A 3Q8PB 3QYPA 1FXAA 1KL9A 3RPFC 4F7ZA 3MTNB 3TANA 2OWOA 3BQTA 3ML9A 1TFRA 4KX5A 4YCXA 5AM3A 3M9MB 4QWAA 4P7IA 2PKOA 2FPKA 1I7HA 2KDBA 3Q8CA 5KFZA 2LI5A 3WAOA 3LDZE 3I9V1 1KFDA 4ED2A 1YJ1A 2J52A 4N6EB 2Q5WD 5ALHA 3L0WB 2IOHA 2DZKA 5HKHA 3HX0A 2QEJC 1X6JA 1I4PA 1X9WA 1ZQVA 3C5FA 2FCQA 1WJUA 3JYUA 4O3PA 2W9CA 1UCVA 4E3CA 2HD5B 2Q0ZX 3NJTA 4AJYB 2PXIA 1TAMA 3IXSA 4TV3A 1U48A 5KFSA 3GS2A 3LWMA 2DYOA 1ZDVA 2YB4A 5CHVC 2VJ5A 5CHFA 4ED0A 5TSSA 4KLGA 4GDKB 1Y56A 2HSZA 4NAWA 1UWMA 1IGDA 2XK5B 1RYSA 4J9QA 3A1QB 3VTVA 4MGIE 4HYKA 8ICZA 2JY6A 3Q8AA 2ZCCA 5E6JA 1I35A 3UF8A 5AK3A 3QU4A 1TS4A 4ELVA 3CSTA 2KFNA 1BPDA 4RNNA 1J7BA 2LRUA 3QU5A 3MGIA 1VJKA 3V3XA 1GC7A 1NOMA 1C78A 2MJDA 3LDAA 3ZLZA 2B21A 5AKJA 1E8ZA 3JSVA 3ZD8A 1E8XA 1V9PA 3M8RA 3DBLI 4PH5A 4O9MA 2I2YA 2MAXA 3AQEA 2FAZA 4II3B 4TUUA 2IYDB 3EWAA 1OUQA 2C60A 2L00B 3PMNA 5D4BA 3MJ5A 1RM6C 3RFAA 1XSLA 4RQ2A 3GIKA 4JE3B 1ET6A 3P4QB 1BPXA 4ECRA 4MFFA 3QEAZ 1S0MA 3AE7B 4LCDE 3ZIMA 5JHAA 1QQ6A 3SV3A 1SWWA 3PSTA 1D4BA 1HJPA 2EAPA 4QW9A 5JH5C 1GG3A 3LB8C 1U47A 3N1YC 4KITB 2QARB 2OJRA 7ICJA 3IG5A 5DPRA 3AM9A 5JRTA 1V8CA 4ECUA 2JXJA 4C8MA 4UAVA 2N4FA 2G9HD 5TISU 5KFKA 3TAPA 4ECQA 1XSPA 4IUMB 5J2IA 5IP4D 1DYQA 2K8BB 4XA5A 1HEZE 1ZYQA 1TAQA 1ZQTA 4BKSA 1HTOA 3ZDEA 5KFLA 3AH7A 2D3AA 3WK7A 4JMUA 4DOAA 4ELUA 1S1QB 3HM6X 2KACA 3RNAC 1V1OA 1MG4A 9ICSA 2A19A 5ALOA 3IV6A 5AI5A 2W8LA 1E7PB 2E8NA 1SGGA 2IOFA 5KFQA 1TJEA 3AEFB 2KFKB 3BS5A 1HUOA 1C7YA 5ALNA 3T5KA 5J0PA 4F5QA 3GIMA 4KIKA 4A3OA 4CF4A 1JW9D 1U4BA 3EZ5A 2AEHA 2LXCA 4C8NA 1DXSA 2K3UA 4DDID 1ZQQA 1SE9A 1FFVA 1QH9A 3ETRA 2AQ0A 5DG8A 3MR2A 1T6BX 3LYSA 2XY7A 3UPQA 2YLMA 2X8XX 5EWFA 4GXBA 2KD1A 2LYAA 5J0UA 3B1LX 1DOYA 4KLQA 4DEZA 3NS8A 3QUBA 3WKEA 4JL9A 4C7YA 2D11A 3ZKJC 2K0PA 1BMLC 3C21A 4PPXA 2MRPA 1OGWA 4PHPA 1S0NA 1V5OA 2OM6A 4P6VF 3VUYA 1C4CA 1L8OA 5EDSA 3AEGB 1AW7A 1ACCA 5CR0A 3AXCA 3GU3A 3RJIA 1IUEA 3NTUA 1VJ5A 9ICAA 3GFKB 3DVGX 4HKZE 3EYZA 5G55A 2ES6A 1RXVA 2G08A 3PLUA 3QC8B 4RFBA 4QJFB 2KYWA 3IHQB 1SXTA 2RPQA 1OFFA 4Y2UA 1ED1A 3R9KA 2PJHA 1L6UA 4HCNB 5KT5A 2NBUA 2E8MA 3M6KA 1TBEA 3LXFA 3A9KB 3FC4A 1NYRA 3FKYA 4WWMA 4RQ5A 4FZLA 2G06A 3DBSA 1DOXA 1S0VA 1RAXA 5KFIA 1UUPA 4YD1A 3KUZA 1SL2A 2FNJB 1YD8U 3WKAA 4UB3A 1L5UA 2GO7A 4MSMB 5KFXA 2NO4A 4HCPB 4CE6A 3VVWB 4L2YA 1TKDA 1XLQA 2NRVA 3H0MB 2J0KA 4JQWC 2AX5A 4RF0A 4FZMA 4QZCA 4YQWA 2XC9A 3GZNI 3JPNA 5HR6A 3U7ZA 5H92C 1C77A 4E71A 2ZZPB 3UXOA 2VA8A 3ISBA 4JGHB 2JUOA 4W9CA 2LGXA 1WJ6A 2MJ3A 3ZDBA 5JU5A 4RQ4A 4IR1A 1EU4A 1JXEA 2LHEA 5J2EA 1F0MA 1JROA 4DWIA 4OZAA 2KTQA 2V3SA 2VRRB 3NRZA 1TS5A 3GV7B 2LWPA 4A8XC 4PZNA 4KLOA 3KKAA 8ICIA 1T8EA 2KWUB 4QW8A 3IN5A 1D8BA 1Z4NA 4ANVA 5AKGA 4REZA 4MGZE 1QQRA 5C3JB 3PRMB 3RNBC 3NZUA 4LJPB 2PMVA 3GILA 1SF0A 1WF9A 5KTQA 3K4GA 4IRKA 4NAMA 4ZHOA 3TACB 3IHPC 2E3TA 4IM0A 4PGXA 1U45A 1RDFA 2HI0A 5J2CA 1D9DA 3OJSA 8ICCA 3Q3JA 3RR8A 1X40A 3DV9A 3JPRA 1XC9A 2NPTA 7ICFA 2BYEA 3TADC 1NJWA 2BCVA 1ET9A 1SBBB 4GDLA 3TCAA 1Z00B 5BYRA 2BQRA 3NVWA 5AKYA 3L08A 2YX8A 2LKYA 2UVVA 1FFUA 4LNKA 1GAQB 2ASQA 1HTQA 1KN5A 2C2DA 4D2KA 3GDXA 5AKHA 2BTEA 2UYZB 1UGMA 3PX6A 4U7CA 4I6LB 1JALA 1K1QA 4RQ3A 1NKCA 5BMIA 4Y2VA 1ZDXA 1AQ6A 1XEEA 2XN9C 1TAUA 1QSLA 4XGAB 2UVRA 4P0QB 2YN4A 4XDDA 4ZH4A 4OZCA 3ML8A 4CO7A 2LYHA 2B76B 5D94A 3SD7A 4DCCA 5IINA 3OJ3A 2K8HA 2VJ4A 1FEHA 4M8NA 2PIAA 5BYQA 2PI4A 3T3NA 2MRLA 2MWSB 1MFWA 2DWQA 1QLNA 4KMOB 5ALMA 4OCZA 1KDHA 2FE9A 2D6FC 2HHSA 1S5LU 1YQ4B 3HT3A 3TSSA 2GBJA 4C4RA 3UI3A 1V1PB 5KFAA 2IGHA 5ALEA 3BYTB 1L4ZB 5J0XA 2KK8A 5ALXA 2LUMA 2A5UA 4BKSD 2R18A 1U49A 3DOWA 4OHJA 1ZQMA 5G5HA 2KWDA 3TMPB 2MU2A 3DBRB 3JPSA 1CMXB 3KUCB 3KKAC 3UINB 2CHZA 7ICQA 4DF8A 2WTFA 3TI0A 8ICSA 1SSNA 3PW0A 7ICPA 1XCQL 2WDVB 2VH1A 2NRTA 2IMWP 2WAQF 5CTRC 3WK4A 2HHWA 1OQYA 1V80A 4O5CA 3QA8A 1EWYC 1KF6B 3ETLA 8ICOA 4URKA 5KT3A 3DCGA 1XO3A 3Q6BA 3QCAA 1NJXA 4W9FA 4FO6A 2K4HA 4F5PA 2TSSA 3S6JA 1V49A 1MJDA 2YB1A 3V6HA 4MEXA 1C9FA 1V5TA 2KX3A 2WU2B 5FR3A 1E10A 3APCA 4Q8FA 4LJXA 7ICIA 2KP7A 2IJ0A 4YWGG 5HHIA 3HJEA 1FRDA 2JRIB 1SL1A 3D6JA 1NVID 3V62A 5KT7A 2Y5CA 2WWZA 1ENFA 4KLDA 2WF6A 1JMLA 1WJNA 1JWMD 5DBBA 3F2BA 3CSFA 1KFYB 5D49A 4M01A 4XE0A 4LJOB 2G4DB 3MGHA 4A8EA 2ZIUA 3Q69A 5GXGB 3JVZX 3N28A 5AKIA 2I1JA 1BPEA 4ZOHC 2V3PA 1BXTA 5AM4A 4YG2A 3CYMA 3I5JC 3BJYA 8ICHA 1X1MA 3RUIB 4NNJB 3A4SC 4BUGA 3TJPA 5ALFA 2KDFB 2Y1JA 5KFUA 5J0OA 4LVSA 2N9KA 3IDWA 4LNOA 4IWOA 5IO9A 1NK8A 3V61A 3RB3A 3RNCC 4IRCA 2HBJA 4IC7B 3N9YC 1C76A 3N32A 3V6JA 4A9AA 1E90A 2BZFA 3V7JA 4I27A 4K1RB 2H89B 1WI0A 3RJHA 2JVCA 4GC7A 4ICAA 3N1ZC 4I2IA 2L32A 4LNFA 2K9XA 4UATA 1L7YA 1K1SA 2I1QA 5AM0A 1YN3A 5KG2A 2HTME 2L5YA 2KMAA 2ZXHA 4OJPA 2BQQA 3NS1A 2WHIA 2ZG6A 3HW8A 1D3ZA 2W82A 2ZUDA 4RUCA 1RXWA 5KT4A 3ZDAA 1OW5A 4O3OA 5ALTA 5BOMA 2O6VD 1NK5A 2ZEQA 4EKUA 2W9CB 2D3BA 1NI2A 2MCNB 4EELA 5ALIA 3I1YA 2NBWB 8ICQA 2J42A 3C8YA 2NRWA 5J29A 3L4PA 4TKNA 4W9KA 4MEYA 3M1YA 1QOBA 7ICSA 4ZDVA 4RNMA 2UVUA 5BMHA 4UAZA 1CRXA 3JW0X 2L3ZA 4NAWB 3RN9C 5BMGA 3BIID 4PS7A 4US9A 8ICJA 3A9JA 2L83A 4MJSA 2H3VA 5JZEB 1JMSA 1N2XA 5A0LA 1MC8A 3V60A 2IO1B 2KFZA 1OEYA 4C56C 3CW2C 2ZJ5A 1WXAA 3TEXA 4K4IA 5DDYA 4QWDA 2QLTA 2WF9A 4KV2A 1MQ3A 2PKEA 2XGPA 1WUDA 4OJ5A 3PW2A 1T0RC 2IY1B 5EOZA 4QZHA 1B4FA 2MBHA 5J2HA 3AE9B 3RNEC 1WX7A 3D2SA 4B95A 4F93B 3CWIA 1XT9B 1SXDA 4JB3A 2BR0A 3JSVB 3IRUA 1XF5L 1XD3B 3EPIA 4ANUA 2O2VB 2CPRA 3TBLD 5KFDA 2ZPYA 5DB6A 2WXPA 9ICIA 5D2MB 3LVVA 1URJA 5G5GA 3RJGA 4XC2A 2KO3A 2X38A 3DBHI 1J97A 3PZPA 2EMTA 3AB5A 2FBWB 3T5LA 4B0EA 4BVUC 3DDHA 2QKQA 3F5AA 4ECWA 1JI7A 2RDHA 1TKGA 4ACFA 3U26A 3DPDA 3MBYA 5HMLA 2DPIA 3VC8A 4NY0A 2C22A 1F5SA 1S10A 4QZIA 2KT7A 2FLNA 4WJNA 1RQLA 5ALLA 4RM9A 2L1AA 2N0SB 2G1EA 4EZKA 3PREA 3BQ2A 1SKSA 2KQ4X 3OSPA 3AE4B 1WWVA 4UBCA 3CNHA 1SKWA 3IBEA 2ZNVB 5KG7A 2DX5B 2RQ5A 1FMAD 3ZJTA 2WXOA 1PDXA 4FADA 4CF3A 2HDOA 1O08A 1PVQA 3HKZC 3Q3NC 3ZDTA 3N7RC 2CS4A 2K4EA 2W43A 4NQLB 5K4LA 4LTUA 3QEBZ 3N4MB 2KWVB 1MHXA 2VZKD 3ABVB 2CXYA 1YJJA 3QXGA 3BS5B 1CJEA 4K4GA 1RLFA 3TEWA 1V97A 2ZIXA 4FFDA 2H3FA 4XWTA 3WKBA 3EPGA 2DHZA 1NZPA 2BYFA 2IDYA 4KIKB 1ECWA 4EYIB 9ICQA 4EE2A 4NV0A 5IIOA 1V86A 1T94A 3Q8QB 3C28A 4ANWA 4F5OA 4DS4A 4MM3A 3F2CA 4TMAB 2ASDA 2KLGA 1NK4A 2M0AA 4O3SA 3M62B 3ZJUA 3C0RB 1PK1A 2D8CA 4EENA 5CX3A 4HJGE 2KG5A 4I2HA 2MSNA 8ICAA 5AK5A 7ICUA 2A1JB 3SHQA 3JPPA 2JEFA 2D07B 3OWEB 4ZRIA 1KW4A 2D3DA 1WZ3A 4J03A 2INCC 3HHMA 2KK0A 1MA7A 1IG6A 2XNAC 4XDCA 4KLEA 4DWFA 2KZRA 3H7IA 2IY0B 4QZDA 4HLEA 2YMPA 3NUHB 4BOZB 3B08A 2R8IA 2CHXA 2DBYA 3FDSA 2M56B 1TK5A 4DL4A 4YL8A 1TKYA 2NR2A 5C2TB 3B9JA 2HBKA 4C7ZA 2V9HA 1R4MI 5KHOA 5GTHU 4FBUA 2DAJA 4YTPB 5EWEA 1DK3A 5DG7A 4UB5A 2K8CA 2WAQC 1WGKA 3T3OA 3AEAB 5IIMA 3AEEB 4EZ9A 2DZMA 2HMXA 5LNK1 1T4GA 2VH2A 2KZ3A 2QMTA 2KHWB 1FNWA 1WRIA 1RQNA 1KM7A 4HWIB 2KOXA 3RULA 5C5JA 2NTTA 2KHQA 5ALRA 1Q3VA 3OJUA 1QILA 4HEA1 1MG8A 2W9MA 4GXKA 5KG4A 3PX4A 2FLLA 1NDDA 4IW0A 2K22A 4LNNA 3OPXA 2BT6A 4WWOA 4PHEA 3GE8C 2PEAA 2K1FA 4YXDB 5J2RA 1J7CA 2D2QA 2N7DA 1YMHE 4LZGA 4Y2TA 3RJFA 2W7PA 4UB2A 4E0DA 5E79U 4F2SA 4OVZA 3U30A 2GWSA 4J9KA 3AEVA 1H4RA 2LGYA 1GJZA 2WGSA 2PVOD 1ZE3D 1QQ7A 2K89A 3PSIA 1UF0A 3L13A 4LLGM 1ZP0B 4DL7A 5KFMA 2LYBA 4BFRA 3AMZA 2F76X 3AE1B 3QHTA 5FR6A 1PUTA 1F44A 3HVDA 4Y2JA 1A0PA 1YX6B 3ZDCA 1EO6A 2FI1A 1E7UA 4FS2A 2M19A 4RNAA 4DSEA 1ZW7A 2I5HA 3NOBA 4KN7A 5KFPA 4ECYA 2ZVOA 1WY8A 1NJZA 1SZPA 5AI0A 4ECTA 4F4YA 3SYZA 5KFEA 1I4RA 4UB4A 2YQEA 4YVZA 3M3JA 5JUMA 2D3GA 1XCTL 4RGOS 2KIVA 1TT5B 4AUQC 1E0ZA 5BOLA 3PZDA 4G50A 1RFAA 4P0PA 4HXDA 9ICOA 2NPTB 4MACA 3UM9A 4BDPA 2O6KA 1JCKB 2IO3B 4GDLB 2Y5PA 4K7SA 4OVUA 3V05A 4IDIA 4DSJA 5AK4A 7ICGA 1ZQXA 2Y1IA 3F5EA 2HHUA 4IQVA 9ICTA 3EC8A 1KRPA 3RB0A 4JK1A 1PYWD 3J9CA 4FHKA 3ZVVA 3L5KA 2RRDA 4OVVA 3KHGA 2WF5A 4WWPA 2H3ZA 1EM7A 2IHMA 4DOCA 1TS2A 4KKJA 2E8PA 3V6KA 1ZQZA 5BPCA 2FJ6A 3ED5A 4C00A 3VH4B 1Z3EB 3BQ1A 5D46A 3WAMA 4EBCA 3J81j 2LGIA 2HOFA 5DQGA 3OTQA 1GNUA 2AQ3B 4P16A 3KZXA 2JYTA 5G2NA 1NJYA 2DQNB 4J9OA 4JV2A 3OLMD 1UA1A 2WYQA 4JPSA 4F50A 1VD2A 2PE9A 4J9PA 2R8KA 4A55A 2LJIA 5DKWA 5I4DA 3KUDB 3W1SC 3C2LA 2QB0A 5F3XB 3GV8B 4NLGA 4MFCA 2HJ8A 4PHAA 2NS5A 4DQOC 2BDUA 2FPMA 3P2BA 5HMMA 3TARA 4I2JA 4ARCA 9ICUA 2MHJA 3GP7A 2ZJDA 1YZ7A 3QX1A 1S97A 9ICFA 3P1MA 1JRUA 3SAHA 1GOZA 1T0SC 4B9LA 5KL8B 2Y0SF 3MABA 1T3NA 8ICMA 4G9BA 4CQNA 2ZIVA 2R8GA 3PMLA 2LHDA 4YSXB 3Q8FA 5ALVA 3TFSA 1VZ6A 5LXHA 5DBAA 4KGTA 4JV1A 9ICRA 3L10B 5ALQA 3C2MA 2LPEA 3RH5A 2MX2A 3U4EG 4FA6A 5HNKA 2HCFA 8ICGA 1ZD5A 2ISPA 1PGXA 5KFVA 3D2NA 2R8JA 5IAAC 1J19A 4ECXA 2PVGC 4RU9A 2ATLA 2B0CA 4JIOU 2MA9B 1BVSA 2FUG1 3RZFA 2W9NA 3M8SA 1R4NI 3THVA 2ZUBA 3KLSX 3MFIA 2ZPNA 4KGRA 5HFYA 2KVRA 1Q1OA 3H0LB 1SJED 3WK9A 3TQ1A 4I2CA 5J2FA 2KZMA 2KQ7A 5D6JB 4G3IA 4J9SA 2XVTA 1ZPSA 3MHSD 4ASWC 1KEJA 2MUTA 2BHNA 2RD0A 2F1IA 3AU2A 4P2HA 2XY6A 3NVZA 4GSWA 4IL6U 4F4KA 1IPGA 1YX5B 2INPE 3K9OB 3G6YA 3P4RB 4RQ7A 4I2AA 2WQYB 4DQPA 3KW5B 3RNFC 1ZD3A 2XIDA 3HP6A 1L3UA 1BUIC 2E5SA 4DXFA 4DFDA 8ICRA 1KLGD 1WM2A 5AIBA 4DFMA 2KNBA 4GLSC 1JWBD 3ISCA 3KHHA 2V3NA 1SV4A 3U2SC 5ALWA 2W9BA 2ASLA 4KLTA 2FIFA 3B0YA 2JF5A 1NK0A 2LXAA 1AROP 3DBRI 4FXCA 3RD2A 4YMOA 3WK6A 4JX1C 3KFUF 2DL0A 1VCBA 3K1RB 7ICKA 9ICGA 3ZUNA 1T0QC 3TADA 1X66A 4G11A 1J0GA 3I3TB 2LBOA 3VDZA 1ZQUA 4J9RA 3PZ7A 5C0YA 2HBLA 2RDBC 4NXZA 5B66U 2Z59B 4CCHA 3OGUA 5L1LA 1TY2A 4P4PA 9ICWA 4ZRPA 9ICNA 2EZYA 2FMSA 3NUQA 5KT6A 4YXJA 2LRWA 1L7PA 4HPLB 2LI6A 1K50A 1YIWA 4F91B 5KFGA 4DQSA 2KJ6A 4I6NB 1E6EB 4M6WA 3PO0A 2J6UA 4DHJD 2IHNA 2KNJA 4I2GA 2MP2A 1L0XB 1NK6A 2KSOA 3ZRCA 9ICEA 4R8UA 4MJSB 4J6IA 5KFYA 2H3IA 4TQ1A 3ZYYX 2WXHA 3QUCA 2KKCA 1DGJA 9ICBA 1DOIA 3GV5B 1CQVA 2PW9A 3UIOB 4B9NA 2WXFA 1S76D 3ZQ4A 3AU5A 1G6JA 2EKIA 2FCMA 2JGAA 5LXIB 3EGRA 2MBBB 5AZFA 2BKEA 4M02A 3UQBA 4YTMB 7ICRA 1S8OA 3ZNHB 2F3NA 3WU2U 4F4XA 3KWLA 4ED8A 2O6VA 1TK8A 4M9JA 1WMHA 2BPSA 3O13A 1SKRA 3ALRA 2BS3B 5FP0A 2G5IB 4EZ6A 3GQCA 4M0AA 4ICVA 3DBLB 4NQKE 1WE7A 2XO7A 4Q8EA 4RPZA 2K4IA 5AI4A 1QTMA 1UBIA 2EMSA 1Z5SB 4M8MA 4IR9A 2BKRB 3UXPA 4KDLB 4IWPA 2XBBC 1RPLA 4ED3A 2BCUA 1LQBA 2WS3B 4C4TA 2D5GA 2G4SA 1PGAA 2OH2A 9ICLA 5GTIU 2KICA 5AHXA 1OXJA 1LVHA 3LJ3A 1J7AA 1C3TA 4GOCA 5L95C 3IG8A 2A4ZA 4OJOA 3X0WA 2JMGA 2IZVB 1T0YA 3EA6A 4AS1A 3WALA 3BVMA 3PHWB 3AEDB 1WX8A 2L7RA 2BYTA 4II2B 3WK5A 5KFJA 2WF8A 2JXTA 5FK9C 5D3IB 1SV0C 2EELA 2K60A 1WXSA 1N61A 1FXTB 2XEWA 3C1YA 5KFRA 2K8AA 1V6EA 3VCBA 4N58A 2J4XA 4ITKA 4W9LA 4M9LA 4YTNB 3RR7A 1QOGA 1VRAB 2ZJ8A 9ICKA 2YEPB 1DGSA 3MFHA 4H2AA 1WR6E 2WB1F 1MI0A 5CA7A 1KLUD 4Z6FA 1BT0A 1XS9D 3WA0A 2W9AA 1NKEA 3TIXA 9ICXA 2ASJA 1ZQPA 8ICXA 2RDJA 4PGQA 1CZPA 4KLSA 4RGMA 4ZHPA 3E0FA 3ZNGC 4DHZB 2ZIXB 4GXIA 5DLFA 2JRZA 3GZFA 1CEZA 2GBNA 3KYDD 4O3MA 4RUAA 1F9JA 4KX3A 1FXIA 5KG0A 4JWSC 2ZTEA 3BK1A 1IBXB 1ZQYA 1QT9A 1K8RB 1ZQHA 2WX0A 2INDC 2MW5A 4MM3B 1N60A 1GUAB 4KDIC 2MH7A 2DGZA 3AE2B 5HR7A 4EZJA 1PK1B 2KDEB 1ZQJA 2KN5A 3PPAA 1R7SA 1XLOA 4BOSC 4MF2A 3KH0A 1ZJNA 1WGYA 3MJWA 4IG7B 1N5XA 4NLZA 3DDCB 3N20C 3PTFC 2BGWA 1KTKA 3V6CB 4NL9C 2LEKA 9ICJA 3HPOA 2BBCA 1K53A 3AEBB 1HZ6A 1EF1A 4YN4A 1IXRA 3LWLA 4EX7A 2J0JA 3I63C 4YXMA 4PS3A 1JIHA 2DF4B 4EEYA 3RH4A 1HXYD 3RAXA 2WXNA 1LFDA 2QCZA 4F8CB 8ICEA 4IQWA 5AI8A 4J9LA 2GOWA 4WURA 3ZW3A 4DSKA 2EKEC 2K8CB 2GB1A 3L3FX 4O1NA 2JZZA 3NHEB 3PY8A 2JZ3B 2Y0SC 2BPFA 2FUHB 1ZJMA 1MSWD 3WK8A 2WP9B 3FYHA 2N1RA 3WKDA 2V4RA 3PW7A 2YEPF 3MP9A 2Q4TA 3NG0A 3NVYA 4KLLA 3QU9A 1BNOA 2W11A 2BVCA 2V1YA 2Z0EB 1JWUD 4S0RA 2AYOB 2L8JA 2IGGA 4EEWA 4C4VA 2DYMA 4DL5A 7ICLA 2DNFA 4CGZA 3QAQA 3A0BU 3QX7A 3MC8A 5AKKA 4RPYA 7ICEA 4ZRQA 4EYHB 1B1ZA 4J3OD 2KJ5A 1WXVA 2M0NA 1J8CA 4DXGA 2GBRA 3AQFA 5J2KA 4HROA 2Y9TA 1TZ1A 3ZDMC 4AYBF 4LNIA 4Z6CA 3IFWB 3DVGY 1QSYA 2KFKA 4M2YA 4WAAA 2P35A 3M9OB 1L8LA 3FILA 1A6SA 2BWES 7ICMA 5J2GA 2EDUA 2N7EA 3JPQA 3O65B 4XX5A 3RT3B 5KFTA 3OG5A 4O3RA 2KKVA 4K3CA 1JRPA 2JWZA 3P4SB 2AQ2B 4DHJB 4BZAA 4USAA 3DVNU 3RYTA 2F2AB 2KTRA 1PK3A 2V4QA 1JWSD 1QKZA 4M9HA 4YSYB 7ICTA 2NVUI 3LK9A 4PS8A 4O5KA 4P0PB 3RI7C 1QSSA 1TVAA 3R7RA 4DL3A 4YP3A 4W9GA 1Y88A 4IC9A 2W03A 2PFNA 4WJQA 2Y9UA 3M95A 3Q14C 4AOFA 2R2QA 1ZKHA 3QUTA 4JUZA 1NKBA 5LLIA 1MPEA 2F1HA 4WWNA 2W8KA 5J18A 1FO4A 2N1VA 2M9NA 4NJ8A 8ICYA 7ICHA 1LGRA 2WDRB 3Q3FA 2NCNA 3MDCA 1XO1A 3V6EB 4RT3A 4QZEA 3UQ0A 4KN4A 4DF4A 3DVNV 4HVBA 1YQBA 4BAXA 4JV0A 4RPXA 2WXKA 3ONSA 3LVWA 4ECVA 3GIIA 3VTWA 5HHHA 2J6SA 2ZVNA 4FE3A 2KWCA 2BKFA 4Y2YA 1PFDA 3I28A 2KEYA 5DB8A 3MDAA 2W7OA 2AGOA 1QOFA 1V2YA 2D10A 3TKAA 2EANA 4UW9A 3H40A 4R64A 4JLCA 3V7KA 5AI6A 4YMNA 3T3FA 1HA5A 3KD3A 2Y5BB 2PFOA 4KX6B 2P66A 1XLNA 3D32A 3C1ZA 1V9JA 3RRGA 4AP4C 4RNOA 3E2EA 3AL0B 5J2BA 1Q3UA 3T9LA 4C4SA 4F71A 1I4HA 2CKHB 3G6XA 5IA7A 5H2FU 4C8KA 3N7PD 4FLHA 1HEKA 4DLEA 3V7LA 1L7MA 4RZRA 1SGHA 2LMCA 3AE3B 1UNSA 1I4XA 2G5HB 5L1MA 1YN5A 3SR6A 2J53A 4BWMA 3ZNID 2BCRA 2AHOB 3VUWA 1GB4A 3ZRFA 1KH0A 1N6ZA 1TGZB 4DQQA 2ZCBA 3AV8A 4LK0M 4RF1A 3SEBA 3RFZB 2LGSA 2OEDA 5DPTA 1OQRA 3SD5A 3CP8A 3HUIA 2KVCA 4IOIE 3C23A 1PVPA 3ECIA 5AI9A 2ZIVB 2G07A 5ALZA 4P4MA 2LVQA 5B5EU 3H7PA 1L4DB 2SEBD 3TAQA 3NZSA 5C1ZA 4DOBA 3T79A 1SL0A 2CHWA 2JU6X 3E58A 2VA3A 2MLBA 2HDEA 5L83A 3QU7A 2QC8A 4LZDA 4RQ0A 4B9UA 3VHTC 5ALPA 3SMVA 4WIPA 5GMVA 4RM8A 1BPYA 4JWNA 1ZQIA 1SIJA 5KAFU 3V72A 1COOA 8ICUA 1BPZA 1WSPA 4PT5A 4ZRJA 2ISOA 3QQ8B 2C2EA 5E6PA 2C9WB 1KQQA 4X57B 3VTUA 3DHGC 2I1KA 1D5XC 4O3QA 4NWIA 3ZDDA 4XYCA 2JZBA 2KIWA 1ZOLA 2V4IB 3VXWA 5KG3A 1XQQA 4IQTA 4NLNA 1Y8RC 2MUTB 2XCPA 8ICLA 2DUYA 4PYZA 1P0RA 3E9SA 2ALZA 1ZXIA 4A3PA 3RF9A 3FAHA 1RG6A 2XI9A 2XY5A 1FIQA 2WB1C 1TK0A 1RYUA 1ZOYB 1ZQNA 2J6TA 4PHDA 1L0YB 1TY0A 5AZGA 4P4OA 2PFQA 2JXXA 3WIMA 4R66A 3TEYA 3MR6A 1RZTA 2QB1A 3BQ7A 2OJWA 4KLMA 2E6XA 2N9LA 1EF5A 1CK1A 1UD7A 4Y2XA 4XZ4A 4WJPA 2ZUCA 3H6NA 4WJOA 1YQ3B 5DPWA 1ZETA 2QSDA 3QU2A 2VA2A 2HVHA 4OD0A 2E8OA 1B9RA 4ACOA 3M9NB 3Q8BA 1NZBA 1AYFA 1FRRA 3RNGC 2AH5A 3ZGZA 1NK9A 4DDGD 9ICCA 3PNCA 5EE1A 1ZQCA 1IIPA 1EXNA 1EUVB 4M9GA 1ZD4A 3OHAA 1L3TA 4W9HA 3EFUA 2WXJA 5L9XA 1C4PA 1FD6A 3ZD9A 2DPJA 1P7FA 3H8MA 1FEZA 2L05A 4B9KA 4UAWA 1KLNA 1MVKA 1LKYA 3ZJVA 7ICNA 4PL1A 2BCSA 1KLVA 1L7NA 4FHJA 5CEHA 2F8LA 4ED7A 2R61A 4QWCA 4DK5A 2WFAA 8ICWA 2GLSA 4MGYE 2MP2B 1F2RC 3VAWA 3UMCA 1OEYJ 2KSOB 2K6QA 7ICOA 2RGFA 3A33B 1H8CA 4R8UB 3QIJA 3UMGA 2KTFA 3BZCA 2KJRA 2KAJA 1I4GA 4TQSA 1KKXA 4GFJA 1QCKA 5DDMA 1TE2A 4N59A 4ZYNA 4NLKA 5AZHA 5KFBA 4RT2A 3PZ8A 4CNQA 4DLGA 3VH3B 1ZRNA 2JV3A 5DLGA 2YMLA 2E1FA 4O0IA 1YOVB 3A0HU 3R3MA 3MGVA 3W1SA 5J2DA 4EX6A 4RQ6A 4UAYA 2O6VB 1WMHB 4E74A 1X42A 1KBUA 2R8HA 1AN8A 3PSPA 2M0XA 3BVGA 4NJCA 4NLBA 2OHFA 2ICIA 2ZW0A 2ODGA 1FM0D 2PLPA 4YR3A 3W1YA 3WKCA 3RAQA 3RTVA 1PQSA 4I2BA 4TQ0A 1PUZA 1IGCA 3PV8A 4AYBC 4UARA 4Q2JA 2KMDA 4QWBA 1ZUD2 1LM8B 3ALBA 3DBHB 5KG5A 4GIVA 2K39A 4MELA 1GPXA 2ZTCA 4DFJA 3KBBA 3N30A 4FJYA 4W9IA 1YT3A 5TR5A 2IOFK 3R66C 1K52A 2BQ3A 1XNSA 3T5JA 1KFSA 1E7VA 1WX9A 2JQRB 2PPHA 4AWJA 5DB7A 5J8YC 4NJ7A 3G6VA 4GGQA 1RYJA 5DGBA 4KSLC 2BF8B 3PRZA 3M7DA 4QZ9A 2FMPA 4WAFA 3JPOA 2JH7A 1NYQA 4AP9A 4FJZA 2GBMA 3D2QA 2ZXIA 4MH8A 2WXQA 3AU6A 1WWTA 3VR9B 3SAFA 1JXLA 2G09A 4ECZA 2RPVA 3P42A 4K7WA 4BKTA 4YR0A 1Q46A 2KZZA 2GMIC 3SDLC 4KKIA 1L7OA 2QJLA 4YSZB 2KANA 4KZ0A 4GXJA 3Q8KA 4DFKA 5H8YE 1ZRMA 4DL2A 1ZQDA 3PGEA 1K5OA 3H8JA 4IKGA 1WH3A 3ORYA 5KT2A 3F2DA 1ZQGA 4AJWA 4BBNF 3IVFA 2I9GA 3U7DA 3W9CB 2JZPA 2LGDA 4B0MA 5F9LA 3Q2AC 2K6DB 2LM1A 4DS5A 1Q10A 1TS3A 4HK2A 2NV3A 5T14A 1ZQSA 1Z4OA 1KFTA 3QARA 4IM3A 2JEGA 4B6JA 1NENB 1U4AA 2HOIA 4DSLA 3VUXA 4QZGA 1UHUA 2K25A 4IRDA 1UH6A 2C7HA 5KG1A 1WRDB 4HPPA 2F77X 4I29A 4PYUA 3SEIA 5ALDA 2KV2A 2FE8A 4BXOA 1S3SG 3KHLA 3Q8SB 2NRZA 3SFDB 1T3QA 2UWQA 4GIBA 4F72A 3RBEA 1P7EA 2D3CA 1O03A 1WE6A 1YJIA 2M8SA 3H8HA 4ANXA 1C1YB 3PX0A 1TKEA 4K7UA 1AARA 3BY4B 4Y2RA 2WU5B 2BB5A 3EHVA 2CU1A 1CUKA 3W2DA 4CYEA 1E9MA 1ZQFA 3PRPB 3RB6A 5HG2A 2QIEB 1KRHA 1ISNA 2BS4B 2O2VA 2J7QB 2BGFA 5DQHA 3EFCA 5DBCA 2W55A 5CHWA 3O0FA 2VZKB 2L52A 5ALGA 1PVRA 2I38A 2CJOA 2N9EB 2DAFA 3E56A 5AKLA 5TZVA 2VKQA 2CU3A 5J0QA 9ICMA 5AKEA 1X9MA 2F8KA 4P1CC 1NK7A 2SAKA 1WZ0A 1JQ4A 1R4MB 4MHVA 3C19A 2EZZA 4QZAA 1MHHE 5ALJA 1FNVA 1WR1A 2WDQB 5CJ7A 1E8YA 4EZLA 1OQQA 4KGSA 4FBJB 2CN1A 1QQ5A 2VANA 1SIFA 3OHBA 2DFLA 1LB2B 3KHRA 4RGNA 5L1JA 3OJ4B 1X9SA 1F2RI 4K4HA 1E5WA 3ENEA 4R3DA 1QOAA 2IGDA 4DO9A 2H3QA 2KX0A 1EU3A 1D5MC 3AECB 4C4VB 5KFCA 2C2RA 1ZQBA 4MFAA 2PI5A 2LVPA 3N97B 5DCNA 2W3RA 4N9F4 2ZIUB 1S0OA 2P6RA 2DKZA 3BS7A 4EOYA 3TL5A 1UELA 5J0WA 4F4WA 1D9FA 2HE7A 4DQIA 1ZQ1C 3DWMA 3KZIU 2REXA 3PW5A 2N9XA 1SWVA 8ICKA 1B43A 3PO5A 4NZLB 5EE9A 2KDMA 1F52A 3JPTA 4OJ6A 5CB1A 3ZO5B 4Y2SA 4F8RA 3H9DA 5J2AA 3FILB 4FJVB 4Y2QA 2I6XA 2N7JA 4M0WA 4W9EA 3L54A 2A1AA 4A90A 1SEBD 1L2NA 2ON8A 3ZTDA 4XQ8A 1L5PA 1IYFA 8ICNA 2IO0B 3RB4A 2NMQA 2G3QB 4RCOA 9ICVA 3IT6B 2WXGA 3T5HA 1PZNA 4MDKE 4W9JA 5IIJA 4Z6DA 1ZXHA 2ZIWA 2KTRB 4B9MA 4WH4A 3H1UA 2A1JA 4MEMA 2XICA 3VRBB 2P6UA 2WXRA 4A6QA 3M63B 2KJ8A 2WLBA 3SENA 2JWUA 2WX1A 3GOEA 4PJ0U 3MC9A 9ICPA 4HAIA 4F4ZA 1SV0A 1ROEA 3SV4A 1H38A 1ZQRA 3CIRB 4XUSA 2MA1A 3RJJA 5ALUA 2JEIA 4DBGA 1UA0A 2IO2B 5CRXA 3IG3A 1ZQWA 2PFPA 2A3VA 4BKGA 5IKCM 2LHTA 2YY6A 2BQUA 2GOLA 4G0NB 3BK2A 1XSNA 4FN2A 4ARIA 2KJ9A 4YD2A 4QZ8A 3AU4A 2RP5A 1JWAD 5BO4B 2ZNVC 3A9JB 5J0YA 4MSQB 1L3SA 2PTLA 2BCQA 4WQMA 1WWUA 1L3VA 5L1KA 2YVCA 2KC2A 1DOQA 2YTUA 3SAGA 3QZ8A 3X23A 1B22A 2FCNA 3K9PB 1SE4A 3PV1A 2FCSA 2HOQA 3UGBB 5KFWA 3H8WA 8ICTA 2JHDA 1A76A 4F2RA 4QAYA 3NGDA 1IV8A 2L76A 5CHGA 4F3OA 4QWEA 1D5ZC 3HVZA 3N1XC 2MBOA 3HRDD 4UB6U 3BDPA 5AM5A
chains in the Genus database with same CATH topology
4DXGA 3TEWA 1V97A 4HROA 1TS4A 4XWTA 5FKAC 2IDYA 4EE2A 1J7BA 1VJKA 3V3XA 1C78A 3Q8EA 3FILA 4TMAB 2MJDA 2M0AA 3ZJUA 2WXIA 1RFKA 4HJGE 3KQ4A 2I2YA 3B2FA 2KN4A 1JRPA 3P4SB 2AQ2B 3OWEB 4US8A 4USAA 1SJHD 3MJ5A 1D6EC 1YNTE 2JSVX 1RM6C 2XNAC 1JWSD 1QKZA 4JE3B 1ET6A 4XDCA 3P4QB 4YSYB 3AE7B 2Z8LA 2LFIA 3NUHB 1D4BA 1NEKB 3VQIA 2DBYA 2M56B 3LB8C 1TKYA 1XLPA 5C2TB 3B9JA 4C7ZA 3AM9A 1V8CA 3DWGC 4YTPB 2G9HD 1WGKA 4OZBA 3AEAB 3T3OA 3AEEB 1MPEA 5LNK1 3VRAB 1FO4A 2WDRB 1DYQA 2QMTA 1HEZE 1FNWA 1WRIA 2WXKA 2RDGA 3AH7A 2NTTA 1QILA 4HEA1 1K51A 2KACA 3AN1A 1PFDA 1V1OA 1QOFA 2K22A 2BT6A 3AE8B 1E7PB 4YXDB 1TJEA 1J7CA 3AEFB 1HA5A 3BWUD 1YMHE 4KX6B 1XLNA 4ZYSA 3BZDB 3R2IA 1QLBB 4OW0A 4OVZA 2H88B 1JW9D 1I4HA 3MHZA 2PVOD 1ZE3D 2BB6A 2K3UA 4LLGM 1FFVA 3ETRA 1T6BX 1ZP0B 4HRSA 1FNUA 2LMCA 3AE3B 3AMZA 1UNSA 1FCCC 3AE1B 3NVVA 1I4XA 3EUB2 1PUTA 1YN5A 3SR6A 2J53A 3HVDA 4RGTA 5JXVA 5BYSA 1DOYA 1GB4A 2M19A 1KH0A 3AV8A 4LK0M 4RF1A 3BYYB 4RNAA 4C7YA 3SEBA 3RFZB 2K0PA 1BMLC 2OEDA 3W5VB 1OQRA 3HUIA 3AE6B 4IOIE 3URYA 4P6VF 3KWVA 1I4RA 1C4CA 2ACZB 3AEGB 1AW7A 1ACCA 1XCTL 4RGOS 1E0ZA 2JX5A 1L4DB 1IUEA 2SEBD 4HKZE 4MACA 1JCKB 2JU6X 4GDLB 4RFBA 1HZ5A 2Y5PA 4L1BA 2HDEA 1SXTA 3V05A 4IDIA 1OFFA 4WIPA 1L6UA 2QILA 1SIJA 3LXFA 2BW2A 1PYWD 3J9CA 3FC4A 1NYRA 3IT4B 4PT5A 1WSPA 4WWMA 3W5UB 1DOXA 1EM7A 1TS2A 2W54A 4KKJA 1D5XC 1UUPA 2WXLA 1I4QA 2V4IB 4L2YA 1XLQA 3NZ3A 3E9SA 2LGIA 1ZXIA 2AQ3B 4P16A 3FAHA 2AX5A 4RF0A 2JYTA 2GRIA 3MC0B 1FIQA 1L0VB 1ZOYB 3U7ZA 5H92C 4JPSA 1C77A 1L0YB 1TY0A 4A55A 2LJIA 5I4DA 2MJ3A 1EU4A 2LHEA 2WXMA 4DQOC 3TEYA 4JWUC 2CJNA 1JROA 2E6XA 4OZAA 2N9LA 3NRZA 1CK1A 4ARCA 1TS5A 2AQ1B 2WNMA 3GP7A 4A8XC 1GB1A 1YQ3B 2Y3AA 2QSDA 4REZA 3P1MA 1QQRA 5C3JB 1GOZA 5HI1A 1VZ8A 3TUOA 1B9RA 3Q8BA 1HQRD 2PMVA 1PGBA 1AYFA 1FRRA 1SF0A 3ZGZA 1C79A 1QF6A 4NAMA 4ZHOA 4CQNA 2MJEA 2E3TA 5EE1A 2LHDA 4YSXB 3Q8FA 3LYYA 3TEZA 1VZ6A 4KGTA 1ET9A 1SBBB 3MFGA 1FCLA 5BYRA 2WXJA 2W3SA 3NVWA 1C4PA 1FD6A 3U4EG 1P7FA 4RH6A 5D7GA 1FFUA 1GAQB 2ONQA 1PGXA 1MVKA 4TSSA 4D2KA 3ZJVA 2BTEA 2PVGC 1SB3C 2R61A 1JALA 5BMIA 2K5PA 1EWCA 1ZDXA 2RMMA 1XEEA 1F2RC 2FUG1 2XN9C 3KLSX 4KGRA 4XDDA 4OZCA 2KAJA 1I4GA 5HFYA 1SJED 2B76B 1SE2A 3WCQA 1FEHA 4N59A 1ZPSA 2PIAA 3IAS1 5BYQA 3T3NA 1C4AA 2DWQA 3PZ8A 1VDVA 1M4VA 3NVZA 1YQ4B 3TSSA 3I57A 3UI3A 1V1PB 3W1SA 2INPE 2IGHA 3BYTB 1L4ZB 3P4RB 1AN8A 3BVGA 1LO5D 2LUMA 2WQYB 1L6VA 3BVZA 4NJCA 1BUIC 2OHFA 2ICIA 2ZW0A 4OHJA 5G5HA 2KWDA 1FM0D 2PLPA 3R2TA 4DXFA 1UWXA 4TQ0A 4XWWA 1IGCA 1KLGD 4Q2JA 1VZ7A 1ZUD2 1JWBD 4GLSC 2V3NA 1F77A 1SSNA 3U2SC 4FXCA 5E6JA 1GPXA 1XCQL 2WDVB 4JX1C 1K52A 2JQRB 1YN4A 1EWYC 1KF6B 1SE3A 1RYJA 4MT5A 4L23A 1XO3A 4WAFA 1NYQA 3PZ7A 2TSSA 3P4PB 4MH8A 2WXQA 1WWTA 3VR9B 1TY2A 1C9FA 1ESFA 2WU2B 2RPVA 4ZRPA 2BS2B 3P42A 5FR3A 1E10A 4KKIA 2QJLA 4YSZB 2IJ0A 4YWGG 1FRDA 1K50A 5H8YE 5D3DA 1NI3A 1E6EB 1STEA 3PO0A 4C80A 1NVID 4IKGA 3SFEB 2Y5CA 1ENFA 1L0XB 3W9CB 1TYGB 1RWSA 2DLBA 2JZPA 4B0MA 4TQ1A 1JMLA 3ZYYX 1Q10A 3GB1A 1TS3A 2WXHA 2JYEA 1JWMD 1DGJA 1NENB 1DOIA 2PW9A 1CQVA 1VLBA 1KFYB 4XE0A 2WXFA 3ZQ4A 2NTSA 2EKIA 5T8IA 5MPOA 3EGRA 3R8BA 3Q69A 5GXGB 4AQ7A 3IAM1 1V1PA 4YTMB 4ZOHC 2V3PA 2FE8A 1BXTA 3KWLA 1AWDA 2BS3B 3O13A 4HKQA 3SFDB 1T3QA 1P7EA 1IBXA 3H8HA 1YJIA 2N9KA 1TKEA 5AUKA 1T5XD 2WU5B 2BB5A 3W2DA 1E9MA 5HG2A 3N9YC 1C76A 1KRHA 2QIEB 2BS4B 4A9AA 2W55A 2WS3B 2H89B 2VZKB 2D5GA 2L52A 1PGAA 1WYGA 1UGJA 2I38A 5FK9C 2IPKD 2CJOA 1J7AA 3E56A 2L32A 2CU3A 1XXGA 2K9XA 3P63A 3EA6A 2MEKA 1YN3A 2SAKA 4AS1A 2HTME 3BVMA 1JQ4A 3AEDB 3NS1A 2BYTA 1MHHE 2WDQB 1FNVA 2JXTA 1A70A 5D3IB 2EELA 2W82A 1OQQA 4KGSA 1N61A 1F0ZA 2ZW1A 4N58A 5AUIA 2J4XA 4ITKA 4RGNA 2V0GA 3C8YA 2J42A 4YT0B 1F2RI 4YTNB 3L4PA 1QOGA 1VRAB 1QOAA 1WXQA 1VR9A 2IGDA 2YEPB 4R3DA 4UDUC 1QOBA 1EU3A 1D5MC 3AECB 4H2AA 1MI0A 5BMHA 1KLUD 2INNE 4NAWB 5BMGA 3BIID 4US9A 2L83A 5EE0A 2KMMA 1CZPA 2W3RA 2GI9A 4RGMA 4ZHPA 1N62A 3VR8B 4C56C 3TEXA 3DWMA 1N5WA 1FXIA 4JWSC 4NZLB 1N63A 2KDMA 3BK1A 5EE9A 1IBXB 1QT9A 4MM3B 1N60A 3AE9B 5HHDG 3FILB 1TZOA 2MH7A 3CWIA 3AE2B 3B2GA 2N7JA 4M0WA 1XF5L 4A90A 1SEBD 2ON8A 3AE5B 1L5PA 1R7SA 1XLOA 3U52E 2NMQA 1N5XA 5EE3A 4RCOA 2WXPA 1KTKA 5G5GA 1FXAA 3IT6B 2WXGA 3RPFC 2LEKA 2X38A 1ZXHA 2BBCA 3AB5A 2FBWB 1K53A 3AEBB 4B0EA 1HZ6A 4WH4A 2PKOA 1I7HA 3VRBB 2WXRA 3Q8CA 1HXYD 2RDHA 2WXNA 1TKGA 4A6QA 2WLBA 2JWUA 3I9V1 4N6EB 2J52A 4WURA 1ROEA 2Q5WD 3CIRB 2L1AA 2N0SB 2G1EA 2GB1A 2QEJC 4O1NA 2KQ4X 1I4PA 3AE4B 2WP9B 3BK2A 4ARIA 2YEPF 1FMAD 3MP9A 3ZJTA 3NVYA 1JWAD 2WXOA 1PDXA 3IXSA 1JWUD 2PTLA 3GS2A 2DYOA 1ZDVA 2IGGA 4WQMA 2DYMA 5TSSA 4GDKB 1SE4A 1Y56A 1UWMA 1IGDA 4LTUA 4ZRQA 1B1ZA 4J3OD 1MHXA 2VZKD 3ABVB 3Q8AA 1D5ZC 3HVZA 3HRDD 1YJJA 1CJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P63 A;  2DWQ A;  1V97 A;  1VDV A;  4HRO A;  2HTM E;  3NVZ A;  1YQ4 B;  1JQ4 A;  3AED B;  3NS1 A;  1J7B A;  2WDQ B;  1A70 A;  4IDI A;  1VJK A;  1OQQ A;  1N61 A;  1OFF A;  3P4R B;  1F0Z A;  2WQY B;  1L6V A;  2MJD A;  1L6U A;  4N58 A;  2OHF A;  1SIJ A;  3LXF A;  5AUI A;  5G5H A;  1FM0 D;  1RFK A;  4ITK A;  3FC4 A;  1NYR A;  4YT0 B;  4WWM A;  4YTN B;  3L4P A;  1QOG A;  1QOA A;  1WXQ A;  1QOB A;  3B2F A;  3AEC B;  1JRP A;  3W5U B;  3P4S B;  1DOX A;  1ZUD 2;  1JWB D;  2W54 A;  4US8 A;  4FXC A;  1GPX A;  4USA A;  2WDV B;  3BII D;  4US9 A;  2L83 A;  4JX1 C;  5EE0 A;  1RM6 C;  2JQR B;  2KMM A;  1CZP A;  2W3R A;  4ZHP A;  3P4Q B;  4YSY B;  1EWY C;  1KF6 B;  1N62 A;  3AE7 B;  1XLQ A;  3VR8 B;  1RYJ A;  1ZXI A;  3FAH A;  3DWM A;  1NEK B;  1XO3 A;  1N5W A;  2AX5 A;  2DBY A;  1NYQ A;  2M56 B;  3LB8 C;  1FIQ A;  1L0V B;  1TKY A;  1XLP A;  5C2T B;  3P4P B;  1ZOY B;  1FXI A;  3B9J A;  4C7Z A;  5H92 C;  4JWS C;  3AM9 A;  1N63 A;  1V8C A;  1WWT A;  5EE9 A;  3VR9 B;  1QT9 A;  3DWG C;  4YTP B;  2WU2 B;  1N60 A;  1WGK A;  2BS2 B;  3AE9 B;  1E10 A;  3AEA B;  2MJ3 A;  2MH7 A;  3AEE B;  3CWI A;  2QJL A;  3AE2 B;  3VRA B;  3B2G A;  1FO4 A;  2CJN A;  4JWU C;  4YSZ B;  1JRO A;  2WDR B;  1FRD A;  3AE5 B;  5H8Y E;  3NRZ A;  1L5P A;  1R7S A;  1WRI A;  1NI3 A;  1E6E B;  1XLO A;  3PO0 A;  4C80 A;  1NVI D;  3SFE B;  1N5X A;  1YQ3 B;  2Y5C A;  5EE3 A;  3AH7 A;  5G5G A;  1FXA A;  3W9C B;  1TYG B;  3RPF C;  1RWS A;  2LEK A;  3P1M A;  5C3J B;  3AN1 A;  1B9R A;  3AB5 A;  2FBW B;  3ZYY X;  1PFD A;  3AEB B;  1QOF A;  1DGJ A;  1AYF A;  1FRR A;  1SF0 A;  2K22 A;  1NEN B;  1DOI A;  2BT6 A;  2PKO A;  3AE8 B;  1VLB A;  1I7H A;  1E7P B;  1KFY B;  3VRB B;  4ZHO A;  1QF6 A;  1TKG A;  4YXD B;  2WLB A;  1TJE A;  2E3T A;  1J7C A;  2MJE A;  3AEF B;  5EE1 A;  4YSX B;  2EKI A;  4KX6 B;  1XLN A;  4N6E B;  1ROE A;  5MPO A;  2Q5W D;  3CIR B;  5GXG B;  1QLB B;  2N0S B;  2W3S A;  3NVW A;  2G1E A;  2H88 B;  4YTM B;  1JW9 D;  4ZOH C;  3AE4 B;  3KWL A;  1FFU A;  1GAQ B;  2PVO D;  1AWD A;  2BS3 B;  3SFD B;  1T3Q A;  2WP9 B;  1FFV A;  3ETR A;  1ZP0 B;  4HRS A;  1YJI A;  3AE3 B;  1FMA D;  3AMZ A;  2PVG C;  1SB3 C;  3NVY A;  1TKE A;  1JWA D;  3NVV A;  1JAL A;  3AE1 B;  3EUB 2;  1PDX A;  2K5P A;  1PUT A;  3SR6 A;  5AUK A;  2WU5 B;  4WQM A;  1DOY A;  2M19 A;  1E9M A;  3AV8 A;  2CU3 A;  4C7Y A;  2QIE B;  1KRH A;  2BS4 B;  3W5V B;  4A9A A;  1OQR A;  2KAJ A;  3HUI A;  1UWM A;  2W55 A;  3AE6 B;  2WS3 B;  2H89 B;  4LTU A;  2B76 B;  2L52 A;  1WYG A;  4P6V F;  3WCQ A;  4N59 A;  2ACZ B;  2CJO A;  3ABV B;  1J7A A;  3AEG B;  2PIA A;  3HVZ A;  3HRD D;  1E0Z A;  1YJJ A;  2K9X A;  2JX5 A;  1CJE A;  1IUE A; 
#chains in the Genus database with same CATH topology
 3SZ2 A;  3HWT A;  1D8L A;  4Y2P A;  5ALS A;  3QZ7 A;  4B9T A;  4MF8 A;  3QJZ A;  2GLE A;  3H8S A;  3MC1 A;  1S9F A;  5FKA C;  3MR3 A;  3APD A;  1OTR B;  4ELT A;  2HHQ A;  4C8O A;  1HIW A;  1RYR A;  1DK2 A;  4CRX A;  3BIN A;  2ZTD A;  4TUS A;  1LV5 A;  3Q8E A;  1N56 A;  2KD0 A;  1WIA A;  2MBE A;  4RMA A;  4FBT A;  2WXI A;  4NY8 A;  1RFK A;  1UT8 A;  3ZXV A;  5F9N A;  3HK0 A;  4NL9 A;  2UU7 A;  3KQ4 A;  3B2F A;  2KN4 A;  4BWJ A;  4BGD A;  4US8 A;  3UQ2 A;  2AGQ A;  2EZX A;  2FPL A;  1SJH D;  1D6E C;  1YNT E;  2RR9 A;  2JSV X;  2JR5 A;  2K4P A;  5J0S A;  3MR5 A;  2Z8L A;  3H7P B;  2LFI A;  1TTN A;  3K1Z A;  5DB9 A;  3Q8R B;  1NEK B;  3VQI A;  3ZNZ B;  4FS1 A;  1ZQA A;  1L6N A;  1XLP A;  4W9D A;  4KLJ A;  2Z0D B;  5JHB A;  1GC6 A;  3DWG C;  2AQ4 A;  9ICH A;  4OZB A;  5DGA A;  4Q44 A;  4Z6E A;  1IP9 A;  3VRA B;  3ONN A;  3HKZ F;  4KZC A;  3PLV A;  1U9L A;  1N48 A;  1R4N B;  4C0Z A;  2KVS A;  2AU0 A;  1TIF A;  4YFK A;  2RDG A;  4IWQ A;  2DYB A;  2EAM A;  2VIX A;  4PZO A;  2KOB A;  2JZB B;  2CRX A;  1K51 A;  3AN1 A;  2CR5 A;  2OYY A;  3EW9 A;  1S77 D;  5AKX A;  3QWZ B;  4GDK A;  4M9N A;  2XK5 A;  3A1Q A;  1P9D U;  2M1M A;  3AE8 B;  3L16 A;  1UBQ A;  4I6P A;  5KFN A;  4M00 A;  3UIP B;  1JUD A;  3BWU D;  4MH0 E;  2MBQ A;  2M17 A;  3PR5 B;  4BBN C;  2JT4 B;  4EBE A;  4DSF A;  2BPG A;  4ZYS A;  4CHK A;  1M6Y A;  4FZN A;  3ISD A;  2HHT A;  3DEE A;  1WGH A;  1QLB B;  3BZD B;  3R2I A;  4OW0 A;  4JWM A;  2KKP A;  2H88 B;  4R63 A;  2RLT A;  2KQS A;  1ZQO A;  1Q8K A;  3MHZ A;  4YMM A;  2PMZ F;  4F5N A;  2HHX A;  2BB6 A;  1JN3 A;  4UAS A;  1ZGU B;  2LM4 A;  3C29 A;  4HRS A;  4P1B C;  1FNU A;  3OAW A;  1FCC C;  1A77 A;  4TUQ A;  3NVV A;  1UPH A;  3EUB 2;  5ALY A;  5JXV A;  2DZJ A;  3B0A A;  3CRX A;  4RGT A;  5HP4 A;  5CWR A;  4ZRK A;  3AI5 A;  5BYS A;  2W04 A;  4NM1 A;  4DL6 A;  1RRB A;  4F92 B;  3BYY B;  1J2N A;  4LDT D;  3W5V B;  4DFP A;  1CI4 A;  2HJ1 A;  3PR4 A;  3AE6 B;  3URY A;  4YR2 A;  5EWG A;  4M04 A;  2EH9 A;  3KWV A;  4QZF A;  2ACZ B;  4A20 A;  4UB8 U;  2FMQ A;  2JX5 A;  4DHZ E;  2HHV A;  3ZI4 A;  3OSN A;  1YZ6 A;  1HZ5 A;  2QAR A;  3IP4 B;  1E8W A;  4L1B A;  2YMM A;  1J2M A;  2G45 B;  2OOB B;  4FUL A;  4EBD A;  1LKY B;  3KTQ A;  4B9S A;  1Z2M A;  1KSP A;  2LZ6 A;  2QIL A;  3RJK A;  2L0F A;  4EEK A;  7ICV A;  2BW2 A;  3IT4 B;  4RQ8 A;  4TUP A;  2K8B A;  1SXE A;  2B3A A;  2DZI A;  3APF A;  3T8M A;  5AM1 A;  3W5U B;  2AL6 A;  4IS7 A;  2W54 A;  1NNL A;  3K75 D;  1UQV A;  3I76 A;  1C20 A;  1M94 A;  1KTQ A;  1B0X A;  2LAS A;  1WM3 A;  2WXL A;  3HIZ A;  3QK0 A;  1I4Q A;  3GZN B;  5III A;  2KN7 A;  3CF6 E;  3PSF A;  3H0R B;  2XCA A;  3NZ3 A;  3VFK A;  4ED6 A;  8ICF A;  4U6P A;  2GRI A;  3MC0 B;  4QIW F;  2NBV B;  2KE7 A;  1L0V B;  4RQN A;  5DPS A;  2KLC A;  2RSU A;  5C23 A;  1Q0W B;  2UVW A;  4NPN A;  4I2F A;  4GMV A;  2JH1 A;  5ALK A;  4B6W A;  2WXM A;  4KVG B;  4JWU C;  2CJN A;  3QE9 Y;  2KJH B;  3WAP A;  4GU2 A;  1ZQE A;  3Q8M A;  2AQ1 B;  1UT5 A;  2WNM A;  1GB1 A;  5KL1 B;  2HBM A;  4DSI A;  1IM4 A;  2Y3A A;  1T7P A;  4I2E A;  2R2O A;  4GC6 A;  4PGY A;  1NBF C;  3PW4 A;  2RDI A;  4PK1 A;  3H7S A;  1P98 A;  2E1E A;  5HI1 A;  3WAN A;  1VZ8 A;  3TUO A;  1I42 A;  1HQR D;  4K3B A;  3PVX A;  1PGB A;  1WCN A;  1C79 A;  1Z1B A;  1QF6 A;  1FPY A;  5KFH A;  5AK6 A;  2MJE A;  3GIJ A;  5KFF A;  3LYY A;  1V85 A;  2AXT U;  1KJT A;  3TEZ A;  4O3N A;  5JTI A;  1DRG A;  3NRW A;  1BNP A;  3PVL A;  2DKX A;  2KXJ A;  3HM3 A;  3MFG A;  2C28 A;  3PHX B;  1FCL A;  2W3S A;  1XWL A;  5KAI U;  2HW3 A;  3QUQ A;  2AJQ A;  2H5X A;  4RH6 A;  5D7G A;  2ONQ A;  4I2D A;  4BJQ A;  4TSS A;  1XO0 A;  2JEJ A;  4B9V A;  3PSE B;  2LUE A;  2J0M A;  1LXD A;  3A9K A;  1SB3 C;  3N7S C;  2LMR A;  2K5P A;  1EWC A;  4IQU A;  2RMM A;  3RRH A;  2NYV A;  4F1S A;  5IIK A;  4J9M A;  4CDG A;  2LD9 A;  2B6G A;  2KHV A;  2KFJ A;  1P3Q U;  4DQR A;  5J17 A;  3M6Z A;  3DHH C;  4HJK A;  1SE2 A;  3SQI A;  3WCQ A;  1COK A;  3IAS 1;  5KHQ A;  1C4A A;  3RBD A;  2M4N A;  1VDV A;  3Q8L A;  1M4V A;  2QB0 B;  2DEN B;  4UAU A;  3I57 A;  4X5V A;  5KNI A;  2LJ5 A;  1BPB A;  2ZJA A;  2XGQ A;  1D8Y A;  4BXO B;  3GE3 C;  4WQO B;  4UBB A;  1LO5 D;  3BVZ A;  1L6V A;  2V9W A;  2L0T A;  2NO5 A;  3R2T A;  5J0R A;  3H4D A;  1UWX A;  4I28 A;  2PE6 B;  3R7Q A;  1WG8 A;  4XWW A;  4ED1 A;  3PO4 A;  2JPH A;  3BZK A;  3Q3O C;  1VZ7 A;  2KVZ A;  4UB1 A;  4NLC A;  1XU4 A;  1MQ2 A;  1F77 A;  1WCL A;  3Q3M C;  2YMQ A;  4CF5 A;  4HDQ A;  1P7D A;  4Q45 A;  1F1H A;  5J0T A;  1YN4 A;  2IBI B;  5KG6 A;  1SE3 A;  4R65 A;  5L1I A;  4KTQ A;  2C5L C;  5AM2 A;  4MT5 A;  2WHE A;  4L23 A;  2NRX A;  2EQY A;  4QNL A;  3NY5 A;  4BX9 C;  1SZH A;  4O5E A;  2FLP A;  3ZXR A;  3P4P B;  4HPM B;  1Z00 A;  1ESF A;  2AGP A;  4PL2 A;  2BS2 B;  3QNM A;  2OEH A;  4C8L A;  1X2I A;  1WYW B;  4GN1 A;  3UXN A;  1WGG A;  3RZW C;  4KSK C;  4QZB A;  2IBK A;  2MQJ A;  3HIL A;  3CMM B;  8ICP A;  3KVF B;  5D3D A;  1NI3 A;  1STE A;  5AIC A;  4C80 A;  3SFE B;  1GO3 F;  4DXA B;  1ZQL A;  2BPC A;  2HVI A;  5KFO A;  3A4R A;  4KLF A;  4G3X B;  2C7M B;  5IN7 A;  1TYG B;  4XRH A;  3BQ0 A;  1RWS A;  2DLB A;  4M47 A;  4EFO A;  2G0A A;  1V38 A;  4P0Q A;  3GB1 A;  4K81 A;  8ICV A;  2JYE A;  4ICU A;  3UQA A;  1WGD A;  4LDT B;  2HTH A;  1WJ4 A;  4GLX A;  1VLB A;  3KYC D;  2C7N B;  4OO1 J;  2F44 A;  1QZE A;  2KC1 A;  2NTS A;  1A5R A;  2ESE A;  2FDR A;  3AUL A;  1WGR A;  4J9N A;  5T8I A;  5MPO A;  1Z19 A;  1WXM A;  3DHI C;  3R8B A;  4AQ7 A;  3IAM 1;  2OCE A;  1MN8 A;  4NM2 A;  5CP2 A;  1UZX B;  1V1P A;  2MSE D;  1V81 A;  3C5G A;  1BGX T;  3PT2 B;  1AWD A;  2GBK A;  4HKQ A;  5E6N A;  2EAO A;  5AKZ A;  3L17 A;  4M0W B;  4KMU A;  1IBX A;  4HDO A;  4RQ1 A;  1X9X A;  3ICX A;  2W9B B;  8ICB A;  3UMB A;  5AUK A;  1T5X D;  3F53 A;  5AIA A;  3RH6 A;  2QDF A;  4MGK E;  3H4B A;  3N3K B;  4WJ3 B;  2ZIW B;  2QHO A;  3KOO A;  2AWT A;  2BYV E;  2BWF A;  2PMZ C;  4GB9 A;  5J8Y A;  4KLU A;  1WYG A;  2Z7J A;  1UGJ A;  2IPK D;  4EUT A;  1TV9 A;  4NJ6 A;  1Q5W B;  1KOT A;  3SU8 X;  1XXG A;  3PS6 A;  4RQM A;  4OJL A;  3SI8 A;  3P63 A;  1HE8 A;  5AEK B;  2MEK A;  2BDP A;  2V4L A;  3RJE A;  1P1A A;  3TFR A;  3DQV A;  2AL3 A;  1A70 A;  4UQG A;  4KLI A;  2LVO A;  2F1J A;  3RMK C;  1F0Z A;  4M6W B;  4IM2 A;  3S2A A;  3NAS A;  2ZW1 A;  2GH1 A;  4KLH A;  1WFY A;  2KMC A;  3IM1 A;  5AUI A;  2V0G A;  4YT0 B;  4UDU C;  1WXQ A;  1VR9 A;  2WF7 A;  5DG9 A;  3AUO A;  3B0X A;  2INN E;  3EEC A;  2OXO A;  5EE0 A;  3FM9 A;  5J2J A;  4F5R A;  4Q43 A;  2KMM A;  2GI9 A;  1JX4 A;  5IOI A;  1N62 A;  4ECS A;  5DQI A;  3VR8 B;  1HUZ A;  2FID A;  4S17 A;  1N5W A;  2JRH A;  5IIL A;  1X6I A;  1ZD2 P;  3U8Z A;  1N63 A;  4TUR A;  5E6O A;  3RCZ A;  5HHD G;  1TZO A;  2IA6 A;  4TQR A;  1Z1V A;  3B2G A;  3C2K A;  2WDT B;  3ZTC A;  1ZQK A;  2N9P C;  3AE5 B;  2N1W A;  4QIW C;  2RHF A;  2KDI A;  3U52 E;  5EE3 A;  3Q8P B;  3QYP A;  1FXA A;  1KL9 A;  3RPF C;  4F7Z A;  3MTN B;  3TAN A;  2OWO A;  3BQT A;  3ML9 A;  1TFR A;  4KX5 A;  4YCX A;  5AM3 A;  3M9M B;  4QWA A;  4P7I A;  2PKO A;  2FPK A;  1I7H A;  2KDB A;  3Q8C A;  5KFZ A;  2LI5 A;  3WAO A;  3LDZ E;  3I9V 1;  1KFD A;  4ED2 A;  1YJ1 A;  2J52 A;  4N6E B;  2Q5W D;  5ALH A;  3L0W B;  2IOH A;  2DZK A;  5HKH A;  3HX0 A;  2QEJ C;  1X6J A;  1I4P A;  1X9W A;  1ZQV A;  3C5F A;  2FCQ A;  1WJU A;  3JYU A;  4O3P A;  2W9C A;  1UCV A;  4E3C A;  2HD5 B;  2Q0Z X;  3NJT A;  4AJY B;  2PXI A;  1TAM A;  3IXS A;  4TV3 A;  1U48 A;  5KFS A;  3GS2 A;  3LWM A;  2DYO A;  1ZDV A;  2YB4 A;  5CHV C;  2VJ5 A;  5CHF A;  4ED0 A;  5TSS A;  4KLG A;  4GDK B;  1Y56 A;  2HSZ A;  4NAW A;  1UWM A;  1IGD A;  2XK5 B;  1RYS A;  4J9Q A;  3A1Q B;  3VTV A;  4MGI E;  4HYK A;  8ICZ A;  2JY6 A;  3Q8A A;  2ZCC A;  5E6J A;  1I35 A;  3UF8 A;  5AK3 A;  3QU4 A;  1TS4 A;  4ELV A;  3CST A;  2KFN A;  1BPD A;  4RNN A;  1J7B A;  2LRU A;  3QU5 A;  3MGI A;  1VJK A;  3V3X A;  1GC7 A;  1NOM A;  1C78 A;  2MJD A;  3LDA A;  3ZLZ A;  2B21 A;  5AKJ A;  1E8Z A;  3JSV A;  3ZD8 A;  1E8X A;  1V9P A;  3M8R A;  3DBL I;  4PH5 A;  4O9M A;  2I2Y A;  2MAX A;  3AQE A;  2FAZ A;  4II3 B;  4TUU A;  2IYD B;  3EWA A;  1OUQ A;  2C60 A;  2L00 B;  3PMN A;  5D4B A;  3MJ5 A;  1RM6 C;  3RFA A;  1XSL A;  4RQ2 A;  3GIK A;  4JE3 B;  1ET6 A;  3P4Q B;  1BPX A;  4ECR A;  4MFF A;  3QEA Z;  1S0M A;  3AE7 B;  4LCD E;  3ZIM A;  5JHA A;  1QQ6 A;  3SV3 A;  1SWW A;  3PST A;  1D4B A;  1HJP A;  2EAP A;  4QW9 A;  5JH5 C;  1GG3 A;  3LB8 C;  1U47 A;  3N1Y C;  4KIT B;  2QAR B;  2OJR A;  7ICJ A;  3IG5 A;  5DPR A;  3AM9 A;  5JRT A;  1V8C A;  4ECU A;  2JXJ A;  4C8M A;  4UAV A;  2N4F A;  2G9H D;  5TIS U;  5KFK A;  3TAP A;  4ECQ A;  1XSP A;  4IUM B;  5J2I A;  5IP4 D;  1DYQ A;  2K8B B;  4XA5 A;  1HEZ E;  1ZYQ A;  1TAQ A;  1ZQT A;  4BKS A;  1HTO A;  3ZDE A;  5KFL A;  3AH7 A;  2D3A A;  3WK7 A;  4JMU A;  4DOA A;  4ELU A;  1S1Q B;  3HM6 X;  2KAC A;  3RNA C;  1V1O A;  1MG4 A;  9ICS A;  2A19 A;  5ALO A;  3IV6 A;  5AI5 A;  2W8L A;  1E7P B;  2E8N A;  1SGG A;  2IOF A;  5KFQ A;  1TJE A;  3AEF B;  2KFK B;  3BS5 A;  1HUO A;  1C7Y A;  5ALN A;  3T5K A;  5J0P A;  4F5Q A;  3GIM A;  4KIK A;  4A3O A;  4CF4 A;  1JW9 D;  1U4B A;  3EZ5 A;  2AEH A;  2LXC A;  4C8N A;  1DXS A;  2K3U A;  4DDI D;  1ZQQ A;  1SE9 A;  1FFV A;  1QH9 A;  3ETR A;  2AQ0 A;  5DG8 A;  3MR2 A;  1T6B X;  3LYS A;  2XY7 A;  3UPQ A;  2YLM A;  2X8X X;  5EWF A;  4GXB A;  2KD1 A;  2LYA A;  5J0U A;  3B1L X;  1DOY A;  4KLQ A;  4DEZ A;  3NS8 A;  3QUB A;  3WKE A;  4JL9 A;  4C7Y A;  2D11 A;  3ZKJ C;  2K0P A;  1BML C;  3C21 A;  4PPX A;  2MRP A;  1OGW A;  4PHP A;  1S0N A;  1V5O A;  2OM6 A;  4P6V F;  3VUY A;  1C4C A;  1L8O A;  5EDS A;  3AEG B;  1AW7 A;  1ACC A;  5CR0 A;  3AXC A;  3GU3 A;  3RJI A;  1IUE A;  3NTU A;  1VJ5 A;  9ICA A;  3GFK B;  3DVG X;  4HKZ E;  3EYZ A;  5G55 A;  2ES6 A;  1RXV A;  2G08 A;  3PLU A;  3QC8 B;  4RFB A;  4QJF B;  2KYW A;  3IHQ B;  1SXT A;  2RPQ A;  1OFF A;  4Y2U A;  1ED1 A;  3R9K A;  2PJH A;  1L6U A;  4HCN B;  5KT5 A;  2NBU A;  2E8M A;  3M6K A;  1TBE A;  3LXF A;  3A9K B;  3FC4 A;  1NYR A;  3FKY A;  4WWM A;  4RQ5 A;  4FZL A;  2G06 A;  3DBS A;  1DOX A;  1S0V A;  1RAX A;  5KFI A;  1UUP A;  4YD1 A;  3KUZ A;  1SL2 A;  2FNJ B;  1YD8 U;  3WKA A;  4UB3 A;  1L5U A;  2GO7 A;  4MSM B;  5KFX A;  2NO4 A;  4HCP B;  4CE6 A;  3VVW B;  4L2Y A;  1TKD A;  1XLQ A;  2NRV A;  3H0M B;  2J0K A;  4JQW C;  2AX5 A;  4RF0 A;  4FZM A;  4QZC A;  4YQW A;  2XC9 A;  3GZN I;  3JPN A;  5HR6 A;  3U7Z A;  5H92 C;  1C77 A;  4E71 A;  2ZZP B;  3UXO A;  2VA8 A;  3ISB A;  4JGH B;  2JUO A;  4W9C A;  2LGX A;  1WJ6 A;  2MJ3 A;  3ZDB A;  5JU5 A;  4RQ4 A;  4IR1 A;  1EU4 A;  1JXE A;  2LHE A;  5J2E A;  1F0M A;  1JRO A;  4DWI A;  4OZA A;  2KTQ A;  2V3S A;  2VRR B;  3NRZ A;  1TS5 A;  3GV7 B;  2LWP A;  4A8X C;  4PZN A;  4KLO A;  3KKA A;  8ICI A;  1T8E A;  2KWU B;  4QW8 A;  3IN5 A;  1D8B A;  1Z4N A;  4ANV A;  5AKG A;  4REZ A;  4MGZ E;  1QQR A;  5C3J B;  3PRM B;  3RNB C;  3NZU A;  4LJP B;  2PMV A;  3GIL A;  1SF0 A;  1WF9 A;  5KTQ A;  3K4G A;  4IRK A;  4NAM A;  4ZHO A;  3TAC B;  3IHP C;  2E3T A;  4IM0 A;  4PGX A;  1U45 A;  1RDF A;  2HI0 A;  5J2C A;  1D9D A;  3OJS A;  8ICC A;  3Q3J A;  3RR8 A;  1X40 A;  3DV9 A;  3JPR A;  1XC9 A;  2NPT A;  7ICF A;  2BYE A;  3TAD C;  1NJW A;  2BCV A;  1ET9 A;  1SBB B;  4GDL A;  3TCA A;  1Z00 B;  5BYR A;  2BQR A;  3NVW A;  5AKY A;  3L08 A;  2YX8 A;  2LKY A;  2UVV A;  1FFU A;  4LNK A;  1GAQ B;  2ASQ A;  1HTQ A;  1KN5 A;  2C2D A;  4D2K A;  3GDX A;  5AKH A;  2BTE A;  2UYZ B;  1UGM A;  3PX6 A;  4U7C A;  4I6L B;  1JAL A;  1K1Q A;  4RQ3 A;  1NKC A;  5BMI A;  4Y2V A;  1ZDX A;  1AQ6 A;  1XEE A;  2XN9 C;  1TAU A;  1QSL A;  4XGA B;  2UVR A;  4P0Q B;  2YN4 A;  4XDD A;  4ZH4 A;  4OZC A;  3ML8 A;  4CO7 A;  2LYH A;  2B76 B;  5D94 A;  3SD7 A;  4DCC A;  5IIN A;  3OJ3 A;  2K8H A;  2VJ4 A;  1FEH A;  4M8N A;  2PIA A;  5BYQ A;  2PI4 A;  3T3N A;  2MRL A;  2MWS B;  1MFW A;  2DWQ A;  1QLN A;  4KMO B;  5ALM A;  4OCZ A;  1KDH A;  2FE9 A;  2D6F C;  2HHS A;  1S5L U;  1YQ4 B;  3HT3 A;  3TSS A;  2GBJ A;  4C4R A;  3UI3 A;  1V1P B;  5KFA A;  2IGH A;  5ALE A;  3BYT B;  1L4Z B;  5J0X A;  2KK8 A;  5ALX A;  2LUM A;  2A5U A;  4BKS D;  2R18 A;  1U49 A;  3DOW A;  4OHJ A;  1ZQM A;  5G5H A;  2KWD A;  3TMP B;  2MU2 A;  3DBR B;  3JPS A;  1CMX B;  3KUC B;  3KKA C;  3UIN B;  2CHZ A;  7ICQ A;  4DF8 A;  2WTF A;  3TI0 A;  8ICS A;  1SSN A;  3PW0 A;  7ICP A;  1XCQ L;  2WDV B;  2VH1 A;  2NRT A;  2IMW P;  2WAQ F;  5CTR C;  3WK4 A;  2HHW A;  1OQY A;  1V80 A;  4O5C A;  3QA8 A;  1EWY C;  1KF6 B;  3ETL A;  8ICO A;  4URK A;  5KT3 A;  3DCG A;  1XO3 A;  3Q6B A;  3QCA A;  1NJX A;  4W9F A;  4FO6 A;  2K4H A;  4F5P A;  2TSS A;  3S6J A;  1V49 A;  1MJD A;  2YB1 A;  3V6H A;  4MEX A;  1C9F A;  1V5T A;  2KX3 A;  2WU2 B;  5FR3 A;  1E10 A;  3APC A;  4Q8F A;  4LJX A;  7ICI A;  2KP7 A;  2IJ0 A;  4YWG G;  5HHI A;  3HJE A;  1FRD A;  2JRI B;  1SL1 A;  3D6J A;  1NVI D;  3V62 A;  5KT7 A;  2Y5C A;  2WWZ A;  1ENF A;  4KLD A;  2WF6 A;  1JML A;  1WJN A;  1JWM D;  5DBB A;  3F2B A;  3CSF A;  1KFY B;  5D49 A;  4M01 A;  4XE0 A;  4LJO B;  2G4D B;  3MGH A;  4A8E A;  2ZIU A;  3Q69 A;  5GXG B;  3JVZ X;  3N28 A;  5AKI A;  2I1J A;  1BPE A;  4ZOH C;  2V3P A;  1BXT A;  5AM4 A;  4YG2 A;  3CYM A;  3I5J C;  3BJY A;  8ICH A;  1X1M A;  3RUI B;  4NNJ B;  3A4S C;  4BUG A;  3TJP A;  5ALF A;  2KDF B;  2Y1J A;  5KFU A;  5J0O A;  4LVS A;  2N9K A;  3IDW A;  4LNO A;  4IWO A;  5IO9 A;  1NK8 A;  3V61 A;  3RB3 A;  3RNC C;  4IRC A;  2HBJ A;  4IC7 B;  3N9Y C;  1C76 A;  3N32 A;  3V6J A;  4A9A A;  1E90 A;  2BZF A;  3V7J A;  4I27 A;  4K1R B;  2H89 B;  1WI0 A;  3RJH A;  2JVC A;  4GC7 A;  4ICA A;  3N1Z C;  4I2I A;  2L32 A;  4LNF A;  2K9X A;  4UAT A;  1L7Y A;  1K1S A;  2I1Q A;  5AM0 A;  1YN3 A;  5KG2 A;  2HTM E;  2L5Y A;  2KMA A;  2ZXH A;  4OJP A;  2BQQ A;  3NS1 A;  2WHI A;  2ZG6 A;  3HW8 A;  1D3Z A;  2W82 A;  2ZUD A;  4RUC A;  1RXW A;  5KT4 A;  3ZDA A;  1OW5 A;  4O3O A;  5ALT A;  5BOM A;  2O6V D;  1NK5 A;  2ZEQ A;  4EKU A;  2W9C B;  2D3B A;  1NI2 A;  2MCN B;  4EEL A;  5ALI A;  3I1Y A;  2NBW B;  8ICQ A;  2J42 A;  3C8Y A;  2NRW A;  5J29 A;  3L4P A;  4TKN A;  4W9K A;  4MEY A;  3M1Y A;  1QOB A;  7ICS A;  4ZDV A;  4RNM A;  2UVU A;  5BMH A;  4UAZ A;  1CRX A;  3JW0 X;  2L3Z A;  4NAW B;  3RN9 C;  5BMG A;  3BII D;  4PS7 A;  4US9 A;  8ICJ A;  3A9J A;  2L83 A;  4MJS A;  2H3V A;  5JZE B;  1JMS A;  1N2X A;  5A0L A;  1MC8 A;  3V60 A;  2IO1 B;  2KFZ A;  1OEY A;  4C56 C;  3CW2 C;  2ZJ5 A;  1WXA A;  3TEX A;  4K4I A;  5DDY A;  4QWD A;  2QLT A;  2WF9 A;  4KV2 A;  1MQ3 A;  2PKE A;  2XGP A;  1WUD A;  4OJ5 A;  3PW2 A;  1T0R C;  2IY1 B;  5EOZ A;  4QZH A;  1B4F A;  2MBH A;  5J2H A;  3AE9 B;  3RNE C;  1WX7 A;  3D2S A;  4B95 A;  4F93 B;  3CWI A;  1XT9 B;  1SXD A;  4JB3 A;  2BR0 A;  3JSV B;  3IRU A;  1XF5 L;  1XD3 B;  3EPI A;  4ANU A;  2O2V B;  2CPR A;  3TBL D;  5KFD A;  2ZPY A;  5DB6 A;  2WXP A;  9ICI A;  5D2M B;  3LVV A;  1URJ A;  5G5G A;  3RJG A;  4XC2 A;  2KO3 A;  2X38 A;  3DBH I;  1J97 A;  3PZP A;  2EMT A;  3AB5 A;  2FBW B;  3T5L A;  4B0E A;  4BVU C;  3DDH A;  2QKQ A;  3F5A A;  4ECW A;  1JI7 A;  2RDH A;  1TKG A;  4ACF A;  3U26 A;  3DPD A;  3MBY A;  5HML A;  2DPI A;  3VC8 A;  4NY0 A;  2C22 A;  1F5S A;  1S10 A;  4QZI A;  2KT7 A;  2FLN A;  4WJN A;  1RQL A;  5ALL A;  4RM9 A;  2L1A A;  2N0S B;  2G1E A;  4EZK A;  3PRE A;  3BQ2 A;  1SKS A;  2KQ4 X;  3OSP A;  3AE4 B;  1WWV A;  4UBC A;  3CNH A;  1SKW A;  3IBE A;  2ZNV B;  5KG7 A;  2DX5 B;  2RQ5 A;  1FMA D;  3ZJT A;  2WXO A;  1PDX A;  4FAD A;  4CF3 A;  2HDO A;  1O08 A;  1PVQ A;  3HKZ C;  3Q3N C;  3ZDT A;  3N7R C;  2CS4 A;  2K4E A;  2W43 A;  4NQL B;  5K4L A;  4LTU A;  3QEB Z;  3N4M B;  2KWV B;  1MHX A;  2VZK D;  3ABV B;  2CXY A;  1YJJ A;  3QXG A;  3BS5 B;  1CJE A;  4K4G A;  1RLF A;  3TEW A;  1V97 A;  2ZIX A;  4FFD A;  2H3F A;  4XWT A;  3WKB A;  3EPG A;  2DHZ A;  1NZP A;  2BYF A;  2IDY A;  4KIK B;  1ECW A;  4EYI B;  9ICQ A;  4EE2 A;  4NV0 A;  5IIO A;  1V86 A;  1T94 A;  3Q8Q B;  3C28 A;  4ANW A;  4F5O A;  4DS4 A;  4MM3 A;  3F2C A;  4TMA B;  2ASD A;  2KLG A;  1NK4 A;  2M0A A;  4O3S A;  3M62 B;  3ZJU A;  3C0R B;  1PK1 A;  2D8C A;  4EEN A;  5CX3 A;  4HJG E;  2KG5 A;  4I2H A;  2MSN A;  8ICA A;  5AK5 A;  7ICU A;  2A1J B;  3SHQ A;  3JPP A;  2JEF A;  2D07 B;  3OWE B;  4ZRI A;  1KW4 A;  2D3D A;  1WZ3 A;  4J03 A;  2INC C;  3HHM A;  2KK0 A;  1MA7 A;  1IG6 A;  2XNA C;  4XDC A;  4KLE A;  4DWF A;  2KZR A;  3H7I A;  2IY0 B;  4QZD A;  4HLE A;  2YMP A;  3NUH B;  4BOZ B;  3B08 A;  2R8I A;  2CHX A;  2DBY A;  3FDS A;  2M56 B;  1TK5 A;  4DL4 A;  4YL8 A;  1TKY A;  2NR2 A;  5C2T B;  3B9J A;  2HBK A;  4C7Z A;  2V9H A;  1R4M I;  5KHO A;  5GTH U;  4FBU A;  2DAJ A;  4YTP B;  5EWE A;  1DK3 A;  5DG7 A;  4UB5 A;  2K8C A;  2WAQ C;  1WGK A;  3T3O A;  3AEA B;  5IIM A;  3AEE B;  4EZ9 A;  2DZM A;  2HMX A;  5LNK 1;  1T4G A;  2VH2 A;  2KZ3 A;  2QMT A;  2KHW B;  1FNW A;  1WRI A;  1RQN A;  1KM7 A;  4HWI B;  2KOX A;  3RUL A;  5C5J A;  2NTT A;  2KHQ A;  5ALR A;  1Q3V A;  3OJU A;  1QIL A;  4HEA 1;  1MG8 A;  2W9M A;  4GXK A;  5KG4 A;  3PX4 A;  2FLL A;  1NDD A;  4IW0 A;  2K22 A;  4LNN A;  3OPX A;  2BT6 A;  4WWO A;  4PHE A;  3GE8 C;  2PEA A;  2K1F A;  4YXD B;  5J2R A;  1J7C A;  2D2Q A;  2N7D A;  1YMH E;  4LZG A;  4Y2T A;  3RJF A;  2W7P A;  4UB2 A;  4E0D A;  5E79 U;  4F2S A;  4OVZ A;  3U30 A;  2GWS A;  4J9K A;  3AEV A;  1H4R A;  2LGY A;  1GJZ A;  2WGS A;  2PVO D;  1ZE3 D;  1QQ7 A;  2K89 A;  3PSI A;  1UF0 A;  3L13 A;  4LLG M;  1ZP0 B;  4DL7 A;  5KFM A;  2LYB A;  4BFR A;  3AMZ A;  2F76 X;  3AE1 B;  3QHT A;  5FR6 A;  1PUT A;  1F44 A;  3HVD A;  4Y2J A;  1A0P A;  1YX6 B;  3ZDC A;  1EO6 A;  2FI1 A;  1E7U A;  4FS2 A;  2M19 A;  4RNA A;  4DSE A;  1ZW7 A;  2I5H A;  3NOB A;  4KN7 A;  5KFP A;  4ECY A;  2ZVO A;  1WY8 A;  1NJZ A;  1SZP A;  5AI0 A;  4ECT A;  4F4Y A;  3SYZ A;  5KFE A;  1I4R A;  4UB4 A;  2YQE A;  4YVZ A;  3M3J A;  5JUM A;  2D3G A;  1XCT L;  4RGO S;  2KIV A;  1TT5 B;  4AUQ C;  1E0Z A;  5BOL A;  3PZD A;  4G50 A;  1RFA A;  4P0P A;  4HXD A;  9ICO A;  2NPT B;  4MAC A;  3UM9 A;  4BDP A;  2O6K A;  1JCK B;  2IO3 B;  4GDL B;  2Y5P A;  4K7S A;  4OVU A;  3V05 A;  4IDI A;  4DSJ A;  5AK4 A;  7ICG A;  1ZQX A;  2Y1I A;  3F5E A;  2HHU A;  4IQV A;  9ICT A;  3EC8 A;  1KRP A;  3RB0 A;  4JK1 A;  1PYW D;  3J9C A;  4FHK A;  3ZVV A;  3L5K A;  2RRD A;  4OVV A;  3KHG A;  2WF5 A;  4WWP A;  2H3Z A;  1EM7 A;  2IHM A;  4DOC A;  1TS2 A;  4KKJ A;  2E8P A;  3V6K A;  1ZQZ A;  5BPC A;  2FJ6 A;  3ED5 A;  4C00 A;  3VH4 B;  1Z3E B;  3BQ1 A;  5D46 A;  3WAM A;  4EBC A;  3J81 j;  2LGI A;  2HOF A;  5DQG A;  3OTQ A;  1GNU A;  2AQ3 B;  4P16 A;  3KZX A;  2JYT A;  5G2N A;  1NJY A;  2DQN B;  4J9O A;  4JV2 A;  3OLM D;  1UA1 A;  2WYQ A;  4JPS A;  4F50 A;  1VD2 A;  2PE9 A;  4J9P A;  2R8K A;  4A55 A;  2LJI A;  5DKW A;  5I4D A;  3KUD B;  3W1S C;  3C2L A;  2QB0 A;  5F3X B;  3GV8 B;  4NLG A;  4MFC A;  2HJ8 A;  4PHA A;  2NS5 A;  4DQO C;  2BDU A;  2FPM A;  3P2B A;  5HMM A;  3TAR A;  4I2J A;  4ARC A;  9ICU A;  2MHJ A;  3GP7 A;  2ZJD A;  1YZ7 A;  3QX1 A;  1S97 A;  9ICF A;  3P1M A;  1JRU A;  3SAH A;  1GOZ A;  1T0S C;  4B9L A;  5KL8 B;  2Y0S F;  3MAB A;  1T3N A;  8ICM A;  4G9B A;  4CQN A;  2ZIV A;  2R8G A;  3PML A;  2LHD A;  4YSX B;  3Q8F A;  5ALV A;  3TFS A;  1VZ6 A;  5LXH A;  5DBA A;  4KGT A;  4JV1 A;  9ICR A;  3L10 B;  5ALQ A;  3C2M A;  2LPE A;  3RH5 A;  2MX2 A;  3U4E G;  4FA6 A;  5HNK A;  2HCF A;  8ICG A;  1ZD5 A;  2ISP A;  1PGX A;  5KFV A;  3D2N A;  2R8J A;  5IAA C;  1J19 A;  4ECX A;  2PVG C;  4RU9 A;  2ATL A;  2B0C A;  4JIO U;  2MA9 B;  1BVS A;  2FUG 1;  3RZF A;  2W9N A;  3M8S A;  1R4N I;  3THV A;  2ZUB A;  3KLS X;  3MFI A;  2ZPN A;  4KGR A;  5HFY A;  2KVR A;  1Q1O A;  3H0L B;  1SJE D;  3WK9 A;  3TQ1 A;  4I2C A;  5J2F A;  2KZM A;  2KQ7 A;  5D6J B;  4G3I A;  4J9S A;  2XVT A;  1ZPS A;  3MHS D;  4ASW C;  1KEJ A;  2MUT A;  2BHN A;  2RD0 A;  2F1I A;  3AU2 A;  4P2H A;  2XY6 A;  3NVZ A;  4GSW A;  4IL6 U;  4F4K A;  1IPG A;  1YX5 B;  2INP E;  3K9O B;  3G6Y A;  3P4R B;  4RQ7 A;  4I2A A;  2WQY B;  4DQP A;  3KW5 B;  3RNF C;  1ZD3 A;  2XID A;  3HP6 A;  1L3U A;  1BUI C;  2E5S A;  4DXF A;  4DFD A;  8ICR A;  1KLG D;  1WM2 A;  5AIB A;  4DFM A;  2KNB A;  4GLS C;  1JWB D;  3ISC A;  3KHH A;  2V3N A;  1SV4 A;  3U2S C;  5ALW A;  2W9B A;  2ASL A;  4KLT A;  2FIF A;  3B0Y A;  2JF5 A;  1NK0 A;  2LXA A;  1ARO P;  3DBR I;  4FXC A;  3RD2 A;  4YMO A;  3WK6 A;  4JX1 C;  3KFU F;  2DL0 A;  1VCB A;  3K1R B;  7ICK A;  9ICG A;  3ZUN A;  1T0Q C;  3TAD A;  1X66 A;  4G11 A;  1J0G A;  3I3T B;  2LBO A;  3VDZ A;  1ZQU A;  4J9R A;  3PZ7 A;  5C0Y A;  2HBL A;  2RDB C;  4NXZ A;  5B66 U;  2Z59 B;  4CCH A;  3OGU A;  5L1L A;  1TY2 A;  4P4P A;  9ICW A;  4ZRP A;  9ICN A;  2EZY A;  2FMS A;  3NUQ A;  5KT6 A;  4YXJ A;  2LRW A;  1L7P A;  4HPL B;  2LI6 A;  1K50 A;  1YIW A;  4F91 B;  5KFG A;  4DQS A;  2KJ6 A;  4I6N B;  1E6E B;  4M6W A;  3PO0 A;  2J6U A;  4DHJ D;  2IHN A;  2KNJ A;  4I2G A;  2MP2 A;  1L0X B;  1NK6 A;  2KSO A;  3ZRC A;  9ICE A;  4R8U A;  4MJS B;  4J6I A;  5KFY A;  2H3I A;  4TQ1 A;  3ZYY X;  2WXH A;  3QUC A;  2KKC A;  1DGJ A;  9ICB A;  1DOI A;  3GV5 B;  1CQV A;  2PW9 A;  3UIO B;  4B9N A;  2WXF A;  1S76 D;  3ZQ4 A;  3AU5 A;  1G6J A;  2EKI A;  2FCM A;  2JGA A;  5LXI B;  3EGR A;  2MBB B;  5AZF A;  2BKE A;  4M02 A;  3UQB A;  4YTM B;  7ICR A;  1S8O A;  3ZNH B;  2F3N A;  3WU2 U;  4F4X A;  3KWL A;  4ED8 A;  2O6V A;  1TK8 A;  4M9J A;  1WMH A;  2BPS A;  3O13 A;  1SKR A;  3ALR A;  2BS3 B;  5FP0 A;  2G5I B;  4EZ6 A;  3GQC A;  4M0A A;  4ICV A;  3DBL B;  4NQK E;  1WE7 A;  2XO7 A;  4Q8E A;  4RPZ A;  2K4I A;  5AI4 A;  1QTM A;  1UBI A;  2EMS A;  1Z5S B;  4M8M A;  4IR9 A;  2BKR B;  3UXP A;  4KDL B;  4IWP A;  2XBB C;  1RPL A;  4ED3 A;  2BCU A;  1LQB A;  2WS3 B;  4C4T A;  2D5G A;  2G4S A;  1PGA A;  2OH2 A;  9ICL A;  5GTI U;  2KIC A;  5AHX A;  1OXJ A;  1LVH A;  3LJ3 A;  1J7A A;  1C3T A;  4GOC A;  5L95 C;  3IG8 A;  2A4Z A;  4OJO A;  3X0W A;  2JMG A;  2IZV B;  1T0Y A;  3EA6 A;  4AS1 A;  3WAL A;  3BVM A;  3PHW B;  3AED B;  1WX8 A;  2L7R A;  2BYT A;  4II2 B;  3WK5 A;  5KFJ A;  2WF8 A;  2JXT A;  5FK9 C;  5D3I B;  1SV0 C;  2EEL A;  2K60 A;  1WXS A;  1N61 A;  1FXT B;  2XEW A;  3C1Y A;  5KFR A;  2K8A A;  1V6E A;  3VCB A;  4N58 A;  2J4X A;  4ITK A;  4W9L A;  4M9L A;  4YTN B;  3RR7 A;  1QOG A;  1VRA B;  2ZJ8 A;  9ICK A;  2YEP B;  1DGS A;  3MFH A;  4H2A A;  1WR6 E;  2WB1 F;  1MI0 A;  5CA7 A;  1KLU D;  4Z6F A;  1BT0 A;  1XS9 D;  3WA0 A;  2W9A A;  1NKE A;  3TIX A;  9ICX A;  2ASJ A;  1ZQP A;  8ICX A;  2RDJ A;  4PGQ A;  1CZP A;  4KLS A;  4RGM A;  4ZHP A;  3E0F A;  3ZNG C;  4DHZ B;  2ZIX B;  4GXI A;  5DLF A;  2JRZ A;  3GZF A;  1CEZ A;  2GBN A;  3KYD D;  4O3M A;  4RUA A;  1F9J A;  4KX3 A;  1FXI A;  5KG0 A;  4JWS C;  2ZTE A;  3BK1 A;  1IBX B;  1ZQY A;  1QT9 A;  1K8R B;  1ZQH A;  2WX0 A;  2IND C;  2MW5 A;  4MM3 B;  1N60 A;  1GUA B;  4KDI C;  2MH7 A;  2DGZ A;  3AE2 B;  5HR7 A;  4EZJ A;  1PK1 B;  2KDE B;  1ZQJ A;  2KN5 A;  3PPA A;  1R7S A;  1XLO A;  4BOS C;  4MF2 A;  3KH0 A;  1ZJN A;  1WGY A;  3MJW A;  4IG7 B;  1N5X A;  4NLZ A;  3DDC B;  3N20 C;  3PTF C;  2BGW A;  1KTK A;  3V6C B;  4NL9 C;  2LEK A;  9ICJ A;  3HPO A;  2BBC A;  1K53 A;  3AEB B;  1HZ6 A;  1EF1 A;  4YN4 A;  1IXR A;  3LWL A;  4EX7 A;  2J0J A;  3I63 C;  4YXM A;  4PS3 A;  1JIH A;  2DF4 B;  4EEY A;  3RH4 A;  1HXY D;  3RAX A;  2WXN A;  1LFD A;  2QCZ A;  4F8C B;  8ICE A;  4IQW A;  5AI8 A;  4J9L A;  2GOW A;  4WUR A;  3ZW3 A;  4DSK A;  2EKE C;  2K8C B;  2GB1 A;  3L3F X;  4O1N A;  2JZZ A;  3NHE B;  3PY8 A;  2JZ3 B;  2Y0S C;  2BPF A;  2FUH B;  1ZJM A;  1MSW D;  3WK8 A;  2WP9 B;  3FYH A;  2N1R A;  3WKD A;  2V4R A;  3PW7 A;  2YEP F;  3MP9 A;  2Q4T A;  3NG0 A;  3NVY A;  4KLL A;  3QU9 A;  1BNO A;  2W11 A;  2BVC A;  2V1Y A;  2Z0E B;  1JWU D;  4S0R A;  2AYO B;  2L8J A;  2IGG A;  4EEW A;  4C4V A;  2DYM A;  4DL5 A;  7ICL A;  2DNF A;  4CGZ A;  3QAQ A;  3A0B U;  3QX7 A;  3MC8 A;  5AKK A;  4RPY A;  7ICE A;  4ZRQ A;  4EYH B;  1B1Z A;  4J3O D;  2KJ5 A;  1WXV A;  2M0N A;  1J8C A;  4DXG A;  2GBR A;  3AQF A;  5J2K A;  4HRO A;  2Y9T A;  1TZ1 A;  3ZDM C;  4AYB F;  4LNI A;  4Z6C A;  3IFW B;  3DVG Y;  1QSY A;  2KFK A;  4M2Y A;  4WAA A;  2P35 A;  3M9O B;  1L8L A;  3FIL A;  1A6S A;  2BWE S;  7ICM A;  5J2G A;  2EDU A;  2N7E A;  3JPQ A;  3O65 B;  4XX5 A;  3RT3 B;  5KFT A;  3OG5 A;  4O3R A;  2KKV A;  4K3C A;  1JRP A;  2JWZ A;  3P4S B;  2AQ2 B;  4DHJ B;  4BZA A;  4USA A;  3DVN U;  3RYT A;  2F2A B;  2KTR A;  1PK3 A;  2V4Q A;  1JWS D;  1QKZ A;  4M9H A;  4YSY B;  7ICT A;  2NVU I;  3LK9 A;  4PS8 A;  4O5K A;  4P0P B;  3RI7 C;  1QSS A;  1TVA A;  3R7R A;  4DL3 A;  4YP3 A;  4W9G A;  1Y88 A;  4IC9 A;  2W03 A;  2PFN A;  4WJQ A;  2Y9U A;  3M95 A;  3Q14 C;  4AOF A;  2R2Q A;  1ZKH A;  3QUT A;  4JUZ A;  1NKB A;  5LLI A;  1MPE A;  2F1H A;  4WWN A;  2W8K A;  5J18 A;  1FO4 A;  2N1V A;  2M9N A;  4NJ8 A;  8ICY A;  7ICH A;  1LGR A;  2WDR B;  3Q3F A;  2NCN A;  3MDC A;  1XO1 A;  3V6E B;  4RT3 A;  4QZE A;  3UQ0 A;  4KN4 A;  4DF4 A;  3DVN V;  4HVB A;  1YQB A;  4BAX A;  4JV0 A;  4RPX A;  2WXK A;  3ONS A;  3LVW A;  4ECV A;  3GII A;  3VTW A;  5HHH A;  2J6S A;  2ZVN A;  4FE3 A;  2KWC A;  2BKF A;  4Y2Y A;  1PFD A;  3I28 A;  2KEY A;  5DB8 A;  3MDA A;  2W7O A;  2AGO A;  1QOF A;  1V2Y A;  2D10 A;  3TKA A;  2EAN A;  4UW9 A;  3H40 A;  4R64 A;  4JLC A;  3V7K A;  5AI6 A;  4YMN A;  3T3F A;  1HA5 A;  3KD3 A;  2Y5B B;  2PFO A;  4KX6 B;  2P66 A;  1XLN A;  3D32 A;  3C1Z A;  1V9J A;  3RRG A;  4AP4 C;  4RNO A;  3E2E A;  3AL0 B;  5J2B A;  1Q3U A;  3T9L A;  4C4S A;  4F71 A;  1I4H A;  2CKH B;  3G6X A;  5IA7 A;  5H2F U;  4C8K A;  3N7P D;  4FLH A;  1HEK A;  4DLE A;  3V7L A;  1L7M A;  4RZR A;  1SGH A;  2LMC A;  3AE3 B;  1UNS A;  1I4X A;  2G5H B;  5L1M A;  1YN5 A;  3SR6 A;  2J53 A;  4BWM A;  3ZNI D;  2BCR A;  2AHO B;  3VUW A;  1GB4 A;  3ZRF A;  1KH0 A;  1N6Z A;  1TGZ B;  4DQQ A;  2ZCB A;  3AV8 A;  4LK0 M;  4RF1 A;  3SEB A;  3RFZ B;  2LGS A;  2OED A;  5DPT A;  1OQR A;  3SD5 A;  3CP8 A;  3HUI A;  2KVC A;  4IOI E;  3C23 A;  1PVP A;  3ECI A;  5AI9 A;  2ZIV B;  2G07 A;  5ALZ A;  4P4M A;  2LVQ A;  5B5E U;  3H7P A;  1L4D B;  2SEB D;  3TAQ A;  3NZS A;  5C1Z A;  4DOB A;  3T79 A;  1SL0 A;  2CHW A;  2JU6 X;  3E58 A;  2VA3 A;  2MLB A;  2HDE A;  5L83 A;  3QU7 A;  2QC8 A;  4LZD A;  4RQ0 A;  4B9U A;  3VHT C;  5ALP A;  3SMV A;  4WIP A;  5GMV A;  4RM8 A;  1BPY A;  4JWN A;  1ZQI A;  1SIJ A;  5KAF U;  3V72 A;  1COO A;  8ICU A;  1BPZ A;  1WSP A;  4PT5 A;  4ZRJ A;  2ISO A;  3QQ8 B;  2C2E A;  5E6P A;  2C9W B;  1KQQ A;  4X57 B;  3VTU A;  3DHG C;  2I1K A;  1D5X C;  4O3Q A;  4NWI A;  3ZDD A;  4XYC A;  2JZB A;  2KIW A;  1ZOL A;  2V4I B;  3VXW A;  5KG3 A;  1XQQ A;  4IQT A;  4NLN A;  1Y8R C;  2MUT B;  2XCP A;  8ICL A;  2DUY A;  4PYZ A;  1P0R A;  3E9S A;  2ALZ A;  1ZXI A;  4A3P A;  3RF9 A;  3FAH A;  1RG6 A;  2XI9 A;  2XY5 A;  1FIQ A;  2WB1 C;  1TK0 A;  1RYU A;  1ZOY B;  1ZQN A;  2J6T A;  4PHD A;  1L0Y B;  1TY0 A;  5AZG A;  4P4O A;  2PFQ A;  2JXX A;  3WIM A;  4R66 A;  3TEY A;  3MR6 A;  1RZT A;  2QB1 A;  3BQ7 A;  2OJW A;  4KLM A;  2E6X A;  2N9L A;  1EF5 A;  1CK1 A;  1UD7 A;  4Y2X A;  4XZ4 A;  4WJP A;  2ZUC A;  3H6N A;  4WJO A;  1YQ3 B;  5DPW A;  1ZET A;  2QSD A;  3QU2 A;  2VA2 A;  2HVH A;  4OD0 A;  2E8O A;  1B9R A;  4ACO A;  3M9N B;  3Q8B A;  1NZB A;  1AYF A;  1FRR A;  3RNG C;  2AH5 A;  3ZGZ A;  1NK9 A;  4DDG D;  9ICC A;  3PNC A;  5EE1 A;  1ZQC A;  1IIP A;  1EXN A;  1EUV B;  4M9G A;  1ZD4 A;  3OHA A;  1L3T A;  4W9H A;  3EFU A;  2WXJ A;  5L9X A;  1C4P A;  1FD6 A;  3ZD9 A;  2DPJ A;  1P7F A;  3H8M A;  1FEZ A;  2L05 A;  4B9K A;  4UAW A;  1KLN A;  1MVK A;  1LKY A;  3ZJV A;  7ICN A;  4PL1 A;  2BCS A;  1KLV A;  1L7N A;  4FHJ A;  5CEH A;  2F8L A;  4ED7 A;  2R61 A;  4QWC A;  4DK5 A;  2WFA A;  8ICW A;  2GLS A;  4MGY E;  2MP2 B;  1F2R C;  3VAW A;  3UMC A;  1OEY J;  2KSO B;  2K6Q A;  7ICO A;  2RGF A;  3A33 B;  1H8C A;  4R8U B;  3QIJ A;  3UMG A;  2KTF A;  3BZC A;  2KJR A;  2KAJ A;  1I4G A;  4TQS A;  1KKX A;  4GFJ A;  1QCK A;  5DDM A;  1TE2 A;  4N59 A;  4ZYN A;  4NLK A;  5AZH A;  5KFB A;  4RT2 A;  3PZ8 A;  4CNQ A;  4DLG A;  3VH3 B;  1ZRN A;  2JV3 A;  5DLG A;  2YML A;  2E1F A;  4O0I A;  1YOV B;  3A0H U;  3R3M A;  3MGV A;  3W1S A;  5J2D A;  4EX6 A;  4RQ6 A;  4UAY A;  2O6V B;  1WMH B;  4E74 A;  1X42 A;  1KBU A;  2R8H A;  1AN8 A;  3PSP A;  2M0X A;  3BVG A;  4NJC A;  4NLB A;  2OHF A;  2ICI A;  2ZW0 A;  2ODG A;  1FM0 D;  2PLP A;  4YR3 A;  3W1Y A;  3WKC A;  3RAQ A;  3RTV A;  1PQS A;  4I2B A;  4TQ0 A;  1PUZ A;  1IGC A;  3PV8 A;  4AYB C;  4UAR A;  4Q2J A;  2KMD A;  4QWB A;  1ZUD 2;  1LM8 B;  3ALB A;  3DBH B;  5KG5 A;  4GIV A;  2K39 A;  4MEL A;  1GPX A;  2ZTC A;  4DFJ A;  3KBB A;  3N30 A;  4FJY A;  4W9I A;  1YT3 A;  5TR5 A;  2IOF K;  3R66 C;  1K52 A;  2BQ3 A;  1XNS A;  3T5J A;  1KFS A;  1E7V A;  1WX9 A;  2JQR B;  2PPH A;  4AWJ A;  5DB7 A;  5J8Y C;  4NJ7 A;  3G6V A;  4GGQ A;  1RYJ A;  5DGB A;  4KSL C;  2BF8 B;  3PRZ A;  3M7D A;  4QZ9 A;  2FMP A;  4WAF A;  3JPO A;  2JH7 A;  1NYQ A;  4AP9 A;  4FJZ A;  2GBM A;  3D2Q A;  2ZXI A;  4MH8 A;  2WXQ A;  3AU6 A;  1WWT A;  3VR9 B;  3SAF A;  1JXL A;  2G09 A;  4ECZ A;  2RPV A;  3P42 A;  4K7W A;  4BKT A;  4YR0 A;  1Q46 A;  2KZZ A;  2GMI C;  3SDL C;  4KKI A;  1L7O A;  2QJL A;  4YSZ B;  2KAN A;  4KZ0 A;  4GXJ A;  3Q8K A;  4DFK A;  5H8Y E;  1ZRM A;  4DL2 A;  1ZQD A;  3PGE A;  1K5O A;  3H8J A;  4IKG A;  1WH3 A;  3ORY A;  5KT2 A;  3F2D A;  1ZQG A;  4AJW A;  4BBN F;  3IVF A;  2I9G A;  3U7D A;  3W9C B;  2JZP A;  2LGD A;  4B0M A;  5F9L A;  3Q2A C;  2K6D B;  2LM1 A;  4DS5 A;  1Q10 A;  1TS3 A;  4HK2 A;  2NV3 A;  5T14 A;  1ZQS A;  1Z4O A;  1KFT A;  3QAR A;  4IM3 A;  2JEG A;  4B6J A;  1NEN B;  1U4A A;  2HOI A;  4DSL A;  3VUX A;  4QZG A;  1UHU A;  2K25 A;  4IRD A;  1UH6 A;  2C7H A;  5KG1 A;  1WRD B;  4HPP A;  2F77 X;  4I29 A;  4PYU A;  3SEI A;  5ALD A;  2KV2 A;  2FE8 A;  4BXO A;  1S3S G;  3KHL A;  3Q8S B;  2NRZ A;  3SFD B;  1T3Q A;  2UWQ A;  4GIB A;  4F72 A;  3RBE A;  1P7E A;  2D3C A;  1O03 A;  1WE6 A;  1YJI A;  2M8S A;  3H8H A;  4ANX A;  1C1Y B;  3PX0 A;  1TKE A;  4K7U A;  1AAR A;  3BY4 B;  4Y2R A;  2WU5 B;  2BB5 A;  3EHV A;  2CU1 A;  1CUK A;  3W2D A;  4CYE A;  1E9M A;  1ZQF A;  3PRP B;  3RB6 A;  5HG2 A;  2QIE B;  1KRH A;  1ISN A;  2BS4 B;  2O2V A;  2J7Q B;  2BGF A;  5DQH A;  3EFC A;  5DBC A;  2W55 A;  5CHW A;  3O0F A;  2VZK B;  2L52 A;  5ALG A;  1PVR A;  2I38 A;  2CJO A;  2N9E B;  2DAF A;  3E56 A;  5AKL A;  5TZV A;  2VKQ A;  2CU3 A;  5J0Q A;  9ICM A;  5AKE A;  1X9M A;  2F8K A;  4P1C C;  1NK7 A;  2SAK A;  1WZ0 A;  1JQ4 A;  1R4M B;  4MHV A;  3C19 A;  2EZZ A;  4QZA A;  1MHH E;  5ALJ A;  1FNV A;  1WR1 A;  2WDQ B;  5CJ7 A;  1E8Y A;  4EZL A;  1OQQ A;  4KGS A;  4FBJ B;  2CN1 A;  1QQ5 A;  2VAN A;  1SIF A;  3OHB A;  2DFL A;  1LB2 B;  3KHR A;  4RGN A;  5L1J A;  3OJ4 B;  1X9S A;  1F2R I;  4K4H A;  1E5W A;  3ENE A;  4R3D A;  1QOA A;  2IGD A;  4DO9 A;  2H3Q A;  2KX0 A;  1EU3 A;  1D5M C;  3AEC B;  4C4V B;  5KFC A;  2C2R A;  1ZQB A;  4MFA A;  2PI5 A;  2LVP A;  3N97 B;  5DCN A;  2W3R A;  4N9F 4;  2ZIU B;  1S0O A;  2P6R A;  2DKZ A;  3BS7 A;  4EOY A;  3TL5 A;  1UEL A;  5J0W A;  4F4W A;  1D9F A;  2HE7 A;  4DQI A;  1ZQ1 C;  3DWM A;  3KZI U;  2REX A;  3PW5 A;  2N9X A;  1SWV A;  8ICK A;  1B43 A;  3PO5 A;  4NZL B;  5EE9 A;  2KDM A;  1F52 A;  3JPT A;  4OJ6 A;  5CB1 A;  3ZO5 B;  4Y2S A;  4F8R A;  3H9D A;  5J2A A;  3FIL B;  4FJV B;  4Y2Q A;  2I6X A;  2N7J A;  4M0W A;  4W9E A;  3L54 A;  2A1A A;  4A90 A;  1SEB D;  1L2N A;  2ON8 A;  3ZTD A;  4XQ8 A;  1L5P A;  1IYF A;  8ICN A;  2IO0 B;  3RB4 A;  2NMQ A;  2G3Q B;  4RCO A;  9ICV A;  3IT6 B;  2WXG A;  3T5H A;  1PZN A;  4MDK E;  4W9J A;  5IIJ A;  4Z6D A;  1ZXH A;  2ZIW A;  2KTR B;  4B9M A;  4WH4 A;  3H1U A;  2A1J A;  4MEM A;  2XIC A;  3VRB B;  2P6U A;  2WXR A;  4A6Q A;  3M63 B;  2KJ8 A;  2WLB A;  3SEN A;  2JWU A;  2WX1 A;  3GOE A;  4PJ0 U;  3MC9 A;  9ICP A;  4HAI A;  4F4Z A;  1SV0 A;  1ROE A;  3SV4 A;  1H38 A;  1ZQR A;  3CIR B;  4XUS A;  2MA1 A;  3RJJ A;  5ALU A;  2JEI A;  4DBG A;  1UA0 A;  2IO2 B;  5CRX A;  3IG3 A;  1ZQW A;  2PFP A;  2A3V A;  4BKG A;  5IKC M;  2LHT A;  2YY6 A;  2BQU A;  2GOL A;  4G0N B;  3BK2 A;  1XSN A;  4FN2 A;  4ARI A;  2KJ9 A;  4YD2 A;  4QZ8 A;  3AU4 A;  2RP5 A;  1JWA D;  5BO4 B;  2ZNV C;  3A9J B;  5J0Y A;  4MSQ B;  1L3S A;  2PTL A;  2BCQ A;  4WQM A;  1WWU A;  1L3V A;  5L1K A;  2YVC A;  2KC2 A;  1DOQ A;  2YTU A;  3SAG A;  3QZ8 A;  3X23 A;  1B22 A;  2FCN A;  3K9P B;  1SE4 A;  3PV1 A;  2FCS A;  2HOQ A;  3UGB B;  5KFW A;  3H8W A;  8ICT A;  2JHD A;  1A76 A;  4F2R A;  4QAY A;  3NGD A;  1IV8 A;  2L76 A;  5CHG A;  4F3O A;  4QWE A;  1D5Z C;  3HVZ A;  3N1X C;  2MBO A;  3HRD D;  4UB6 U;  3BDP A;  5AM5 A; 
#chains in the Genus database with same CATH homology
 4DXG A;  3TEW A;  1V97 A;  4HRO A;  1TS4 A;  4XWT A;  5FKA C;  2IDY A;  4EE2 A;  1J7B A;  1VJK A;  3V3X A;  1C78 A;  3Q8E A;  3FIL A;  4TMA B;  2MJD A;  2M0A A;  3ZJU A;  2WXI A;  1RFK A;  4HJG E;  3KQ4 A;  2I2Y A;  3B2F A;  2KN4 A;  1JRP A;  3P4S B;  2AQ2 B;  3OWE B;  4US8 A;  4USA A;  1SJH D;  3MJ5 A;  1D6E C;  1YNT E;  2JSV X;  1RM6 C;  2XNA C;  1JWS D;  1QKZ A;  4JE3 B;  1ET6 A;  4XDC A;  3P4Q B;  4YSY B;  3AE7 B;  2Z8L A;  2LFI A;  3NUH B;  1D4B A;  1NEK B;  3VQI A;  2DBY A;  2M56 B;  3LB8 C;  1TKY A;  1XLP A;  5C2T B;  3B9J A;  4C7Z A;  3AM9 A;  1V8C A;  3DWG C;  4YTP B;  2G9H D;  1WGK A;  4OZB A;  3AEA B;  3T3O A;  3AEE B;  1MPE A;  5LNK 1;  3VRA B;  1FO4 A;  2WDR B;  1DYQ A;  2QMT A;  1HEZ E;  1FNW A;  1WRI A;  2WXK A;  2RDG A;  3AH7 A;  2NTT A;  1QIL A;  4HEA 1;  1K51 A;  2KAC A;  3AN1 A;  1PFD A;  1V1O A;  1QOF A;  2K22 A;  2BT6 A;  3AE8 B;  1E7P B;  4YXD B;  1TJE A;  1J7C A;  3AEF B;  1HA5 A;  3BWU D;  1YMH E;  4KX6 B;  1XLN A;  4ZYS A;  3BZD B;  3R2I A;  1QLB B;  4OW0 A;  4OVZ A;  2H88 B;  1JW9 D;  1I4H A;  3MHZ A;  2PVO D;  1ZE3 D;  2BB6 A;  2K3U A;  4LLG M;  1FFV A;  3ETR A;  1T6B X;  1ZP0 B;  4HRS A;  1FNU A;  2LMC A;  3AE3 B;  3AMZ A;  1UNS A;  1FCC C;  3AE1 B;  3NVV A;  1I4X A;  3EUB 2;  1PUT A;  1YN5 A;  3SR6 A;  2J53 A;  3HVD A;  4RGT A;  5JXV A;  5BYS A;  1DOY A;  1GB4 A;  2M19 A;  1KH0 A;  3AV8 A;  4LK0 M;  4RF1 A;  3BYY B;  4RNA A;  4C7Y A;  3SEB A;  3RFZ B;  2K0P A;  1BML C;  2OED A;  3W5V B;  1OQR A;  3HUI A;  3AE6 B;  4IOI E;  3URY A;  4P6V F;  3KWV A;  1I4R A;  1C4C A;  2ACZ B;  3AEG B;  1AW7 A;  1ACC A;  1XCT L;  4RGO S;  1E0Z A;  2JX5 A;  1L4D B;  1IUE A;  2SEB D;  4HKZ E;  4MAC A;  1JCK B;  2JU6 X;  4GDL B;  4RFB A;  1HZ5 A;  2Y5P A;  4L1B A;  2HDE A;  1SXT A;  3V05 A;  4IDI A;  1OFF A;  4WIP A;  1L6U A;  2QIL A;  1SIJ A;  3LXF A;  2BW2 A;  1PYW D;  3J9C A;  3FC4 A;  1NYR A;  3IT4 B;  4PT5 A;  1WSP A;  4WWM A;  3W5U B;  1DOX A;  1EM7 A;  1TS2 A;  2W54 A;  4KKJ A;  1D5X C;  1UUP A;  2WXL A;  1I4Q A;  2V4I B;  4L2Y A;  1XLQ A;  3NZ3 A;  3E9S A;  2LGI A;  1ZXI A;  2AQ3 B;  4P16 A;  3FAH A;  2AX5 A;  4RF0 A;  2JYT A;  2GRI A;  3MC0 B;  1FIQ A;  1L0V B;  1ZOY B;  3U7Z A;  5H92 C;  4JPS A;  1C77 A;  1L0Y B;  1TY0 A;  4A55 A;  2LJI A;  5I4D A;  2MJ3 A;  1EU4 A;  2LHE A;  2WXM A;  4DQO C;  3TEY A;  4JWU C;  2CJN A;  1JRO A;  2E6X A;  4OZA A;  2N9L A;  3NRZ A;  1CK1 A;  4ARC A;  1TS5 A;  2AQ1 B;  2WNM A;  3GP7 A;  4A8X C;  1GB1 A;  1YQ3 B;  2Y3A A;  2QSD A;  4REZ A;  3P1M A;  1QQR A;  5C3J B;  1GOZ A;  5HI1 A;  1VZ8 A;  3TUO A;  1B9R A;  3Q8B A;  1HQR D;  2PMV A;  1PGB A;  1AYF A;  1FRR A;  1SF0 A;  3ZGZ A;  1C79 A;  1QF6 A;  4NAM A;  4ZHO A;  4CQN A;  2MJE A;  2E3T A;  5EE1 A;  2LHD A;  4YSX B;  3Q8F A;  3LYY A;  3TEZ A;  1VZ6 A;  4KGT A;  1ET9 A;  1SBB B;  3MFG A;  1FCL A;  5BYR A;  2WXJ A;  2W3S A;  3NVW A;  1C4P A;  1FD6 A;  3U4E G;  1P7F A;  4RH6 A;  5D7G A;  1FFU A;  1GAQ B;  2ONQ A;  1PGX A;  1MVK A;  4TSS A;  4D2K A;  3ZJV A;  2BTE A;  2PVG C;  1SB3 C;  2R61 A;  1JAL A;  5BMI A;  2K5P A;  1EWC A;  1ZDX A;  2RMM A;  1XEE A;  1F2R C;  2FUG 1;  2XN9 C;  3KLS X;  4KGR A;  4XDD A;  4OZC A;  2KAJ A;  1I4G A;  5HFY A;  1SJE D;  2B76 B;  1SE2 A;  3WCQ A;  1FEH A;  4N59 A;  1ZPS A;  2PIA A;  3IAS 1;  5BYQ A;  3T3N A;  1C4A A;  2DWQ A;  3PZ8 A;  1VDV A;  1M4V A;  3NVZ A;  1YQ4 B;  3TSS A;  3I57 A;  3UI3 A;  1V1P B;  3W1S A;  2INP E;  2IGH A;  3BYT B;  1L4Z B;  3P4R B;  1AN8 A;  3BVG A;  1LO5 D;  2LUM A;  2WQY B;  1L6V A;  3BVZ A;  4NJC A;  1BUI C;  2OHF A;  2ICI A;  2ZW0 A;  4OHJ A;  5G5H A;  2KWD A;  1FM0 D;  2PLP A;  3R2T A;  4DXF A;  1UWX A;  4TQ0 A;  4XWW A;  1IGC A;  1KLG D;  4Q2J A;  1VZ7 A;  1ZUD 2;  1JWB D;  4GLS C;  2V3N A;  1F77 A;  1SSN A;  3U2S C;  4FXC A;  5E6J A;  1GPX A;  1XCQ L;  2WDV B;  4JX1 C;  1K52 A;  2JQR B;  1YN4 A;  1EWY C;  1KF6 B;  1SE3 A;  1RYJ A;  4MT5 A;  4L23 A;  1XO3 A;  4WAF A;  1NYQ A;  3PZ7 A;  2TSS A;  3P4P B;  4MH8 A;  2WXQ A;  1WWT A;  3VR9 B;  1TY2 A;  1C9F A;  1ESF A;  2WU2 B;  2RPV A;  4ZRP A;  2BS2 B;  3P42 A;  5FR3 A;  1E10 A;  4KKI A;  2QJL A;  4YSZ B;  2IJ0 A;  4YWG G;  1FRD A;  1K50 A;  5H8Y E;  5D3D A;  1NI3 A;  1E6E B;  1STE A;  3PO0 A;  4C80 A;  1NVI D;  4IKG A;  3SFE B;  2Y5C A;  1ENF A;  1L0X B;  3W9C B;  1TYG B;  1RWS A;  2DLB A;  2JZP A;  4B0M A;  4TQ1 A;  1JML A;  3ZYY X;  1Q10 A;  3GB1 A;  1TS3 A;  2WXH A;  2JYE A;  1JWM D;  1DGJ A;  1NEN B;  1DOI A;  2PW9 A;  1CQV A;  1VLB A;  1KFY B;  4XE0 A;  2WXF A;  3ZQ4 A;  2NTS A;  2EKI A;  5T8I A;  5MPO A;  3EGR A;  3R8B A;  3Q69 A;  5GXG B;  4AQ7 A;  3IAM 1;  1V1P A;  4YTM B;  4ZOH C;  2V3P A;  2FE8 A;  1BXT A;  3KWL A;  1AWD A;  2BS3 B;  3O13 A;  4HKQ A;  3SFD B;  1T3Q A;  1P7E A;  1IBX A;  3H8H A;  1YJI A;  2N9K A;  1TKE A;  5AUK A;  1T5X D;  2WU5 B;  2BB5 A;  3W2D A;  1E9M A;  5HG2 A;  3N9Y C;  1C76 A;  1KRH A;  2QIE B;  2BS4 B;  4A9A A;  2W55 A;  2WS3 B;  2H89 B;  2VZK B;  2D5G A;  2L52 A;  1PGA A;  1WYG A;  1UGJ A;  2I38 A;  5FK9 C;  2IPK D;  2CJO A;  1J7A A;  3E56 A;  2L32 A;  2CU3 A;  1XXG A;  2K9X A;  3P63 A;  3EA6 A;  2MEK A;  1YN3 A;  2SAK A;  4AS1 A;  2HTM E;  3BVM A;  1JQ4 A;  3AED B;  3NS1 A;  2BYT A;  1MHH E;  2WDQ B;  1FNV A;  2JXT A;  1A70 A;  5D3I B;  2EEL A;  2W82 A;  1OQQ A;  4KGS A;  1N61 A;  1F0Z A;  2ZW1 A;  4N58 A;  5AUI A;  2J4X A;  4ITK A;  4RGN A;  2V0G A;  3C8Y A;  2J42 A;  4YT0 B;  1F2R I;  4YTN B;  3L4P A;  1QOG A;  1VRA B;  1QOA A;  1WXQ A;  1VR9 A;  2IGD A;  2YEP B;  4R3D A;  4UDU C;  1QOB A;  1EU3 A;  1D5M C;  3AEC B;  4H2A A;  1MI0 A;  5BMH A;  1KLU D;  2INN E;  4NAW B;  5BMG A;  3BII D;  4US9 A;  2L83 A;  5EE0 A;  2KMM A;  1CZP A;  2W3R A;  2GI9 A;  4RGM A;  4ZHP A;  1N62 A;  3VR8 B;  4C56 C;  3TEX A;  3DWM A;  1N5W A;  1FXI A;  4JWS C;  4NZL B;  1N63 A;  2KDM A;  3BK1 A;  5EE9 A;  1IBX B;  1QT9 A;  4MM3 B;  1N60 A;  3AE9 B;  5HHD G;  3FIL B;  1TZO A;  2MH7 A;  3CWI A;  3AE2 B;  3B2G A;  2N7J A;  4M0W A;  1XF5 L;  4A90 A;  1SEB D;  2ON8 A;  3AE5 B;  1L5P A;  1R7S A;  1XLO A;  3U52 E;  2NMQ A;  1N5X A;  5EE3 A;  4RCO A;  2WXP A;  1KTK A;  5G5G A;  1FXA A;  3IT6 B;  2WXG A;  3RPF C;  2LEK A;  2X38 A;  1ZXH A;  2BBC A;  3AB5 A;  2FBW B;  1K53 A;  3AEB B;  4B0E A;  1HZ6 A;  4WH4 A;  2PKO A;  1I7H A;  3VRB B;  2WXR A;  3Q8C A;  1HXY D;  2RDH A;  2WXN A;  1TKG A;  4A6Q A;  2WLB A;  2JWU A;  3I9V 1;  4N6E B;  2J52 A;  4WUR A;  1ROE A;  2Q5W D;  3CIR B;  2L1A A;  2N0S B;  2G1E A;  2GB1 A;  2QEJ C;  4O1N A;  2KQ4 X;  1I4P A;  3AE4 B;  2WP9 B;  3BK2 A;  4ARI A;  2YEP F;  1FMA D;  3MP9 A;  3ZJT A;  3NVY A;  1JWA D;  2WXO A;  1PDX A;  3IXS A;  1JWU D;  2PTL A;  3GS2 A;  2DYO A;  1ZDV A;  2IGG A;  4WQM A;  2DYM A;  5TSS A;  4GDK B;  1SE4 A;  1Y56 A;  1UWM A;  1IGD A;  4LTU A;  4ZRQ A;  1B1Z A;  4J3O D;  1MHX A;  2VZK D;  3ABV B;  3Q8A A;  1D5Z C;  3HVZ A;  3HRD D;  1YJJ A;  1CJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...