3NVXA

Molecular mechanism of guidance cue recognition
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
383
structure length
379
Chain Sequence
SIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLTNNNYITTSIKVKDTLVCGTNNGNPKCWKIDGSDDPKHRGRGYAPYQNSKVTIISYNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGLRGAFVDKDGTYDKVYILFTDTIGSKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSRTIKTDNDTILYVFFDSPYSKSALCTYSMNTIKQSFSTSKLEGYTKQLPSPAPGICLPAGKVVSHTTFEVIEKYNVLDDIIKPLSNQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENSIYSFDTKSKQTRSSQVDARLFSVMVTSKPLFIADIGIGVGMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
molecule keywords Protein A39
total genus 86
structure length 379
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvxA00
3PXSD 2AGLA 4KFMB 2UZYB 2CE9A 4O3TB 2I3TA 4HDJA 1SQ9A 5I5JA 3JRPA 2G9AA 3MZLA 5FKRA 3IIYA 4JSNC 4CI8A 3SCYA 5GXIA 4U7AA 3OKWA 4PNKB 1NEXB 3JPXA 4JT6C 2OVPB 4CZVA 2IUQA 5H17A 3OKTA 4FA4D 3NVNA 4CZXA 3JB9L 4CZYA 3SBPA 3A0FA 5THAA 4ZOVA 3MZKA 2BCJB 2P9KC 4CY1A 1P22A 3EWEA 4OZUA 4H5JA 3JZHA 2IWKA 2J56H 4PC0A 3OKYA 2H3XA 2J57G 3FRXA 3L4MD 4BH6A 3AL8B 5TF2A 2AGYA 5A2Qg 4CI3A 3UVMA 4LGNA 3RN1D 4ZOZA 3DM0A 4PXWA 5FA5B 2HJBA 3NVQA 2IWFA 5C2VB 3KRXB 4J8BA 4H5IA 4GQBB 2TRCB 5K1CC 1N6DA 3RSEC 3RMZD 4ZOYA 5AMSA 4QL1A 2XU7A 3SWSD 2AQ5A 4GGAA 2AH1A 3OW8A 3C99A 4FHLA 4X60B 3AL8A 3ZWLB 2H6QA 4L3GD 5FKQA 4O9DA 3SVWD 3UVLA 2YNPA 3UVKA 1GXRA 3SBQA 4X61B 2OK6A 5EMKB 2XL3A 1JOFA 3SLED 4ERYA 4ZN4A 5AFU3 2XYIA 5SXMA 3W15A 3VGZA 5FKSA 1K32A 5HE1B 4GM3A 3CIKB 5EARA 3UKRC 2I0SA 4J84A 5IGQA 3I2NA 3L4OD 4JD2C 3F3PA 3I8EA 4AEZA 5I5MA 2PM7B 4GZ8A 4PSXB 3SFZA 1Q47A 1QNIA 4CY5A 3SN6B 3V7DB 4PBZA 1XKSA 4I79A 5EAMA 3PSCB 3F3GA 1RI6A 4MK0B 4N14A 4A2MA 4A08B 1B9XA 1VYHC 2Z2OA 2OIZA 4R7AB 2GC4A 2P9NC 2IURA 3AL9A 5B4WA 4FA1D 2EBSA 4J87A 3EI1B 3EI3A 4A0AB 3IJ1A 3IJCA 2H14A 2H9MA 5IC7A 3KRWB 4EWRA 4E54A 5CYKA 2P9PC 3MMYA 4G56B 2P9UC 3I89A 2J55H 3EI4A 2CE8A 3UVOA 5HYNB 2CO0A 2QXVA 4UI9R 1PGUA 3EG6A 5EALA 5IT9g 1NR0A 3VA6A 1XHMA 2AGZA 3I8CA 4ESGA 3EI1A 4J73A 4FB1D 5EAPA 1PEVA 3J80g 2MTAH 5CYKB 3SJLD 3ULEC 5GMKn 4A08A 5CXCA 3GFCA 3DXKC 3MXXA 3I7HA 3K27A 2HESX 1U2VC 3CFSB 3DWLC 4NSXA 4A0AA 2GC7A 3NVXA 4A0BB 5I5IA 5FLXg 2OVQB 4O45A 1L0QA 4K3ID 5CXBB 2Z2PA 4JXMA 4IMMA 3I7OA 3I7NA 1OLZA 2CO0C 3F3FA 5C2WB 2G99A 3FM0A 4L9OA 2H9PA 4J86A 5EM2B 3C75H 3PVWB 4XYIA 2AH0A 4A0BA 4Y5RD 3JROA 3I7LA 4J8GA 3EI4B 3I7PA 3MKQA 4D6VA 3I7KA 1A0RB 4GMBA 3OL2B 2CN3A 5JWZA 4A2LA 4GGCA 2I3SA 4BL0A 2H6NA 4QQEA 4FA5D 3VH0A 4L1QD 2PBIB 4OWRA 3U4YA 5GXHA 2AGXA 4X3EA 3K26A 2H47A 1R5MA 4D0KA 3FGBA 3MKSB 2XL2A 3OKYB 4PBYA 2I0RA 3RRMC 1GOTB 4J78A 1K8KC 5EMMB 3N0DA 4XYHA 1JMZB 3RFHA 4FAVD 5HE0B 4GQ2P 2H6KA 1GG2B 1YFQA 3P4FA 4JT5C 4A7JA 4CI1A 4QRJA 1TBGA 3OL2A 3CFVA 5GSAA 4BUJC 2PM9A 4PSWB 4GM9A 2HKMA 2P9SC 3SMRA 4LG8A 4J79A 2BBKH 4O3UB 3RLMD 3HFQA 2IUPA 4E5ZB 4ES0A 3OTTA 1OMWB 2H13A 5FXYA 3DSMA 2Z2NA 5H1MA 1B9YA 3SBRA 2HJ4A 5HQGA 3AH8B 3N0EA 4K3JB 4XEIC 3JZGA 3PSLA 3DXMC 2H9NA 2OK4A 1JMXB 5EMJB 4J81A 2YNNA 3E0CA 5CXCB 3RN0D 4A09A 4GGDA 2PM9B 2P9LC 3ORVD 3EI2A 3PE7A 4ERQA 5HE3B 1MG3A 4CY3A 3EU7A 1PI6A 4A11A 4FA9D 5HE2B 4QT8A 2YB8B 5K19A 1MDAH 5EMLB 3UKUC 3EMHA 4FAND 2YMUA 5IJ8E 5KDOB 2HYEA 4CC9A 4CI2A 2H68A 3EI2B 2YBAA 1JJUB 2I0TA 1U4CA 4GQ1A 3UVNA 1S4UX 3AFCA 3ODTA 3UR4A 5CXBA 2UZXB 4JSXC 3C5MA 1XIPA 4J0XA 3J81g 3IKOA 2H9LA 4L3HD 5TEEA 3EI3B 4LG9A 3RFGA 2IUVA 2HKRA 5EM2A 3JAMg 4ERZA 4U1EI 2AGWA 4J77A 4YVDA 3BWSA 3SXTD 3V5WB 3PXWD 4E54B 1ERJA 1MG2A 1GP2B 4GM8A 4J82A 5TDHB 4CY2A 4Z8LA 3IIWA 3GREA 5C9ZB 3PXTD 4A11B 3B7FA 2B5MA 2GNQA 4E5ZA 2PM6B 4ZOXA 3JZNA 2HXCA 3SHFA 5H14A 2OJYA 3C9CA 3BG0A 2YNOA 2O9KA 1N6EA 4IA9A 1PBYB 4X63B 2CNXA 3PVUB 1SHYB 2OVRB 5TEFA 1SQJA 2Q7QA 1TYQC 4JSPC 4TZ4A 5FKTA 2QC5A 2CN2A 4FWWA 4O1QD 2IAAA 2W18A 2B5LA 5IJ7E 2B5NA 3IJ0A 4A09B 4Y7RA 4AOWA 1N6FA 4JSVC 1FWXA 5FQDA 5IGOA 5AJAA 3BG1A 3V9FA 2P9IC 4J0WA 2B4EA
chains in the Genus database with same CATH superfamily
4D9SA 3PXSD 2AGLA 5C86A 4KFMB 2UZYB 3EQ7A 2CE9A 2I3TA 4HDJA 4O3TB 1SQ9A 5I5JA 1O6GA 3JRPA 2G9AA 3MZLA 5FKRA 3IIYA 4JSNC 4CI8A 3SCYA 5GXIA 4U7AA 3OKWA 4PNKB 1I2MB 1NEXB 3ZDYA 3JPXA 1VZ3A 4JT6C 3IUNA 2OVPB 4CZVA 2EICA 2IUQA 5M5SA 5H17A 1M1XA 3OKTA 4FA4D 3NVNA 4CZXA 3JB9L 1H2ZA 4CZYA 3SBPA 3A0FA 5THAA 4ZOVA 3MZKA 2BCJB 2P9KC 4NC4A 1P22A 3EWEA 4CY1A 4OZUA 4H5JA 5M5RA 4BCCA 3JZHA 2IWKA 2J56H 3K71A 4PC0A 3OKYA 2H3XA 2J57G 3FRXA 3L4MD 4BH6A 4UM8A 3AL8B 3ZDXA 1JTDB 5TF2A 2AGYA 5A2Qg 2VDMA 4CI3A 2VZ3A 3UVMA 5M5TA 4LGNA 3RN1D 4ZOZA 3DM0A 4PXWA 5FA5B 2HJBA 3NVQA 4WJKA 2IWFA 1VZ2A 5C2VB 3KRXB 4J8BA 4H5IA 3O4HA 4GQBB 2TRCB 5K1CC 1N6DA 3RSEC 3NIDA 1H2XA 3RMZD 1UOQA 2HU7A 4G55A 4ZOYA 4JHNA 3MUOA 5AMSA 4QL1A 2XU7A 3SWSD 2AQ5A 4GGAA 2AH1A 3OW8A 3C99A 2WQ8A 1C9LA 4FHLA 3O4JA 4X60B 3AL8A 3ZWLB 2H6QA 4L3GD 5FKQA 4O9DA 3SVWD 3UVLA 2YNPA 3UVKA 4O02A 3V4PA 1GXRA 3SBQA 2VDKA 5E6SA 4X61B 2OK6A 5EMKB 2XL3A 1JOFA 3SLED 4ERYA 4ZN4A 5AFU3 4RE5A 2XYIA 5SXMA 3W15A 4AN0A 2XDWA 3VGZA 5FKSA 3VI3A 1K32A 5HE1B 4GM3A 3CIKB 2VDOA 5EARA 3EQ9A 3UKRC 4AMZA 2I0SA 1GOFA 4J84A 5IGQA 3I2NA 3T3PA 2EIEA 3L4OD 4JD2C 4WK4A 3F3PA 3I8EA 4AEZA 5I5MA 2PM7B 4GZ8A 4PSXB 3SFZA 3ZE0A 3IUQA 1Q47A 3ZDZA 2VZ1A 1QNIA 3IUMA 4CY5A 3SN6B 3V7DB 4PBZA 5E6RA 1XKSA 4Z7NA 4G1EA 4I79A 5EAMA 3PSCB 3F3GA 1RI6A 4MK0B 4N14A 4A2MA 4A08B 1B9XA 1VYHC 2Z2OA 2OIZA 2GC4A 4R7AB 2P9NC 2IURA 3AL9A 5B4WA 4FA1D 2EBSA 4J87A 3EI1B 3EI3A 4A0AB 5FFOA 3IJ1A 3IJCA 2H14A 2HU8A 2H9MA 5IC7A 3KRWB 4EWRA 4E54A 2QZPA 1QFSA 2EIDA 5CYKA 2P9PC 3MMYA 4G56B 2P9UC 3I89A 2J55H 3EI4A 2CE8A 3UVOA 5HYNB 2CO0A 5C92A 2QXVA 4UI9R 1PGUA 3EG6A 5EALA 1TYEA 5IT9g 1NR0A 3VA6A 1XHMA 2QR5A 2AGZA 3I8CA 4ESGA 3EI1A 4J73A 4FB1D 5EAPA 1PEVA 3J80g 2MTAH 4DNUA 1T2XA 5CYKB 3SJLD 3ULEC 5GMKn 4A08A 5CXCA 3GFCA 3DXKC 3MXXA 3I7HA 3K27A 2EIBA 2HESX 1U2VC 3CFSB 4L1MA 3DWLC 4NSXA 2VDQA 4A0AA 1E8MA 2GC7A 1H2YA 3NVXA 5M5VA 4A0BB 5I5IA 5FLXg 2BKLA 2OVQB 4O45A 1L0QA 3OF7A 4K3ID 5CXBB 2Z2PA 4JXMA 4IMMA 4Z7OA 4NENA 3ZE1A 1E8NA 3I7OA 3I7NA 1OLZA 4MMYA 2CO0C 3F3FA 5C2WB 2G99A 3FM0A 4MMXA 4L9OA 5HDBA 2H9PA 4J86A 1YR2A 5EM2B 3C75H 3PVWB 4XYIA 2AH0A 4A0BA 1GOGA 4Y5RD 3JROA 3I7LA 4J8GA 3EI4B 3I7PA 3MKQA 4D6VA 3I7KA 1A0RB 4BP8A 4GMBA 4WK2A 3OL2B 2CN3A 4G1MA 5JWZA 4A2LA 4GGCA 2I3SA 4BL0A 2H6NA 4QQEA 4FA5D 3VH0A 4L1QD 2VDLA 2PBIB 3IJEA 4OWRA 3U4YA 1H2WA 5GXHA 4DNWA 4NBMA 3V4VA 1C9IA 2AGXA 4X3EA 3K26A 2H47A 1R5MA 4AN1A 4D0KA 3FGBA 3MKSB 1QFMA 2XL2A 3OKYB 4PBYA 2I0RA 3RRMC 1GOTB 4J78A 1K8KC 3GD1I 5EMMB 3N0DA 4XYHA 1JMZB 3EQ8A 4Z7QA 3RFHA 4FAVD 3K72A 5HE0B 4GQ2P 2H6KA 1GG2B 1L5GA 1YFQA 2XE4A 3P4FA 3ZE2A 4JT5C 4A7JA 4CI1A 4QRJA 1BPOA 1TBGA 3QI0A 3OL2A 5E6UA 3CFVA 5M5UA 5GSAA 3MVDK 4BUJC 2PM9A 4PSWB 4GM9A 2HKMA 2P9SC 3SMRA 4LG8A 4J79A 2BBKH 4O3UB 3RLMD 3HFQA 2IUPA 4E5ZB 4ES0A 3OTTA 1OMWB 2H13A 5FXYA 3DSMA 2Z2NA 5H1MA 1B9YA 3SBRA 2HJ4A 5HQGA 3AH8B 3N0EA 4K3JB 4XEIC 1K3IA 1UTCA 3JZGA 1O6FA 3PSLA 3DXMC 2H9NA 2OK4A 1JMXB 3DDUA 5EMJB 4J81A 2YNNA 3E0CA 5CXCB 3RN0D 3KCIA 2VDPA 3FCSA 4A09A 4GGDA 2PM9B 2P9LC 3ORVD 3MUNA 3EI2A 3PE7A 4ERQA 4O2WA 5HE3B 1MG3A 4BCDA 4CY3A 3VI4A 3EU7A 1VE6A 1PI6A 4A11A 3IULA 4FA9D 5HE2B 4QT8A 2YB8B 5K19A 1A12A 3O4GA 1MDAH 5EMLB 3UKUC 3EMHA 2XZGA 4FAND 2YMUA 5IJ8E 5KDOB 2HYEA 4CC9A 4CI2A 4AX4A 3K6SA 2H68A 3EI2B 2YBAA 1JJUB 2I0TA 1U4CA 4GQ1A 3UVNA 1S4UX 3IVMA 3AFCA 3ODTA 3QHYB 3UR4A 5CXBA 2UZXB 4JSXC 3C5MA 1XIPA 1E5TA 1UOOA 4J0XA 3J81g 3IKOA 3IUJA 1UOPA 2H9LA 4L3HD 5TEEA 2JKXA 3EI3B 4LG9A 3RFGA 2IUVA 2HKRA 3NIGA 5EM2A 3JAMg 4ERZA 4U1EI 4WK0A 2AGWA 4J77A 1U8CA 3NIFA 1VE7A 4YVDA 3BWSA 3SXTD 3V5WB 3PXWD 4E54B 1ERJA 4RE6A 1MG2A 5FFGA 1GP2B 4GM8A 4J82A 5M61A 3FCUA 5TDHB 4NAAA 2HU5A 4CY2A 4Z8LA 3IIWA 3GREA 5C9ZB 4AMYA 3PXTD 4A11B 2VDRA 3B7FA 3IURA 1JV2A 2B5MA 3O4IA 2GNQA 4E5ZA 2PM6B 4ZOXA 3JZNA 2HXCA 3SHFA 5H14A 2OJYA 3C9CA 1GOHA 3BG0A 2YNOA 2O9KA 1N6EA 4IA9A 1PBYB 4X63B 2CNXA 3PVUB 4BCBA 1SHYB 2OVRB 5TEFA 4BP9A 1SQJA 2Q7QA 1TYQC 4JSPC 4TZ4A 5FKTA 2VC2A 3GC3B 4DNVA 4UM9A 2QC5A 2CN2A 4FWWA 4O1QD 2IAAA 2W18A 4MMZA 3T3MA 2B5LA 5IJ7E 2B5NA 3IJ0A 4A09B 4Y7RA 4AOWA 1N6FA 4JSVC 1FWXA 4JHPC 5FQDA 5IGOA 2VDNA 4IRZA 5AJAA 3BG1A 3V9FA 2P9IC 4J0WA 4QAMA 2B4EA
chains in the Genus database with same CATH topology
3PXSD 2AGLA 4KFMB 2UZYB 2CE9A 4O3TB 2I3TA 4HDJA 1SQ9A 5I5JA 3JRPA 2G9AA 3MZLA 5FKRA 3IIYA 4JSNC 4CI8A 3SCYA 5GXIA 4U7AA 3OKWA 4PNKB 1NEXB 3JPXA 4JT6C 2OVPB 4CZVA 2IUQA 5H17A 3OKTA 4FA4D 3NVNA 4CZXA 3JB9L 4CZYA 3SBPA 3A0FA 5THAA 4ZOVA 3MZKA 2BCJB 2P9KC 4CY1A 1P22A 3EWEA 4OZUA 4H5JA 3JZHA 2IWKA 2J56H 4PC0A 3OKYA 2H3XA 2J57G 3FRXA 3L4MD 4BH6A 3AL8B 5TF2A 2AGYA 5A2Qg 4CI3A 3UVMA 4LGNA 3RN1D 4ZOZA 3DM0A 4PXWA 5FA5B 2HJBA 3NVQA 2IWFA 5C2VB 3KRXB 4J8BA 4H5IA 4GQBB 2TRCB 5K1CC 1N6DA 3RSEC 3RMZD 4ZOYA 5AMSA 4QL1A 2XU7A 3SWSD 2AQ5A 4GGAA 2AH1A 3OW8A 3C99A 4FHLA 4X60B 3AL8A 3ZWLB 2H6QA 4L3GD 5FKQA 4O9DA 3SVWD 3UVLA 2YNPA 3UVKA 1GXRA 3SBQA 4X61B 2OK6A 5EMKB 2XL3A 1JOFA 3SLED 4ERYA 4ZN4A 5AFU3 2XYIA 5SXMA 3W15A 3VGZA 5FKSA 1K32A 5HE1B 4GM3A 3CIKB 5EARA 3UKRC 2I0SA 4J84A 5IGQA 3I2NA 3L4OD 4JD2C 3F3PA 3I8EA 4AEZA 5I5MA 2PM7B 4GZ8A 4PSXB 3SFZA 1Q47A 1QNIA 4CY5A 3SN6B 3V7DB 4PBZA 1XKSA 4I79A 5EAMA 3PSCB 3F3GA 1RI6A 4MK0B 4N14A 4A2MA 4A08B 1B9XA 1VYHC 2Z2OA 2OIZA 4R7AB 2GC4A 2P9NC 2IURA 3AL9A 5B4WA 4FA1D 2EBSA 4J87A 3EI1B 3EI3A 4A0AB 3IJ1A 3IJCA 2H14A 2H9MA 5IC7A 3KRWB 4EWRA 4E54A 5CYKA 2P9PC 3MMYA 4G56B 2P9UC 3I89A 2J55H 3EI4A 2CE8A 3UVOA 5HYNB 2CO0A 2QXVA 4UI9R 1PGUA 3EG6A 5EALA 5IT9g 1NR0A 3VA6A 1XHMA 2AGZA 3I8CA 4ESGA 3EI1A 4J73A 4FB1D 5EAPA 1PEVA 3J80g 2MTAH 5CYKB 3SJLD 3ULEC 5GMKn 4A08A 5CXCA 3GFCA 3DXKC 3MXXA 3I7HA 3K27A 2HESX 1U2VC 3CFSB 3DWLC 4NSXA 4A0AA 2GC7A 3NVXA 4A0BB 5I5IA 5FLXg 2OVQB 4O45A 1L0QA 4K3ID 5CXBB 2Z2PA 4JXMA 4IMMA 3I7OA 3I7NA 1OLZA 2CO0C 3F3FA 5C2WB 2G99A 3FM0A 4L9OA 2H9PA 4J86A 5EM2B 3C75H 3PVWB 4XYIA 2AH0A 4A0BA 4Y5RD 3JROA 3I7LA 4J8GA 3EI4B 3I7PA 3MKQA 4D6VA 3I7KA 1A0RB 4GMBA 3OL2B 2CN3A 5JWZA 4A2LA 4GGCA 2I3SA 4BL0A 2H6NA 4QQEA 4FA5D 3VH0A 4L1QD 2PBIB 4OWRA 3U4YA 5GXHA 2AGXA 4X3EA 3K26A 2H47A 1R5MA 4D0KA 3FGBA 3MKSB 2XL2A 3OKYB 4PBYA 2I0RA 3RRMC 1GOTB 4J78A 1K8KC 5EMMB 3N0DA 4XYHA 1JMZB 3RFHA 4FAVD 5HE0B 4GQ2P 2H6KA 1GG2B 1YFQA 3P4FA 4JT5C 4A7JA 4CI1A 4QRJA 1TBGA 3OL2A 3CFVA 5GSAA 4BUJC 2PM9A 4PSWB 4GM9A 2HKMA 2P9SC 3SMRA 4LG8A 4J79A 2BBKH 4O3UB 3RLMD 3HFQA 2IUPA 4E5ZB 4ES0A 3OTTA 1OMWB 2H13A 5FXYA 3DSMA 2Z2NA 5H1MA 1B9YA 3SBRA 2HJ4A 5HQGA 3AH8B 3N0EA 4K3JB 4XEIC 3JZGA 3PSLA 3DXMC 2H9NA 2OK4A 1JMXB 5EMJB 4J81A 2YNNA 3E0CA 5CXCB 3RN0D 4A09A 4GGDA 2PM9B 2P9LC 3ORVD 3EI2A 3PE7A 4ERQA 5HE3B 1MG3A 4CY3A 3EU7A 1PI6A 4A11A 4FA9D 5HE2B 4QT8A 2YB8B 5K19A 1MDAH 5EMLB 3UKUC 3EMHA 4FAND 2YMUA 5IJ8E 5KDOB 2HYEA 4CC9A 4CI2A 2H68A 3EI2B 2YBAA 1JJUB 2I0TA 1U4CA 4GQ1A 3UVNA 1S4UX 3AFCA 3ODTA 3UR4A 5CXBA 2UZXB 4JSXC 3C5MA 1XIPA 4J0XA 3J81g 3IKOA 2H9LA 4L3HD 5TEEA 3EI3B 4LG9A 3RFGA 2IUVA 2HKRA 5EM2A 3JAMg 4ERZA 4U1EI 2AGWA 4J77A 4YVDA 3BWSA 3SXTD 3V5WB 3PXWD 4E54B 1ERJA 1MG2A 1GP2B 4GM8A 4J82A 5TDHB 4CY2A 4Z8LA 3IIWA 3GREA 5C9ZB 3PXTD 4A11B 3B7FA 2B5MA 2GNQA 4E5ZA 2PM6B 4ZOXA 3JZNA 2HXCA 3SHFA 5H14A 2OJYA 3C9CA 3BG0A 2YNOA 2O9KA 1N6EA 4IA9A 1PBYB 4X63B 2CNXA 3PVUB 1SHYB 2OVRB 5TEFA 1SQJA 2Q7QA 1TYQC 4JSPC 4TZ4A 5FKTA 2QC5A 2CN2A 4FWWA 4O1QD 2IAAA 2W18A 2B5LA 5IJ7E 2B5NA 3IJ0A 4A09B 4Y7RA 4AOWA 1N6FA 4JSVC 1FWXA 5FQDA 5IGOA 5AJAA 3BG1A 3V9FA 2P9IC 4J0WA 2B4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXS D;  2AGL A;  4KFM B;  2UZY B;  2CE9 A;  4O3T B;  2I3T A;  4HDJ A;  1SQ9 A;  5I5J A;  3JRP A;  2G9A A;  3MZL A;  5FKR A;  3IIY A;  4JSN C;  4CI8 A;  3SCY A;  5GXI A;  4U7A A;  3OKW A;  4PNK B;  1NEX B;  3JPX A;  4JT6 C;  2OVP B;  4CZV A;  2IUQ A;  5H17 A;  3OKT A;  4FA4 D;  3NVN A;  4CZX A;  3JB9 L;  4CZY A;  3SBP A;  3A0F A;  5THA A;  4ZOV A;  3MZK A;  2BCJ B;  2P9K C;  4CY1 A;  1P22 A;  3EWE A;  4OZU A;  4H5J A;  3JZH A;  2IWK A;  2J56 H;  4PC0 A;  3OKY A;  2H3X A;  2J57 G;  3FRX A;  3L4M D;  4BH6 A;  3AL8 B;  5TF2 A;  2AGY A;  5A2Q g;  4CI3 A;  3UVM A;  4LGN A;  3RN1 D;  4ZOZ A;  3DM0 A;  4PXW A;  5FA5 B;  2HJB A;  3NVQ A;  2IWF A;  5C2V B;  3KRX B;  4J8B A;  4H5I A;  4GQB B;  2TRC B;  5K1C C;  1N6D A;  3RSE C;  3RMZ D;  4ZOY A;  5AMS A;  4QL1 A;  2XU7 A;  3SWS D;  2AQ5 A;  4GGA A;  2AH1 A;  3OW8 A;  3C99 A;  4FHL A;  4X60 B;  3AL8 A;  3ZWL B;  2H6Q A;  4L3G D;  5FKQ A;  4O9D A;  3SVW D;  3UVL A;  2YNP A;  3UVK A;  1GXR A;  3SBQ A;  4X61 B;  2OK6 A;  5EMK B;  2XL3 A;  1JOF A;  3SLE D;  4ERY A;  4ZN4 A;  5AFU 3;  2XYI A;  5SXM A;  3W15 A;  3VGZ A;  5FKS A;  1K32 A;  5HE1 B;  4GM3 A;  3CIK B;  5EAR A;  3UKR C;  2I0S A;  4J84 A;  5IGQ A;  3I2N A;  3L4O D;  4JD2 C;  3F3P A;  3I8E A;  4AEZ A;  5I5M A;  2PM7 B;  4GZ8 A;  4PSX B;  3SFZ A;  1Q47 A;  1QNI A;  4CY5 A;  3SN6 B;  3V7D B;  4PBZ A;  1XKS A;  4I79 A;  5EAM A;  3PSC B;  3F3G A;  1RI6 A;  4MK0 B;  4N14 A;  4A2M A;  4A08 B;  1B9X A;  1VYH C;  2Z2O A;  2OIZ A;  4R7A B;  2GC4 A;  2P9N C;  2IUR A;  3AL9 A;  5B4W A;  4FA1 D;  2EBS A;  4J87 A;  3EI1 B;  3EI3 A;  4A0A B;  3IJ1 A;  3IJC A;  2H14 A;  2H9M A;  5IC7 A;  3KRW B;  4EWR A;  4E54 A;  5CYK A;  2P9P C;  3MMY A;  4G56 B;  2P9U C;  3I89 A;  2J55 H;  3EI4 A;  2CE8 A;  3UVO A;  5HYN B;  2CO0 A;  2QXV A;  4UI9 R;  1PGU A;  3EG6 A;  5EAL A;  5IT9 g;  1NR0 A;  3VA6 A;  1XHM A;  2AGZ A;  3I8C A;  4ESG A;  3EI1 A;  4J73 A;  4FB1 D;  5EAP A;  1PEV A;  3J80 g;  2MTA H;  5CYK B;  3SJL D;  3ULE C;  5GMK n;  4A08 A;  5CXC A;  3GFC A;  3DXK C;  3MXX A;  3I7H A;  3K27 A;  2HES X;  1U2V C;  3CFS B;  3DWL C;  4NSX A;  4A0A A;  2GC7 A;  3NVX A;  4A0B B;  5I5I A;  5FLX g;  2OVQ B;  4O45 A;  1L0Q A;  4K3I D;  5CXB B;  2Z2P A;  4JXM A;  4IMM A;  3I7O A;  3I7N A;  1OLZ A;  2CO0 C;  3F3F A;  5C2W B;  2G99 A;  3FM0 A;  4L9O A;  2H9P A;  4J86 A;  5EM2 B;  3C75 H;  3PVW B;  4XYI A;  2AH0 A;  4A0B A;  4Y5R D;  3JRO A;  3I7L A;  4J8G A;  3EI4 B;  3I7P A;  3MKQ A;  4D6V A;  3I7K A;  1A0R B;  4GMB A;  3OL2 B;  2CN3 A;  5JWZ A;  4A2L A;  4GGC A;  2I3S A;  4BL0 A;  2H6N A;  4QQE A;  4FA5 D;  3VH0 A;  4L1Q D;  2PBI B;  4OWR A;  3U4Y A;  5GXH A;  2AGX A;  4X3E A;  3K26 A;  2H47 A;  1R5M A;  4D0K A;  3FGB A;  3MKS B;  2XL2 A;  3OKY B;  4PBY A;  2I0R A;  3RRM C;  1GOT B;  4J78 A;  1K8K C;  5EMM B;  3N0D A;  4XYH A;  1JMZ B;  3RFH A;  4FAV D;  5HE0 B;  4GQ2 P;  2H6K A;  1GG2 B;  1YFQ A;  3P4F A;  4JT5 C;  4A7J A;  4CI1 A;  4QRJ A;  1TBG A;  3OL2 A;  3CFV A;  5GSA A;  4BUJ C;  2PM9 A;  4PSW B;  4GM9 A;  2HKM A;  2P9S C;  3SMR A;  4LG8 A;  4J79 A;  2BBK H;  4O3U B;  3RLM D;  3HFQ A;  2IUP A;  4E5Z B;  4ES0 A;  3OTT A;  1OMW B;  2H13 A;  5FXY A;  3DSM A;  2Z2N A;  5H1M A;  1B9Y A;  3SBR A;  2HJ4 A;  5HQG A;  3AH8 B;  3N0E A;  4K3J B;  4XEI C;  3JZG A;  3PSL A;  3DXM C;  2H9N A;  2OK4 A;  1JMX B;  5EMJ B;  4J81 A;  2YNN A;  3E0C A;  5CXC B;  3RN0 D;  4A09 A;  4GGD A;  2PM9 B;  2P9L C;  3ORV D;  3EI2 A;  3PE7 A;  4ERQ A;  5HE3 B;  1MG3 A;  4CY3 A;  3EU7 A;  1PI6 A;  4A11 A;  4FA9 D;  5HE2 B;  4QT8 A;  2YB8 B;  5K19 A;  1MDA H;  5EML B;  3UKU C;  3EMH A;  4FAN D;  2YMU A;  5IJ8 E;  5KDO B;  2HYE A;  4CC9 A;  4CI2 A;  2H68 A;  3EI2 B;  2YBA A;  1JJU B;  2I0T A;  1U4C A;  4GQ1 A;  3UVN A;  1S4U X;  3AFC A;  3ODT A;  3UR4 A;  5CXB A;  2UZX B;  4JSX C;  3C5M A;  1XIP A;  4J0X A;  3J81 g;  3IKO A;  2H9L A;  4L3H D;  5TEE A;  3EI3 B;  4LG9 A;  3RFG A;  2IUV A;  2HKR A;  5EM2 A;  3JAM g;  4ERZ A;  4U1E I;  2AGW A;  4J77 A;  4YVD A;  3BWS A;  3SXT D;  3V5W B;  3PXW D;  4E54 B;  1ERJ A;  1MG2 A;  1GP2 B;  4GM8 A;  4J82 A;  5TDH B;  4CY2 A;  4Z8L A;  3IIW A;  3GRE A;  5C9Z B;  3PXT D;  4A11 B;  3B7F A;  2B5M A;  2GNQ A;  4E5Z A;  2PM6 B;  4ZOX A;  3JZN A;  2HXC A;  3SHF A;  5H14 A;  2OJY A;  3C9C A;  3BG0 A;  2YNO A;  2O9K A;  1N6E A;  4IA9 A;  1PBY B;  4X63 B;  2CNX A;  3PVU B;  1SHY B;  2OVR B;  5TEF A;  1SQJ A;  2Q7Q A;  1TYQ C;  4JSP C;  4TZ4 A;  5FKT A;  2QC5 A;  2CN2 A;  4FWW A;  4O1Q D;  2IAA A;  2W18 A;  2B5L A;  5IJ7 E;  2B5N A;  3IJ0 A;  4A09 B;  4Y7R A;  4AOW A;  1N6F A;  4JSV C;  1FWX A;  5FQD A;  5IGO A;  5AJA A;  3BG1 A;  3V9F A;  2P9I C;  4J0W A;  2B4E A; 
#chains in the Genus database with same CATH topology
 4D9S A;  3PXS D;  2AGL A;  5C86 A;  4KFM B;  2UZY B;  3EQ7 A;  2CE9 A;  2I3T A;  4HDJ A;  4O3T B;  1SQ9 A;  5I5J A;  1O6G A;  3JRP A;  2G9A A;  3MZL A;  5FKR A;  3IIY A;  4JSN C;  4CI8 A;  3SCY A;  5GXI A;  4U7A A;  3OKW A;  4PNK B;  1I2M B;  1NEX B;  3ZDY A;  3JPX A;  1VZ3 A;  4JT6 C;  3IUN A;  2OVP B;  4CZV A;  2EIC A;  2IUQ A;  5M5S A;  5H17 A;  1M1X A;  3OKT A;  4FA4 D;  3NVN A;  4CZX A;  3JB9 L;  1H2Z A;  4CZY A;  3SBP A;  3A0F A;  5THA A;  4ZOV A;  3MZK A;  2BCJ B;  2P9K C;  4NC4 A;  1P22 A;  3EWE A;  4CY1 A;  4OZU A;  4H5J A;  5M5R A;  4BCC A;  3JZH A;  2IWK A;  2J56 H;  3K71 A;  4PC0 A;  3OKY A;  2H3X A;  2J57 G;  3FRX A;  3L4M D;  4BH6 A;  4UM8 A;  3AL8 B;  3ZDX A;  1JTD B;  5TF2 A;  2AGY A;  5A2Q g;  2VDM A;  4CI3 A;  2VZ3 A;  3UVM A;  5M5T A;  4LGN A;  3RN1 D;  4ZOZ A;  3DM0 A;  4PXW A;  5FA5 B;  2HJB A;  3NVQ A;  4WJK A;  2IWF A;  1VZ2 A;  5C2V B;  3KRX B;  4J8B A;  4H5I A;  3O4H A;  4GQB B;  2TRC B;  5K1C C;  1N6D A;  3RSE C;  3NID A;  1H2X A;  3RMZ D;  1UOQ A;  2HU7 A;  4G55 A;  4ZOY A;  4JHN A;  3MUO A;  5AMS A;  4QL1 A;  2XU7 A;  3SWS D;  2AQ5 A;  4GGA A;  2AH1 A;  3OW8 A;  3C99 A;  2WQ8 A;  1C9L A;  4FHL A;  3O4J A;  4X60 B;  3AL8 A;  3ZWL B;  2H6Q A;  4L3G D;  5FKQ A;  4O9D A;  3SVW D;  3UVL A;  2YNP A;  3UVK A;  4O02 A;  3V4P A;  1GXR A;  3SBQ A;  2VDK A;  5E6S A;  4X61 B;  2OK6 A;  5EMK B;  2XL3 A;  1JOF A;  3SLE D;  4ERY A;  4ZN4 A;  5AFU 3;  4RE5 A;  2XYI A;  5SXM A;  3W15 A;  4AN0 A;  2XDW A;  3VGZ A;  5FKS A;  3VI3 A;  1K32 A;  5HE1 B;  4GM3 A;  3CIK B;  2VDO A;  5EAR A;  3EQ9 A;  3UKR C;  4AMZ A;  2I0S A;  1GOF A;  4J84 A;  5IGQ A;  3I2N A;  3T3P A;  2EIE A;  3L4O D;  4JD2 C;  4WK4 A;  3F3P A;  3I8E A;  4AEZ A;  5I5M A;  2PM7 B;  4GZ8 A;  4PSX B;  3SFZ A;  3ZE0 A;  3IUQ A;  1Q47 A;  3ZDZ A;  2VZ1 A;  1QNI A;  3IUM A;  4CY5 A;  3SN6 B;  3V7D B;  4PBZ A;  5E6R A;  1XKS A;  4Z7N A;  4G1E A;  4I79 A;  5EAM A;  3PSC B;  3F3G A;  1RI6 A;  4MK0 B;  4N14 A;  4A2M A;  4A08 B;  1B9X A;  1VYH C;  2Z2O A;  2OIZ A;  2GC4 A;  4R7A B;  2P9N C;  2IUR A;  3AL9 A;  5B4W A;  4FA1 D;  2EBS A;  4J87 A;  3EI1 B;  3EI3 A;  4A0A B;  5FFO A;  3IJ1 A;  3IJC A;  2H14 A;  2HU8 A;  2H9M A;  5IC7 A;  3KRW B;  4EWR A;  4E54 A;  2QZP A;  1QFS A;  2EID A;  5CYK A;  2P9P C;  3MMY A;  4G56 B;  2P9U C;  3I89 A;  2J55 H;  3EI4 A;  2CE8 A;  3UVO A;  5HYN B;  2CO0 A;  5C92 A;  2QXV A;  4UI9 R;  1PGU A;  3EG6 A;  5EAL A;  1TYE A;  5IT9 g;  1NR0 A;  3VA6 A;  1XHM A;  2QR5 A;  2AGZ A;  3I8C A;  4ESG A;  3EI1 A;  4J73 A;  4FB1 D;  5EAP A;  1PEV A;  3J80 g;  2MTA H;  4DNU A;  1T2X A;  5CYK B;  3SJL D;  3ULE C;  5GMK n;  4A08 A;  5CXC A;  3GFC A;  3DXK C;  3MXX A;  3I7H A;  3K27 A;  2EIB A;  2HES X;  1U2V C;  3CFS B;  4L1M A;  3DWL C;  4NSX A;  2VDQ A;  4A0A A;  1E8M A;  2GC7 A;  1H2Y A;  3NVX A;  5M5V A;  4A0B B;  5I5I A;  5FLX g;  2BKL A;  2OVQ B;  4O45 A;  1L0Q A;  3OF7 A;  4K3I D;  5CXB B;  2Z2P A;  4JXM A;  4IMM A;  4Z7O A;  4NEN A;  3ZE1 A;  1E8N A;  3I7O A;  3I7N A;  1OLZ A;  4MMY A;  2CO0 C;  3F3F A;  5C2W B;  2G99 A;  3FM0 A;  4MMX A;  4L9O A;  5HDB A;  2H9P A;  4J86 A;  1YR2 A;  5EM2 B;  3C75 H;  3PVW B;  4XYI A;  2AH0 A;  4A0B A;  1GOG A;  4Y5R D;  3JRO A;  3I7L A;  4J8G A;  3EI4 B;  3I7P A;  3MKQ A;  4D6V A;  3I7K A;  1A0R B;  4BP8 A;  4GMB A;  4WK2 A;  3OL2 B;  2CN3 A;  4G1M A;  5JWZ A;  4A2L A;  4GGC A;  2I3S A;  4BL0 A;  2H6N A;  4QQE A;  4FA5 D;  3VH0 A;  4L1Q D;  2VDL A;  2PBI B;  3IJE A;  4OWR A;  3U4Y A;  1H2W A;  5GXH A;  4DNW A;  4NBM A;  3V4V A;  1C9I A;  2AGX A;  4X3E A;  3K26 A;  2H47 A;  1R5M A;  4AN1 A;  4D0K A;  3FGB A;  3MKS B;  1QFM A;  2XL2 A;  3OKY B;  4PBY A;  2I0R A;  3RRM C;  1GOT B;  4J78 A;  1K8K C;  3GD1 I;  5EMM B;  3N0D A;  4XYH A;  1JMZ B;  3EQ8 A;  4Z7Q A;  3RFH A;  4FAV D;  3K72 A;  5HE0 B;  4GQ2 P;  2H6K A;  1GG2 B;  1L5G A;  1YFQ A;  2XE4 A;  3P4F A;  3ZE2 A;  4JT5 C;  4A7J A;  4CI1 A;  4QRJ A;  1BPO A;  1TBG A;  3QI0 A;  3OL2 A;  5E6U A;  3CFV A;  5M5U A;  5GSA A;  3MVD K;  4BUJ C;  2PM9 A;  4PSW B;  4GM9 A;  2HKM A;  2P9S C;  3SMR A;  4LG8 A;  4J79 A;  2BBK H;  4O3U B;  3RLM D;  3HFQ A;  2IUP A;  4E5Z B;  4ES0 A;  3OTT A;  1OMW B;  2H13 A;  5FXY A;  3DSM A;  2Z2N A;  5H1M A;  1B9Y A;  3SBR A;  2HJ4 A;  5HQG A;  3AH8 B;  3N0E A;  4K3J B;  4XEI C;  1K3I A;  1UTC A;  3JZG A;  1O6F A;  3PSL A;  3DXM C;  2H9N A;  2OK4 A;  1JMX B;  3DDU A;  5EMJ B;  4J81 A;  2YNN A;  3E0C A;  5CXC B;  3RN0 D;  3KCI A;  2VDP A;  3FCS A;  4A09 A;  4GGD A;  2PM9 B;  2P9L C;  3ORV D;  3MUN A;  3EI2 A;  3PE7 A;  4ERQ A;  4O2W A;  5HE3 B;  1MG3 A;  4BCD A;  4CY3 A;  3VI4 A;  3EU7 A;  1VE6 A;  1PI6 A;  4A11 A;  3IUL A;  4FA9 D;  5HE2 B;  4QT8 A;  2YB8 B;  5K19 A;  1A12 A;  3O4G A;  1MDA H;  5EML B;  3UKU C;  3EMH A;  2XZG A;  4FAN D;  2YMU A;  5IJ8 E;  5KDO B;  2HYE A;  4CC9 A;  4CI2 A;  4AX4 A;  3K6S A;  2H68 A;  3EI2 B;  2YBA A;  1JJU B;  2I0T A;  1U4C A;  4GQ1 A;  3UVN A;  1S4U X;  3IVM A;  3AFC A;  3ODT A;  3QHY B;  3UR4 A;  5CXB A;  2UZX B;  4JSX C;  3C5M A;  1XIP A;  1E5T A;  1UOO A;  4J0X A;  3J81 g;  3IKO A;  3IUJ A;  1UOP A;  2H9L A;  4L3H D;  5TEE A;  2JKX A;  3EI3 B;  4LG9 A;  3RFG A;  2IUV A;  2HKR A;  3NIG A;  5EM2 A;  3JAM g;  4ERZ A;  4U1E I;  4WK0 A;  2AGW A;  4J77 A;  1U8C A;  3NIF A;  1VE7 A;  4YVD A;  3BWS A;  3SXT D;  3V5W B;  3PXW D;  4E54 B;  1ERJ A;  4RE6 A;  1MG2 A;  5FFG A;  1GP2 B;  4GM8 A;  4J82 A;  5M61 A;  3FCU A;  5TDH B;  4NAA A;  2HU5 A;  4CY2 A;  4Z8L A;  3IIW A;  3GRE A;  5C9Z B;  4AMY A;  3PXT D;  4A11 B;  2VDR A;  3B7F A;  3IUR A;  1JV2 A;  2B5M A;  3O4I A;  2GNQ A;  4E5Z A;  2PM6 B;  4ZOX A;  3JZN A;  2HXC A;  3SHF A;  5H14 A;  2OJY A;  3C9C A;  1GOH A;  3BG0 A;  2YNO A;  2O9K A;  1N6E A;  4IA9 A;  1PBY B;  4X63 B;  2CNX A;  3PVU B;  4BCB A;  1SHY B;  2OVR B;  5TEF A;  4BP9 A;  1SQJ A;  2Q7Q A;  1TYQ C;  4JSP C;  4TZ4 A;  5FKT A;  2VC2 A;  3GC3 B;  4DNV A;  4UM9 A;  2QC5 A;  2CN2 A;  4FWW A;  4O1Q D;  2IAA A;  2W18 A;  4MMZ A;  3T3M A;  2B5L A;  5IJ7 E;  2B5N A;  3IJ0 A;  4A09 B;  4Y7R A;  4AOW A;  1N6F A;  4JSV C;  1FWX A;  4JHP C;  5FQD A;  5IGO A;  2VDN A;  4IRZ A;  5AJA A;  3BG1 A;  3V9F A;  2P9I C;  4J0W A;  4QAM A;  2B4E A; 
#chains in the Genus database with same CATH homology
 3PXS D;  2AGL A;  4KFM B;  2UZY B;  2CE9 A;  4O3T B;  2I3T A;  4HDJ A;  1SQ9 A;  5I5J A;  3JRP A;  2G9A A;  3MZL A;  5FKR A;  3IIY A;  4JSN C;  4CI8 A;  3SCY A;  5GXI A;  4U7A A;  3OKW A;  4PNK B;  1NEX B;  3JPX A;  4JT6 C;  2OVP B;  4CZV A;  2IUQ A;  5H17 A;  3OKT A;  4FA4 D;  3NVN A;  4CZX A;  3JB9 L;  4CZY A;  3SBP A;  3A0F A;  5THA A;  4ZOV A;  3MZK A;  2BCJ B;  2P9K C;  4CY1 A;  1P22 A;  3EWE A;  4OZU A;  4H5J A;  3JZH A;  2IWK A;  2J56 H;  4PC0 A;  3OKY A;  2H3X A;  2J57 G;  3FRX A;  3L4M D;  4BH6 A;  3AL8 B;  5TF2 A;  2AGY A;  5A2Q g;  4CI3 A;  3UVM A;  4LGN A;  3RN1 D;  4ZOZ A;  3DM0 A;  4PXW A;  5FA5 B;  2HJB A;  3NVQ A;  2IWF A;  5C2V B;  3KRX B;  4J8B A;  4H5I A;  4GQB B;  2TRC B;  5K1C C;  1N6D A;  3RSE C;  3RMZ D;  4ZOY A;  5AMS A;  4QL1 A;  2XU7 A;  3SWS D;  2AQ5 A;  4GGA A;  2AH1 A;  3OW8 A;  3C99 A;  4FHL A;  4X60 B;  3AL8 A;  3ZWL B;  2H6Q A;  4L3G D;  5FKQ A;  4O9D A;  3SVW D;  3UVL A;  2YNP A;  3UVK A;  1GXR A;  3SBQ A;  4X61 B;  2OK6 A;  5EMK B;  2XL3 A;  1JOF A;  3SLE D;  4ERY A;  4ZN4 A;  5AFU 3;  2XYI A;  5SXM A;  3W15 A;  3VGZ A;  5FKS A;  1K32 A;  5HE1 B;  4GM3 A;  3CIK B;  5EAR A;  3UKR C;  2I0S A;  4J84 A;  5IGQ A;  3I2N A;  3L4O D;  4JD2 C;  3F3P A;  3I8E A;  4AEZ A;  5I5M A;  2PM7 B;  4GZ8 A;  4PSX B;  3SFZ A;  1Q47 A;  1QNI A;  4CY5 A;  3SN6 B;  3V7D B;  4PBZ A;  1XKS A;  4I79 A;  5EAM A;  3PSC B;  3F3G A;  1RI6 A;  4MK0 B;  4N14 A;  4A2M A;  4A08 B;  1B9X A;  1VYH C;  2Z2O A;  2OIZ A;  4R7A B;  2GC4 A;  2P9N C;  2IUR A;  3AL9 A;  5B4W A;  4FA1 D;  2EBS A;  4J87 A;  3EI1 B;  3EI3 A;  4A0A B;  3IJ1 A;  3IJC A;  2H14 A;  2H9M A;  5IC7 A;  3KRW B;  4EWR A;  4E54 A;  5CYK A;  2P9P C;  3MMY A;  4G56 B;  2P9U C;  3I89 A;  2J55 H;  3EI4 A;  2CE8 A;  3UVO A;  5HYN B;  2CO0 A;  2QXV A;  4UI9 R;  1PGU A;  3EG6 A;  5EAL A;  5IT9 g;  1NR0 A;  3VA6 A;  1XHM A;  2AGZ A;  3I8C A;  4ESG A;  3EI1 A;  4J73 A;  4FB1 D;  5EAP A;  1PEV A;  3J80 g;  2MTA H;  5CYK B;  3SJL D;  3ULE C;  5GMK n;  4A08 A;  5CXC A;  3GFC A;  3DXK C;  3MXX A;  3I7H A;  3K27 A;  2HES X;  1U2V C;  3CFS B;  3DWL C;  4NSX A;  4A0A A;  2GC7 A;  3NVX A;  4A0B B;  5I5I A;  5FLX g;  2OVQ B;  4O45 A;  1L0Q A;  4K3I D;  5CXB B;  2Z2P A;  4JXM A;  4IMM A;  3I7O A;  3I7N A;  1OLZ A;  2CO0 C;  3F3F A;  5C2W B;  2G99 A;  3FM0 A;  4L9O A;  2H9P A;  4J86 A;  5EM2 B;  3C75 H;  3PVW B;  4XYI A;  2AH0 A;  4A0B A;  4Y5R D;  3JRO A;  3I7L A;  4J8G A;  3EI4 B;  3I7P A;  3MKQ A;  4D6V A;  3I7K A;  1A0R B;  4GMB A;  3OL2 B;  2CN3 A;  5JWZ A;  4A2L A;  4GGC A;  2I3S A;  4BL0 A;  2H6N A;  4QQE A;  4FA5 D;  3VH0 A;  4L1Q D;  2PBI B;  4OWR A;  3U4Y A;  5GXH A;  2AGX A;  4X3E A;  3K26 A;  2H47 A;  1R5M A;  4D0K A;  3FGB A;  3MKS B;  2XL2 A;  3OKY B;  4PBY A;  2I0R A;  3RRM C;  1GOT B;  4J78 A;  1K8K C;  5EMM B;  3N0D A;  4XYH A;  1JMZ B;  3RFH A;  4FAV D;  5HE0 B;  4GQ2 P;  2H6K A;  1GG2 B;  1YFQ A;  3P4F A;  4JT5 C;  4A7J A;  4CI1 A;  4QRJ A;  1TBG A;  3OL2 A;  3CFV A;  5GSA A;  4BUJ C;  2PM9 A;  4PSW B;  4GM9 A;  2HKM A;  2P9S C;  3SMR A;  4LG8 A;  4J79 A;  2BBK H;  4O3U B;  3RLM D;  3HFQ A;  2IUP A;  4E5Z B;  4ES0 A;  3OTT A;  1OMW B;  2H13 A;  5FXY A;  3DSM A;  2Z2N A;  5H1M A;  1B9Y A;  3SBR A;  2HJ4 A;  5HQG A;  3AH8 B;  3N0E A;  4K3J B;  4XEI C;  3JZG A;  3PSL A;  3DXM C;  2H9N A;  2OK4 A;  1JMX B;  5EMJ B;  4J81 A;  2YNN A;  3E0C A;  5CXC B;  3RN0 D;  4A09 A;  4GGD A;  2PM9 B;  2P9L C;  3ORV D;  3EI2 A;  3PE7 A;  4ERQ A;  5HE3 B;  1MG3 A;  4CY3 A;  3EU7 A;  1PI6 A;  4A11 A;  4FA9 D;  5HE2 B;  4QT8 A;  2YB8 B;  5K19 A;  1MDA H;  5EML B;  3UKU C;  3EMH A;  4FAN D;  2YMU A;  5IJ8 E;  5KDO B;  2HYE A;  4CC9 A;  4CI2 A;  2H68 A;  3EI2 B;  2YBA A;  1JJU B;  2I0T A;  1U4C A;  4GQ1 A;  3UVN A;  1S4U X;  3AFC A;  3ODT A;  3UR4 A;  5CXB A;  2UZX B;  4JSX C;  3C5M A;  1XIP A;  4J0X A;  3J81 g;  3IKO A;  2H9L A;  4L3H D;  5TEE A;  3EI3 B;  4LG9 A;  3RFG A;  2IUV A;  2HKR A;  5EM2 A;  3JAM g;  4ERZ A;  4U1E I;  2AGW A;  4J77 A;  4YVD A;  3BWS A;  3SXT D;  3V5W B;  3PXW D;  4E54 B;  1ERJ A;  1MG2 A;  1GP2 B;  4GM8 A;  4J82 A;  5TDH B;  4CY2 A;  4Z8L A;  3IIW A;  3GRE A;  5C9Z B;  3PXT D;  4A11 B;  3B7F A;  2B5M A;  2GNQ A;  4E5Z A;  2PM6 B;  4ZOX A;  3JZN A;  2HXC A;  3SHF A;  5H14 A;  2OJY A;  3C9C A;  3BG0 A;  2YNO A;  2O9K A;  1N6E A;  4IA9 A;  1PBY B;  4X63 B;  2CNX A;  3PVU B;  1SHY B;  2OVR B;  5TEF A;  1SQJ A;  2Q7Q A;  1TYQ C;  4JSP C;  4TZ4 A;  5FKT A;  2QC5 A;  2CN2 A;  4FWW A;  4O1Q D;  2IAA A;  2W18 A;  2B5L A;  5IJ7 E;  2B5N A;  3IJ0 A;  4A09 B;  4Y7R A;  4AOW A;  1N6F A;  4JSV C;  1FWX A;  5FQD A;  5IGO A;  5AJA A;  3BG1 A;  3V9F A;  2P9I C;  4J0W A;  2B4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...