3NVXA

Molecular mechanism of guidance cue recognition
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
383
structure length
379
Chain Sequence
SIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLTNNNYITTSIKVKDTLVCGTNNGNPKCWKIDGSDDPKHRGRGYAPYQNSKVTIISYNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGLRGAFVDKDGTYDKVYILFTDTIGSKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSRTIKTDNDTILYVFFDSPYSKSALCTYSMNTIKQSFSTSKLEGYTKQLPSPAPGICLPAGKVVSHTTFEVIEKYNVLDDIIKPLSNQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENSIYSFDTKSKQTRSSQVDARLFSVMVTSKPLFIADIGIGVGMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein A39
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
total genus 86
structure length 379
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvxA00
3FM0A 2XL3A 4GQ2P 1MG2A 1PI6A 2J56H 3VA6A 2HYEA 4J81A 4J73A 3ORVD 3SWSD 1B9YA 3L4OD 4ERZA 5EM2A 3OKYA 3IKOA 3I2NA 4NSXA 4XEIC 2OJYA 1OMWB 1JMXB 4X60B 1SHYB 4H5JA 3SCYA 4A7JA 3RFHA 1N6FA 3I8CA 5FKTA 4FB1D 3UVKA 2P9PC 5FA5B 4ERYA 3OKWA 4GM8A 4LG8A 4E54A 2IWFA 4ZN4A 2H9NA 4XYHA 5HE1B 4K3JB 5GXIA 3AL8B 4A09A 2IAAA 3ULEC 5IGOA 2BBKH 5EAMA 2H3XA 4X61B 2CNXA 4O9DA 3KRXB 4EWRA 5IJ7E 1U2VC 2H6KA 4R7AB 3BG1A 1K8KC 2P9UC 4O3TB 5HE0B 3SXTD 3IJ0A 4JSPC 3PXTD 3PVUB 3U4YA 5H17A 2CO0C 2TRCB 4A11B 4CZYA 3PSLA 2AGXA 2P9IC 4PNKB 2XU7A 2UZYB 3C99A 5I5JA 4PSXB 2I0RA 3RMZD 3OL2B 3UVOA 2OK6A 4X3EA 3ODTA 4OWRA 1FWXA 5C2WB 3OKTA 5HE2B 5IT9g 3EU7A 5K1CC 1XIPA 2IUQA 3CFVA 1U4CA 5AMSA 4PBYA 3RN0D 3EMHA 3IIWA 4ZOZA 1JMZB 2QC5A 4K3ID 4O3UB 4LGNA 4CY1A 2CE8A 4UI9R 4AOWA 3JZNA 5FQDA 3E0CA 5GSAA 2YNNA 1K32A 4D0KA 3MKSB 3SLED 4FA5D 5EMJB 4FA9D 4O45A 2AQ5A 2B5LA 4G56B 1GG2B 3GREA 5EMMB 4U1EI 3HFQA 5FKQA 4PSWB 2Z2OA 4IMMA 3EI1B 4ES0A 5A2Qg 2PM6B 3MZLA 3UVLA 1NEXB 1B9XA 3PE7A 4GQ1A 4I79A 3F3PA 2B4EA 3SJLD 2HXCA 3EI3B 3F3GA 5EAPA 4FAVD 3UR4A 2OVQB 3V5WB 4A11A 4OZUA 3JPXA 2H14A 4JT6C 2EBSA 3CIKB 3OL2A 4JD2C 4JSXC 4IA9A 2HKMA 3RLMD 3I7KA 3VGZA 3MKQA 3V9FA 3UKRC 2H9LA 4LG9A 3RN1D 4CY5A 1MDAH 3EI2B 3RFGA 5TEEA 3IIYA 2I0TA 4E5ZB 3IJ1A 3ZWLB 1JOFA 4A08A 4CI3A 4MK0B 2I3SA 3UVMA 3AFCA 1NR0A 4CY3A 1OLZA 3EG6A 4L1QD 3FGBA 3I7LA 4GGDA 4GZ8A 1TBGA 2H47A 2YMUA 2G9AA 4J82A 2OIZA 4ZOVA 4BUJC 3PXSD 5EALA 3JZGA 4PXWA 5HE3B 1TYQC 1L0QA 3EI1A 2AGLA 2GC4A 2W18A 4QT8A 4KFMB 3OTTA 4A2LA 5THAA 3AL9A 3DM0A 1QNIA 4PBZA 1PGUA 3JB9L 3DXMC 2IUVA 4J8BA 5CYKB 3EI3A 1PEVA 3K26A 5FKRA 4ZOXA 4J8GA 3SVWD 3JROA 4BL0A 2Z2PA 1XHMA 3DWLC 5TEFA 4L3HD 4JSNC 3I7NA 1A0RB 4GM3A 5H14A 3B7FA 4Y7RA 5EARA 5FKSA 4GGAA 2AGWA 5I5MA 4CI1A 5FLXg 4FA1D 3EI2A 5IC7A 4YVDA 3SMRA 2B5MA 1SQJA 5HQGA 4E5ZA 4CI8A 1VYHC 2P9NC 3VH0A 3I8EA 3SFZA 4A0AB 4XYIA 3V7DB 3AL8A 4A0BB 3NVXA 3SBPA 4O1QD 4N14A 2HESX 2H6NA 3W15A 2AH0A 4J77A 1SQ9A 3C5MA 2CN3A 2I3TA 2P9KC 2AGYA 1XKSA 5CXCB 5C2VB 4FAND 3NVQA 3MXXA 2XYIA 2CE9A 4ERQA 1GP2B 2H6QA 2HKRA 4J84A 5H1MA 4X63B 5I5IA 4CI2A 2PM9B 1P22A 3A0FA 3UKUC 3F3FA 3C75H 2IURA 2Z2NA 4H5IA 4HDJA 2I0SA 2OVRB 3RSEC 4FHLA 5EMKB 5TF2A 3JRPA 5CYKA 4GMBA 3EI4B 2GNQA 2OK4A 3JAMg 3CFSB 5SXMA 4A2MA 4AEZA 3KRWB 2YBAA 4U7AA 3NVNA 4JXMA 2O9KA 2HJBA 3L4MD 4Y5RD 1GXRA 3MZKA 3I89A 5IGQA 1S4UX 3PSCB 2YB8B 2CO0A 3N0EA 4L3GD 4QRJA 5K19A 3DSMA 4D6VA 3I7HA 3SN6B 3GFCA 2GC7A 3IJCA 3JZHA 4FA4D 4GGCA 4A0AA 1PBYB 4A0BA 3J80g 5AFU3 3P4FA 2PBIB 5CXBB 2YNPA 3I7PA 4QL1A 3PVWB 5GMKn 3BWSA 4FWWA 3C9CA 4ESGA 2BCJB 2P9SC 3DXKC 5CXCA 1N6EA 4PC0A 5KDOB 2PM7B 3K27A 5C9ZB 5TDHB 4TZ4A 1MG3A 4ZOYA 2H9PA 3SHFA 4CY2A 4BH6A 2PM9A 2Q7QA 1N6DA 4GQBB 2P9LC 4QQEA 4J87A 3OW8A 2G99A 3OKYB 4CZXA 5EM2B 5B4WA 4J86A 2CN2A 2B5NA 1RI6A 1JJUB 4L9OA 2XL2A 2IWKA 3EI4A 1ERJA 2H13A 4GM9A 2QXVA 5IJ8E 4CC9A 4J0WA 3SBRA 5AJAA 3EWEA 4E54B 5GXHA 5FXYA 2MTAH 4A08B 3RRMC 4CZVA 4A09B 2UZXB 2J57G 2YNOA 2OVPB 2AH1A 1YFQA 3AH8B 2HJ4A 4Z8LA 3BG0A 4J78A 5EMLB 2J55H 1R5MA 4JT5C 2H9MA 3J81g 5CXBA 1Q47A 3SBQA 5JWZA 3PXWD 2H68A 4JSVC 1GOTB 4J0XA 3FRXA 2IUPA 3UVNA 3N0DA 5HYNB 3I7OA 3MMYA 4J79A 2AGZA
chains in the Genus database with same CATH superfamily
3FM0A 4WJKA 2XL3A 3ZDZA 4GQ2P 1MG2A 1PI6A 3EQ8A 2J56H 2EIDA 3VA6A 2HYEA 4J81A 4J73A 3ORVD 3SWSD 1B9YA 1YR2A 2EIEA 3L4OD 3GD1I 4ERZA 5EM2A 3OKYA 4D9SA 3IKOA 3IJEA 3I2NA 4NSXA 4XEIC 2OJYA 1OMWB 1JMXB 4X60B 1SHYB 4H5JA 3SCYA 4A7JA 3RFHA 1N6FA 3I8CA 4NC4A 5FKTA 4FB1D 3UVKA 2P9PC 5FA5B 4ERYA 3OKWA 4GM8A 3IURA 4LG8A 4E54A 2IWFA 2EICA 4ZN4A 2H9NA 4XYHA 1GOGA 5HE1B 4K3JB 5GXIA 3AL8B 4A09A 2IAAA 3ULEC 5IGOA 2BBKH 2VDQA 5EAMA 3ZE2A 2H3XA 4X61B 2CNXA 4O9DA 2VDNA 3KRXB 4EWRA 2EIBA 5IJ7E 1U2VC 2H6KA 3FCUA 4R7AB 3BG1A 1K8KC 1BPOA 2P9UC 4O3TB 5HE0B 3SXTD 3IJ0A 5C92A 4JSPC 3PXTD 3PVUB 3U4YA 5H17A 3K72A 2VC2A 3K6SA 3O4IA 2CO0C 2TRCB 4A11B 4CZYA 3PSLA 2AGXA 2P9IC 4PNKB 2XU7A 2UZYB 3C99A 5I5JA 4PSXB 1GOFA 2I0RA 3OL2B 3RMZD 2OK6A 4X3EA 3UVOA 2VZ1A 3ODTA 4BCCA 4OWRA 1FWXA 4RE6A 5C2WB 2WQ8A 3OKTA 5HE2B 5IT9g 3EU7A 5K1CC 1XIPA 2IUQA 3CFVA 4QAMA 1UOQA 5E6SA 1U4CA 1I2MB 5AMSA 4PBYA 3RN0D 3EMHA 3IIWA 4ZOZA 1JMZB 2QC5A 4IRZA 4K3ID 3K71A 4O3UB 2XZGA 4LGNA 4CY1A 2CE8A 3T3MA 4UI9R 3NIDA 1JV2A 4AOWA 3IVMA 3JZNA 5FQDA 3E0CA 3DDUA 5GSAA 5C86A 2YNNA 4BP8A 1K32A 4D0KA 3MKSB 4WK4A 3SLED 4FA5D 5EMJB 4FA9D 4O45A 2AQ5A 2B5LA 4G56B 4WK0A 1GG2B 3GREA 5EMMB 1QFSA 4U1EI 3HFQA 5FKQA 4PSWB 2XDWA 2Z2OA 4IMMA 5E6UA 3EI1B 4ES0A 5A2Qg 2PM6B 3MZLA 3UVLA 4BP9A 1NEXB 1B9XA 3PE7A 4GQ1A 4I79A 3F3PA 2B4EA 3SJLD 1C9LA 2HXCA 3F3GA 3EI3B 1QFMA 5EAPA 4FAVD 3UR4A 2OVQB 3V5WB 3NIGA 4A11A 4OZUA 1E8MA 3JPXA 2H14A 4JT6C 2EBSA 3CIKB 3OL2A 1O6FA 4JD2C 4JSXC 4G1MA 4BCDA 4IA9A 2HKMA 3RLMD 3I7KA 3VGZA 3MKQA 3V9FA 3UKRC 2H9LA 4LG9A 1M1XA 3RN1D 4MMZA 4AN0A 2BKLA 4CY5A 3NIFA 1MDAH 2VDRA 3EI2B 3RFGA 5TEEA 3IIYA 4Z7NA 1UOPA 2I0TA 4E5ZB 3T3PA 3IJ1A 3ZWLB 1JOFA 1A12A 4A08A 4CI3A 4MK0B 2I3SA 4DNVA 3UVMA 3IUMA 3AFCA 1NR0A 5M5UA 4CY3A 1OLZA 2VDKA 3EG6A 4AN1A 4L1QD 4DNUA 3FGBA 3ZE1A 3I7LA 4GGDA 4GZ8A 1TBGA 2H47A 2YMUA 2G9AA 4J82A 2OIZA 4ZOVA 4BUJC 4Z7OA 3PXSD 4RE5A 5EALA 3JZGA 2JKXA 4PXWA 5HE3B 3MVDK 1TYQC 1L0QA 3EI1A 2AGLA 2GC4A 2W18A 4QT8A 4KFMB 3OTTA 4A2LA 5THAA 1VE7A 3AL9A 5M5SA 3DM0A 3ZDYA 1QNIA 4PBZA 1PGUA 4UM8A 3VI3A 5M5RA 3DXMC 2IUVA 3JB9L 4J8BA 5CYKB 3EI3A 3IUJA 1PEVA 3K26A 5FKRA 4ZOXA 4J8GA 2HU8A 3KCIA 5E6RA 3SVWD 3JROA 4BL0A 2Z2PA 1XHMA 3DWLC 5TEFA 4L3HD 4JSNC 3I7NA 1A0RB 2VDLA 1O6GA 4GM3A 5H14A 3B7FA 4Y7RA 5EARA 1VZ3A 5FKSA 4GGAA 2AGWA 3FCSA 5I5MA 3ZDXA 4CI1A 5FLXg 4FA1D 3EI2A 5IC7A 4YVDA 3QHYB 4MMYA 3SMRA 2VDMA 2B5MA 1H2WA 1SQJA 3QI0A 5HQGA 4CI8A 1VYHC 2P9NC 4E5ZA 3VH0A 1C9IA 3I8EA 3SFZA 4A0AB 4XYIA 3V7DB 3AL8A 3EQ7A 4A0BB 3NVXA 3SBPA 4O1QD 4O02A 4N14A 2HESX 4MMXA 2H6NA 3W15A 2AH0A 5M5TA 4J77A 1SQ9A 2P9KC 3C5MA 2CN3A 2I3TA 3EQ9A 2AGYA 1XKSA 5CXCB 5C2VB 2VDOA 4FAND 3NVQA 3MXXA 3O4GA 2XYIA 3IUQA 2CE9A 4O2WA 4ERQA 1GP2B 2H6QA 2QR5A 2HKRA 1E5TA 4J84A 5H1MA 4X63B 5I5IA 5FFGA 2PM9B 4CI2A 1P22A 3A0FA 3UKUC 3F3FA 3C75H 2VDPA 2QZPA 4G1EA 2IURA 2Z2NA 4H5IA 4HDJA 2I0SA 2OVRB 3RSEC 4FHLA 5EMKB 5TF2A 3JRPA 4Z7QA 1GOHA 4AMYA 5CYKA 4UM9A 4GMBA 2VZ3A 3EI4B 2GNQA 2OK4A 3JAMg 3CFSB 1T2XA 5SXMA 4A2MA 1VZ2A 4AEZA 3KRWB 2YBAA 5M61A 3IUNA 4U7AA 3O4HA 3NVNA 4JXMA 2O9KA 2HJBA 3L4MD 4Y5RD 1GXRA 3MZKA 3I89A 5IGQA 1S4UX 4WK2A 3PSCB 2YB8B 2CO0A 3N0EA 4L3GD 4QRJA 3VI4A 4BCBA 5K19A 3DSMA 4D6VA 1K3IA 3I7HA 4JHNA 3SN6B 1L5GA 1VE6A 1E8NA 3GFCA 2GC7A 3O4JA 1UTCA 3IJCA 3JZHA 4DNWA 4FA4D 4GGCA 4A0AA 1PBYB 3IULA 5HDBA 4A0BA 3J80g 5AFU3 3P4FA 1H2YA 2PBIB 5CXBB 4NBMA 2YNPA 3I7PA 4QL1A 3PVWB 5GMKn 2XE4A 3BWSA 4FWWA 3V4PA 3C9CA 4NAAA 4ESGA 2BCJB 2P9SC 3DXKC 5CXCA 4AMZA 1N6EA 1TYEA 4PC0A 2HU5A 5KDOB 2PM7B 3K27A 5C9ZB 5TDHB 4NENA 4TZ4A 1MG3A 4ZOYA 2H9PA 4JHPC 3SHFA 4CY2A 4BH6A 2PM9A 2Q7QA 1N6DA 4GQBB 2P9LC 4QQEA 3OF7A 4AX4A 4J87A 5FFOA 3OW8A 2G99A 3OKYB 4CZXA 5EM2B 5B4WA 4J86A 2CN2A 2B5NA 1RI6A 1JJUB 4L9OA 2XL2A 2IWKA 3EI4A 1ERJA 2H13A 4GM9A 2QXVA 5IJ8E 4CC9A 4J0WA 3SBRA 5AJAA 3EWEA 4E54B 5M5VA 5GXHA 5FXYA 2MTAH 4A08B 1H2XA 3RRMC 4CZVA 4A09B 3MUOA 2UZXB 2J57G 3ZE0A 4G55A 2YNOA 2OVPB 2AH1A 1YFQA 3AH8B 2HJ4A 4Z8LA 3BG0A 4J78A 5EMLB 2J55H 1R5MA 4JT5C 4L1MA 2H9MA 3J81g 5CXBA 1Q47A 3SBQA 3GC3B 2HU7A 5JWZA 3PXWD 2H68A 4JSVC 1GOTB 4J0XA 3FRXA 2IUPA 1UOOA 3MUNA 3UVNA 3N0DA 5HYNB 3V4VA 3I7OA 3MMYA 4J79A 1U8CA 1H2ZA 2AGZA 1JTDB
chains in the Genus database with same CATH topology
3FM0A 2XL3A 4GQ2P 1MG2A 1PI6A 2J56H 3VA6A 2HYEA 4J81A 4J73A 3ORVD 3SWSD 1B9YA 3L4OD 4ERZA 5EM2A 3OKYA 3IKOA 3I2NA 4NSXA 4XEIC 2OJYA 1OMWB 1JMXB 4X60B 1SHYB 4H5JA 3SCYA 4A7JA 3RFHA 1N6FA 3I8CA 5FKTA 4FB1D 3UVKA 2P9PC 5FA5B 4ERYA 3OKWA 4GM8A 4LG8A 4E54A 2IWFA 4ZN4A 2H9NA 4XYHA 5HE1B 4K3JB 5GXIA 3AL8B 4A09A 2IAAA 3ULEC 5IGOA 2BBKH 5EAMA 2H3XA 4X61B 2CNXA 4O9DA 3KRXB 4EWRA 5IJ7E 1U2VC 2H6KA 4R7AB 3BG1A 1K8KC 2P9UC 4O3TB 5HE0B 3SXTD 3IJ0A 4JSPC 3PXTD 3PVUB 3U4YA 5H17A 2CO0C 2TRCB 4A11B 4CZYA 3PSLA 2AGXA 2P9IC 4PNKB 2XU7A 2UZYB 3C99A 5I5JA 4PSXB 2I0RA 3RMZD 3OL2B 3UVOA 2OK6A 4X3EA 3ODTA 4OWRA 1FWXA 5C2WB 3OKTA 5HE2B 5IT9g 3EU7A 5K1CC 1XIPA 2IUQA 3CFVA 1U4CA 5AMSA 4PBYA 3RN0D 3EMHA 3IIWA 4ZOZA 1JMZB 2QC5A 4K3ID 4O3UB 4LGNA 4CY1A 2CE8A 4UI9R 4AOWA 3JZNA 5FQDA 3E0CA 5GSAA 2YNNA 1K32A 4D0KA 3MKSB 3SLED 4FA5D 5EMJB 4FA9D 4O45A 2AQ5A 2B5LA 4G56B 1GG2B 3GREA 5EMMB 4U1EI 3HFQA 5FKQA 4PSWB 2Z2OA 4IMMA 3EI1B 4ES0A 5A2Qg 2PM6B 3MZLA 3UVLA 1NEXB 1B9XA 3PE7A 4GQ1A 4I79A 3F3PA 2B4EA 3SJLD 2HXCA 3EI3B 3F3GA 5EAPA 4FAVD 3UR4A 2OVQB 3V5WB 4A11A 4OZUA 3JPXA 2H14A 4JT6C 2EBSA 3CIKB 3OL2A 4JD2C 4JSXC 4IA9A 2HKMA 3RLMD 3I7KA 3VGZA 3MKQA 3V9FA 3UKRC 2H9LA 4LG9A 3RN1D 4CY5A 1MDAH 3EI2B 3RFGA 5TEEA 3IIYA 2I0TA 4E5ZB 3IJ1A 3ZWLB 1JOFA 4A08A 4CI3A 4MK0B 2I3SA 3UVMA 3AFCA 1NR0A 4CY3A 1OLZA 3EG6A 4L1QD 3FGBA 3I7LA 4GGDA 4GZ8A 1TBGA 2H47A 2YMUA 2G9AA 4J82A 2OIZA 4ZOVA 4BUJC 3PXSD 5EALA 3JZGA 4PXWA 5HE3B 1TYQC 1L0QA 3EI1A 2AGLA 2GC4A 2W18A 4QT8A 4KFMB 3OTTA 4A2LA 5THAA 3AL9A 3DM0A 1QNIA 4PBZA 1PGUA 3JB9L 3DXMC 2IUVA 4J8BA 5CYKB 3EI3A 1PEVA 3K26A 5FKRA 4ZOXA 4J8GA 3SVWD 3JROA 4BL0A 2Z2PA 1XHMA 3DWLC 5TEFA 4L3HD 4JSNC 3I7NA 1A0RB 4GM3A 5H14A 3B7FA 4Y7RA 5EARA 5FKSA 4GGAA 2AGWA 5I5MA 4CI1A 5FLXg 4FA1D 3EI2A 5IC7A 4YVDA 3SMRA 2B5MA 1SQJA 5HQGA 4E5ZA 4CI8A 1VYHC 2P9NC 3VH0A 3I8EA 3SFZA 4A0AB 4XYIA 3V7DB 3AL8A 4A0BB 3NVXA 3SBPA 4O1QD 4N14A 2HESX 2H6NA 3W15A 2AH0A 4J77A 1SQ9A 3C5MA 2CN3A 2I3TA 2P9KC 2AGYA 1XKSA 5CXCB 5C2VB 4FAND 3NVQA 3MXXA 2XYIA 2CE9A 4ERQA 1GP2B 2H6QA 2HKRA 4J84A 5H1MA 4X63B 5I5IA 4CI2A 2PM9B 1P22A 3A0FA 3UKUC 3F3FA 3C75H 2IURA 2Z2NA 4H5IA 4HDJA 2I0SA 2OVRB 3RSEC 4FHLA 5EMKB 5TF2A 3JRPA 5CYKA 4GMBA 3EI4B 2GNQA 2OK4A 3JAMg 3CFSB 5SXMA 4A2MA 4AEZA 3KRWB 2YBAA 4U7AA 3NVNA 4JXMA 2O9KA 2HJBA 3L4MD 4Y5RD 1GXRA 3MZKA 3I89A 5IGQA 1S4UX 3PSCB 2YB8B 2CO0A 3N0EA 4L3GD 4QRJA 5K19A 3DSMA 4D6VA 3I7HA 3SN6B 3GFCA 2GC7A 3IJCA 3JZHA 4FA4D 4GGCA 4A0AA 1PBYB 4A0BA 3J80g 5AFU3 3P4FA 2PBIB 5CXBB 2YNPA 3I7PA 4QL1A 3PVWB 5GMKn 3BWSA 4FWWA 3C9CA 4ESGA 2BCJB 2P9SC 3DXKC 5CXCA 1N6EA 4PC0A 5KDOB 2PM7B 3K27A 5C9ZB 5TDHB 4TZ4A 1MG3A 4ZOYA 2H9PA 3SHFA 4CY2A 4BH6A 2PM9A 2Q7QA 1N6DA 4GQBB 2P9LC 4QQEA 4J87A 3OW8A 2G99A 3OKYB 4CZXA 5EM2B 5B4WA 4J86A 2CN2A 2B5NA 1RI6A 1JJUB 4L9OA 2XL2A 2IWKA 3EI4A 1ERJA 2H13A 4GM9A 2QXVA 5IJ8E 4CC9A 4J0WA 3SBRA 5AJAA 3EWEA 4E54B 5GXHA 5FXYA 2MTAH 4A08B 3RRMC 4CZVA 4A09B 2UZXB 2J57G 2YNOA 2OVPB 2AH1A 1YFQA 3AH8B 2HJ4A 4Z8LA 3BG0A 4J78A 5EMLB 2J55H 1R5MA 4JT5C 2H9MA 3J81g 5CXBA 1Q47A 3SBQA 5JWZA 3PXWD 2H68A 4JSVC 1GOTB 4J0XA 3FRXA 2IUPA 3UVNA 3N0DA 5HYNB 3I7OA 3MMYA 4J79A 2AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FM0 A;  2XL3 A;  4GQ2 P;  1MG2 A;  1PI6 A;  2J56 H;  3VA6 A;  2HYE A;  4J81 A;  4J73 A;  3ORV D;  3SWS D;  1B9Y A;  3L4O D;  4ERZ A;  5EM2 A;  3OKY A;  3IKO A;  3I2N A;  4NSX A;  4XEI C;  2OJY A;  1OMW B;  1JMX B;  4X60 B;  1SHY B;  4H5J A;  3SCY A;  4A7J A;  3RFH A;  1N6F A;  3I8C A;  5FKT A;  4FB1 D;  3UVK A;  2P9P C;  5FA5 B;  4ERY A;  3OKW A;  4GM8 A;  4LG8 A;  4E54 A;  2IWF A;  4ZN4 A;  2H9N A;  4XYH A;  5HE1 B;  4K3J B;  5GXI A;  3AL8 B;  4A09 A;  2IAA A;  3ULE C;  5IGO A;  2BBK H;  5EAM A;  2H3X A;  4X61 B;  2CNX A;  4O9D A;  3KRX B;  4EWR A;  5IJ7 E;  1U2V C;  2H6K A;  4R7A B;  3BG1 A;  1K8K C;  2P9U C;  4O3T B;  5HE0 B;  3SXT D;  3IJ0 A;  4JSP C;  3PXT D;  3PVU B;  3U4Y A;  5H17 A;  2CO0 C;  2TRC B;  4A11 B;  4CZY A;  3PSL A;  2AGX A;  2P9I C;  4PNK B;  2XU7 A;  2UZY B;  3C99 A;  5I5J A;  4PSX B;  2I0R A;  3RMZ D;  3OL2 B;  3UVO A;  2OK6 A;  4X3E A;  3ODT A;  4OWR A;  1FWX A;  5C2W B;  3OKT A;  5HE2 B;  5IT9 g;  3EU7 A;  5K1C C;  1XIP A;  2IUQ A;  3CFV A;  1U4C A;  5AMS A;  4PBY A;  3RN0 D;  3EMH A;  3IIW A;  4ZOZ A;  1JMZ B;  2QC5 A;  4K3I D;  4O3U B;  4LGN A;  4CY1 A;  2CE8 A;  4UI9 R;  4AOW A;  3JZN A;  5FQD A;  3E0C A;  5GSA A;  2YNN A;  1K32 A;  4D0K A;  3MKS B;  3SLE D;  4FA5 D;  5EMJ B;  4FA9 D;  4O45 A;  2AQ5 A;  2B5L A;  4G56 B;  1GG2 B;  3GRE A;  5EMM B;  4U1E I;  3HFQ A;  5FKQ A;  4PSW B;  2Z2O A;  4IMM A;  3EI1 B;  4ES0 A;  5A2Q g;  2PM6 B;  3MZL A;  3UVL A;  1NEX B;  1B9X A;  3PE7 A;  4GQ1 A;  4I79 A;  3F3P A;  2B4E A;  3SJL D;  2HXC A;  3EI3 B;  3F3G A;  5EAP A;  4FAV D;  3UR4 A;  2OVQ B;  3V5W B;  4A11 A;  4OZU A;  3JPX A;  2H14 A;  4JT6 C;  2EBS A;  3CIK B;  3OL2 A;  4JD2 C;  4JSX C;  4IA9 A;  2HKM A;  3RLM D;  3I7K A;  3VGZ A;  3MKQ A;  3V9F A;  3UKR C;  2H9L A;  4LG9 A;  3RN1 D;  4CY5 A;  1MDA H;  3EI2 B;  3RFG A;  5TEE A;  3IIY A;  2I0T A;  4E5Z B;  3IJ1 A;  3ZWL B;  1JOF A;  4A08 A;  4CI3 A;  4MK0 B;  2I3S A;  3UVM A;  3AFC A;  1NR0 A;  4CY3 A;  1OLZ A;  3EG6 A;  4L1Q D;  3FGB A;  3I7L A;  4GGD A;  4GZ8 A;  1TBG A;  2H47 A;  2YMU A;  2G9A A;  4J82 A;  2OIZ A;  4ZOV A;  4BUJ C;  3PXS D;  5EAL A;  3JZG A;  4PXW A;  5HE3 B;  1TYQ C;  1L0Q A;  3EI1 A;  2AGL A;  2GC4 A;  2W18 A;  4QT8 A;  4KFM B;  3OTT A;  4A2L A;  5THA A;  3AL9 A;  3DM0 A;  1QNI A;  4PBZ A;  1PGU A;  3JB9 L;  3DXM C;  2IUV A;  4J8B A;  5CYK B;  3EI3 A;  1PEV A;  3K26 A;  5FKR A;  4ZOX A;  4J8G A;  3SVW D;  3JRO A;  4BL0 A;  2Z2P A;  1XHM A;  3DWL C;  5TEF A;  4L3H D;  4JSN C;  3I7N A;  1A0R B;  4GM3 A;  5H14 A;  3B7F A;  4Y7R A;  5EAR A;  5FKS A;  4GGA A;  2AGW A;  5I5M A;  4CI1 A;  5FLX g;  4FA1 D;  3EI2 A;  5IC7 A;  4YVD A;  3SMR A;  2B5M A;  1SQJ A;  5HQG A;  4E5Z A;  4CI8 A;  1VYH C;  2P9N C;  3VH0 A;  3I8E A;  3SFZ A;  4A0A B;  4XYI A;  3V7D B;  3AL8 A;  4A0B B;  3NVX A;  3SBP A;  4O1Q D;  4N14 A;  2HES X;  2H6N A;  3W15 A;  2AH0 A;  4J77 A;  1SQ9 A;  3C5M A;  2CN3 A;  2I3T A;  2P9K C;  2AGY A;  1XKS A;  5CXC B;  5C2V B;  4FAN D;  3NVQ A;  3MXX A;  2XYI A;  2CE9 A;  4ERQ A;  1GP2 B;  2H6Q A;  2HKR A;  4J84 A;  5H1M A;  4X63 B;  5I5I A;  4CI2 A;  2PM9 B;  1P22 A;  3A0F A;  3UKU C;  3F3F A;  3C75 H;  2IUR A;  2Z2N A;  4H5I A;  4HDJ A;  2I0S A;  2OVR B;  3RSE C;  4FHL A;  5EMK B;  5TF2 A;  3JRP A;  5CYK A;  4GMB A;  3EI4 B;  2GNQ A;  2OK4 A;  3JAM g;  3CFS B;  5SXM A;  4A2M A;  4AEZ A;  3KRW B;  2YBA A;  4U7A A;  3NVN A;  4JXM A;  2O9K A;  2HJB A;  3L4M D;  4Y5R D;  1GXR A;  3MZK A;  3I89 A;  5IGQ A;  1S4U X;  3PSC B;  2YB8 B;  2CO0 A;  3N0E A;  4L3G D;  4QRJ A;  5K19 A;  3DSM A;  4D6V A;  3I7H A;  3SN6 B;  3GFC A;  2GC7 A;  3IJC A;  3JZH A;  4FA4 D;  4GGC A;  4A0A A;  1PBY B;  4A0B A;  3J80 g;  5AFU 3;  3P4F A;  2PBI B;  5CXB B;  2YNP A;  3I7P A;  4QL1 A;  3PVW B;  5GMK n;  3BWS A;  4FWW A;  3C9C A;  4ESG A;  2BCJ B;  2P9S C;  3DXK C;  5CXC A;  1N6E A;  4PC0 A;  5KDO B;  2PM7 B;  3K27 A;  5C9Z B;  5TDH B;  4TZ4 A;  1MG3 A;  4ZOY A;  2H9P A;  3SHF A;  4CY2 A;  4BH6 A;  2PM9 A;  2Q7Q A;  1N6D A;  4GQB B;  2P9L C;  4QQE A;  4J87 A;  3OW8 A;  2G99 A;  3OKY B;  4CZX A;  5EM2 B;  5B4W A;  4J86 A;  2CN2 A;  2B5N A;  1RI6 A;  1JJU B;  4L9O A;  2XL2 A;  2IWK A;  3EI4 A;  1ERJ A;  2H13 A;  4GM9 A;  2QXV A;  5IJ8 E;  4CC9 A;  4J0W A;  3SBR A;  5AJA A;  3EWE A;  4E54 B;  5GXH A;  5FXY A;  2MTA H;  4A08 B;  3RRM C;  4CZV A;  4A09 B;  2UZX B;  2J57 G;  2YNO A;  2OVP B;  2AH1 A;  1YFQ A;  3AH8 B;  2HJ4 A;  4Z8L A;  3BG0 A;  4J78 A;  5EML B;  2J55 H;  1R5M A;  4JT5 C;  2H9M A;  3J81 g;  5CXB A;  1Q47 A;  3SBQ A;  5JWZ A;  3PXW D;  2H68 A;  4JSV C;  1GOT B;  4J0X A;  3FRX A;  2IUP A;  3UVN A;  3N0D A;  5HYN B;  3I7O A;  3MMY A;  4J79 A;  2AGZ A; 
#chains in the Genus database with same CATH topology
 3FM0 A;  4WJK A;  2XL3 A;  3ZDZ A;  4GQ2 P;  1MG2 A;  1PI6 A;  3EQ8 A;  2J56 H;  2EID A;  3VA6 A;  2HYE A;  4J81 A;  4J73 A;  3ORV D;  3SWS D;  1B9Y A;  1YR2 A;  2EIE A;  3L4O D;  3GD1 I;  4ERZ A;  5EM2 A;  3OKY A;  4D9S A;  3IKO A;  3IJE A;  3I2N A;  4NSX A;  4XEI C;  2OJY A;  1OMW B;  1JMX B;  4X60 B;  1SHY B;  4H5J A;  3SCY A;  4A7J A;  3RFH A;  1N6F A;  3I8C A;  4NC4 A;  5FKT A;  4FB1 D;  3UVK A;  2P9P C;  5FA5 B;  4ERY A;  3OKW A;  4GM8 A;  3IUR A;  4LG8 A;  4E54 A;  2IWF A;  2EIC A;  4ZN4 A;  2H9N A;  4XYH A;  1GOG A;  5HE1 B;  4K3J B;  5GXI A;  3AL8 B;  4A09 A;  2IAA A;  3ULE C;  5IGO A;  2BBK H;  2VDQ A;  5EAM A;  3ZE2 A;  2H3X A;  4X61 B;  2CNX A;  4O9D A;  2VDN A;  3KRX B;  4EWR A;  2EIB A;  5IJ7 E;  1U2V C;  2H6K A;  3FCU A;  4R7A B;  3BG1 A;  1K8K C;  1BPO A;  2P9U C;  4O3T B;  5HE0 B;  3SXT D;  3IJ0 A;  5C92 A;  4JSP C;  3PXT D;  3PVU B;  3U4Y A;  5H17 A;  3K72 A;  2VC2 A;  3K6S A;  3O4I A;  2CO0 C;  2TRC B;  4A11 B;  4CZY A;  3PSL A;  2AGX A;  2P9I C;  4PNK B;  2XU7 A;  2UZY B;  3C99 A;  5I5J A;  4PSX B;  1GOF A;  2I0R A;  3OL2 B;  3RMZ D;  2OK6 A;  4X3E A;  3UVO A;  2VZ1 A;  3ODT A;  4BCC A;  4OWR A;  1FWX A;  4RE6 A;  5C2W B;  2WQ8 A;  3OKT A;  5HE2 B;  5IT9 g;  3EU7 A;  5K1C C;  1XIP A;  2IUQ A;  3CFV A;  4QAM A;  1UOQ A;  5E6S A;  1U4C A;  1I2M B;  5AMS A;  4PBY A;  3RN0 D;  3EMH A;  3IIW A;  4ZOZ A;  1JMZ B;  2QC5 A;  4IRZ A;  4K3I D;  3K71 A;  4O3U B;  2XZG A;  4LGN A;  4CY1 A;  2CE8 A;  3T3M A;  4UI9 R;  3NID A;  1JV2 A;  4AOW A;  3IVM A;  3JZN A;  5FQD A;  3E0C A;  3DDU A;  5GSA A;  5C86 A;  2YNN A;  4BP8 A;  1K32 A;  4D0K A;  3MKS B;  4WK4 A;  3SLE D;  4FA5 D;  5EMJ B;  4FA9 D;  4O45 A;  2AQ5 A;  2B5L A;  4G56 B;  4WK0 A;  1GG2 B;  3GRE A;  5EMM B;  1QFS A;  4U1E I;  3HFQ A;  5FKQ A;  4PSW B;  2XDW A;  2Z2O A;  4IMM A;  5E6U A;  3EI1 B;  4ES0 A;  5A2Q g;  2PM6 B;  3MZL A;  3UVL A;  4BP9 A;  1NEX B;  1B9X A;  3PE7 A;  4GQ1 A;  4I79 A;  3F3P A;  2B4E A;  3SJL D;  1C9L A;  2HXC A;  3F3G A;  3EI3 B;  1QFM A;  5EAP A;  4FAV D;  3UR4 A;  2OVQ B;  3V5W B;  3NIG A;  4A11 A;  4OZU A;  1E8M A;  3JPX A;  2H14 A;  4JT6 C;  2EBS A;  3CIK B;  3OL2 A;  1O6F A;  4JD2 C;  4JSX C;  4G1M A;  4BCD A;  4IA9 A;  2HKM A;  3RLM D;  3I7K A;  3VGZ A;  3MKQ A;  3V9F A;  3UKR C;  2H9L A;  4LG9 A;  1M1X A;  3RN1 D;  4MMZ A;  4AN0 A;  2BKL A;  4CY5 A;  3NIF A;  1MDA H;  2VDR A;  3EI2 B;  3RFG A;  5TEE A;  3IIY A;  4Z7N A;  1UOP A;  2I0T A;  4E5Z B;  3T3P A;  3IJ1 A;  3ZWL B;  1JOF A;  1A12 A;  4A08 A;  4CI3 A;  4MK0 B;  2I3S A;  4DNV A;  3UVM A;  3IUM A;  3AFC A;  1NR0 A;  5M5U A;  4CY3 A;  1OLZ A;  2VDK A;  3EG6 A;  4AN1 A;  4L1Q D;  4DNU A;  3FGB A;  3ZE1 A;  3I7L A;  4GGD A;  4GZ8 A;  1TBG A;  2H47 A;  2YMU A;  2G9A A;  4J82 A;  2OIZ A;  4ZOV A;  4BUJ C;  4Z7O A;  3PXS D;  4RE5 A;  5EAL A;  3JZG A;  2JKX A;  4PXW A;  5HE3 B;  3MVD K;  1TYQ C;  1L0Q A;  3EI1 A;  2AGL A;  2GC4 A;  2W18 A;  4QT8 A;  4KFM B;  3OTT A;  4A2L A;  5THA A;  1VE7 A;  3AL9 A;  5M5S A;  3DM0 A;  3ZDY A;  1QNI A;  4PBZ A;  1PGU A;  4UM8 A;  3VI3 A;  5M5R A;  3DXM C;  2IUV A;  3JB9 L;  4J8B A;  5CYK B;  3EI3 A;  3IUJ A;  1PEV A;  3K26 A;  5FKR A;  4ZOX A;  4J8G A;  2HU8 A;  3KCI A;  5E6R A;  3SVW D;  3JRO A;  4BL0 A;  2Z2P A;  1XHM A;  3DWL C;  5TEF A;  4L3H D;  4JSN C;  3I7N A;  1A0R B;  2VDL A;  1O6G A;  4GM3 A;  5H14 A;  3B7F A;  4Y7R A;  5EAR A;  1VZ3 A;  5FKS A;  4GGA A;  2AGW A;  3FCS A;  5I5M A;  3ZDX A;  4CI1 A;  5FLX g;  4FA1 D;  3EI2 A;  5IC7 A;  4YVD A;  3QHY B;  4MMY A;  3SMR A;  2VDM A;  2B5M A;  1H2W A;  1SQJ A;  3QI0 A;  5HQG A;  4CI8 A;  1VYH C;  2P9N C;  4E5Z A;  3VH0 A;  1C9I A;  3I8E A;  3SFZ A;  4A0A B;  4XYI A;  3V7D B;  3AL8 A;  3EQ7 A;  4A0B B;  3NVX A;  3SBP A;  4O1Q D;  4O02 A;  4N14 A;  2HES X;  4MMX A;  2H6N A;  3W15 A;  2AH0 A;  5M5T A;  4J77 A;  1SQ9 A;  2P9K C;  3C5M A;  2CN3 A;  2I3T A;  3EQ9 A;  2AGY A;  1XKS A;  5CXC B;  5C2V B;  2VDO A;  4FAN D;  3NVQ A;  3MXX A;  3O4G A;  2XYI A;  3IUQ A;  2CE9 A;  4O2W A;  4ERQ A;  1GP2 B;  2H6Q A;  2QR5 A;  2HKR A;  1E5T A;  4J84 A;  5H1M A;  4X63 B;  5I5I A;  5FFG A;  2PM9 B;  4CI2 A;  1P22 A;  3A0F A;  3UKU C;  3F3F A;  3C75 H;  2VDP A;  2QZP A;  4G1E A;  2IUR A;  2Z2N A;  4H5I A;  4HDJ A;  2I0S A;  2OVR B;  3RSE C;  4FHL A;  5EMK B;  5TF2 A;  3JRP A;  4Z7Q A;  1GOH A;  4AMY A;  5CYK A;  4UM9 A;  4GMB A;  2VZ3 A;  3EI4 B;  2GNQ A;  2OK4 A;  3JAM g;  3CFS B;  1T2X A;  5SXM A;  4A2M A;  1VZ2 A;  4AEZ A;  3KRW B;  2YBA A;  5M61 A;  3IUN A;  4U7A A;  3O4H A;  3NVN A;  4JXM A;  2O9K A;  2HJB A;  3L4M D;  4Y5R D;  1GXR A;  3MZK A;  3I89 A;  5IGQ A;  1S4U X;  4WK2 A;  3PSC B;  2YB8 B;  2CO0 A;  3N0E A;  4L3G D;  4QRJ A;  3VI4 A;  4BCB A;  5K19 A;  3DSM A;  4D6V A;  1K3I A;  3I7H A;  4JHN A;  3SN6 B;  1L5G A;  1VE6 A;  1E8N A;  3GFC A;  2GC7 A;  3O4J A;  1UTC A;  3IJC A;  3JZH A;  4DNW A;  4FA4 D;  4GGC A;  4A0A A;  1PBY B;  3IUL A;  5HDB A;  4A0B A;  3J80 g;  5AFU 3;  3P4F A;  1H2Y A;  2PBI B;  5CXB B;  4NBM A;  2YNP A;  3I7P A;  4QL1 A;  3PVW B;  5GMK n;  2XE4 A;  3BWS A;  4FWW A;  3V4P A;  3C9C A;  4NAA A;  4ESG A;  2BCJ B;  2P9S C;  3DXK C;  5CXC A;  4AMZ A;  1N6E A;  1TYE A;  4PC0 A;  2HU5 A;  5KDO B;  2PM7 B;  3K27 A;  5C9Z B;  5TDH B;  4NEN A;  4TZ4 A;  1MG3 A;  4ZOY A;  2H9P A;  4JHP C;  3SHF A;  4CY2 A;  4BH6 A;  2PM9 A;  2Q7Q A;  1N6D A;  4GQB B;  2P9L C;  4QQE A;  3OF7 A;  4AX4 A;  4J87 A;  5FFO A;  3OW8 A;  2G99 A;  3OKY B;  4CZX A;  5EM2 B;  5B4W A;  4J86 A;  2CN2 A;  2B5N A;  1RI6 A;  1JJU B;  4L9O A;  2XL2 A;  2IWK A;  3EI4 A;  1ERJ A;  2H13 A;  4GM9 A;  2QXV A;  5IJ8 E;  4CC9 A;  4J0W A;  3SBR A;  5AJA A;  3EWE A;  4E54 B;  5M5V A;  5GXH A;  5FXY A;  2MTA H;  4A08 B;  1H2X A;  3RRM C;  4CZV A;  4A09 B;  3MUO A;  2UZX B;  2J57 G;  3ZE0 A;  4G55 A;  2YNO A;  2OVP B;  2AH1 A;  1YFQ A;  3AH8 B;  2HJ4 A;  4Z8L A;  3BG0 A;  4J78 A;  5EML B;  2J55 H;  1R5M A;  4JT5 C;  4L1M A;  2H9M A;  3J81 g;  5CXB A;  1Q47 A;  3SBQ A;  3GC3 B;  2HU7 A;  5JWZ A;  3PXW D;  2H68 A;  4JSV C;  1GOT B;  4J0X A;  3FRX A;  2IUP A;  1UOO A;  3MUN A;  3UVN A;  3N0D A;  5HYN B;  3V4V A;  3I7O A;  3MMY A;  4J79 A;  1U8C A;  1H2Z A;  2AGZ A;  1JTD B; 
#chains in the Genus database with same CATH homology
 3FM0 A;  2XL3 A;  4GQ2 P;  1MG2 A;  1PI6 A;  2J56 H;  3VA6 A;  2HYE A;  4J81 A;  4J73 A;  3ORV D;  3SWS D;  1B9Y A;  3L4O D;  4ERZ A;  5EM2 A;  3OKY A;  3IKO A;  3I2N A;  4NSX A;  4XEI C;  2OJY A;  1OMW B;  1JMX B;  4X60 B;  1SHY B;  4H5J A;  3SCY A;  4A7J A;  3RFH A;  1N6F A;  3I8C A;  5FKT A;  4FB1 D;  3UVK A;  2P9P C;  5FA5 B;  4ERY A;  3OKW A;  4GM8 A;  4LG8 A;  4E54 A;  2IWF A;  4ZN4 A;  2H9N A;  4XYH A;  5HE1 B;  4K3J B;  5GXI A;  3AL8 B;  4A09 A;  2IAA A;  3ULE C;  5IGO A;  2BBK H;  5EAM A;  2H3X A;  4X61 B;  2CNX A;  4O9D A;  3KRX B;  4EWR A;  5IJ7 E;  1U2V C;  2H6K A;  4R7A B;  3BG1 A;  1K8K C;  2P9U C;  4O3T B;  5HE0 B;  3SXT D;  3IJ0 A;  4JSP C;  3PXT D;  3PVU B;  3U4Y A;  5H17 A;  2CO0 C;  2TRC B;  4A11 B;  4CZY A;  3PSL A;  2AGX A;  2P9I C;  4PNK B;  2XU7 A;  2UZY B;  3C99 A;  5I5J A;  4PSX B;  2I0R A;  3RMZ D;  3OL2 B;  3UVO A;  2OK6 A;  4X3E A;  3ODT A;  4OWR A;  1FWX A;  5C2W B;  3OKT A;  5HE2 B;  5IT9 g;  3EU7 A;  5K1C C;  1XIP A;  2IUQ A;  3CFV A;  1U4C A;  5AMS A;  4PBY A;  3RN0 D;  3EMH A;  3IIW A;  4ZOZ A;  1JMZ B;  2QC5 A;  4K3I D;  4O3U B;  4LGN A;  4CY1 A;  2CE8 A;  4UI9 R;  4AOW A;  3JZN A;  5FQD A;  3E0C A;  5GSA A;  2YNN A;  1K32 A;  4D0K A;  3MKS B;  3SLE D;  4FA5 D;  5EMJ B;  4FA9 D;  4O45 A;  2AQ5 A;  2B5L A;  4G56 B;  1GG2 B;  3GRE A;  5EMM B;  4U1E I;  3HFQ A;  5FKQ A;  4PSW B;  2Z2O A;  4IMM A;  3EI1 B;  4ES0 A;  5A2Q g;  2PM6 B;  3MZL A;  3UVL A;  1NEX B;  1B9X A;  3PE7 A;  4GQ1 A;  4I79 A;  3F3P A;  2B4E A;  3SJL D;  2HXC A;  3EI3 B;  3F3G A;  5EAP A;  4FAV D;  3UR4 A;  2OVQ B;  3V5W B;  4A11 A;  4OZU A;  3JPX A;  2H14 A;  4JT6 C;  2EBS A;  3CIK B;  3OL2 A;  4JD2 C;  4JSX C;  4IA9 A;  2HKM A;  3RLM D;  3I7K A;  3VGZ A;  3MKQ A;  3V9F A;  3UKR C;  2H9L A;  4LG9 A;  3RN1 D;  4CY5 A;  1MDA H;  3EI2 B;  3RFG A;  5TEE A;  3IIY A;  2I0T A;  4E5Z B;  3IJ1 A;  3ZWL B;  1JOF A;  4A08 A;  4CI3 A;  4MK0 B;  2I3S A;  3UVM A;  3AFC A;  1NR0 A;  4CY3 A;  1OLZ A;  3EG6 A;  4L1Q D;  3FGB A;  3I7L A;  4GGD A;  4GZ8 A;  1TBG A;  2H47 A;  2YMU A;  2G9A A;  4J82 A;  2OIZ A;  4ZOV A;  4BUJ C;  3PXS D;  5EAL A;  3JZG A;  4PXW A;  5HE3 B;  1TYQ C;  1L0Q A;  3EI1 A;  2AGL A;  2GC4 A;  2W18 A;  4QT8 A;  4KFM B;  3OTT A;  4A2L A;  5THA A;  3AL9 A;  3DM0 A;  1QNI A;  4PBZ A;  1PGU A;  3JB9 L;  3DXM C;  2IUV A;  4J8B A;  5CYK B;  3EI3 A;  1PEV A;  3K26 A;  5FKR A;  4ZOX A;  4J8G A;  3SVW D;  3JRO A;  4BL0 A;  2Z2P A;  1XHM A;  3DWL C;  5TEF A;  4L3H D;  4JSN C;  3I7N A;  1A0R B;  4GM3 A;  5H14 A;  3B7F A;  4Y7R A;  5EAR A;  5FKS A;  4GGA A;  2AGW A;  5I5M A;  4CI1 A;  5FLX g;  4FA1 D;  3EI2 A;  5IC7 A;  4YVD A;  3SMR A;  2B5M A;  1SQJ A;  5HQG A;  4E5Z A;  4CI8 A;  1VYH C;  2P9N C;  3VH0 A;  3I8E A;  3SFZ A;  4A0A B;  4XYI A;  3V7D B;  3AL8 A;  4A0B B;  3NVX A;  3SBP A;  4O1Q D;  4N14 A;  2HES X;  2H6N A;  3W15 A;  2AH0 A;  4J77 A;  1SQ9 A;  3C5M A;  2CN3 A;  2I3T A;  2P9K C;  2AGY A;  1XKS A;  5CXC B;  5C2V B;  4FAN D;  3NVQ A;  3MXX A;  2XYI A;  2CE9 A;  4ERQ A;  1GP2 B;  2H6Q A;  2HKR A;  4J84 A;  5H1M A;  4X63 B;  5I5I A;  4CI2 A;  2PM9 B;  1P22 A;  3A0F A;  3UKU C;  3F3F A;  3C75 H;  2IUR A;  2Z2N A;  4H5I A;  4HDJ A;  2I0S A;  2OVR B;  3RSE C;  4FHL A;  5EMK B;  5TF2 A;  3JRP A;  5CYK A;  4GMB A;  3EI4 B;  2GNQ A;  2OK4 A;  3JAM g;  3CFS B;  5SXM A;  4A2M A;  4AEZ A;  3KRW B;  2YBA A;  4U7A A;  3NVN A;  4JXM A;  2O9K A;  2HJB A;  3L4M D;  4Y5R D;  1GXR A;  3MZK A;  3I89 A;  5IGQ A;  1S4U X;  3PSC B;  2YB8 B;  2CO0 A;  3N0E A;  4L3G D;  4QRJ A;  5K19 A;  3DSM A;  4D6V A;  3I7H A;  3SN6 B;  3GFC A;  2GC7 A;  3IJC A;  3JZH A;  4FA4 D;  4GGC A;  4A0A A;  1PBY B;  4A0B A;  3J80 g;  5AFU 3;  3P4F A;  2PBI B;  5CXB B;  2YNP A;  3I7P A;  4QL1 A;  3PVW B;  5GMK n;  3BWS A;  4FWW A;  3C9C A;  4ESG A;  2BCJ B;  2P9S C;  3DXK C;  5CXC A;  1N6E A;  4PC0 A;  5KDO B;  2PM7 B;  3K27 A;  5C9Z B;  5TDH B;  4TZ4 A;  1MG3 A;  4ZOY A;  2H9P A;  3SHF A;  4CY2 A;  4BH6 A;  2PM9 A;  2Q7Q A;  1N6D A;  4GQB B;  2P9L C;  4QQE A;  4J87 A;  3OW8 A;  2G99 A;  3OKY B;  4CZX A;  5EM2 B;  5B4W A;  4J86 A;  2CN2 A;  2B5N A;  1RI6 A;  1JJU B;  4L9O A;  2XL2 A;  2IWK A;  3EI4 A;  1ERJ A;  2H13 A;  4GM9 A;  2QXV A;  5IJ8 E;  4CC9 A;  4J0W A;  3SBR A;  5AJA A;  3EWE A;  4E54 B;  5GXH A;  5FXY A;  2MTA H;  4A08 B;  3RRM C;  4CZV A;  4A09 B;  2UZX B;  2J57 G;  2YNO A;  2OVP B;  2AH1 A;  1YFQ A;  3AH8 B;  2HJ4 A;  4Z8L A;  3BG0 A;  4J78 A;  5EML B;  2J55 H;  1R5M A;  4JT5 C;  2H9M A;  3J81 g;  5CXB A;  1Q47 A;  3SBQ A;  5JWZ A;  3PXW D;  2H68 A;  4JSV C;  1GOT B;  4J0X A;  3FRX A;  2IUP A;  3UVN A;  3N0D A;  5HYN B;  3I7O A;  3MMY A;  4J79 A;  2AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...