3NVWA

Crystal structure of bovine xanthine oxidase in complex with guanine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate orientation and specificity in xanthine oxidase: crystal structures of the enzyme in complex with indole-3-acetaldehyde and guanine.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 42
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvwA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvwA01
1PDXA 1F0ZA 1ZUD2 1RYJA 1JRPA 2CU3A 2KAJA 3AV8A 5G5GA 3VRBB 1I7HA 1N62A 1JWAD 2WP9B 3AEFB 2ACZB 3SFEB 1TKGA 1N60A 5G5HA 2EKIA 3DWMA 2CJNA 3HRDD 3AECB 2M19A 1NVID 1PUTA 1QOAA 5EE3A 1ROEA 3AEBB 3NVVA 3BIID 1RWSA 1KRHA 1QF6A 1A70A 3FAHA 1WXQA 1EWYC 2K9XA 2Y5CA 3EUB2 3SR6A 1TKYA 3NVZA 2H89B 2JX5A 3HVZA 1TYGB 3W5VB 3FC4A 4ZHPA 2FBWB 1FMAD 1KF6B 3AEAB 3RPFC 4YTNB 2DWQA 2QIEB 3DWGC 3AEEB 5EE1A 3AN1A 1WGKA 2K22A 3ZYYX 1PFDA 1ZOYB 1YJJA 2BS4B 2WQYB 3NVWA 1E7PB 2G1EA 4YSYB 1V8CA 4KX6B 1FRDA 1WWTA 2OHFA 4WQMA 2B76B 2BT6A 1L6VA 1FO4A 4N59A 4US8A 4A9AA 1SIJA 5MPOA 4FXCA 1B9RA 1RFKA 3AB5A 2MJEA 1NYRA 3B2FA 3P1MA 1KFYB 2W54A 2BS3B 4US9A 1NYQA 1FIQA 2E3TA 1QLBB 1UWMA 2BS2B 1YJIA 2KMMA 2QJLA 5C3JB 2N0SB 1GPXA 1E6EB 3P63A 1L5PA 2WU2B 1FFUA 3ETRA 2H88B 3P4QB 1FM0D 1JQ4A 1XLQA 3B9JA 1AWDA 2LEKA 1QT9A 4YSZB 3P4SB 1V97A 2PIAA 1WYGA 2WDQB 4ZOHC 2MH7A 1N5WA 2CJOA 2PVGC 1CJEA 1QOGA 3VRAB 4JX1C 1TKEA 1ZP0B 2WLBA 2WS3B 4YSXB 1TJEA 1T3QA 1JWBD 1J7AA 2L52A 1DOXA 4C7ZA 1FFVA 4HROA 1JROA 3CWIA 1VLBA 5EE0A 2WDRB 2WU5B 4YTPB 3AH7A 1JW9D 4ITKA 1FXAA 2L83A 4YT0B 5GXGB 3AM9A 3AE5B 5AUKA 1J7CA 1ZXIA 1OFFA 1JALA 3W5UB 4C80A 1QOBA 3HUIA 2K5PA 3VR9B 2JQRB 1NEKB 1SB3C 1XLOA 3KWLA 1QOFA 1N5XA 3L4PA 3AE3B 3VR8B 4LTUA 1OQQA 3AE8B 4WWMA 3ABVB 1FRRA 3AE9B 1DGJA 4YTMB 3AE4B 4C7YA 1L6UA 1VJKA 2M56B 2MJ3A 1XLNA 1NENB 1YQ3B 2PKOA 4P6VF 2W55A 3NRZA 1AYFA 3AEGB 3P4PB 3SFDB 3W9CB 2DBYA 1IUEA 2HTME 3AE1B 4JWUC 5H8YE 1J7BA 2Q5WD 1WRIA 1NI3A 4N58A 4HRSA 4USAA 1E0ZA 1FXIA 4IDIA 4N6EB 3AE2B 1R7SA 1XO3A 3PO0A 4YXDB 4JWSC 1GAQB 5C2TB 1N63A 3NVYA 2MJDA 2WDVB 3CIRB 1N61A 1CZPA 2W3SA 5AUIA 1E10A 5EE9A 3AE7B 3AEDB 3LXFA 1E9MA 2W3RA 1SF0A 1DOYA 1XLPA 3WCQA 3NS1A 5H92C 3LB8C 3B2GA 1DOIA 1L0VB 1VDVA 1OQRA 3AE6B 3P4RB 1RM6C 4ZHOA 3AMZA 1YQ4B 2PVOD 2AX5A
chains in the Genus database with same CATH superfamily
3TADA 2DAFA 4HK2A 2WAQF 1C3TA 5CEHA 5ALUA 9ICQA 3PSFA 1KN5A 4WWPA 1RYUA 1D8BA 1PYWD 1V80A 4MGYE 2R8GA 1UBIA 5KG7A 1WE7A 3H1UA 4GLSC 3DBHI 2K1FA 2RSUA 4H2AA 3C2LA 2DHZA 4DDID 1WM2A 1PZNA 1TS2A 1WGYA 9ICSA 3R8BA 3E58A 5E6PA 1ET6A 2RLTA 1QF6A 1IIPA 5AEKB 1SV0A 5ALQA 3LJ3A 2DX5B 1WX8A 4CE6A 1KBUA 3PMLA 3KZXA 3DBSA 2INNE 1ZGUB 1JUDA 2P6UA 2BQUA 2DZJA 5BYSA 4B0MA 3PO5A 4ANVA 4M9JA 4UASA 3H0LB 4IR1A 4Y2QA 3M9NB 2EMSA 3ZW3A 4W9JA 3MC8A 2ZVNA 3V7KA 4FJVB 5HFYA 3BK2A 1L6VA 3APDA 2J52A 7ICTA 4YXMA 2MJEA 4RM9A 2Y1IA 3P1MA 4ECZA 3BQ2A 2LWPA 2KHVA 1P7EA 3DVGX 2LPEA 2KFJA 4DL2A 2VH1A 2KANA 2WU2B 2WWZA 4I2DA 1JQ4A 1URJA 5AM4A 2WHIA 5KFAA 2J53A 1NJXA 1F52A 5HNKA 1WXSA 2HOFA 2V3SA 5AM2A 3PMNA 2F1IA 2BPGA 2ZPYA 4NZLB 4G3XB 4C4SA 2CRXA 3JPSA 4E3CA 3I76A 2DYOA 1Z00A 2INCC 5K4LA 4DDGD 3PSEB 3MHZA 1YX6B 3QNMA 4QIWC 8ICTA 3NOBA 3BQTA 4TQSA 2MA1A 2BVCA 1I4QA 2KNBA 4DSFA 5L9XA 5KFNA 2Z59B 3X0WA 3TKAA 1RLFA 4F4KA 2E8PA 2VANA 4RPYA 3K1RB 4JIOU 1WGRA 4PS3A 3LDAA 9ICIA 1F77A 4FULA 3EYZA 2VJ5A 4JWMA 4M9NA 1YQ3B 4C4VA 4EYHB 5BMGA 3GIIA 4XA5A 3EPGA 3ZD8A 2HTME 4JWUC 4MGIE 4HDQA 4IM2A 4BVUC 3R9KA 2V3NA 1NI3A 3EGRA 1X9XA 2BQ3A 2JEGA 3ZJVA 2XK5B 1NJWA 2CHZA 1GAQB 4NLKA 4ICVA 3K1ZA 4UAZA 1N56A 4HAIA 1WXAA 3CIRB 1N61A 5HHHA 1WFYA 3AE7B 3M63B 5DG7A 3J9CA 5KG5A 4JLCA 4J9LA 3B2GA 3JVZX 5KL8B 2KMAA 5JZEB 4IW0A 4Q2JA 2D2QA 3P4RB 1JRUA 2HCFA 4KN4A 2LZ6A 1OEYJ 2LI5A 4MSQB 2KVSA 4GDKB 4KGRA 1M4VA 2LMRA 3AV8A 4IUMB 1I7HA 5CHVC 2W9BA 1ZQNA 1WGDA 3S6JA 5HMLA 4J9PA 2OWOA 4MF2A 2YB4A 5DG9A 4PYUA 4I2CA 4DFKA 3F5AA 5ALRA 2PW9A 3AEBB 3KUCB 5KFRA 3QYPA 3A4RA 2FI1A 1TS4A 3ZXRA 3Q8PB 4Y2YA 5EE9A 2Y5CA 4PL2A 2FBWB 2KMDA 2ZIUB 2WTFA 3ZIMA 1FXTB 5KG1A 1E8YA 3AEEB 2K22A 2JXJA 1P1AA 1T5XD 1R4MI 3VC8A 1V8CA 1AQ6A 2WXLA 1BMLC 1WWTA 2FDRA 4WQMA 3MDCA 2NRWA 4C8MA 2WF6A 1QTMA 4AS1A 2KX3A 2GBMA 3RTVA 3FYHA 4WJ3B 2M1MA 4QW8A 1C79A 1Y56A 5KT4A 5KFUA 2D6FC 1IV8A 5J0SA 7ICOA 1LO5D 3MC0B 9ICBA 3URYA 2MRPA 4DHZE 2MU2A 3ZJTA 2JGAA 5ALGA 9ICGA 2V9HA 1ZQOA 3GV8B 4UBBA 3VDZA 2RPVA 4ELVA 2C7NB 2LGYA 4A6QA 4R8UA 1JWBD 4MEMA 1NKBA 2M4NA 2I38A 4GIBA 2ICIA 2WU5B 4XC2A 2AXTU 5DGBA 2EAPA 5DPTA 3T79A 3RFZB 3RNFC 3VUWA 3KD3A 3V62A 1TTNA 2Z8LA 2DYBA 4HYKA 1XO1A 4ICAA 3T5KA 1H8CA 2PXIA 1DYQA 2IMWP 3ABVB 4WWNA 3GU3A 4GXIA 1Y8RC 2C7MB 2LRUA 3MGHA 3NGDA 8ICNA 4M0WB 4JV1A 3RJGA 4RF1A 2BCRA 2C22A 5AZFA 2PI5A 1X9MA 1WJ4A 1ZXHA 2F8KA 3MC9A 3JPNA 2ZPNA 3VFKA 4USAA 2LYHA 1V1PB 2K39A 2M8SA 4QWDA 3NJTA 2K8CB 2MJDA 4RGOS 1YJ1A 3N97B 3M62B 5C23A 5G55A 3NS1A 4B0EA 2E8MA 3RB4A 3LB8C 3C0RB 3E9SA 1U9LA 2O6VB 4LJOB 4RQMA 5KT3A 2WXKA 2Q0ZX 4QWCA 4MSMB 4A8XC 1RYJA 3EC8A 1S76D 1XQQA 8ICKA 3ZQ4A 2DF4B 3Q8QB 4GC7A 4ECTA 1SWVA 4P4OA 5DB7A 4EZ6A 1WX9A 2KFKA 3A9KB 3EA6A 3HP6A 3ZLZA 5EDSA 5AKXA 5EWGA 8ICWA 3PV8A 3A33B 2LHDA 2JH7A 2QB0A 3N7RC 1UHUA 5JHAA 1DRGA 3RB0A 2KO3A 2NBWB 2QDFA 1B4FA 1ZD2P 4CF3A 1NK9A 5AK6A 4BKTA 3UINB 2BPSA 2WXFA 4RQ6A 2L1AA 1NI2A 2BGFA 3NRWA 5KFDA 3M8SA 2A4ZA 2MRLA 3TBLD 3W1SC 2JRZA 3BQ7A 2KTFA 1IP9A 2XI9A 1HA5A 4Y2PA 3AU6A 5KT6A 3SHQA 3C5FA 1GNUA 1S5LU 4OJ5A 4ACOA 2M0NA 3RH4A 2Q4TA 2QJLA 1KL9A 4B9LA 4TUQA 5AHXA 5HG2A 3C2KA 4J9SA 8ICIA 1YN5A 1ZQYA 2H88B 3RFAA 5DGAA 8ICHA 1AWDA 4LDTB 2CHWA 1PQSA 2K4PA 5AKZA 1V97A 3L13A 2WB1C 1SGHA 1BGXT 1N5WA 1L7NA 4IQVA 5IIMA 1BPEA 4AOFA 5HMMA 4DLGA 1OQYA 4NJCA 2ZUCA 1T4GA 2JZ3B 4LJPB 1ZPSA 2GLEA 2A1JB 4FZMA 4NXZA 3F2DA 4QZGA 3CWIA 1L8OA 1KTQA 2R61A 2K0PA 4ITKA 2FCNA 4UB3A 4B95A 1VZ7A 1ACCA 3QAQA 5E6OA 1XCTL 2JZZA 2VA3A 1WXVA 5KFCA 4Z6FA 1AROP 3PRZA 1FCLA 2D11A 2K8BB 1SIFA 4QWBA 1L2NA 1ZD5A 4IG7B 4RZRA 1QOFA 2D07B 2FCMA 1IGDA 4DWIA 1PGAA 3AE8B 4LDTD 4YTMB 1DGJA 1F9JA 1NZBA 1ESFA 4DXAB 2A1AA 2KJRA 5IOIA 3UIPB 3IBEA 3W9CB 2HHXA 3DBRI 8ICAA 1B43A 2GBRA 2HE7A 2NRTA 1EO6A 4M8NA 7ICLA 4PHPA 3MFGA 5GTHU 2L32A 1KLUD 3ENEA 1ZJMA 2O6VD 4YR0A 3PR4A 3OJUA 3I28A 5ALEA 3MDAA 2W3SA 1ZQXA 1V9PA 1V1OA 3G6YA 1VCBA 1KRPA 1SE9A 2G5HB 2NS5A 5LXHA 5AKIA 3ML8A 3PZ7A 4M6WB 5ALLA 2N7DA 3H4DA 1ZQGA 1JWUD 1YIWA 5DBBA 4ECQA 1PK3A 4QAYA 2B0CA 1A76A 2IGHA 2LYBA 1ZQJA 5DDYA 2A5UA 2HJ1A 1RXWA 4WJNA 2JZBB 1FNUA 4WIPA 1WG8A 5IINA 4GDLB 4TSSA 2WGSA 2ZJ5A 1GB4A 1QCKA 5J0WA 4RMAA 3KVFB 3IHQB 1V81A 2IHNA 5KHOA 3BZDB 2NO5A 2OEHA 4NAWB 4MJSA 3THVA 5IA7A 4AP9A 5TISU 3BZKA 2P35A 1T7PA 2C7HA 4K7UA 1TT5B 2AQ2B 3QUCA 3RRGA 3V05A 1BXTA 2IY0B 1KFTA 4R65A 4P1CC 3H0MB 4JPSA 3UIOB 2FMPA 2BKRB 3UMGA 4KLGA 2B76B 3FILB 3KUZA 1DK3A 4HEA1 4RQ0A 1ZD4A 2NO4A 4MGKE 3W1YA 3F53A 5AK5A 3ZDEA 5ALHA 3F2CA 2L0FA 1WCLA 1FNWA 1ZQMA 2ZW0A 1PVQA 1L4ZB 4BJQA 1Q5WB 1A5RA 3KHRA 2H5XA 2UVVA 2DUYA 4DFDA 5EOZA 2ZJDA 3B9JA 4OVVA 4YSZB 3PV1A 4R63A 1PGBA 2INDC 5JHBA 3P4SB 3N28A 2WDQB 1L6NA 2IOFA 4OJOA 4PH5A 5AKLA 1C1YB 2P6RA 1SZHA 4F4WA 3A9KA 5DBCA 5KG4A 2BCUA 2GMIC 2L52A 2LJIA 2JEFA 4MELA 5IIJA 4B6WA 5EE0A 5BO4B 1IM4A 1XCQL 1SKWA 4C4VB 1VR9A 1J7CA 3BS5B 1ZDXA 2WXJA 2O6VA 3HUIA 2DAJA 5ALIA 1X9WA 1XLOA 4W9HA 4ECVA 4DS5A 3L4PA 1CRXA 1K50A 2V0GA 1UPHA 1OQQA 4LTUA 4KN7A 4PHEA 4WWMA 5ALWA 2XEWA 4TMAB 1V9JA 1WGGA 3PPAA 3ZDTA 1HTOA 1X2IA 2PKOA 4FO6A 3RRHA 1WIAA 2DBYA 5J2CA 3JPQA 4RPXA 5AK4A 3QU9A 3PREA 4KLTA 1F5SA 4W9GA 2D3BA 3BZCA 2KDBA 2H3IA 2E8OA 2MP2B 3PLUA 5ALVA 1N63A 1TZOA 2BPFA 1OEYA 4EYIB 2QB1A 4YFKA 4M04A 1WGHA 2XVTA 4OZBA 4REZA 3N7SC 3UXNA 3QXGA 2R8IA 1AN8A 2YLMA 3GB1A 4XE0A 4MM3A 1MI0A 2ZIWA 1T0SC 1V5TA 2LI6A 2J0JA 1X6JA 5KFJA 2WF7A 2YMQA 5KFTA 1PVRA 3V60A 4IM3A 4F72A 1RQLA 3OPXA 7ICFA 5CA7A 3WALA 4YR3A 3G6VA 1NBFC 2CPRA 5J0YA 2VKQA 3ICXA 2J0KA 3GZNI 3RBDA 2Y9TA 2PLPA 5J0RA 3L17A 2MCNB 3AEFB 2FE8A 3RCZA 2ASLA 2J4XA 2KV2A 3A1QB 2LVOA 2YVCA 3O65B 4DSKA 2L3ZA 4O3NA 2G45B 3JYUA 1HEKA 4ECRA 1GB1A 2Y0SF 1ZQFA 3HJEA 1RWSA 5ALOA 4BKSA 3WAMA 3V6CB 5AK3A 1WXQA 1IG6A 9ICRA 2GI9A 2H89B 5KNIA 2KLGA 2HOIA 2KC1A 3A9JB 3OLMD 5DG8A 5JXVA 2KKPA 5DPSA 2ZUBA 3BYTB 2KJ9A 2GOLA 3PW0A 1ZQLA 1PFDA 1S0MA 3N1XC 1WZ3A 4Y2VA 5C0YA 1LV5A 1C20A 3QIJA 1G6JA 2MSED 4M2YA 1SJED 1MHHE 3RZFA 4PGXA 1XSNA 3ED5A 3MR5A 5HHDG 3M1YA 3SI8A 3GFKB 3KKAA 2N9XA 3OJSA 2F1JA 1FO4A 4N59A 3PZ8A 4O1NA 3ZJUA 5J0UA 2ZIUA 1L0YB 4HCPB 4EELA 4F91B 2KTRA 4MEYA 2N0SB 2Y1JA 3GIKA 1M94A 3ZDMC 2ZTDA 3HT3A 4P16A 3ETRA 1MQ2A 1NZPA 9ICTA 4C4TA 1XLQA 3C29A 2KG5A 3HKZC 5J2BA 4JMUA 4A8EA 1D9FA 2C2RA 1STEA 1VZ8A 5AI0A 5A0LA 2HVHA 4EKUA 2D8CA 4C8NA 7ICPA 1HUZA 3PHWB 2MHJA 5CWRA 3QC8B 4PPXA 1RQNA 1H4RA 4MJSB 4EZJA 2WXIA 3NY5A 4PS8A 4R66A 7ICUA 2BHNA 2KIWA 4QNLA 1OFFA 1JALA 1GC6A 2PE9A 4BAXA 3ZDAA 3DV9A 4UARA 5HP4A 3QWZB 2WXNA 2K5PA 1ZYQA 1WX7A 2JR5A 2GO7A 1E5WA 2M9NA 1MFWA 3QUTA 1FRRA 4KIKA 1S0VA 3QU7A 2O6KA 1VJKA 4KLSA 2K4IA 4BOZB 4I27A 3NRZA 3RBEA 1WMHA 3ZTCA 2F44A 4WAFA 1VJ5A 4HRSA 1ZRMA 4KLIA 5F9LA 1UD7A 4IDIA 3DHHC 2FPKA 4I6PA 1XEEA 2JSVX 3E56A 4II3B 3L0WB 5DPWA 4E74A 1UA0A 4JQWC 1KM7A 5JRTA 3RN9C 3TI0A 4DL3A 2BKEA 2KWCA 2CS4A 4BKSD 1L0VB 5KG3A 4ZH4A 1B1ZA 1J2MA 3JPRA 1D5XC 2KJ5A 1FPYA 1L3TA 3IDWA 1WCNA 1HE8A 3ZO5B 3I57A 2N4FA 3KFUF 8ICGA 1XSLA 4RCOA 1ZUD2 3RI7C 1JRPA 4QW9A 4LZGA 4KGSA 4F3OA 3Q8FA 4MM3B 4M0AA 2WXQA 4J9OA 3EFUA 1Z4OA 2PMZF 3H8JA 3HM6X 4ELUA 4F5NA 4FN2A 4DBGA 4UAYA 3QE9Y 4XYCA 2WAQC 5J0PA 2KZZA 2KJHB 2LXAA 3RULA 1DOQA 1TY2A 4TUSA 4P0PA 1ROEA 4BBNF 4YG2A 3FDSA 3L54A 2IOFK 1A70A 2JMGA 2BYEA 4GXBA 2LMCA 4RUAA 4R64A 3SMVA 1COKA 3HVZA 2DKZA 3D2NA 4RU9A 1FMAD 4AJWA 3VVWB 3RAQA 2FIFA 1T6BX 3NZ3A 3E2EA 1KLNA 3AN1A 3H8HA 3ZYYX 3H8MA 4OJ6A 1RPLA 4DOAA 2BS4B 2JT4B 5AI8A 2KK8A 2QILA 2HHQA 3R7RA 8ICBA 2M17A 3M6ZA 1WUDA 4MH8A 3R66C 2XC9A 5H2FU 4GGQA 1WH3A 3IAM1 3BS5A 1T0RC 2RRDA 4FE3A 4Z6CA 4EBEA 4RGNA 4UDUC 3OHAA 1KFYB 1ZQCA 1YJIA 1GPXA 2IHMA 5BMHA 4C56C 3C23A 2ON8A 5J18A 4JK1A 5KFBA 5AKHA 1X1MA 2MX2A 4IWOA 4L2YA 3C2MA 1AW7A 2ATLA 1TZ1A 1UWXA 1QOGA 2XNAC 4JX1C 2BCQA 2HVIA 4DHZB 3ALRA 4XUSA 3PSTA 1PK1B 3HKZF 5L1LA 1O03A 1NK6A 4PT5A 1I4PA 5D49A 1SE4A 1XD3B 2QB0B 3W5UB 3T5JA 4DS4A 2KWDA 2L0TA 3N3KB 4FA6A 3WA0A 2ASJA 1QOBA 3V6KA 5HKHA 2G07A 3KWLA 2AL6A 3ZDCA 2WXMA 3V6HA 5J29A 3QZ7A 4N9F4 2HSZA 2R18A 1ZQDA 3QU4A 1F2RC 1C4PA 2LFIA 2M56B 2E6XA 5KFWA 2W55A 1AYFA 4P2HA 4UAWA 1OUQA 4FHJA 5TZVA 3DHGC 2KWVB 4QWAA 4NAWA 2IBKA 3TARA 5C5JA 1BNPA 2IGDA 4GXKA 3LVWA 2DFLA 4ED8A 4D2KA 2WF9A 2J42A 1ZQEA 3RR8A 1SF0A 2Y3AA 1YNTE 3CF6E 8ICUA 4AYBF 2PPHA 3Q8EA 5J2AA 3IT6B 2J0MA 3KHHA 1DXSA 4NLCA 2DZKA 2RP5A 3VR9B 1KKXA 4F71A 3ZNHB 1F0ZA 3H7PB 4JL9A 2TSSA 4XDDA 4CF5A 1ZQAA 2FCQA 2LM1A 3AEVA 1JWAD 3C8YA 2DKXA 3OHBA 2XGPA 1ZQPA 4DQSA 3F2BA 5AM5A 5G5HA 2AU0A 2A3VA 2EKIA 4NY0A 5J8YC 1NKCA 1ECWA 2BYVE 2W8KA 2FAZA 3RT3B 4PGYA 2YN4A 4A3PA 1D8LA 2KK0A 2H3VA 5J2FA 4KDLB 1GJZA 3IHPC 1NK8A 3FAHA 1JI7A 1D4BA 3EUB2 3W5VB 3MR3A 4KGTA 5FK9C 1MHXA 3BJYA 3IV6A 3AEAB 3C1YA 2YEPF 4MH0E 2RDBC 4RQ5A 2OOBB 1NKEA 2ZIXB 1YJJA 4WWOA 4UB4A 2JY6A 3HVDA 2MUTB 5BYQA 2R2OA 8ICOA 2BCVA 4QWEA 1WXMA 2FJ6A 3UM9A 2W9CA 8ICLA 9ICNA 2CU1A 2NR2A 3BWUD 2ALZA 2CHXA 5KFXA 2ESEA 5KT7A 5MPOA 1TV9A 4FBUA 4KDIC 1Q3VA 4TQ0A 4C8OA 8ICQA 2K6QA 3C28A 5JTIA 4ECXA 1OGWA 2JXXA 2AGPA 4C8LA 4I2HA 2MAXA 4P0QA 5F9NA 2MH7A 2CJOA 2YEPB 2JU6X 4JE3B 3EECA 4YL8A 3ISDA 4KLDA 1J0GA 4RGMA 4Y2SA 3GV7B 4NL9C 5DQIA 4GLXA 3ZRCA 4XRHA 1JW9D 4PZNA 1ZQVA 4BGDA 2FCSA 1ZXIA 4B9VA 4CNQA 1JX4A 4I2BA 5J8YA 4FJZA 3DBHB 1SV4A 4HPMB 1BPXA 2KXJA 2DYMA 8ICYA 1UELA 2ZIVB 2PMVA 3ONSA 5J0OA 2WXHA 4FLHA 4ZYSA 1KH0A 2NRZA 1D8YA 1NENB 2LGXA 1HJPA 5J2DA 1UGMA 5ALPA 3TL5A 2JV3A 4ED3A 4G3IA 3PTFC 2QSDA 2LKYA 1S10A 3TUOA 2KN4A 2ZEQA 2GRIA 1Z5SB 3PW5A 2BDPA 1A6SA 5EWFA 4W9IA 1LB2B 2ZW1A 3R2IA 4PS7A 3L5KA 2ZNVB 4EZ9A 4YR2A 1CK1A 1F1HA 7ICRA 3DDCB 2VIXA 4I6NB 2IDYA 3H6NA 4F8CB 1Z19A 3VTWA 4OCZA 2I9GA 1H38A 3AMZA 3NUHB 4F4YA 2JZPA 3KWVA 1F2RI 2LGSA 1TAMA 2GBNA 9ICKA 4M9LA 4IS7A 2HDOA 1N62A 4DFMA 1J19A 1L7YA 2BW2A 1WSPA 1CI4A 4I2FA 2BQQA 3VHTC 9ICCA 3KYDD 2RMMA 4P0QB 8ICRA 2NYVA 5AM0A 5DB6A 4YCXA 4DFPA 3V6JA 3J81j 3JPOA 1QSLA 4BUGA 4E71A 1K51A 3ZNZB 3TQ1A 1YZ7A 4O3RA 2K9XA 4WQOB 1B0XA 3NVZA 4OD0A 2RPQA 1WWVA 1KDHA 2N7EA 3MHSD 3MJWA 2F8LA 4K3CA 3OGUA 4R3DA 5T8IA 3IT4B 2XY6A 4YTNB 5L1MA 2GBKA 4M0WA 5JU5A 2NPTA 5I4DA 3N30A 2AQ0A 4F93B 1SL2A 5J2EA 1E7PB 2EDUA 3ZVVA 3PT2B 5E79U 5KFQA 2NMQA 5FKAC 3L3FX 3ZXVA 2BCSA 1C76A 4US8A 2W43A 2F2AB 3QEBZ 1J2NA 1NYRA 9ICPA 5FR3A 1S1QB 3EPIA 2RD0A 3Q3FA 3PW4A 4NQKE 4RQ8A 3UMBA 2HBJA 1JIHA 4XQ8A 2YB1A 4F5OA 2IA6A 2B3AA 4QIWF 1Y88A 3RMKC 1MA7A 1MVKA 4W9EA 4QZ8A 2ONQA 2YMPA 2FMQA 3A0HU 2FUG1 1T3QA 1V49A 1C7YA 4NPNA 1O08A 1L4DB 4LNNA 2DL0A 1E8WA 2FUHB 9ICFA 2K6DB 3OAWA 3LYSA 5ALJA 1T0YA 3H7PA 1CEZA 4DF8A 3RH6A 2EZYA 1FEZA 1TY0A 2KHWB 2ISPA 4ARIA 1FXAA 5GXGB 4ED2A 1I4RA 2BWES 2M0AA 3V72A 4F4ZA 3BQ1A 4GB9A 1K1SA 3RF9A 2BZFA 5GTIU 3U7ZA 3QCAA 1X66A 2XIDA 3AE3B 4P4MA 4EEWA 1SWWA 4G0NB 3UXPA 1L6UA 1SKRA 1L7OA 3NZUA 3QHTA 4AUQC 2NV3A 3RB3A 3U30A 4B6JA 2BKFA 3KKAC 4O5CA 2IBIB 4O3SA 3L16A 3TEWA 3VUXA 3WIMA 3BK1A 3IM1A 3H7SA 5AI4A 5AZGA 4DF4A 3DOWA 1WY8A 4IQWA 9ICVA 1BT0A 3DCGA 4OHJA 4K7WA 2N1VA 3R2TA 4DQOC 2W3RA 2V4LA 3H8SA 1TFRA 4ECUA 4NLZA 3WAPA 4FJYA 3SENA 4UB6U 8ICSA 2MSNA 1YN4A 3VTVA 3WK5A 1YX5B 5TR5A 2L7RA 1ZW7A 4GDKA 5AKJA 2CR5A 4Y2XA 1OTRB 5KL1B 4BBNC 1ZQKA 1V6EA 4NL9A 2Y5BB 1X40A 1JMLA 2QKQA 1PK1A 2UVRA 2JF5A 1RFAA 2YX8A 2ACZB 2KWUB 5KFVA 4U7CA 4O3OA 1N60A 4F92B 4MEXA 5IO9A 1J97A 2CJNA 2ZXHA 3IXSA 1XF5L 5CB1A 9ICHA 4EX7A 4A55A 3ZNID 4OZAA 9ICXA 2XK5A 3Q69A 3X23A 3CMMB 3AULA 3DDHA 3P42A 2P66A 1IXRA 5BOMA 3PVXA 3RJKA 2VRRB 3QK0A 1YQBA 5ALFA 1FCCC 4YMOA 5KFYA 2AJQA 7ICGA 4MHVA 1HTQA 3VTUA 1MSWD 2I6XA 2EELA 2JRHA 4MFAA 3DBLB 3I63C 4IR9A 4FZLA 4BX9C 1WI0A 2KVZA 2MBOA 2WFAA 4QZIA 2OCEA 2G4SA 5J2JA 2ZXIA 2W54A 2KD0A 1P7FA 3Q3OC 2LHTA 2EQYA 4ED1A 1V38A 1L5PA 3P4QB 4WAAA 1SKSA 3CP8A 3GV5B 3NUQA 3FM9A 2HHUA 5AIAA 3VRAB 4ZOHC 3UMCA 5B5EU 4ED7A 3T5HA 3UGBB 1TKEA 3RNAC 3PS6A 5AKEA 2G5IB 4TUUA 1BPYA 2G4DB 4C7ZA 4JWNA 2KICA 4M47A 2R8KA 1VLBA 4DWFA 3QA8A 2HBMA 3WK7A 3HK0A 3NZSA 5AUKA 1F44A 4IOIE 1P98A 2L05A 3N4MB 2JXTA 4A90A 4DOCA 1N48A 3AXCA 4ZRIA 5DPRA 1SL0A 2D10A 2DNFA 1QLNA 4UAUA 4ED0A 3K9PB 1K5OA 2KIVA 5J2IA 1WR1A 5KAIU 3T5LA 5IIIA 3T3NA 3JPTA 5ALTA 2OM6A 3P2BA 4TKNA 3P4PB 4YD1A 2V4QA 3MTNB 2KNJA 1HUOA 1T0QC 2C28A 3KYCD 2L00B 5KAFU 1COOA 5KG2A 2ZTEA 1WMHB 4BFRA 3GE3C 3HILA 5KTQA 4C0ZA 3NVYA 5J0QA 1R4NI 3C1ZA 2WXPA 4KSLC 4KIKB 4ANXA 4QZDA 4KVGB 2K25A 2ODGA 3WAOA 1Q8KA 2CN1A 4DL5A 3AEDB 1E9MA 2KDMA 3LXFA 2M0XA 3WCQA 3AUOA 4BWMA 1I4XA 2V4IB 3RNBC 1MG4A 2FIDA 3QUBA 1Z3EB 1OQRA 4KZCA 1T8EA 4MF8A 3LYYA 1XNSA 4I2JA 1BVSA 5D4BA 3TANA 3WK9A 1D3ZA 2CU3A 5J0TA 5G5GA 2JWZA 5AICA 4I28A 2KQSA 5L95C 4MFCA 2MWSB 3ZI4A 2KMCA 2WHEA 3WKEA 4KMUA 1AARA 3VH4B 5T14A 2Y9UA 3HPOA 3U7DA 5F3XB 1UT5A 1VRAB 3IVFA 3PGEA 8ICZA 2HI0A 3MJ5A 4J03A 1N6ZA 2WX1A 3MBYA 3JSVB 3CYMA 5ALSA 4UB2A 2KFNA 1TS3A 2G09A 3M95A 1TAQA 3MFHA 1XO0A 4K4GA 3U2SC 1SL1A 2V1YA 7ICIA 2XBBC 4PYZA 4WH4A 2Y0SC 2DWQA 1MPEA 4KX5A 4WJPA 2ZUDA 3AQFA 1J8CA 1ZOYB 1UQVA 2W82A 1GC7A 3N7PD 1TK0A 5ALNA 8ICPA 4GDLA 5L83A 2KKVA 5IILA 1GOZA 4J6IA 1KW4A 4GC6A 4F2RA 5ALKA 1I4GA 2ES6A 2J6UA 2KX0A 4XZ4A 3U8ZA 3HWTA 5IN7A 3QJZA 4I29A 1SEBD 2DENB 1ZKHA 3TSSA 2PKEA 4OO1J 2NTSA 2WB1F 4W9DA 4KLFA 3NTUA 5DLFA 1I35A 3UF8A 2W9CB 4NJ8A 2JRIB 2EAOA 4DSEA 1Q46A 1NNLA 2LM4A 2ZJ8A 2LEKA 1L0XB 5E6NA 3VQIA 2PIAA 2MUTA 1ENFA 4RUCA 2IPKD 3Q8KA 3B1LX 1PGXA 4DHJD 1N2XA 1DOXA 3T8MA 4LK0M 4W9KA 3APFA 3H9DA 5CJ7A 3GDXA 3PRPB 1HXYD 3H0RB 3PX4A 2D5GA 1U4AA 4PZOA 2FLNA 4BOSC 4F5PA 2HDEA 3N32A 3BVMA 1IYFA 2WX0A 1SZPA 2FPMA 5KFPA 3D2SA 2K8BA 4F8RA 1BPDA 1P7DA 2NPTB 4YQWA 1Q10A 1YOVB 4ACFA 1FD6A 4TV3A 2W9MA 4KLQA 4KLEA 3SFDB 3MR6A 4CCHA 2IO2B 3Q3NC 2Q5WD 4A20A 9ICUA 2GOWA 3AQEA 1WM3A 2ZJAA 4FS2A 4NLGA 8ICJA 1TGZB 1SXDA 1X6IA 5D7GA 3VUYA 1S97A 2WF5A 4W9LA 3Q3MC 2PFQA 5AUIA 3AU2A 3E0FA 1WE6A 4IQUA 2KDIA 2Z7JA 3NASA 3LWMA 1D6EC 4MGZE 1CUKA 2HMXA 4JB3A 1DOIA 2ZTCA 2HHVA 2CXYA 8ICFA 4LLGM 4ZRJA 1C77A 1RRBA 2Y5PA 4RPZA 3QZ8A 1IPGA 1PDXA 2QCZA 1QH9A 3QX7A 3ZGZA 1S77D 1EF1A 2C5LC 4J9KA 2WXGA 3Q8AA 3BVGA 2I1KA 3KBBA 3RAXA 4FZNA 2MBHA 4ARCA 2DPJA 2R8JA 2JHDA 2L76A 4DEZA 3Q8LA 4M01A 3ONNA 4DSIA 2XO7A 2EZZA 3PNCA 1SGGA 3TEZA 2K8AA 5JUMA 1KRHA 5CR0A 1EWYC 2LUMA 1BPZA 1KF6B 2B6GA 5KFIA 4BDPA 1ZQRA 3H7IA 1PUZA 3MFIA 4NM1A 3UQ2A 1WGKA 1ET9A 4NLNA 1I42A 3NVWA 2KACA 1LXDA 3UQBA 2HHWA 4XDCA 3LVVA 2BT6A 2KLCA 2EAMA 2PFOA 2AGOA 1RAXA 1L3UA 5JH5C 3B2FA 3HX0A 5ALZA 2LASA 2BS3B 5L1IA 1FIQA 2E3TA 1KQQA 2JH1A 4PJ0U 5KFOA 3SZ2A 3SEBA 2I2YA 2KVCA 2NBVB 2IY1B 5AI5A 4B9TA 3SV4A 5AZHA 2OYYA 2MLBA 2JEJA 5ALDA 2FLLA 1CJEA 3BDPA 4S17A 2VA8A 3UQAA 3JW0X 4BXOB 1Q0WB 2JZBA 2XCPA 4LVSA 1LKYB 5KFFA 1NK7A 1LM8B 4OJPA 4QZEA 1C78A 1ZD3A 1YZ6A 5KFMA 5DDMA 1EUVB 2QC8A 2KZ3A 4C80A 4M6WA 4U6PA 4AQ7A 2NVUI 2BB6A 1NEKB 2JQRB 1N5XA 3RJEA 2SAKA 2KN7A 3D6JA 2PJHA 1A77A 2ZIXA 5AM3A 3GIMA 3TCAA 4O0IA 1MG8A 2SEBD 2UWQA 4ED6A 4DQPA 4FBTA 4B9SA 8ICCA 3AEGB 2MBQA 2VA2A 3TAPA 5H8YE 3IFWB 4CHKA 2Z0DB 3GZFA 1MJDA 2N1RA 5J2HA 3SU8X 4HWIB 1K53A 4WURA 3AE2B 1R7SA 1XO3A 4R8UB 9ICEA 3TEXA 5C2TB 4NQLB 1OXJA 4IWPA 3UXOA 4GIVA 2WDVB 2E5SA 2BWFA 2HW3A 3N20C 3ZDBA 3B0XA 1DOYA 1TAUA 5H92C 3ZD9A 2EMTA 3PZDA 3PHXB 3FKYA 5HR6A 2V9WA 3Q2AC 2VZKB 2KC2A 4ZYNA 2V3PA 3TIXA 4AJYB 1UUPA 2E1FA 8ICXA 1IBXA 1ED1A 1M6YA 2GLSA 2W7PA 1UZXB 3VRBB 4AYBC 5AKKA 3OWEB 4NJ7A 4YP3A 1HEZE 7ICHA 3GS2A 2INPE 4KSKC 3EHVA 1NJZA 4JV2A 1ZDVA 1KOTA 1QOAA 4GOCA 3EFCA 3NG0A 3NVVA 5D6JB 1ZQBA 2DGZA 4ZRKA 4RQNA 4QZBA 1RXVA 2JX5A 3Q14C 1L8LA 1Q3UA 3ALBA 3QX1A 3FC4A 4I2GA 5DB9A 3WANA 4EBCA 2PI4A 2RDIA 4L23A 3RPFC 5LNK1 3RNCC 3HIZA 4Y2JA 2AL3A 1UCVA 4RQ2A 1E7VA 2IZVB 5LLIA 2W8LA 4C8KA 3UPQA 3PZPA 4ELTA 9ICWA 2OHFA 2W9BB 1HZ6A 4LZDA 4QJFB 2G3QB 2PEAA 3CW2C 2EANA 3M8RA 3PX6A 3RB6A 4KKJA 2KTRB 5J17A 4UAVA 2G0AA 3MR2A 1NYQA 4HXDA 4KZ0A 4OW0A 4NNJB 3WKBA 3O13A 1E6EB 2F1HA 5KT2A 1JXLA 3I3TB 4Y2UA 3MABA 4C4RA 4CGZA 1WJ6A 2JEIA 1QT9A 3I9V1 2AEHA 1TE2A 1UH6A 1NJYA 5CRXA 1JCKB 2IO0B 5IIOA 5CHFA 1DGSA 4K4HA 4GFJA 1XC9A 2PFNA 2WLBA 5E6JA 1GG3A 4RQ4A 2BPCA 1NDDA 2RR9A 1K1QA 4YSXB 2LD9A 2HBLA 3EWAA 1ZJNA 4HPLB 4Q8EA 1SSNA 1SE3A 5DLGA 1FEHA 3IG3A 4Z6DA 2L83A 3ZUNA 1U4BA 8ICMA 3GP7A 5ALMA 2IGGA 3A1QA 4PHAA 2KQ7A 5D94A 2C2DA 5DQGA 1K8RB 2XGQA 2EKEC 2FNJB 3V3XA 1FNVA 9ICJA 3KW5B 3AE4B 5AM1A 3EW9A 5IP4D 2QEJC 4KITB 3DVGY 3PR5B 5KFHA 4G11A 1TBEA 3Q8BA 4F2SA 3AE1B 3RJJA 3SEIA 5CP2A 4YXDB 3PO0A 1ZQQA 3SDLC 4DXGA 4EFOA 4IC7B 3RYTA 4P0PB 2VH2A 2WDTB 3GE8C 4FBJB 1WRDB 2GB1A 1QSYA 3ISCA 5D3DA 1E10A 2J7QB 5KFLA 4HJKA 4RQ7A 3LWLA 3APCA 3V61A 2KHQA 3O0FA 5AI6A 4J3OD 1A0PA 2IOHA 4IWQA 5IIKA 2N9EB 1QKZA 3AE6B 4NJ6A 2AYOB 2MA9B 3AU4A 2MBBB 2AX5A 3NHEB 1LVHA 2QLTA 3RNEC 1CQVA 4S0RA 4M9HA 2PE6B 1X42A 4G50A 2LBOA 3M9OB 1EXNA 7ICVA 2G9HD 2KP7A 2KQ4X 2B21A 4DLEA 3OTQA 5G2NA 1TKGA 1L3VA 4O9MA 4K81A 3DWMA 3HRDD 4HCNB 1Q1OA 2M19A 3IP4B 3LK9A 2N9KA 3QUQA 4RM8A 3TADC 4LNKA 4NV0A 3BY4B 1SXTA 2L8JA 3ZTDA 3SD7A 5B66U 3RUIB 5AKGA 2LGIA 2OEDA 4UW9A 3KLSX 1RDFA 4Q8FA 3ECIA 4RNOA 3KOOA 3GIJA 2IO1B 4RQ3A 5KFGA 4KX6B 3RZWC 2DQNB 4MACA 3W1SA 1Z4NA 3C21A 3MC1A 1ZETA 1JMSA 4IRDA 4RNAA 4EUTA 2BDUA 1D9DA 4DQIA 3ISBA 3H4BA 2I5HA 4J9RA 4RGTA 3VXWA 1ZQTA 4XWTA 3IN5A 1WWUA 4UATA 7ICJA 4F1SA 1ISNA 4PL1A 1L7MA 4GN1A 1S8OA 4QZAA 2HTHA 3FILA 3F5EA 1UBQA 4RNMA 4F5QA 2NRVA 3PY8A 2NRXA 4K3BA 3V6EB 2W9AA 2D3AA 1ZQZA 4GSWA 3TEYA 2O2VB 2ZZPB 1I4HA 3JPPA 5J2RA 1SXEA 1TJEA 1J7AA 3M9MB 1EF5A 4HROA 2RDGA 1JWMD 4K7SA 1XWLA 2DZIA 5C1ZA 2F76X 2K89A 3UQ0A 3AH7A 4C00A 3DVNU 4E0DA 3K75D 4TQ1A 2C60A 2WXRA 4RT2A 2AWTA 3WK8A 2KD1A 1ZOLA 3L10B 1KLGD 4IRKA 1XT9B 1YN3A 3OJ3A 4CYEA 4BWJA 2R2QA 1HIWA 2E8NA 4PK1A 1ZQ1C 4KLUA 2ZCBA 4TUPA 4A3OA 1NK5A 1E8XA 3A9JA 1HQRD 5KFKA 3RH5A 3PX0A 1UNSA 2LUEA 5DQHA 4KLJA 1J7BA 3IG5A 4DCCA 1P0RA 3KHLA 2C2EA 4DOBA 1FXIA 4YMNA 4N6EB 1TS5A 4J9NA 4JWSC 4IL6U 2KFZA 1C4CA 4QZHA 2AGQA 1RG6A 2F77X 3M7DA 2XCAA 5TSSA 1EU3A 4J9MA 4TURA 3CNHA 2BB5A 4EEKA 3PRMB 4PGQA 2IJ0A 4P7IA 4XX5A 3WKDA 4ZDVA 3R7QA 3RR7A 2WF8A 1RM6C 4EZLA 4ZHOA 4KLLA 3CSTA 4LNOA 2LYAA 2JYEA 2KJ6A 1IGCA 7ICNA 4IRCA 2D3CA 4DL7A 2RDHA 1SV0C 2W11A 3WU2U 2ZIWB 4XWWA 1Z1VA 5HR7A 1U47A 1ZQHA 2DZMA 2WP9B 3WKAA 4ANUA 4KV2A 1RYRA 7ICKA 4W9FA 4AP4C 4KMOB 2KTQA 2I1JA 2K3UA 3H8WA 3U52E 4CQNA 3L08A 1PUTA 4CF4A 2REXA 2E1EA 2MP2A 1V86A 2WNMA 1JN3A 1MQ3A 8ICVA 4NAMA 2NBUA 2ZG6A 1B22A 1E90A 4I2AA 1TKYA 2MBEA 1ZRNA 4ZHPA 3SAGA 1TYGB 4HDOA 4NY8A 5AI9A 4LJXA 3N1ZC 2YQEA 4KX3A 4UB8U 4BXOA 1LGRA 3ZDDA 3DWGC 4URKA 4GXJA 2A19A 1BNOA 1QQ7A 1ZE3D 1SJHD 3SV3A 3C5GA 2KEYA 3KHGA 3V7JA 2N9LA 2L5YA 4A9AA 2BYTA 4FXCA 5AKYA 2UVUA 1RFKA 3AB5A 3RJFA 2AH5A 2BBCA 4US9A 2BGWA 1QLBB 2KMMA 1UA1A 3DPDA 5GMVA 3PSPA 2KOXA 3QQ8B 1NK0A 2GBJA 2PTLA 3KH0A 1SE2A 4YD2A 3Q3JA 3SYZA 4ASWC 5BMIA 4MDKE 3I1YA 4K4IA 2HBKA 2J6SA 1GUAB 4RFBA 2D3DA 4DK5A 2OH2A 2ASDA 5IKCM 2N9PC 3Q8CA 4B9KA 4MT5A 5J2KA 1FFVA 5AIBA 1JROA 2KZRA 2ZCCA 3AI5A 1WZ0A 1T94A 4OZCA 4IC9A 2KKCA 2WDRB 4K1RB 4YTPB 3T9LA 2XICA 1TVAA 4Q43A 2UYZB 4YT0B 3ZNGC 3AE5B 2J6TA 3N1YC 4LNFA 1XS9D 3A0BU 2HJ8A 3OSNA 4M02A 3M3JA 2KFKB 1TK8A 2BTEA 1QQ5A 4JUZA 2DPIA 2DLBA 4ANWA 1WYWB 4C7YA 2UVWA 3TACB 1XLNA 2EZXA 3KQ4A 4Q44A 4I2IA 5BPCA 2AQ4A 1KTKA 1MC8A 4RH6A 3N9YC 4UB1A 1WRIA 2XN9C 5KHQA 3KZIU 4KLHA 2VZKD 1F0MA 3V7LA 2JWUA 4FS1A 1X9SA 2LJ5A 4OVUA 4XGAB 1EWCA 5L1KA 4HKQA 3QARA 4EX6A 1CZPA 5BOLA 2WYQA 3DBLI 1WF9A 1R4NB 5KG0A 4G9BA 3PW7A 1K52A 2X8XX 2KJ8A 1YMHE 3OJ4B 4BZAA 3AU5A 4Y2TA 4O5KA 3A4SC 2BR0A 3M6KA 2W7OA 5CHGA 2H3FA 4HVBA 4KKIA 1IBXB 1YQ4B 2PVOD 3P63A 2KAJA 1NOMA 1QQRA 2K60A 1QSSA 2FPLA 2QARA 4EENA 1L7PA 3I5JC 4RT3A 3SFEB 3OSPA 2KSOA 2EH9A 4AWJA 2VJ4A 3AECB 4CRXA 4ECWA 2HHTA 1T3NA 1NVID 3TMPB 3BIID 2JUOA 1GO3F 4HLEA 4X57B 3GZNB 2PMZC 3SR6A 4GU2A 3GILA 2FMSA 4NM2A 2YMMA 4OJLA 5KT5A 5DBAA 5ALXA 1KSPA 2OJRA 4O3QA 5D2MB 1E7UA 3B0YA 4DSJA 3RJIA 4DL6A 5DKWA 4RQ1A 4YN4A 4YMMA 8ICEA 1QZEA 3T3OA 4Z6EA 3U4EG 2G1EA 3HW8A 1KLVA 4HJGE 4II2B 4EBDA 4F50A 3WK6A 2LRWA 3B08A 3B0AA 4W9CA 4L1BA 5HI1A 5DB8A 3OG5A 7ICSA 4IQTA 2BYFA 4EZKA 3IAS1 4KLMA 4ICUA 1UWMA 4I2EA 1SBBB 4B9UA 3H40A 2KZMA 1RZTA 1DK2A 2A1JA 3VCBA 1LKYA 4F7ZA 1CMXB 4ECYA 1FM0D 3D32A 1S3SG 4B9NA 4UBCA 2K4HA 3W2DA 3ZRFA 2PVGC 2ZNVC 1V85A 1QILA 1ZP0B 2ASQA 3NS8A 3QU2A 2NCNA 3TJPA 3WK4A 4ECSA 2LHEA 2G06A 2BF8B 3DQVA 3JSVA 4UB5A 3MGIA 2RQ5A 2IYDB 1KEJA 2KYWA 3D2QA 2ISOA 4UQGA 4ZRPA 2H3ZA 3IRUA 5IAAC 3BS7A 2W04A 2AQ3B 3TAQA 4DL4A 2H3QA 3VH3B 4F4XA 3EZ5A 3VR8B 2W03A 4CDGA 1L5UA 2QMTA 1Z1BA 1C9FA 5BYRA 3QEAZ 1LFDA 3S2AA 1UGJA 2C9WB 3HHMA 4FHKA 3CRXA 1NK4A 4WJQA 1D5MC 1UF0A 1Z2MA 1IUEA 1D5ZC 1KFDA 3PO4A 3PLVA 2K4EA 4IM0A 1ZQSA 3TFSA 3DBRB 1S0OA 4N58A 2N7JA 5J2GA 3BQ0A 3GQCA 3GOEA 4OVZA 2KOBA 1E0ZA 2JVCA 3DVNV 4JGHB 2KE7A 1LQBA 1R4MB 4QZFA 1TK5A 4ZRQA 1ZQWA 4M9GA 2ZIVA 3CSFA 3PSIA 2GH1A 3K4GA 3G6XA 2K8HA 2LGDA 4DXFA 2JPHA 3Q8MA 1EM7A 3DEEA 4B9MA 4KLOA 5LXIB 4Y2RA 7ICQA 1WJNA 2CKHB 2W9NA 5KFEA 1WJUA 1YT3A 2IO3B 5KFSA 4MFFA 5FP0A 3RNGC 1ZQUA 4LNIA 4DFJA 4QZ9A 4KTQA 2HD5B 1JXEA 3BINA 1S9FA 3K9OB 1KJTA 2HHSA 4DQQA 1UT8A 1EU4A 2X38A 2K8CA 4BKGA 5EE3A 4DQRA 5D3IB 2RHFA 1V1PA 2XY7A 3Q8SB 4IKGA 2YY6A 9ICAA 5C3JB 4QZCA 3ZKJC 3BYYB 4DSLA 1XXGA 1Z00B 2R8HA 1JWSD 5L1JA 1BUIC 2NTTA 3SQIA 4P1BC 2QIEB 3AL0B 5EE1A 3TFRA 2UU7A 4DHJB 2WQYB 2AQ1B 4RF0A 4YSYB 1C4AA 3SAHA 1FRDA 2PFPA 1VZ6A 5D46A 1SIJA 1B9RA 3IG8A 4O5EA 4HPPA 3T3FA 3KUDB 3ML9A 1P3QU 2Z0EB 4M00A 2BS2B 2XY5A 5CHWA 3LDZE 1HZ5A 5CTRC 3ORYA 4Q45A 1FFUA 4YWGG 3BVZA 5EWEA 4NLBA 4EEYA 1U48A 4YVZA 3PW2A 4O3MA 4YXJA 2KT7A 1BPBA 5HHIA 4J9QA 2LXCA 1WYGA 7ICMA 9ICLA 1XSPA 1OW5A 2KSOB 2OJWA 2OXOA 4DO9A 2N1WA 2QHOA 2WS3B 9ICOA 4HKZE 2V4RA 1KFSA 1E8ZA 4F5RA 2QARB 1TKDA 3C19A 2JYTA 4LCDE 2GWSA 3MGVA 1PVPA 1L3SA 3Q6BA 5FR6A 3RD2A 2F3NA 4PHDA 3R3MA 2I1QA 1RYSA 2MQJA 3AM9A 1U45A 4FADA 4CO7A 1P9DU 2KVRA 2MW5A 2KDEB 3PVLA 1QQ6A 1SB3C 1YD8U 1V5OA 2G08A 4NWIA 4WJOA 9ICMA 3WKCA 4EE2A 2KDFB 1WR6E 3AE9B 2BQRA 3Q8RB 2YTUA 2AHOB 2LVQA 2MJ3A 2RGFA 1MN8A 4EOYA 2LVPA 4P6VF 4I6LB 1ZQIA 3SAFA 1XU4A 4X5VA 7ICEA 2D3GA 3UI3A 5CX3A 2FE9A 2RDJA 3ETLA 2KN5A 1VD2A 2O2VA 1TIFA 1U49A 3RJHA 4JV0A 4O3PA 4FFDA 3VAWA 4TQRA 3DHIC 2YMLA 5KFZA 4M8MA 3QU5A 1XLPA 3U26A 4GMVA 5DCNA 2HOQA 2FLPA 1S0NA 4RNNA 4P4PA 1VDVA 5KG6A 5J0XA 5ALYA 3KTQA 2WXOA 2ZVOA 3SD5A 1V2YA 3MP9A 2MEKA 3HM3A
chains in the Genus database with same CATH topology
1CQVA 2G9HD 2KQ4X 1JMLA 2PLPA 3AEFB 2FE8A 2J4XA 2ACZB 1TKGA 1PYWD 1N60A 4GLSC 3DWMA 2CJNA 3HRDD 3IXSA 1XF5L 4H2AA 2M19A 2N9KA 4A55A 1GB1A 4OZAA 1TS2A 3R8BA 1RWSA 3Q69A 1SXTA 1ET6A 3P42A 1WXQA 1QF6A 2GI9A 2H89B 1FCCC 2INNE 2LGIA 2OEDA 3KLSX 5JXVA 3BYTB 5BYSA 4B0MA 1PFDA 2EELA 1SJED 1MHHE 4KX6B 4MACA 3W1SA 5HHDG 5HFYA 3BK2A 4RNAA 1L6VA 1FO4A 4O1NA 4N59A 3PZ8A 2J52A 4RGTA 3ZJUA 2MJEA 3P1MA 2W54A 1L0YB 4XWTA 1P7EA 2N0SB 1P7FA 1L5PA 2WU2B 4P16A 3ETRA 3P4QB 1JQ4A 1XLQA 3FILA 2J53A 3VRAB 4ZOHC 1TKEA 3TEYA 4NZLB 1I4HA 1STEA 1TJEA 1VZ8A 1J7AA 2DYOA 4C7ZA 3MHZA 4HROA 2RDGA 1VLBA 1JWMD 3AH7A 2WXIA 4TQ1A 5AUKA 2WXRA 1OFFA 1JALA 1I4QA 4IOIE 4A90A 2JXTA 1KLGD 1YN3A 2WXNA 2K5PA 1FRRA 1F77A 1VJKA 1YQ3B 3T3NA 3NRZA 5BMGA 1HQRD 3P4PB 2HTME 4JWUC 1UNSA 4WAFA 1J7BA 2V3NA 1NI3A 3EGRA 4HRSA 1FXIA 3ZJVA 4IDIA 4N6EB 1TS5A 1XEEA 2JSVX 1GAQB 3E56A 4JWSC 3NVYA 2WXPA 1C4CA 3CIRB 1N61A 3AE7B 3AEDB 3LXFA 1E9MA 2KDMA 1EU3A 3J9CA 5TSSA 3WCQA 1I4XA 3B2GA 2BB5A 2V4IB 2IJ0A 1L0VB 4Q2JA 1B1ZA 1OQRA 3P4RB 1D5XC 1RM6C 3LYYA 4ZHOA 2JYEA 3I57A 4GDKB 1IGCA 2RDHA 4KGRA 1M4VA 4RCOA 1ZUD2 2CU3A 1JRPA 4KGSA 3AV8A 5G5GA 1I7HA 4XWWA 3Q8FA 4MM3B 2WP9B 2WXQA 2K3UA 3U52E 4CQNA 1PUTA 1TY2A 2PW9A 1ROEA 1VRAB 3AEBB 2WNMA 3MJ5A 4NAMA 1TS4A 1A70A 1TS3A 2Y5CA 5EE9A 2LMCA 1TKYA 3HVZA 4ZHPA 1TYGB 3U2SC 2FBWB 1FMAD 4WH4A 1T6BX 3NZ3A 2DWQA 1MPEA 3DWGC 3AEEB 3AN1A 2K22A 3H8HA 3ZYYX 1ZOYB 2QILA 1T5XD 2BS4B 2W82A 1V8CA 1ZE3D 2WXLA 4MH8A 1BMLC 1SJHD 1WWTA 4WQMA 1GOZA 3IAM1 2N9LA 1I4GA 4A9AA 4AS1A 2BYTA 4FXCA 1RFKA 3AB5A 4RGNA 4UDUC 1SEBD 2BBCA 1KFYB 3TSSA 4US9A 1QLBB 2NTSA 2KMMA 1C79A 1Y56A 1YJIA 5BMHA 1GPXA 4C56C 3URYA 1LO5D 3MC0B 2ON8A 2PTLA 3ZJTA 2LEKA 1SE2A 3VQIA 1L0XB 4L2YA 2PIAA 1AW7A 1ENFA 5BMIA 2RPVA 1UWXA 1QOGA 2IPKD 2XNAC 4JX1C 4RFBA 4A6QA 1JWBD 1PGXA 3Q8CA 4MT5A 2I38A 1DOXA 1FFVA 4LK0M 1JROA 2ICIA 1HXYD 4OZCA 2WDRB 2WU5B 2D5GA 4PT5A 4YTPB 1I4PA 1SE4A 4YT0B 3AE5B 3W5UB 3RFZB 2KWDA 1QOBA 2HDEA 2Z8LA 3BVMA 3KWLA 2WXMA 1DYQA 2BTEA 3ABVB 2DLBA 4C7YA 1Q10A 2M56B 1F2RC 2LFIA 1C4PA 1XLNA 4RF1A 2E6XA 3KQ4A 1FD6A 2W55A 1AYFA 1KTKA 3SFDB 1ZXHA 3N9YC 4RH6A 2Q5WD 1WRIA 2XN9C 4USAA 2VZKD 2JWUA 1V1PB 5D7GA 1EWCA 2IGDA 4HKQA 2MJDA 4RGOS 4D2KA 1CZPA 5AUIA 2J42A 1SF0A 2Y3AA 1D6EC 3NS1A 4B0EA 1K52A 1YNTE 3LB8C 1YMHE 3E9SA 1DOIA 3Q8EA 3IT6B 2WXKA 4LLGM 4KKIA 1IBXB 1YQ4B 1C77A 2PVOD 2Y5PA 3P63A 1PDXA 3VR9B 4A8XC 1F0ZA 1RYJA 2KAJA 1QQRA 2TSSA 4XDDA 3ZGZA 3ZQ4A 3C8YA 1JWAD 2WXGA 3Q8AA 3SFEB 3BVGA 3EA6A 5G5HA 2EKIA 4ARCA 3AECB 1NVID 2LHDA 3BIID 3TEZA 1KRHA 3FAHA 1D4BA 1EWYC 3EUB2 3SR6A 2LUMA 3W5VB 4KGTA 5FK9C 1MHXA 1KF6B 3AEAB 2WXFA 2YEPF 1WGKA 2L1AA 1ET9A 3T3OA 1YJJA 3NVWA 2G1EA 3HVDA 3U4EG 5BYQA 4HJGE 2KACA 4L1BA 3BWUD 2BT6A 4XDCA 1HA5A 5HI1A 5MPOA 3B2FA 3IAS1 2BS3B 4TQ0A 1FIQA 2E3TA 1UWMA 2QJLA 1SBBB 3SEBA 5HG2A 2I2YA 1YN5A 2H88B 1FM0D 1AWDA 1V97A 3W2DA 2MH7A 1N5WA 2CJOA 2PVGC 1CJEA 2YEPB 2JU6X 1QILA 1ZP0B 4NJCA 4JE3B 4RGMA 1ZPSA 2LHEA 1C78A 3CWIA 2R61A 2K0PA 4ITKA 1JW9D 1ZXIA 1ACCA 1VZ7A 1XCTL 4C80A 1FCLA 4AQ7A 2BB6A 1NEKB 2JQRB 4ZRPA 1QOFA 1N5XA 2DYMA 2SAKA 2AQ3B 2PMVA 3VR8B 1IGDA 1PGAA 3AE8B 2WXHA 2QMTA 1C9FA 4YTMB 1DGJA 4ZYSA 5BYRA 1KH0A 1UGJA 1ESFA 2SEBD 1NENB 3AEGB 1D5MC 3W9CB 1IUEA 1D5ZC 5H8YE 2QSDA 4N58A 2N7JA 1K53A 4OVZA 3MFGA 3TUOA 2L32A 1E0ZA 2KN4A 1KLUD 3AE2B 1R7SA 1XO3A 2GRIA 4WURA 3TEXA 5C2TB 2ZW1A 3R2IA 2WDVB 2W3SA 1V1OA 4ZRQA 1CK1A 1DOYA 5H92C 4DXFA 3PZ7A 1EM7A 2IDYA 1JWUD 2VZKB 2V3PA 2IGHA 1UUPA 3AMZA 3NUHB 1IBXA 2JZPA 3KWVA 1F2RI 3VRBB 3OWEB 1N62A 1FNUA 2BW2A 4WIPA 1WSPA 1HEZE 4GDLB 3GS2A 2INPE 4TSSA 1GB4A 1EU4A 2X38A 1ZDVA 2RMMA 1QOAA 5EE3A 3NVVA 5D3IB 3BZDB 1V1PA 4NAWB 4IKGA 1K51A 2K9XA 2JX5A 5C3JB 3NVZA 3BYYB 3FC4A 1XXGA 4R3DA 5T8IA 1JWSD 1BUIC 2AQ2B 2NTTA 3IT4B 5LNK1 4L23A 3RPFC 4YTNB 3V05A 1BXTA 2QIEB 4M0WA 5EE1A 5I4DA 2WQYB 2AQ1B 1E7PB 4RF0A 4JPSA 4YSYB 1C4AA 1FRDA 2OHFA 2NMQA 1HZ6A 2B76B 3FILB 5FKAC 4HEA1 1C76A 1VZ6A 4US8A 1SIJA 1B9RA 1NYRA 4KKJA 5FR3A 1FNWA 1NYQA 2ZW0A 2BS2B 4OW0A 1L4ZB 3O13A 1E6EB 1HZ5A 1FFUA 4YWGG 3BVZA 3B9JA 1QT9A 3I9V1 4YSZB 1PGBA 3P4SB 1WYGA 1JCKB 2WDQB 1MVKA 2ONQA 5E6JA 2WLBA 2WS3B 2FUG1 4YSXB 1T3QA 4HKZE 1L4DB 2L52A 2LJIA 2JYTA 5EE0A 1SSNA 1TY0A 1SE3A 1XCQL 1FEHA 4ARIA 1FXAA 2L83A 5GXGB 1I4RA 3AM9A 1VR9A 1J7CA 3GP7A 1ZDXA 2WXJA 2M0AA 2IGGA 3HUIA 1SB3C 1XLOA 3U7ZA 3L4PA 1K50A 3AE3B 2V0GA 4LTUA 1OQQA 4EE2A 4WWMA 3V3XA 1FNVA 3AE9B 4TMAB 3AE4B 1L6UA 2MJ3A 2PKOA 2QEJC 4P6VF 2DBYA 3Q8BA 3AE1B 3UI3A 3TEWA 4YXDB 3PO0A 3BK1A 4DXGA 1N63A 1TZOA 2GB1A 4OHJA 5D3DA 4OZBA 4REZA 1E10A 3R2TA 4DQOC 2W3RA 1AN8A 1XLPA 3GB1A 4XE0A 1MI0A 1YN4A 4J3OD 1VDVA 2WXOA 1QKZA 3AE6B 3MP9A 2MEKA 2AX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  1F0Z A;  1ZUD 2;  1RYJ A;  1JRP A;  2CU3 A;  2KAJ A;  3AV8 A;  5G5G A;  3VRB B;  1I7H A;  1N62 A;  1JWA D;  2WP9 B;  3AEF B;  2ACZ B;  3SFE B;  1TKG A;  1N60 A;  5G5H A;  2EKI A;  3DWM A;  2CJN A;  3HRD D;  3AEC B;  2M19 A;  1NVI D;  1PUT A;  1QOA A;  5EE3 A;  1ROE A;  3AEB B;  3NVV A;  3BII D;  1RWS A;  1KRH A;  1QF6 A;  1A70 A;  3FAH A;  1WXQ A;  1EWY C;  2K9X A;  2Y5C A;  3EUB 2;  3SR6 A;  1TKY A;  3NVZ A;  2H89 B;  2JX5 A;  3HVZ A;  1TYG B;  3W5V B;  3FC4 A;  4ZHP A;  2FBW B;  1FMA D;  1KF6 B;  3AEA B;  3RPF C;  4YTN B;  2DWQ A;  2QIE B;  3DWG C;  3AEE B;  5EE1 A;  3AN1 A;  1WGK A;  2K22 A;  3ZYY X;  1PFD A;  1ZOY B;  1YJJ A;  2BS4 B;  2WQY B;  3NVW A;  1E7P B;  2G1E A;  4YSY B;  1V8C A;  4KX6 B;  1FRD A;  1WWT A;  2OHF A;  4WQM A;  2B76 B;  2BT6 A;  1L6V A;  1FO4 A;  4N59 A;  4US8 A;  4A9A A;  1SIJ A;  5MPO A;  4FXC A;  1B9R A;  1RFK A;  3AB5 A;  2MJE A;  1NYR A;  3B2F A;  3P1M A;  1KFY B;  2W54 A;  2BS3 B;  4US9 A;  1NYQ A;  1FIQ A;  2E3T A;  1QLB B;  1UWM A;  2BS2 B;  1YJI A;  2KMM A;  2QJL A;  5C3J B;  2N0S B;  1GPX A;  1E6E B;  3P63 A;  1L5P A;  2WU2 B;  1FFU A;  3ETR A;  2H88 B;  3P4Q B;  1FM0 D;  1JQ4 A;  1XLQ A;  3B9J A;  1AWD A;  2LEK A;  1QT9 A;  4YSZ B;  3P4S B;  1V97 A;  2PIA A;  1WYG A;  2WDQ B;  4ZOH C;  2MH7 A;  1N5W A;  2CJO A;  2PVG C;  1CJE A;  1QOG A;  3VRA B;  4JX1 C;  1TKE A;  1ZP0 B;  2WLB A;  2WS3 B;  4YSX B;  1TJE A;  1T3Q A;  1JWB D;  1J7A A;  2L52 A;  1DOX A;  4C7Z A;  1FFV A;  4HRO A;  1JRO A;  3CWI A;  1VLB A;  5EE0 A;  2WDR B;  2WU5 B;  4YTP B;  3AH7 A;  1JW9 D;  4ITK A;  1FXA A;  2L83 A;  4YT0 B;  5GXG B;  3AM9 A;  3AE5 B;  5AUK A;  1J7C A;  1ZXI A;  1OFF A;  1JAL A;  3W5U B;  4C80 A;  1QOB A;  3HUI A;  2K5P A;  3VR9 B;  2JQR B;  1NEK B;  1SB3 C;  1XLO A;  3KWL A;  1QOF A;  1N5X A;  3L4P A;  3AE3 B;  3VR8 B;  4LTU A;  1OQQ A;  3AE8 B;  4WWM A;  3ABV B;  1FRR A;  3AE9 B;  1DGJ A;  4YTM B;  3AE4 B;  4C7Y A;  1L6U A;  1VJK A;  2M56 B;  2MJ3 A;  1XLN A;  1NEN B;  1YQ3 B;  2PKO A;  4P6V F;  2W55 A;  3NRZ A;  1AYF A;  3AEG B;  3P4P B;  3SFD B;  3W9C B;  2DBY A;  1IUE A;  2HTM E;  3AE1 B;  4JWU C;  5H8Y E;  1J7B A;  2Q5W D;  1WRI A;  1NI3 A;  4N58 A;  4HRS A;  4USA A;  1E0Z A;  1FXI A;  4IDI A;  4N6E B;  3AE2 B;  1R7S A;  1XO3 A;  3PO0 A;  4YXD B;  4JWS C;  1GAQ B;  5C2T B;  1N63 A;  3NVY A;  2MJD A;  2WDV B;  3CIR B;  1N61 A;  1CZP A;  2W3S A;  5AUI A;  1E10 A;  5EE9 A;  3AE7 B;  3AED B;  3LXF A;  1E9M A;  2W3R A;  1SF0 A;  1DOY A;  1XLP A;  3WCQ A;  3NS1 A;  5H92 C;  3LB8 C;  3B2G A;  1DOI A;  1L0V B;  1VDV A;  1OQR A;  3AE6 B;  3P4R B;  1RM6 C;  4ZHO A;  3AMZ A;  1YQ4 B;  2PVO D;  2AX5 A; 
#chains in the Genus database with same CATH topology
 3TAD A;  2DAF A;  4HK2 A;  2WAQ F;  1C3T A;  5CEH A;  5ALU A;  9ICQ A;  3PSF A;  1KN5 A;  4WWP A;  1RYU A;  1D8B A;  1PYW D;  1V80 A;  4MGY E;  2R8G A;  1UBI A;  5KG7 A;  1WE7 A;  3H1U A;  4GLS C;  3DBH I;  2K1F A;  2RSU A;  4H2A A;  3C2L A;  2DHZ A;  4DDI D;  1WM2 A;  1PZN A;  1TS2 A;  1WGY A;  9ICS A;  3R8B A;  3E58 A;  5E6P A;  1ET6 A;  2RLT A;  1QF6 A;  1IIP A;  5AEK B;  1SV0 A;  5ALQ A;  3LJ3 A;  2DX5 B;  1WX8 A;  4CE6 A;  1KBU A;  3PML A;  3KZX A;  3DBS A;  2INN E;  1ZGU B;  1JUD A;  2P6U A;  2BQU A;  2DZJ A;  5BYS A;  4B0M A;  3PO5 A;  4ANV A;  4M9J A;  4UAS A;  3H0L B;  4IR1 A;  4Y2Q A;  3M9N B;  2EMS A;  3ZW3 A;  4W9J A;  3MC8 A;  2ZVN A;  3V7K A;  4FJV B;  5HFY A;  3BK2 A;  1L6V A;  3APD A;  2J52 A;  7ICT A;  4YXM A;  2MJE A;  4RM9 A;  2Y1I A;  3P1M A;  4ECZ A;  3BQ2 A;  2LWP A;  2KHV A;  1P7E A;  3DVG X;  2LPE A;  2KFJ A;  4DL2 A;  2VH1 A;  2KAN A;  2WU2 B;  2WWZ A;  4I2D A;  1JQ4 A;  1URJ A;  5AM4 A;  2WHI A;  5KFA A;  2J53 A;  1NJX A;  1F52 A;  5HNK A;  1WXS A;  2HOF A;  2V3S A;  5AM2 A;  3PMN A;  2F1I A;  2BPG A;  2ZPY A;  4NZL B;  4G3X B;  4C4S A;  2CRX A;  3JPS A;  4E3C A;  3I76 A;  2DYO A;  1Z00 A;  2INC C;  5K4L A;  4DDG D;  3PSE B;  3MHZ A;  1YX6 B;  3QNM A;  4QIW C;  8ICT A;  3NOB A;  3BQT A;  4TQS A;  2MA1 A;  2BVC A;  1I4Q A;  2KNB A;  4DSF A;  5L9X A;  5KFN A;  2Z59 B;  3X0W A;  3TKA A;  1RLF A;  4F4K A;  2E8P A;  2VAN A;  4RPY A;  3K1R B;  4JIO U;  1WGR A;  4PS3 A;  3LDA A;  9ICI A;  1F77 A;  4FUL A;  3EYZ A;  2VJ5 A;  4JWM A;  4M9N A;  1YQ3 B;  4C4V A;  4EYH B;  5BMG A;  3GII A;  4XA5 A;  3EPG A;  3ZD8 A;  2HTM E;  4JWU C;  4MGI E;  4HDQ A;  4IM2 A;  4BVU C;  3R9K A;  2V3N A;  1NI3 A;  3EGR A;  1X9X A;  2BQ3 A;  2JEG A;  3ZJV A;  2XK5 B;  1NJW A;  2CHZ A;  1GAQ B;  4NLK A;  4ICV A;  3K1Z A;  4UAZ A;  1N56 A;  4HAI A;  1WXA A;  3CIR B;  1N61 A;  5HHH A;  1WFY A;  3AE7 B;  3M63 B;  5DG7 A;  3J9C A;  5KG5 A;  4JLC A;  4J9L A;  3B2G A;  3JVZ X;  5KL8 B;  2KMA A;  5JZE B;  4IW0 A;  4Q2J A;  2D2Q A;  3P4R B;  1JRU A;  2HCF A;  4KN4 A;  2LZ6 A;  1OEY J;  2LI5 A;  4MSQ B;  2KVS A;  4GDK B;  4KGR A;  1M4V A;  2LMR A;  3AV8 A;  4IUM B;  1I7H A;  5CHV C;  2W9B A;  1ZQN A;  1WGD A;  3S6J A;  5HML A;  4J9P A;  2OWO A;  4MF2 A;  2YB4 A;  5DG9 A;  4PYU A;  4I2C A;  4DFK A;  3F5A A;  5ALR A;  2PW9 A;  3AEB B;  3KUC B;  5KFR A;  3QYP A;  3A4R A;  2FI1 A;  1TS4 A;  3ZXR A;  3Q8P B;  4Y2Y A;  5EE9 A;  2Y5C A;  4PL2 A;  2FBW B;  2KMD A;  2ZIU B;  2WTF A;  3ZIM A;  1FXT B;  5KG1 A;  1E8Y A;  3AEE B;  2K22 A;  2JXJ A;  1P1A A;  1T5X D;  1R4M I;  3VC8 A;  1V8C A;  1AQ6 A;  2WXL A;  1BML C;  1WWT A;  2FDR A;  4WQM A;  3MDC A;  2NRW A;  4C8M A;  2WF6 A;  1QTM A;  4AS1 A;  2KX3 A;  2GBM A;  3RTV A;  3FYH A;  4WJ3 B;  2M1M A;  4QW8 A;  1C79 A;  1Y56 A;  5KT4 A;  5KFU A;  2D6F C;  1IV8 A;  5J0S A;  7ICO A;  1LO5 D;  3MC0 B;  9ICB A;  3URY A;  2MRP A;  4DHZ E;  2MU2 A;  3ZJT A;  2JGA A;  5ALG A;  9ICG A;  2V9H A;  1ZQO A;  3GV8 B;  4UBB A;  3VDZ A;  2RPV A;  4ELV A;  2C7N B;  2LGY A;  4A6Q A;  4R8U A;  1JWB D;  4MEM A;  1NKB A;  2M4N A;  2I38 A;  4GIB A;  2ICI A;  2WU5 B;  4XC2 A;  2AXT U;  5DGB A;  2EAP A;  5DPT A;  3T79 A;  3RFZ B;  3RNF C;  3VUW A;  3KD3 A;  3V62 A;  1TTN A;  2Z8L A;  2DYB A;  4HYK A;  1XO1 A;  4ICA A;  3T5K A;  1H8C A;  2PXI A;  1DYQ A;  2IMW P;  3ABV B;  4WWN A;  3GU3 A;  4GXI A;  1Y8R C;  2C7M B;  2LRU A;  3MGH A;  3NGD A;  8ICN A;  4M0W B;  4JV1 A;  3RJG A;  4RF1 A;  2BCR A;  2C22 A;  5AZF A;  2PI5 A;  1X9M A;  1WJ4 A;  1ZXH A;  2F8K A;  3MC9 A;  3JPN A;  2ZPN A;  3VFK A;  4USA A;  2LYH A;  1V1P B;  2K39 A;  2M8S A;  4QWD A;  3NJT A;  2K8C B;  2MJD A;  4RGO S;  1YJ1 A;  3N97 B;  3M62 B;  5C23 A;  5G55 A;  3NS1 A;  4B0E A;  2E8M A;  3RB4 A;  3LB8 C;  3C0R B;  3E9S A;  1U9L A;  2O6V B;  4LJO B;  4RQM A;  5KT3 A;  2WXK A;  2Q0Z X;  4QWC A;  4MSM B;  4A8X C;  1RYJ A;  3EC8 A;  1S76 D;  1XQQ A;  8ICK A;  3ZQ4 A;  2DF4 B;  3Q8Q B;  4GC7 A;  4ECT A;  1SWV A;  4P4O A;  5DB7 A;  4EZ6 A;  1WX9 A;  2KFK A;  3A9K B;  3EA6 A;  3HP6 A;  3ZLZ A;  5EDS A;  5AKX A;  5EWG A;  8ICW A;  3PV8 A;  3A33 B;  2LHD A;  2JH7 A;  2QB0 A;  3N7R C;  1UHU A;  5JHA A;  1DRG A;  3RB0 A;  2KO3 A;  2NBW B;  2QDF A;  1B4F A;  1ZD2 P;  4CF3 A;  1NK9 A;  5AK6 A;  4BKT A;  3UIN B;  2BPS A;  2WXF A;  4RQ6 A;  2L1A A;  1NI2 A;  2BGF A;  3NRW A;  5KFD A;  3M8S A;  2A4Z A;  2MRL A;  3TBL D;  3W1S C;  2JRZ A;  3BQ7 A;  2KTF A;  1IP9 A;  2XI9 A;  1HA5 A;  4Y2P A;  3AU6 A;  5KT6 A;  3SHQ A;  3C5F A;  1GNU A;  1S5L U;  4OJ5 A;  4ACO A;  2M0N A;  3RH4 A;  2Q4T A;  2QJL A;  1KL9 A;  4B9L A;  4TUQ A;  5AHX A;  5HG2 A;  3C2K A;  4J9S A;  8ICI A;  1YN5 A;  1ZQY A;  2H88 B;  3RFA A;  5DGA A;  8ICH A;  1AWD A;  4LDT B;  2CHW A;  1PQS A;  2K4P A;  5AKZ A;  1V97 A;  3L13 A;  2WB1 C;  1SGH A;  1BGX T;  1N5W A;  1L7N A;  4IQV A;  5IIM A;  1BPE A;  4AOF A;  5HMM A;  4DLG A;  1OQY A;  4NJC A;  2ZUC A;  1T4G A;  2JZ3 B;  4LJP B;  1ZPS A;  2GLE A;  2A1J B;  4FZM A;  4NXZ A;  3F2D A;  4QZG A;  3CWI A;  1L8O A;  1KTQ A;  2R61 A;  2K0P A;  4ITK A;  2FCN A;  4UB3 A;  4B95 A;  1VZ7 A;  1ACC A;  3QAQ A;  5E6O A;  1XCT L;  2JZZ A;  2VA3 A;  1WXV A;  5KFC A;  4Z6F A;  1ARO P;  3PRZ A;  1FCL A;  2D11 A;  2K8B B;  1SIF A;  4QWB A;  1L2N A;  1ZD5 A;  4IG7 B;  4RZR A;  1QOF A;  2D07 B;  2FCM A;  1IGD A;  4DWI A;  1PGA A;  3AE8 B;  4LDT D;  4YTM B;  1DGJ A;  1F9J A;  1NZB A;  1ESF A;  4DXA B;  2A1A A;  2KJR A;  5IOI A;  3UIP B;  3IBE A;  3W9C B;  2HHX A;  3DBR I;  8ICA A;  1B43 A;  2GBR A;  2HE7 A;  2NRT A;  1EO6 A;  4M8N A;  7ICL A;  4PHP A;  3MFG A;  5GTH U;  2L32 A;  1KLU D;  3ENE A;  1ZJM A;  2O6V D;  4YR0 A;  3PR4 A;  3OJU A;  3I28 A;  5ALE A;  3MDA A;  2W3S A;  1ZQX A;  1V9P A;  1V1O A;  3G6Y A;  1VCB A;  1KRP A;  1SE9 A;  2G5H B;  2NS5 A;  5LXH A;  5AKI A;  3ML8 A;  3PZ7 A;  4M6W B;  5ALL A;  2N7D A;  3H4D A;  1ZQG A;  1JWU D;  1YIW A;  5DBB A;  4ECQ A;  1PK3 A;  4QAY A;  2B0C A;  1A76 A;  2IGH A;  2LYB A;  1ZQJ A;  5DDY A;  2A5U A;  2HJ1 A;  1RXW A;  4WJN A;  2JZB B;  1FNU A;  4WIP A;  1WG8 A;  5IIN A;  4GDL B;  4TSS A;  2WGS A;  2ZJ5 A;  1GB4 A;  1QCK A;  5J0W A;  4RMA A;  3KVF B;  3IHQ B;  1V81 A;  2IHN A;  5KHO A;  3BZD B;  2NO5 A;  2OEH A;  4NAW B;  4MJS A;  3THV A;  5IA7 A;  4AP9 A;  5TIS U;  3BZK A;  2P35 A;  1T7P A;  2C7H A;  4K7U A;  1TT5 B;  2AQ2 B;  3QUC A;  3RRG A;  3V05 A;  1BXT A;  2IY0 B;  1KFT A;  4R65 A;  4P1C C;  3H0M B;  4JPS A;  3UIO B;  2FMP A;  2BKR B;  3UMG A;  4KLG A;  2B76 B;  3FIL B;  3KUZ A;  1DK3 A;  4HEA 1;  4RQ0 A;  1ZD4 A;  2NO4 A;  4MGK E;  3W1Y A;  3F53 A;  5AK5 A;  3ZDE A;  5ALH A;  3F2C A;  2L0F A;  1WCL A;  1FNW A;  1ZQM A;  2ZW0 A;  1PVQ A;  1L4Z B;  4BJQ A;  1Q5W B;  1A5R A;  3KHR A;  2H5X A;  2UVV A;  2DUY A;  4DFD A;  5EOZ A;  2ZJD A;  3B9J A;  4OVV A;  4YSZ B;  3PV1 A;  4R63 A;  1PGB A;  2IND C;  5JHB A;  3P4S B;  3N28 A;  2WDQ B;  1L6N A;  2IOF A;  4OJO A;  4PH5 A;  5AKL A;  1C1Y B;  2P6R A;  1SZH A;  4F4W A;  3A9K A;  5DBC A;  5KG4 A;  2BCU A;  2GMI C;  2L52 A;  2LJI A;  2JEF A;  4MEL A;  5IIJ A;  4B6W A;  5EE0 A;  5BO4 B;  1IM4 A;  1XCQ L;  1SKW A;  4C4V B;  1VR9 A;  1J7C A;  3BS5 B;  1ZDX A;  2WXJ A;  2O6V A;  3HUI A;  2DAJ A;  5ALI A;  1X9W A;  1XLO A;  4W9H A;  4ECV A;  4DS5 A;  3L4P A;  1CRX A;  1K50 A;  2V0G A;  1UPH A;  1OQQ A;  4LTU A;  4KN7 A;  4PHE A;  4WWM A;  5ALW A;  2XEW A;  4TMA B;  1V9J A;  1WGG A;  3PPA A;  3ZDT A;  1HTO A;  1X2I A;  2PKO A;  4FO6 A;  3RRH A;  1WIA A;  2DBY A;  5J2C A;  3JPQ A;  4RPX A;  5AK4 A;  3QU9 A;  3PRE A;  4KLT A;  1F5S A;  4W9G A;  2D3B A;  3BZC A;  2KDB A;  2H3I A;  2E8O A;  2MP2 B;  3PLU A;  5ALV A;  1N63 A;  1TZO A;  2BPF A;  1OEY A;  4EYI B;  2QB1 A;  4YFK A;  4M04 A;  1WGH A;  2XVT A;  4OZB A;  4REZ A;  3N7S C;  3UXN A;  3QXG A;  2R8I A;  1AN8 A;  2YLM A;  3GB1 A;  4XE0 A;  4MM3 A;  1MI0 A;  2ZIW A;  1T0S C;  1V5T A;  2LI6 A;  2J0J A;  1X6J A;  5KFJ A;  2WF7 A;  2YMQ A;  5KFT A;  1PVR A;  3V60 A;  4IM3 A;  4F72 A;  1RQL A;  3OPX A;  7ICF A;  5CA7 A;  3WAL A;  4YR3 A;  3G6V A;  1NBF C;  2CPR A;  5J0Y A;  2VKQ A;  3ICX A;  2J0K A;  3GZN I;  3RBD A;  2Y9T A;  2PLP A;  5J0R A;  3L17 A;  2MCN B;  3AEF B;  2FE8 A;  3RCZ A;  2ASL A;  2J4X A;  2KV2 A;  3A1Q B;  2LVO A;  2YVC A;  3O65 B;  4DSK A;  2L3Z A;  4O3N A;  2G45 B;  3JYU A;  1HEK A;  4ECR A;  1GB1 A;  2Y0S F;  1ZQF A;  3HJE A;  1RWS A;  5ALO A;  4BKS A;  3WAM A;  3V6C B;  5AK3 A;  1WXQ A;  1IG6 A;  9ICR A;  2GI9 A;  2H89 B;  5KNI A;  2KLG A;  2HOI A;  2KC1 A;  3A9J B;  3OLM D;  5DG8 A;  5JXV A;  2KKP A;  5DPS A;  2ZUB A;  3BYT B;  2KJ9 A;  2GOL A;  3PW0 A;  1ZQL A;  1PFD A;  1S0M A;  3N1X C;  1WZ3 A;  4Y2V A;  5C0Y A;  1LV5 A;  1C20 A;  3QIJ A;  1G6J A;  2MSE D;  4M2Y A;  1SJE D;  1MHH E;  3RZF A;  4PGX A;  1XSN A;  3ED5 A;  3MR5 A;  5HHD G;  3M1Y A;  3SI8 A;  3GFK B;  3KKA A;  2N9X A;  3OJS A;  2F1J A;  1FO4 A;  4N59 A;  3PZ8 A;  4O1N A;  3ZJU A;  5J0U A;  2ZIU A;  1L0Y B;  4HCP B;  4EEL A;  4F91 B;  2KTR A;  4MEY A;  2N0S B;  2Y1J A;  3GIK A;  1M94 A;  3ZDM C;  2ZTD A;  3HT3 A;  4P16 A;  3ETR A;  1MQ2 A;  1NZP A;  9ICT A;  4C4T A;  1XLQ A;  3C29 A;  2KG5 A;  3HKZ C;  5J2B A;  4JMU A;  4A8E A;  1D9F A;  2C2R A;  1STE A;  1VZ8 A;  5AI0 A;  5A0L A;  2HVH A;  4EKU A;  2D8C A;  4C8N A;  7ICP A;  1HUZ A;  3PHW B;  2MHJ A;  5CWR A;  3QC8 B;  4PPX A;  1RQN A;  1H4R A;  4MJS B;  4EZJ A;  2WXI A;  3NY5 A;  4PS8 A;  4R66 A;  7ICU A;  2BHN A;  2KIW A;  4QNL A;  1OFF A;  1JAL A;  1GC6 A;  2PE9 A;  4BAX A;  3ZDA A;  3DV9 A;  4UAR A;  5HP4 A;  3QWZ B;  2WXN A;  2K5P A;  1ZYQ A;  1WX7 A;  2JR5 A;  2GO7 A;  1E5W A;  2M9N A;  1MFW A;  3QUT A;  1FRR A;  4KIK A;  1S0V A;  3QU7 A;  2O6K A;  1VJK A;  4KLS A;  2K4I A;  4BOZ B;  4I27 A;  3NRZ A;  3RBE A;  1WMH A;  3ZTC A;  2F44 A;  4WAF A;  1VJ5 A;  4HRS A;  1ZRM A;  4KLI A;  5F9L A;  1UD7 A;  4IDI A;  3DHH C;  2FPK A;  4I6P A;  1XEE A;  2JSV X;  3E56 A;  4II3 B;  3L0W B;  5DPW A;  4E74 A;  1UA0 A;  4JQW C;  1KM7 A;  5JRT A;  3RN9 C;  3TI0 A;  4DL3 A;  2BKE A;  2KWC A;  2CS4 A;  4BKS D;  1L0V B;  5KG3 A;  4ZH4 A;  1B1Z A;  1J2M A;  3JPR A;  1D5X C;  2KJ5 A;  1FPY A;  1L3T A;  3IDW A;  1WCN A;  1HE8 A;  3ZO5 B;  3I57 A;  2N4F A;  3KFU F;  8ICG A;  1XSL A;  4RCO A;  1ZUD 2;  3RI7 C;  1JRP A;  4QW9 A;  4LZG A;  4KGS A;  4F3O A;  3Q8F A;  4MM3 B;  4M0A A;  2WXQ A;  4J9O A;  3EFU A;  1Z4O A;  2PMZ F;  3H8J A;  3HM6 X;  4ELU A;  4F5N A;  4FN2 A;  4DBG A;  4UAY A;  3QE9 Y;  4XYC A;  2WAQ C;  5J0P A;  2KZZ A;  2KJH B;  2LXA A;  3RUL A;  1DOQ A;  1TY2 A;  4TUS A;  4P0P A;  1ROE A;  4BBN F;  4YG2 A;  3FDS A;  3L54 A;  2IOF K;  1A70 A;  2JMG A;  2BYE A;  4GXB A;  2LMC A;  4RUA A;  4R64 A;  3SMV A;  1COK A;  3HVZ A;  2DKZ A;  3D2N A;  4RU9 A;  1FMA D;  4AJW A;  3VVW B;  3RAQ A;  2FIF A;  1T6B X;  3NZ3 A;  3E2E A;  1KLN A;  3AN1 A;  3H8H A;  3ZYY X;  3H8M A;  4OJ6 A;  1RPL A;  4DOA A;  2BS4 B;  2JT4 B;  5AI8 A;  2KK8 A;  2QIL A;  2HHQ A;  3R7R A;  8ICB A;  2M17 A;  3M6Z A;  1WUD A;  4MH8 A;  3R66 C;  2XC9 A;  5H2F U;  4GGQ A;  1WH3 A;  3IAM 1;  3BS5 A;  1T0R C;  2RRD A;  4FE3 A;  4Z6C A;  4EBE A;  4RGN A;  4UDU C;  3OHA A;  1KFY B;  1ZQC A;  1YJI A;  1GPX A;  2IHM A;  5BMH A;  4C56 C;  3C23 A;  2ON8 A;  5J18 A;  4JK1 A;  5KFB A;  5AKH A;  1X1M A;  2MX2 A;  4IWO A;  4L2Y A;  3C2M A;  1AW7 A;  2ATL A;  1TZ1 A;  1UWX A;  1QOG A;  2XNA C;  4JX1 C;  2BCQ A;  2HVI A;  4DHZ B;  3ALR A;  4XUS A;  3PST A;  1PK1 B;  3HKZ F;  5L1L A;  1O03 A;  1NK6 A;  4PT5 A;  1I4P A;  5D49 A;  1SE4 A;  1XD3 B;  2QB0 B;  3W5U B;  3T5J A;  4DS4 A;  2KWD A;  2L0T A;  3N3K B;  4FA6 A;  3WA0 A;  2ASJ A;  1QOB A;  3V6K A;  5HKH A;  2G07 A;  3KWL A;  2AL6 A;  3ZDC A;  2WXM A;  3V6H A;  5J29 A;  3QZ7 A;  4N9F 4;  2HSZ A;  2R18 A;  1ZQD A;  3QU4 A;  1F2R C;  1C4P A;  2LFI A;  2M56 B;  2E6X A;  5KFW A;  2W55 A;  1AYF A;  4P2H A;  4UAW A;  1OUQ A;  4FHJ A;  5TZV A;  3DHG C;  2KWV B;  4QWA A;  4NAW A;  2IBK A;  3TAR A;  5C5J A;  1BNP A;  2IGD A;  4GXK A;  3LVW A;  2DFL A;  4ED8 A;  4D2K A;  2WF9 A;  2J42 A;  1ZQE A;  3RR8 A;  1SF0 A;  2Y3A A;  1YNT E;  3CF6 E;  8ICU A;  4AYB F;  2PPH A;  3Q8E A;  5J2A A;  3IT6 B;  2J0M A;  3KHH A;  1DXS A;  4NLC A;  2DZK A;  2RP5 A;  3VR9 B;  1KKX A;  4F71 A;  3ZNH B;  1F0Z A;  3H7P B;  4JL9 A;  2TSS A;  4XDD A;  4CF5 A;  1ZQA A;  2FCQ A;  2LM1 A;  3AEV A;  1JWA D;  3C8Y A;  2DKX A;  3OHB A;  2XGP A;  1ZQP A;  4DQS A;  3F2B A;  5AM5 A;  5G5H A;  2AU0 A;  2A3V A;  2EKI A;  4NY0 A;  5J8Y C;  1NKC A;  1ECW A;  2BYV E;  2W8K A;  2FAZ A;  3RT3 B;  4PGY A;  2YN4 A;  4A3P A;  1D8L A;  2KK0 A;  2H3V A;  5J2F A;  4KDL B;  1GJZ A;  3IHP C;  1NK8 A;  3FAH A;  1JI7 A;  1D4B A;  3EUB 2;  3W5V B;  3MR3 A;  4KGT A;  5FK9 C;  1MHX A;  3BJY A;  3IV6 A;  3AEA B;  3C1Y A;  2YEP F;  4MH0 E;  2RDB C;  4RQ5 A;  2OOB B;  1NKE A;  2ZIX B;  1YJJ A;  4WWO A;  4UB4 A;  2JY6 A;  3HVD A;  2MUT B;  5BYQ A;  2R2O A;  8ICO A;  2BCV A;  4QWE A;  1WXM A;  2FJ6 A;  3UM9 A;  2W9C A;  8ICL A;  9ICN A;  2CU1 A;  2NR2 A;  3BWU D;  2ALZ A;  2CHX A;  5KFX A;  2ESE A;  5KT7 A;  5MPO A;  1TV9 A;  4FBU A;  4KDI C;  1Q3V A;  4TQ0 A;  4C8O A;  8ICQ A;  2K6Q A;  3C28 A;  5JTI A;  4ECX A;  1OGW A;  2JXX A;  2AGP A;  4C8L A;  4I2H A;  2MAX A;  4P0Q A;  5F9N A;  2MH7 A;  2CJO A;  2YEP B;  2JU6 X;  4JE3 B;  3EEC A;  4YL8 A;  3ISD A;  4KLD A;  1J0G A;  4RGM A;  4Y2S A;  3GV7 B;  4NL9 C;  5DQI A;  4GLX A;  3ZRC A;  4XRH A;  1JW9 D;  4PZN A;  1ZQV A;  4BGD A;  2FCS A;  1ZXI A;  4B9V A;  4CNQ A;  1JX4 A;  4I2B A;  5J8Y A;  4FJZ A;  3DBH B;  1SV4 A;  4HPM B;  1BPX A;  2KXJ A;  2DYM A;  8ICY A;  1UEL A;  2ZIV B;  2PMV A;  3ONS A;  5J0O A;  2WXH A;  4FLH A;  4ZYS A;  1KH0 A;  2NRZ A;  1D8Y A;  1NEN B;  2LGX A;  1HJP A;  5J2D A;  1UGM A;  5ALP A;  3TL5 A;  2JV3 A;  4ED3 A;  4G3I A;  3PTF C;  2QSD A;  2LKY A;  1S10 A;  3TUO A;  2KN4 A;  2ZEQ A;  2GRI A;  1Z5S B;  3PW5 A;  2BDP A;  1A6S A;  5EWF A;  4W9I A;  1LB2 B;  2ZW1 A;  3R2I A;  4PS7 A;  3L5K A;  2ZNV B;  4EZ9 A;  4YR2 A;  1CK1 A;  1F1H A;  7ICR A;  3DDC B;  2VIX A;  4I6N B;  2IDY A;  3H6N A;  4F8C B;  1Z19 A;  3VTW A;  4OCZ A;  2I9G A;  1H38 A;  3AMZ A;  3NUH B;  4F4Y A;  2JZP A;  3KWV A;  1F2R I;  2LGS A;  1TAM A;  2GBN A;  9ICK A;  4M9L A;  4IS7 A;  2HDO A;  1N62 A;  4DFM A;  1J19 A;  1L7Y A;  2BW2 A;  1WSP A;  1CI4 A;  4I2F A;  2BQQ A;  3VHT C;  9ICC A;  3KYD D;  2RMM A;  4P0Q B;  8ICR A;  2NYV A;  5AM0 A;  5DB6 A;  4YCX A;  4DFP A;  3V6J A;  3J81 j;  3JPO A;  1QSL A;  4BUG A;  4E71 A;  1K51 A;  3ZNZ B;  3TQ1 A;  1YZ7 A;  4O3R A;  2K9X A;  4WQO B;  1B0X A;  3NVZ A;  4OD0 A;  2RPQ A;  1WWV A;  1KDH A;  2N7E A;  3MHS D;  3MJW A;  2F8L A;  4K3C A;  3OGU A;  4R3D A;  5T8I A;  3IT4 B;  2XY6 A;  4YTN B;  5L1M A;  2GBK A;  4M0W A;  5JU5 A;  2NPT A;  5I4D A;  3N30 A;  2AQ0 A;  4F93 B;  1SL2 A;  5J2E A;  1E7P B;  2EDU A;  3ZVV A;  3PT2 B;  5E79 U;  5KFQ A;  2NMQ A;  5FKA C;  3L3F X;  3ZXV A;  2BCS A;  1C76 A;  4US8 A;  2W43 A;  2F2A B;  3QEB Z;  1J2N A;  1NYR A;  9ICP A;  5FR3 A;  1S1Q B;  3EPI A;  2RD0 A;  3Q3F A;  3PW4 A;  4NQK E;  4RQ8 A;  3UMB A;  2HBJ A;  1JIH A;  4XQ8 A;  2YB1 A;  4F5O A;  2IA6 A;  2B3A A;  4QIW F;  1Y88 A;  3RMK C;  1MA7 A;  1MVK A;  4W9E A;  4QZ8 A;  2ONQ A;  2YMP A;  2FMQ A;  3A0H U;  2FUG 1;  1T3Q A;  1V49 A;  1C7Y A;  4NPN A;  1O08 A;  1L4D B;  4LNN A;  2DL0 A;  1E8W A;  2FUH B;  9ICF A;  2K6D B;  3OAW A;  3LYS A;  5ALJ A;  1T0Y A;  3H7P A;  1CEZ A;  4DF8 A;  3RH6 A;  2EZY A;  1FEZ A;  1TY0 A;  2KHW B;  2ISP A;  4ARI A;  1FXA A;  5GXG B;  4ED2 A;  1I4R A;  2BWE S;  2M0A A;  3V72 A;  4F4Z A;  3BQ1 A;  4GB9 A;  1K1S A;  3RF9 A;  2BZF A;  5GTI U;  3U7Z A;  3QCA A;  1X66 A;  2XID A;  3AE3 B;  4P4M A;  4EEW A;  1SWW A;  4G0N B;  3UXP A;  1L6U A;  1SKR A;  1L7O A;  3NZU A;  3QHT A;  4AUQ C;  2NV3 A;  3RB3 A;  3U30 A;  4B6J A;  2BKF A;  3KKA C;  4O5C A;  2IBI B;  4O3S A;  3L16 A;  3TEW A;  3VUX A;  3WIM A;  3BK1 A;  3IM1 A;  3H7S A;  5AI4 A;  5AZG A;  4DF4 A;  3DOW A;  1WY8 A;  4IQW A;  9ICV A;  1BT0 A;  3DCG A;  4OHJ A;  4K7W A;  2N1V A;  3R2T A;  4DQO C;  2W3R A;  2V4L A;  3H8S A;  1TFR A;  4ECU A;  4NLZ A;  3WAP A;  4FJY A;  3SEN A;  4UB6 U;  8ICS A;  2MSN A;  1YN4 A;  3VTV A;  3WK5 A;  1YX5 B;  5TR5 A;  2L7R A;  1ZW7 A;  4GDK A;  5AKJ A;  2CR5 A;  4Y2X A;  1OTR B;  5KL1 B;  4BBN C;  1ZQK A;  1V6E A;  4NL9 A;  2Y5B B;  1X40 A;  1JML A;  2QKQ A;  1PK1 A;  2UVR A;  2JF5 A;  1RFA A;  2YX8 A;  2ACZ B;  2KWU B;  5KFV A;  4U7C A;  4O3O A;  1N60 A;  4F92 B;  4MEX A;  5IO9 A;  1J97 A;  2CJN A;  2ZXH A;  3IXS A;  1XF5 L;  5CB1 A;  9ICH A;  4EX7 A;  4A55 A;  3ZNI D;  4OZA A;  9ICX A;  2XK5 A;  3Q69 A;  3X23 A;  3CMM B;  3AUL A;  3DDH A;  3P42 A;  2P66 A;  1IXR A;  5BOM A;  3PVX A;  3RJK A;  2VRR B;  3QK0 A;  1YQB A;  5ALF A;  1FCC C;  4YMO A;  5KFY A;  2AJQ A;  7ICG A;  4MHV A;  1HTQ A;  3VTU A;  1MSW D;  2I6X A;  2EEL A;  2JRH A;  4MFA A;  3DBL B;  3I63 C;  4IR9 A;  4FZL A;  4BX9 C;  1WI0 A;  2KVZ A;  2MBO A;  2WFA A;  4QZI A;  2OCE A;  2G4S A;  5J2J A;  2ZXI A;  2W54 A;  2KD0 A;  1P7F A;  3Q3O C;  2LHT A;  2EQY A;  4ED1 A;  1V38 A;  1L5P A;  3P4Q B;  4WAA A;  1SKS A;  3CP8 A;  3GV5 B;  3NUQ A;  3FM9 A;  2HHU A;  5AIA A;  3VRA B;  4ZOH C;  3UMC A;  5B5E U;  4ED7 A;  3T5H A;  3UGB B;  1TKE A;  3RNA C;  3PS6 A;  5AKE A;  2G5I B;  4TUU A;  1BPY A;  2G4D B;  4C7Z A;  4JWN A;  2KIC A;  4M47 A;  2R8K A;  1VLB A;  4DWF A;  3QA8 A;  2HBM A;  3WK7 A;  3HK0 A;  3NZS A;  5AUK A;  1F44 A;  4IOI E;  1P98 A;  2L05 A;  3N4M B;  2JXT A;  4A90 A;  4DOC A;  1N48 A;  3AXC A;  4ZRI A;  5DPR A;  1SL0 A;  2D10 A;  2DNF A;  1QLN A;  4UAU A;  4ED0 A;  3K9P B;  1K5O A;  2KIV A;  5J2I A;  1WR1 A;  5KAI U;  3T5L A;  5III A;  3T3N A;  3JPT A;  5ALT A;  2OM6 A;  3P2B A;  4TKN A;  3P4P B;  4YD1 A;  2V4Q A;  3MTN B;  2KNJ A;  1HUO A;  1T0Q C;  2C28 A;  3KYC D;  2L00 B;  5KAF U;  1COO A;  5KG2 A;  2ZTE A;  1WMH B;  4BFR A;  3GE3 C;  3HIL A;  5KTQ A;  4C0Z A;  3NVY A;  5J0Q A;  1R4N I;  3C1Z A;  2WXP A;  4KSL C;  4KIK B;  4ANX A;  4QZD A;  4KVG B;  2K25 A;  2ODG A;  3WAO A;  1Q8K A;  2CN1 A;  4DL5 A;  3AED B;  1E9M A;  2KDM A;  3LXF A;  2M0X A;  3WCQ A;  3AUO A;  4BWM A;  1I4X A;  2V4I B;  3RNB C;  1MG4 A;  2FID A;  3QUB A;  1Z3E B;  1OQR A;  4KZC A;  1T8E A;  4MF8 A;  3LYY A;  1XNS A;  4I2J A;  1BVS A;  5D4B A;  3TAN A;  3WK9 A;  1D3Z A;  2CU3 A;  5J0T A;  5G5G A;  2JWZ A;  5AIC A;  4I28 A;  2KQS A;  5L95 C;  4MFC A;  2MWS B;  3ZI4 A;  2KMC A;  2WHE A;  3WKE A;  4KMU A;  1AAR A;  3VH4 B;  5T14 A;  2Y9U A;  3HPO A;  3U7D A;  5F3X B;  1UT5 A;  1VRA B;  3IVF A;  3PGE A;  8ICZ A;  2HI0 A;  3MJ5 A;  4J03 A;  1N6Z A;  2WX1 A;  3MBY A;  3JSV B;  3CYM A;  5ALS A;  4UB2 A;  2KFN A;  1TS3 A;  2G09 A;  3M95 A;  1TAQ A;  3MFH A;  1XO0 A;  4K4G A;  3U2S C;  1SL1 A;  2V1Y A;  7ICI A;  2XBB C;  4PYZ A;  4WH4 A;  2Y0S C;  2DWQ A;  1MPE A;  4KX5 A;  4WJP A;  2ZUD A;  3AQF A;  1J8C A;  1ZOY B;  1UQV A;  2W82 A;  1GC7 A;  3N7P D;  1TK0 A;  5ALN A;  8ICP A;  4GDL A;  5L83 A;  2KKV A;  5IIL A;  1GOZ A;  4J6I A;  1KW4 A;  4GC6 A;  4F2R A;  5ALK A;  1I4G A;  2ES6 A;  2J6U A;  2KX0 A;  4XZ4 A;  3U8Z A;  3HWT A;  5IN7 A;  3QJZ A;  4I29 A;  1SEB D;  2DEN B;  1ZKH A;  3TSS A;  2PKE A;  4OO1 J;  2NTS A;  2WB1 F;  4W9D A;  4KLF A;  3NTU A;  5DLF A;  1I35 A;  3UF8 A;  2W9C B;  4NJ8 A;  2JRI B;  2EAO A;  4DSE A;  1Q46 A;  1NNL A;  2LM4 A;  2ZJ8 A;  2LEK A;  1L0X B;  5E6N A;  3VQI A;  2PIA A;  2MUT A;  1ENF A;  4RUC A;  2IPK D;  3Q8K A;  3B1L X;  1PGX A;  4DHJ D;  1N2X A;  1DOX A;  3T8M A;  4LK0 M;  4W9K A;  3APF A;  3H9D A;  5CJ7 A;  3GDX A;  3PRP B;  1HXY D;  3H0R B;  3PX4 A;  2D5G A;  1U4A A;  4PZO A;  2FLN A;  4BOS C;  4F5P A;  2HDE A;  3N32 A;  3BVM A;  1IYF A;  2WX0 A;  1SZP A;  2FPM A;  5KFP A;  3D2S A;  2K8B A;  4F8R A;  1BPD A;  1P7D A;  2NPT B;  4YQW A;  1Q10 A;  1YOV B;  4ACF A;  1FD6 A;  4TV3 A;  2W9M A;  4KLQ A;  4KLE A;  3SFD B;  3MR6 A;  4CCH A;  2IO2 B;  3Q3N C;  2Q5W D;  4A20 A;  9ICU A;  2GOW A;  3AQE A;  1WM3 A;  2ZJA A;  4FS2 A;  4NLG A;  8ICJ A;  1TGZ B;  1SXD A;  1X6I A;  5D7G A;  3VUY A;  1S97 A;  2WF5 A;  4W9L A;  3Q3M C;  2PFQ A;  5AUI A;  3AU2 A;  3E0F A;  1WE6 A;  4IQU A;  2KDI A;  2Z7J A;  3NAS A;  3LWM A;  1D6E C;  4MGZ E;  1CUK A;  2HMX A;  4JB3 A;  1DOI A;  2ZTC A;  2HHV A;  2CXY A;  8ICF A;  4LLG M;  4ZRJ A;  1C77 A;  1RRB A;  2Y5P A;  4RPZ A;  3QZ8 A;  1IPG A;  1PDX A;  2QCZ A;  1QH9 A;  3QX7 A;  3ZGZ A;  1S77 D;  1EF1 A;  2C5L C;  4J9K A;  2WXG A;  3Q8A A;  3BVG A;  2I1K A;  3KBB A;  3RAX A;  4FZN A;  2MBH A;  4ARC A;  2DPJ A;  2R8J A;  2JHD A;  2L76 A;  4DEZ A;  3Q8L A;  4M01 A;  3ONN A;  4DSI A;  2XO7 A;  2EZZ A;  3PNC A;  1SGG A;  3TEZ A;  2K8A A;  5JUM A;  1KRH A;  5CR0 A;  1EWY C;  2LUM A;  1BPZ A;  1KF6 B;  2B6G A;  5KFI A;  4BDP A;  1ZQR A;  3H7I A;  1PUZ A;  3MFI A;  4NM1 A;  3UQ2 A;  1WGK A;  1ET9 A;  4NLN A;  1I42 A;  3NVW A;  2KAC A;  1LXD A;  3UQB A;  2HHW A;  4XDC A;  3LVV A;  2BT6 A;  2KLC A;  2EAM A;  2PFO A;  2AGO A;  1RAX A;  1L3U A;  5JH5 C;  3B2F A;  3HX0 A;  5ALZ A;  2LAS A;  2BS3 B;  5L1I A;  1FIQ A;  2E3T A;  1KQQ A;  2JH1 A;  4PJ0 U;  5KFO A;  3SZ2 A;  3SEB A;  2I2Y A;  2KVC A;  2NBV B;  2IY1 B;  5AI5 A;  4B9T A;  3SV4 A;  5AZH A;  2OYY A;  2MLB A;  2JEJ A;  5ALD A;  2FLL A;  1CJE A;  3BDP A;  4S17 A;  2VA8 A;  3UQA A;  3JW0 X;  4BXO B;  1Q0W B;  2JZB A;  2XCP A;  4LVS A;  1LKY B;  5KFF A;  1NK7 A;  1LM8 B;  4OJP A;  4QZE A;  1C78 A;  1ZD3 A;  1YZ6 A;  5KFM A;  5DDM A;  1EUV B;  2QC8 A;  2KZ3 A;  4C80 A;  4M6W A;  4U6P A;  4AQ7 A;  2NVU I;  2BB6 A;  1NEK B;  2JQR B;  1N5X A;  3RJE A;  2SAK A;  2KN7 A;  3D6J A;  2PJH A;  1A77 A;  2ZIX A;  5AM3 A;  3GIM A;  3TCA A;  4O0I A;  1MG8 A;  2SEB D;  2UWQ A;  4ED6 A;  4DQP A;  4FBT A;  4B9S A;  8ICC A;  3AEG B;  2MBQ A;  2VA2 A;  3TAP A;  5H8Y E;  3IFW B;  4CHK A;  2Z0D B;  3GZF A;  1MJD A;  2N1R A;  5J2H A;  3SU8 X;  4HWI B;  1K53 A;  4WUR A;  3AE2 B;  1R7S A;  1XO3 A;  4R8U B;  9ICE A;  3TEX A;  5C2T B;  4NQL B;  1OXJ A;  4IWP A;  3UXO A;  4GIV A;  2WDV B;  2E5S A;  2BWF A;  2HW3 A;  3N20 C;  3ZDB A;  3B0X A;  1DOY A;  1TAU A;  5H92 C;  3ZD9 A;  2EMT A;  3PZD A;  3PHX B;  3FKY A;  5HR6 A;  2V9W A;  3Q2A C;  2VZK B;  2KC2 A;  4ZYN A;  2V3P A;  3TIX A;  4AJY B;  1UUP A;  2E1F A;  8ICX A;  1IBX A;  1ED1 A;  1M6Y A;  2GLS A;  2W7P A;  1UZX B;  3VRB B;  4AYB C;  5AKK A;  3OWE B;  4NJ7 A;  4YP3 A;  1HEZ E;  7ICH A;  3GS2 A;  2INP E;  4KSK C;  3EHV A;  1NJZ A;  4JV2 A;  1ZDV A;  1KOT A;  1QOA A;  4GOC A;  3EFC A;  3NG0 A;  3NVV A;  5D6J B;  1ZQB A;  2DGZ A;  4ZRK A;  4RQN A;  4QZB A;  1RXV A;  2JX5 A;  3Q14 C;  1L8L A;  1Q3U A;  3ALB A;  3QX1 A;  3FC4 A;  4I2G A;  5DB9 A;  3WAN A;  4EBC A;  2PI4 A;  2RDI A;  4L23 A;  3RPF C;  5LNK 1;  3RNC C;  3HIZ A;  4Y2J A;  2AL3 A;  1UCV A;  4RQ2 A;  1E7V A;  2IZV B;  5LLI A;  2W8L A;  4C8K A;  3UPQ A;  3PZP A;  4ELT A;  9ICW A;  2OHF A;  2W9B B;  1HZ6 A;  4LZD A;  4QJF B;  2G3Q B;  2PEA A;  3CW2 C;  2EAN A;  3M8R A;  3PX6 A;  3RB6 A;  4KKJ A;  2KTR B;  5J17 A;  4UAV A;  2G0A A;  3MR2 A;  1NYQ A;  4HXD A;  4KZ0 A;  4OW0 A;  4NNJ B;  3WKB A;  3O13 A;  1E6E B;  2F1H A;  5KT2 A;  1JXL A;  3I3T B;  4Y2U A;  3MAB A;  4C4R A;  4CGZ A;  1WJ6 A;  2JEI A;  1QT9 A;  3I9V 1;  2AEH A;  1TE2 A;  1UH6 A;  1NJY A;  5CRX A;  1JCK B;  2IO0 B;  5IIO A;  5CHF A;  1DGS A;  4K4H A;  4GFJ A;  1XC9 A;  2PFN A;  2WLB A;  5E6J A;  1GG3 A;  4RQ4 A;  2BPC A;  1NDD A;  2RR9 A;  1K1Q A;  4YSX B;  2LD9 A;  2HBL A;  3EWA A;  1ZJN A;  4HPL B;  4Q8E A;  1SSN A;  1SE3 A;  5DLG A;  1FEH A;  3IG3 A;  4Z6D A;  2L83 A;  3ZUN A;  1U4B A;  8ICM A;  3GP7 A;  5ALM A;  2IGG A;  3A1Q A;  4PHA A;  2KQ7 A;  5D94 A;  2C2D A;  5DQG A;  1K8R B;  2XGQ A;  2EKE C;  2FNJ B;  3V3X A;  1FNV A;  9ICJ A;  3KW5 B;  3AE4 B;  5AM1 A;  3EW9 A;  5IP4 D;  2QEJ C;  4KIT B;  3DVG Y;  3PR5 B;  5KFH A;  4G11 A;  1TBE A;  3Q8B A;  4F2S A;  3AE1 B;  3RJJ A;  3SEI A;  5CP2 A;  4YXD B;  3PO0 A;  1ZQQ A;  3SDL C;  4DXG A;  4EFO A;  4IC7 B;  3RYT A;  4P0P B;  2VH2 A;  2WDT B;  3GE8 C;  4FBJ B;  1WRD B;  2GB1 A;  1QSY A;  3ISC A;  5D3D A;  1E10 A;  2J7Q B;  5KFL A;  4HJK A;  4RQ7 A;  3LWL A;  3APC A;  3V61 A;  2KHQ A;  3O0F A;  5AI6 A;  4J3O D;  1A0P A;  2IOH A;  4IWQ A;  5IIK A;  2N9E B;  1QKZ A;  3AE6 B;  4NJ6 A;  2AYO B;  2MA9 B;  3AU4 A;  2MBB B;  2AX5 A;  3NHE B;  1LVH A;  2QLT A;  3RNE C;  1CQV A;  4S0R A;  4M9H A;  2PE6 B;  1X42 A;  4G50 A;  2LBO A;  3M9O B;  1EXN A;  7ICV A;  2G9H D;  2KP7 A;  2KQ4 X;  2B21 A;  4DLE A;  3OTQ A;  5G2N A;  1TKG A;  1L3V A;  4O9M A;  4K81 A;  3DWM A;  3HRD D;  4HCN B;  1Q1O A;  2M19 A;  3IP4 B;  3LK9 A;  2N9K A;  3QUQ A;  4RM8 A;  3TAD C;  4LNK A;  4NV0 A;  3BY4 B;  1SXT A;  2L8J A;  3ZTD A;  3SD7 A;  5B66 U;  3RUI B;  5AKG A;  2LGI A;  2OED A;  4UW9 A;  3KLS X;  1RDF A;  4Q8F A;  3ECI A;  4RNO A;  3KOO A;  3GIJ A;  2IO1 B;  4RQ3 A;  5KFG A;  4KX6 B;  3RZW C;  2DQN B;  4MAC A;  3W1S A;  1Z4N A;  3C21 A;  3MC1 A;  1ZET A;  1JMS A;  4IRD A;  4RNA A;  4EUT A;  2BDU A;  1D9D A;  4DQI A;  3ISB A;  3H4B A;  2I5H A;  4J9R A;  4RGT A;  3VXW A;  1ZQT A;  4XWT A;  3IN5 A;  1WWU A;  4UAT A;  7ICJ A;  4F1S A;  1ISN A;  4PL1 A;  1L7M A;  4GN1 A;  1S8O A;  4QZA A;  2HTH A;  3FIL A;  3F5E A;  1UBQ A;  4RNM A;  4F5Q A;  2NRV A;  3PY8 A;  2NRX A;  4K3B A;  3V6E B;  2W9A A;  2D3A A;  1ZQZ A;  4GSW A;  3TEY A;  2O2V B;  2ZZP B;  1I4H A;  3JPP A;  5J2R A;  1SXE A;  1TJE A;  1J7A A;  3M9M B;  1EF5 A;  4HRO A;  2RDG A;  1JWM D;  4K7S A;  1XWL A;  2DZI A;  5C1Z A;  2F76 X;  2K89 A;  3UQ0 A;  3AH7 A;  4C00 A;  3DVN U;  4E0D A;  3K75 D;  4TQ1 A;  2C60 A;  2WXR A;  4RT2 A;  2AWT A;  3WK8 A;  2KD1 A;  1ZOL A;  3L10 B;  1KLG D;  4IRK A;  1XT9 B;  1YN3 A;  3OJ3 A;  4CYE A;  4BWJ A;  2R2Q A;  1HIW A;  2E8N A;  4PK1 A;  1ZQ1 C;  4KLU A;  2ZCB A;  4TUP A;  4A3O A;  1NK5 A;  1E8X A;  3A9J A;  1HQR D;  5KFK A;  3RH5 A;  3PX0 A;  1UNS A;  2LUE A;  5DQH A;  4KLJ A;  1J7B A;  3IG5 A;  4DCC A;  1P0R A;  3KHL A;  2C2E A;  4DOB A;  1FXI A;  4YMN A;  4N6E B;  1TS5 A;  4J9N A;  4JWS C;  4IL6 U;  2KFZ A;  1C4C A;  4QZH A;  2AGQ A;  1RG6 A;  2F77 X;  3M7D A;  2XCA A;  5TSS A;  1EU3 A;  4J9M A;  4TUR A;  3CNH A;  2BB5 A;  4EEK A;  3PRM B;  4PGQ A;  2IJ0 A;  4P7I A;  4XX5 A;  3WKD A;  4ZDV A;  3R7Q A;  3RR7 A;  2WF8 A;  1RM6 C;  4EZL A;  4ZHO A;  4KLL A;  3CST A;  4LNO A;  2LYA A;  2JYE A;  2KJ6 A;  1IGC A;  7ICN A;  4IRC A;  2D3C A;  4DL7 A;  2RDH A;  1SV0 C;  2W11 A;  3WU2 U;  2ZIW B;  4XWW A;  1Z1V A;  5HR7 A;  1U47 A;  1ZQH A;  2DZM A;  2WP9 B;  3WKA A;  4ANU A;  4KV2 A;  1RYR A;  7ICK A;  4W9F A;  4AP4 C;  4KMO B;  2KTQ A;  2I1J A;  2K3U A;  3H8W A;  3U52 E;  4CQN A;  3L08 A;  1PUT A;  4CF4 A;  2REX A;  2E1E A;  2MP2 A;  1V86 A;  2WNM A;  1JN3 A;  1MQ3 A;  8ICV A;  4NAM A;  2NBU A;  2ZG6 A;  1B22 A;  1E90 A;  4I2A A;  1TKY A;  2MBE A;  1ZRN A;  4ZHP A;  3SAG A;  1TYG B;  4HDO A;  4NY8 A;  5AI9 A;  4LJX A;  3N1Z C;  2YQE A;  4KX3 A;  4UB8 U;  4BXO A;  1LGR A;  3ZDD A;  3DWG C;  4URK A;  4GXJ A;  2A19 A;  1BNO A;  1QQ7 A;  1ZE3 D;  1SJH D;  3SV3 A;  3C5G A;  2KEY A;  3KHG A;  3V7J A;  2N9L A;  2L5Y A;  4A9A A;  2BYT A;  4FXC A;  5AKY A;  2UVU A;  1RFK A;  3AB5 A;  3RJF A;  2AH5 A;  2BBC A;  4US9 A;  2BGW A;  1QLB B;  2KMM A;  1UA1 A;  3DPD A;  5GMV A;  3PSP A;  2KOX A;  3QQ8 B;  1NK0 A;  2GBJ A;  2PTL A;  3KH0 A;  1SE2 A;  4YD2 A;  3Q3J A;  3SYZ A;  4ASW C;  5BMI A;  4MDK E;  3I1Y A;  4K4I A;  2HBK A;  2J6S A;  1GUA B;  4RFB A;  2D3D A;  4DK5 A;  2OH2 A;  2ASD A;  5IKC M;  2N9P C;  3Q8C A;  4B9K A;  4MT5 A;  5J2K A;  1FFV A;  5AIB A;  1JRO A;  2KZR A;  2ZCC A;  3AI5 A;  1WZ0 A;  1T94 A;  4OZC A;  4IC9 A;  2KKC A;  2WDR B;  4K1R B;  4YTP B;  3T9L A;  2XIC A;  1TVA A;  4Q43 A;  2UYZ B;  4YT0 B;  3ZNG C;  3AE5 B;  2J6T A;  3N1Y C;  4LNF A;  1XS9 D;  3A0B U;  2HJ8 A;  3OSN A;  4M02 A;  3M3J A;  2KFK B;  1TK8 A;  2BTE A;  1QQ5 A;  4JUZ A;  2DPI A;  2DLB A;  4ANW A;  1WYW B;  4C7Y A;  2UVW A;  3TAC B;  1XLN A;  2EZX A;  3KQ4 A;  4Q44 A;  4I2I A;  5BPC A;  2AQ4 A;  1KTK A;  1MC8 A;  4RH6 A;  3N9Y C;  4UB1 A;  1WRI A;  2XN9 C;  5KHQ A;  3KZI U;  4KLH A;  2VZK D;  1F0M A;  3V7L A;  2JWU A;  4FS1 A;  1X9S A;  2LJ5 A;  4OVU A;  4XGA B;  1EWC A;  5L1K A;  4HKQ A;  3QAR A;  4EX6 A;  1CZP A;  5BOL A;  2WYQ A;  3DBL I;  1WF9 A;  1R4N B;  5KG0 A;  4G9B A;  3PW7 A;  1K52 A;  2X8X X;  2KJ8 A;  1YMH E;  3OJ4 B;  4BZA A;  3AU5 A;  4Y2T A;  4O5K A;  3A4S C;  2BR0 A;  3M6K A;  2W7O A;  5CHG A;  2H3F A;  4HVB A;  4KKI A;  1IBX B;  1YQ4 B;  2PVO D;  3P63 A;  2KAJ A;  1NOM A;  1QQR A;  2K60 A;  1QSS A;  2FPL A;  2QAR A;  4EEN A;  1L7P A;  3I5J C;  4RT3 A;  3SFE B;  3OSP A;  2KSO A;  2EH9 A;  4AWJ A;  2VJ4 A;  3AEC B;  4CRX A;  4ECW A;  2HHT A;  1T3N A;  1NVI D;  3TMP B;  3BII D;  2JUO A;  1GO3 F;  4HLE A;  4X57 B;  3GZN B;  2PMZ C;  3SR6 A;  4GU2 A;  3GIL A;  2FMS A;  4NM2 A;  2YMM A;  4OJL A;  5KT5 A;  5DBA A;  5ALX A;  1KSP A;  2OJR A;  4O3Q A;  5D2M B;  1E7U A;  3B0Y A;  4DSJ A;  3RJI A;  4DL6 A;  5DKW A;  4RQ1 A;  4YN4 A;  4YMM A;  8ICE A;  1QZE A;  3T3O A;  4Z6E A;  3U4E G;  2G1E A;  3HW8 A;  1KLV A;  4HJG E;  4II2 B;  4EBD A;  4F50 A;  3WK6 A;  2LRW A;  3B08 A;  3B0A A;  4W9C A;  4L1B A;  5HI1 A;  5DB8 A;  3OG5 A;  7ICS A;  4IQT A;  2BYF A;  4EZK A;  3IAS 1;  4KLM A;  4ICU A;  1UWM A;  4I2E A;  1SBB B;  4B9U A;  3H40 A;  2KZM A;  1RZT A;  1DK2 A;  2A1J A;  3VCB A;  1LKY A;  4F7Z A;  1CMX B;  4ECY A;  1FM0 D;  3D32 A;  1S3S G;  4B9N A;  4UBC A;  2K4H A;  3W2D A;  3ZRF A;  2PVG C;  2ZNV C;  1V85 A;  1QIL A;  1ZP0 B;  2ASQ A;  3NS8 A;  3QU2 A;  2NCN A;  3TJP A;  3WK4 A;  4ECS A;  2LHE A;  2G06 A;  2BF8 B;  3DQV A;  3JSV A;  4UB5 A;  3MGI A;  2RQ5 A;  2IYD B;  1KEJ A;  2KYW A;  3D2Q A;  2ISO A;  4UQG A;  4ZRP A;  2H3Z A;  3IRU A;  5IAA C;  3BS7 A;  2W04 A;  2AQ3 B;  3TAQ A;  4DL4 A;  2H3Q A;  3VH3 B;  4F4X A;  3EZ5 A;  3VR8 B;  2W03 A;  4CDG A;  1L5U A;  2QMT A;  1Z1B A;  1C9F A;  5BYR A;  3QEA Z;  1LFD A;  3S2A A;  1UGJ A;  2C9W B;  3HHM A;  4FHK A;  3CRX A;  1NK4 A;  4WJQ A;  1D5M C;  1UF0 A;  1Z2M A;  1IUE A;  1D5Z C;  1KFD A;  3PO4 A;  3PLV A;  2K4E A;  4IM0 A;  1ZQS A;  3TFS A;  3DBR B;  1S0O A;  4N58 A;  2N7J A;  5J2G A;  3BQ0 A;  3GQC A;  3GOE A;  4OVZ A;  2KOB A;  1E0Z A;  2JVC A;  3DVN V;  4JGH B;  2KE7 A;  1LQB A;  1R4M B;  4QZF A;  1TK5 A;  4ZRQ A;  1ZQW A;  4M9G A;  2ZIV A;  3CSF A;  3PSI A;  2GH1 A;  3K4G A;  3G6X A;  2K8H A;  2LGD A;  4DXF A;  2JPH A;  3Q8M A;  1EM7 A;  3DEE A;  4B9M A;  4KLO A;  5LXI B;  4Y2R A;  7ICQ A;  1WJN A;  2CKH B;  2W9N A;  5KFE A;  1WJU A;  1YT3 A;  2IO3 B;  5KFS A;  4MFF A;  5FP0 A;  3RNG C;  1ZQU A;  4LNI A;  4DFJ A;  4QZ9 A;  4KTQ A;  2HD5 B;  1JXE A;  3BIN A;  1S9F A;  3K9O B;  1KJT A;  2HHS A;  4DQQ A;  1UT8 A;  1EU4 A;  2X38 A;  2K8C A;  4BKG A;  5EE3 A;  4DQR A;  5D3I B;  2RHF A;  1V1P A;  2XY7 A;  3Q8S B;  4IKG A;  2YY6 A;  9ICA A;  5C3J B;  4QZC A;  3ZKJ C;  3BYY B;  4DSL A;  1XXG A;  1Z00 B;  2R8H A;  1JWS D;  5L1J A;  1BUI C;  2NTT A;  3SQI A;  4P1B C;  2QIE B;  3AL0 B;  5EE1 A;  3TFR A;  2UU7 A;  4DHJ B;  2WQY B;  2AQ1 B;  4RF0 A;  4YSY B;  1C4A A;  3SAH A;  1FRD A;  2PFP A;  1VZ6 A;  5D46 A;  1SIJ A;  1B9R A;  3IG8 A;  4O5E A;  4HPP A;  3T3F A;  3KUD B;  3ML9 A;  1P3Q U;  2Z0E B;  4M00 A;  2BS2 B;  2XY5 A;  5CHW A;  3LDZ E;  1HZ5 A;  5CTR C;  3ORY A;  4Q45 A;  1FFU A;  4YWG G;  3BVZ A;  5EWE A;  4NLB A;  4EEY A;  1U48 A;  4YVZ A;  3PW2 A;  4O3M A;  4YXJ A;  2KT7 A;  1BPB A;  5HHI A;  4J9Q A;  2LXC A;  1WYG A;  7ICM A;  9ICL A;  1XSP A;  1OW5 A;  2KSO B;  2OJW A;  2OXO A;  4DO9 A;  2N1W A;  2QHO A;  2WS3 B;  9ICO A;  4HKZ E;  2V4R A;  1KFS A;  1E8Z A;  4F5R A;  2QAR B;  1TKD A;  3C19 A;  2JYT A;  4LCD E;  2GWS A;  3MGV A;  1PVP A;  1L3S A;  3Q6B A;  5FR6 A;  3RD2 A;  2F3N A;  4PHD A;  3R3M A;  2I1Q A;  1RYS A;  2MQJ A;  3AM9 A;  1U45 A;  4FAD A;  4CO7 A;  1P9D U;  2KVR A;  2MW5 A;  2KDE B;  3PVL A;  1QQ6 A;  1SB3 C;  1YD8 U;  1V5O A;  2G08 A;  4NWI A;  4WJO A;  9ICM A;  3WKC A;  4EE2 A;  2KDF B;  1WR6 E;  3AE9 B;  2BQR A;  3Q8R B;  2YTU A;  2AHO B;  2LVQ A;  2MJ3 A;  2RGF A;  1MN8 A;  4EOY A;  2LVP A;  4P6V F;  4I6L B;  1ZQI A;  3SAF A;  1XU4 A;  4X5V A;  7ICE A;  2D3G A;  3UI3 A;  5CX3 A;  2FE9 A;  2RDJ A;  3ETL A;  2KN5 A;  1VD2 A;  2O2V A;  1TIF A;  1U49 A;  3RJH A;  4JV0 A;  4O3P A;  4FFD A;  3VAW A;  4TQR A;  3DHI C;  2YML A;  5KFZ A;  4M8M A;  3QU5 A;  1XLP A;  3U26 A;  4GMV A;  5DCN A;  2HOQ A;  2FLP A;  1S0N A;  4RNN A;  4P4P A;  1VDV A;  5KG6 A;  5J0X A;  5ALY A;  3KTQ A;  2WXO A;  2ZVO A;  3SD5 A;  1V2Y A;  3MP9 A;  2MEK A;  3HM3 A; 
#chains in the Genus database with same CATH homology
 1CQV A;  2G9H D;  2KQ4 X;  1JML A;  2PLP A;  3AEF B;  2FE8 A;  2J4X A;  2ACZ B;  1TKG A;  1PYW D;  1N60 A;  4GLS C;  3DWM A;  2CJN A;  3HRD D;  3IXS A;  1XF5 L;  4H2A A;  2M19 A;  2N9K A;  4A55 A;  1GB1 A;  4OZA A;  1TS2 A;  3R8B A;  1RWS A;  3Q69 A;  1SXT A;  1ET6 A;  3P42 A;  1WXQ A;  1QF6 A;  2GI9 A;  2H89 B;  1FCC C;  2INN E;  2LGI A;  2OED A;  3KLS X;  5JXV A;  3BYT B;  5BYS A;  4B0M A;  1PFD A;  2EEL A;  1SJE D;  1MHH E;  4KX6 B;  4MAC A;  3W1S A;  5HHD G;  5HFY A;  3BK2 A;  4RNA A;  1L6V A;  1FO4 A;  4O1N A;  4N59 A;  3PZ8 A;  2J52 A;  4RGT A;  3ZJU A;  2MJE A;  3P1M A;  2W54 A;  1L0Y B;  4XWT A;  1P7E A;  2N0S B;  1P7F A;  1L5P A;  2WU2 B;  4P16 A;  3ETR A;  3P4Q B;  1JQ4 A;  1XLQ A;  3FIL A;  2J53 A;  3VRA B;  4ZOH C;  1TKE A;  3TEY A;  4NZL B;  1I4H A;  1STE A;  1TJE A;  1VZ8 A;  1J7A A;  2DYO A;  4C7Z A;  3MHZ A;  4HRO A;  2RDG A;  1VLB A;  1JWM D;  3AH7 A;  2WXI A;  4TQ1 A;  5AUK A;  2WXR A;  1OFF A;  1JAL A;  1I4Q A;  4IOI E;  4A90 A;  2JXT A;  1KLG D;  1YN3 A;  2WXN A;  2K5P A;  1FRR A;  1F77 A;  1VJK A;  1YQ3 B;  3T3N A;  3NRZ A;  5BMG A;  1HQR D;  3P4P B;  2HTM E;  4JWU C;  1UNS A;  4WAF A;  1J7B A;  2V3N A;  1NI3 A;  3EGR A;  4HRS A;  1FXI A;  3ZJV A;  4IDI A;  4N6E B;  1TS5 A;  1XEE A;  2JSV X;  1GAQ B;  3E56 A;  4JWS C;  3NVY A;  2WXP A;  1C4C A;  3CIR B;  1N61 A;  3AE7 B;  3AED B;  3LXF A;  1E9M A;  2KDM A;  1EU3 A;  3J9C A;  5TSS A;  3WCQ A;  1I4X A;  3B2G A;  2BB5 A;  2V4I B;  2IJ0 A;  1L0V B;  4Q2J A;  1B1Z A;  1OQR A;  3P4R B;  1D5X C;  1RM6 C;  3LYY A;  4ZHO A;  2JYE A;  3I57 A;  4GDK B;  1IGC A;  2RDH A;  4KGR A;  1M4V A;  4RCO A;  1ZUD 2;  2CU3 A;  1JRP A;  4KGS A;  3AV8 A;  5G5G A;  1I7H A;  4XWW A;  3Q8F A;  4MM3 B;  2WP9 B;  2WXQ A;  2K3U A;  3U52 E;  4CQN A;  1PUT A;  1TY2 A;  2PW9 A;  1ROE A;  1VRA B;  3AEB B;  2WNM A;  3MJ5 A;  4NAM A;  1TS4 A;  1A70 A;  1TS3 A;  2Y5C A;  5EE9 A;  2LMC A;  1TKY A;  3HVZ A;  4ZHP A;  1TYG B;  3U2S C;  2FBW B;  1FMA D;  4WH4 A;  1T6B X;  3NZ3 A;  2DWQ A;  1MPE A;  3DWG C;  3AEE B;  3AN1 A;  2K22 A;  3H8H A;  3ZYY X;  1ZOY B;  2QIL A;  1T5X D;  2BS4 B;  2W82 A;  1V8C A;  1ZE3 D;  2WXL A;  4MH8 A;  1BML C;  1SJH D;  1WWT A;  4WQM A;  1GOZ A;  3IAM 1;  2N9L A;  1I4G A;  4A9A A;  4AS1 A;  2BYT A;  4FXC A;  1RFK A;  3AB5 A;  4RGN A;  4UDU C;  1SEB D;  2BBC A;  1KFY B;  3TSS A;  4US9 A;  1QLB B;  2NTS A;  2KMM A;  1C79 A;  1Y56 A;  1YJI A;  5BMH A;  1GPX A;  4C56 C;  3URY A;  1LO5 D;  3MC0 B;  2ON8 A;  2PTL A;  3ZJT A;  2LEK A;  1SE2 A;  3VQI A;  1L0X B;  4L2Y A;  2PIA A;  1AW7 A;  1ENF A;  5BMI A;  2RPV A;  1UWX A;  1QOG A;  2IPK D;  2XNA C;  4JX1 C;  4RFB A;  4A6Q A;  1JWB D;  1PGX A;  3Q8C A;  4MT5 A;  2I38 A;  1DOX A;  1FFV A;  4LK0 M;  1JRO A;  2ICI A;  1HXY D;  4OZC A;  2WDR B;  2WU5 B;  2D5G A;  4PT5 A;  4YTP B;  1I4P A;  1SE4 A;  4YT0 B;  3AE5 B;  3W5U B;  3RFZ B;  2KWD A;  1QOB A;  2HDE A;  2Z8L A;  3BVM A;  3KWL A;  2WXM A;  1DYQ A;  2BTE A;  3ABV B;  2DLB A;  4C7Y A;  1Q10 A;  2M56 B;  1F2R C;  2LFI A;  1C4P A;  1XLN A;  4RF1 A;  2E6X A;  3KQ4 A;  1FD6 A;  2W55 A;  1AYF A;  1KTK A;  3SFD B;  1ZXH A;  3N9Y C;  4RH6 A;  2Q5W D;  1WRI A;  2XN9 C;  4USA A;  2VZK D;  2JWU A;  1V1P B;  5D7G A;  1EWC A;  2IGD A;  4HKQ A;  2MJD A;  4RGO S;  4D2K A;  1CZP A;  5AUI A;  2J42 A;  1SF0 A;  2Y3A A;  1D6E C;  3NS1 A;  4B0E A;  1K52 A;  1YNT E;  3LB8 C;  1YMH E;  3E9S A;  1DOI A;  3Q8E A;  3IT6 B;  2WXK A;  4LLG M;  4KKI A;  1IBX B;  1YQ4 B;  1C77 A;  2PVO D;  2Y5P A;  3P63 A;  1PDX A;  3VR9 B;  4A8X C;  1F0Z A;  1RYJ A;  2KAJ A;  1QQR A;  2TSS A;  4XDD A;  3ZGZ A;  3ZQ4 A;  3C8Y A;  1JWA D;  2WXG A;  3Q8A A;  3SFE B;  3BVG A;  3EA6 A;  5G5H A;  2EKI A;  4ARC A;  3AEC B;  1NVI D;  2LHD A;  3BII D;  3TEZ A;  1KRH A;  3FAH A;  1D4B A;  1EWY C;  3EUB 2;  3SR6 A;  2LUM A;  3W5V B;  4KGT A;  5FK9 C;  1MHX A;  1KF6 B;  3AEA B;  2WXF A;  2YEP F;  1WGK A;  2L1A A;  1ET9 A;  3T3O A;  1YJJ A;  3NVW A;  2G1E A;  3HVD A;  3U4E G;  5BYQ A;  4HJG E;  2KAC A;  4L1B A;  3BWU D;  2BT6 A;  4XDC A;  1HA5 A;  5HI1 A;  5MPO A;  3B2F A;  3IAS 1;  2BS3 B;  4TQ0 A;  1FIQ A;  2E3T A;  1UWM A;  2QJL A;  1SBB B;  3SEB A;  5HG2 A;  2I2Y A;  1YN5 A;  2H88 B;  1FM0 D;  1AWD A;  1V97 A;  3W2D A;  2MH7 A;  1N5W A;  2CJO A;  2PVG C;  1CJE A;  2YEP B;  2JU6 X;  1QIL A;  1ZP0 B;  4NJC A;  4JE3 B;  4RGM A;  1ZPS A;  2LHE A;  1C78 A;  3CWI A;  2R61 A;  2K0P A;  4ITK A;  1JW9 D;  1ZXI A;  1ACC A;  1VZ7 A;  1XCT L;  4C80 A;  1FCL A;  4AQ7 A;  2BB6 A;  1NEK B;  2JQR B;  4ZRP A;  1QOF A;  1N5X A;  2DYM A;  2SAK A;  2AQ3 B;  2PMV A;  3VR8 B;  1IGD A;  1PGA A;  3AE8 B;  2WXH A;  2QMT A;  1C9F A;  4YTM B;  1DGJ A;  4ZYS A;  5BYR A;  1KH0 A;  1UGJ A;  1ESF A;  2SEB D;  1NEN B;  3AEG B;  1D5M C;  3W9C B;  1IUE A;  1D5Z C;  5H8Y E;  2QSD A;  4N58 A;  2N7J A;  1K53 A;  4OVZ A;  3MFG A;  3TUO A;  2L32 A;  1E0Z A;  2KN4 A;  1KLU D;  3AE2 B;  1R7S A;  1XO3 A;  2GRI A;  4WUR A;  3TEX A;  5C2T B;  2ZW1 A;  3R2I A;  2WDV B;  2W3S A;  1V1O A;  4ZRQ A;  1CK1 A;  1DOY A;  5H92 C;  4DXF A;  3PZ7 A;  1EM7 A;  2IDY A;  1JWU D;  2VZK B;  2V3P A;  2IGH A;  1UUP A;  3AMZ A;  3NUH B;  1IBX A;  2JZP A;  3KWV A;  1F2R I;  3VRB B;  3OWE B;  1N62 A;  1FNU A;  2BW2 A;  4WIP A;  1WSP A;  1HEZ E;  4GDL B;  3GS2 A;  2INP E;  4TSS A;  1GB4 A;  1EU4 A;  2X38 A;  1ZDV A;  2RMM A;  1QOA A;  5EE3 A;  3NVV A;  5D3I B;  3BZD B;  1V1P A;  4NAW B;  4IKG A;  1K51 A;  2K9X A;  2JX5 A;  5C3J B;  3NVZ A;  3BYY B;  3FC4 A;  1XXG A;  4R3D A;  5T8I A;  1JWS D;  1BUI C;  2AQ2 B;  2NTT A;  3IT4 B;  5LNK 1;  4L23 A;  3RPF C;  4YTN B;  3V05 A;  1BXT A;  2QIE B;  4M0W A;  5EE1 A;  5I4D A;  2WQY B;  2AQ1 B;  1E7P B;  4RF0 A;  4JPS A;  4YSY B;  1C4A A;  1FRD A;  2OHF A;  2NMQ A;  1HZ6 A;  2B76 B;  3FIL B;  5FKA C;  4HEA 1;  1C76 A;  1VZ6 A;  4US8 A;  1SIJ A;  1B9R A;  1NYR A;  4KKJ A;  5FR3 A;  1FNW A;  1NYQ A;  2ZW0 A;  2BS2 B;  4OW0 A;  1L4Z B;  3O13 A;  1E6E B;  1HZ5 A;  1FFU A;  4YWG G;  3BVZ A;  3B9J A;  1QT9 A;  3I9V 1;  4YSZ B;  1PGB A;  3P4S B;  1WYG A;  1JCK B;  2WDQ B;  1MVK A;  2ONQ A;  5E6J A;  2WLB A;  2WS3 B;  2FUG 1;  4YSX B;  1T3Q A;  4HKZ E;  1L4D B;  2L52 A;  2LJI A;  2JYT A;  5EE0 A;  1SSN A;  1TY0 A;  1SE3 A;  1XCQ L;  1FEH A;  4ARI A;  1FXA A;  2L83 A;  5GXG B;  1I4R A;  3AM9 A;  1VR9 A;  1J7C A;  3GP7 A;  1ZDX A;  2WXJ A;  2M0A A;  2IGG A;  3HUI A;  1SB3 C;  1XLO A;  3U7Z A;  3L4P A;  1K50 A;  3AE3 B;  2V0G A;  4LTU A;  1OQQ A;  4EE2 A;  4WWM A;  3V3X A;  1FNV A;  3AE9 B;  4TMA B;  3AE4 B;  1L6U A;  2MJ3 A;  2PKO A;  2QEJ C;  4P6V F;  2DBY A;  3Q8B A;  3AE1 B;  3UI3 A;  3TEW A;  4YXD B;  3PO0 A;  3BK1 A;  4DXG A;  1N63 A;  1TZO A;  2GB1 A;  4OHJ A;  5D3D A;  4OZB A;  4REZ A;  1E10 A;  3R2T A;  4DQO C;  2W3R A;  1AN8 A;  1XLP A;  3GB1 A;  4XE0 A;  1MI0 A;  1YN4 A;  4J3O D;  1VDV A;  2WXO A;  1QKZ A;  3AE6 B;  3MP9 A;  2MEK A;  2AX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...