3NVXA

Molecular mechanism of guidance cue recognition
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
383
structure length
379
Chain Sequence
SIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLTNNNYITTSIKVKDTLVCGTNNGNPKCWKIDGSDDPKHRGRGYAPYQNSKVTIISYNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGLRGAFVDKDGTYDKVYILFTDTIGSKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSRTIKTDNDTILYVFFDSPYSKSALCTYSMNTIKQSFSTSKLEGYTKQLPSPAPGICLPAGKVVSHTTFEVIEKYNVLDDIIKPLSNQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENSIYSFDTKSKQTRSSQVDARLFSVMVTSKPLFIADIGIGVGMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
molecule keywords Protein A39
total genus 86
structure length 379
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvxA00
3JZNA 4H5JA 2YB8B 2Z2PA 5THAA 4FA1D 3DM0A 1QNIA 2CNXA 1ERJA 2H3XA 4IA9A 1U4CA 2H9NA 3CIKB 5GSAA 3F3PA 2I0TA 4X61B 3RN1D 3FM0A 2OK4A 3JRPA 5H14A 3U4YA 2B5MA 3PVWB 2Z2OA 1MDAH 4FA4D 3JROA 3IIWA 3DWLC 2H9LA 3C75H 4A11A 3DXMC 5EAPA 5HE0B 4L9OA 2GNQA 4XYHA 4LG8A 4FHLA 3KRWB 2IUQA 1GXRA 3F3GA 2TRCB 3IJ1A 3SCYA 2CN2A 2UZXB 3GREA 3OL2A 2P9IC 3I7KA 5FKQA 3PVUB 3N0DA 5EMMB 1L0QA 5IT9g 2Z2NA 1GOTB 4CY5A 2BCJB 5FLXg 4CY1A 5CYKA 4A08B 3EI2A 3I7PA 1PBYB 4ZOXA 4JT6C 4FAVD 2P9SC 4QRJA 4ZOVA 2J57G 2MTAH 5C2VB 3AH8B 3CFSB 5AJAA 3MMYA 4QL1A 2O9KA 4A11B 4GMBA 4KFMB 3ULEC 2EBSA 2XYIA 1NEXB 2AH1A 4BH6A 3DSMA 4BL0A 4J8BA 2CN3A 2QC5A 2B5LA 1VYHC 2AGLA 4O3UB 2OK6A 3RFHA 3UR4A 3NVNA 4O3TB 1B9YA 4AOWA 4ZOYA 4GZ8A 2H6QA 2Q7QA 4O9DA 2B5NA 2GC4A 4A08A 4JT5C 3F3FA 4FB1D 3L4OD 3OKYB 1SHYB 3BG1A 3SHFA 5SXMA 2HKMA 5HE1B 3EI4A 5EAMA 3SVWD 5TEEA 4CI1A 3V7DB 2YNPA 1SQ9A 2H14A 3PXTD 2IWFA 3JAMg 4PC0A 4A7JA 1N6EA 1OLZA 5K1CC 2HJ4A 4CI2A 2IAAA 3PXSD 3SXTD 4CZXA 3C99A 4IMMA 3RLMD 5IC7A 3A0FA 3RSEC 4U7AA 2XL2A 1R5MA 3EMHA 3JPXA 3I89A 4Y5RD 3RN0D 4JXMA 4PNKB 5H17A 1B9XA 4J82A 5CXBB 1P22A 3EI3A 3OKTA 4GGAA 1MG3A 3MKQA 5EM2A 4LG9A 4K3JB 3K26A 5CXBA 4J84A 4QQEA 5FKSA 3SBRA 5GXHA 1A0RB 2B4EA 1TBGA 2GC7A 4I79A 2AGWA 2AH0A 4QT8A 5A2Qg 5C9ZB 3B7FA 4EWRA 2BBKH 1MG2A 4H5IA 5EMLB 5IJ8E 3UVKA 2HXCA 4U1EI 3JB9L 2CE9A 3L4MD 5FKRA 3UVOA 4Z8LA 3AFCA 1GG2B 5GMKn 1U2VC 1JMZB 2HKRA 5IGOA 5KDOB 4PSXB 2H13A 3PE7A 4J78A 3SMRA 3J80g 3I7HA 3I7OA 3MKSB 4K3ID 3SWSD 5H1MA 2I0RA 2AGXA 2J56H 1FWXA 4J79A 2QXVA 4CI3A 2IUPA 4GM8A 3JZGA 3OKWA 3V9FA 4NSXA 3OTTA 4CI8A 3EI1B 1TYQC 5I5JA 4GQ1A 3PSLA 2I3TA 4D6VA 2OVQB 4J86A 2CO0C 5AMSA 3UVMA 3RFGA 4JSNC 4O1QD 4FA9D 3C5MA 2J55H 3OW8A 2H9PA 2YBAA 5EMJB 3FRXA 4XYIA 2I3SA 3UKRC 3UVLA 4A0BA 4ES0A 3IIYA 3J81g 3EI1A 5EM2B 3K27A 4JSVC 2AQ5A 4UI9R 5JWZA 2H47A 2XL3A 4X63B 1S4UX 3N0EA 3AL8A 4E54B 4J0XA 3DXKC 4FWWA 2CE8A 2AGYA 3VGZA 4FA5D 5C2WB 4Y7RA 4X60B 4J0WA 1NR0A 4J77A 5EARA 2OJYA 3SLED 1RI6A 3I7NA 5HE3B 4GM9A 4PSWB 4J8GA 4GGCA 4J87A 5EALA 2PM6B 2OVRB 1N6DA 4JSPC 5TDHB 5K19A 4ZN4A 3EI4B 3BWSA 3OKYA 4PBZA 3SBQA 4CZVA 5IJ7E 4ERYA 4CY3A 5AFU3 4GQBB 4OZUA 3RMZD 4E5ZA 3I2NA 4GM3A 1GP2B 4L1QD 5HQGA 3SJLD 1SQJA 3MXXA 2I0SA 4MK0B 4R7AB 3EWEA 4A2LA 2G99A 4G56B 3E0CA 4E5ZB 2IWKA 5TF2A 4XEIC 3IJ0A 3NVQA 4J81A 1OMWB 4CC9A 1YFQA 3I8CA 4O45A 3W15A 4E54A 5FA5B 3VH0A 3IJCA 4L3GD 3IKOA 4A0AB 2P9LC 3AL9A 1JOFA 3HFQA 4CZYA 2CO0A 3I7LA 3JZHA 3FGBA 1JMXB 4ERZA 5FQDA 4ERQA 3ORVD 2H6NA 2OVPB 2PBIB 1Q47A 2UZYB 3MZKA 4BUJC 1K8KC 2PM7B 4HDJA 5FXYA 3AL8B 5GXIA 3CFVA 5CXCA 1XHMA 5I5IA 4JD2C 5IGQA 3RRMC 2P9KC 4AEZA 1XIPA 2P9PC 4L3HD 4A0BB 5CYKB 2H9MA 1PEVA 2YMUA 4LGNA 5CXCB 3NVXA 3P4FA 3UVNA 4A09A 3I8EA 1JJUB 4GQ2P 1PGUA 4X3EA 2HJBA 3BG0A 3MZLA 4GGDA 4PXWA 2P9NC 2OIZA 4N14A 4A09B 3C9CA 4FAND 3GFCA 4TZ4A 4PBYA 3ODTA 3PXWD 3SN6B 5HE2B 3KRXB 1PI6A 2IUVA 2HYEA 2IURA 3V5WB 1XKSA 2H68A 2YNOA 4OWRA 3OL2B 2XU7A 3ZWLB 5B4WA 5HYNB 2H6KA 3VA6A 1N6FA 4YVDA 4D0KA 4A2MA 5I5MA 2G9AA 2AGZA 3EG6A 1K32A 4ESGA 3EI2B 4J73A 5EMKB 3EI3B 3UKUC 4A0AA 2P9UC 2PM9A 5TEFA 3SFZA 2YNNA 3EU7A 2PM9B 4CY2A 3SBPA 3PSCB 2HESX 4ZOZA 2W18A 4JSXC 5FKTA
chains in the Genus database with same CATH superfamily
1BPOA 3JZNA 4H5JA 2YB8B 2Z2PA 5M5UA 5THAA 3GD1I 4FA1D 3DM0A 1C9IA 1QNIA 1L5GA 1ERJA 2CNXA 4BCCA 2H3XA 4IA9A 5E6SA 5M5TA 1U4CA 2H9NA 3CIKB 5GSAA 3F3PA 3K71A 3EQ8A 1O6GA 2I0TA 4X61B 3RN1D 1E8MA 3FM0A 2OK4A 3JRPA 5H14A 3U4YA 2B5MA 3PVWB 2Z2OA 1MDAH 4FA4D 3JROA 3IIWA 3DWLC 2H9LA 3C75H 4A11A 3DXMC 5EAPA 3ZDXA 4MMZA 5HE0B 2VZ1A 4L9OA 1UOPA 2GNQA 4L1MA 3ZE1A 4XYHA 1QFMA 5C92A 4LG8A 1C9LA 4FHLA 1H2YA 3KRWB 3ZDZA 2IUQA 1GXRA 3F3GA 3V4PA 2TRCB 3IJ1A 3SCYA 2CN2A 2UZXB 3GREA 5M5RA 3OL2A 5C86A 2P9IC 3I7KA 5FKQA 3PVUB 3N0DA 5EMMB 1L0QA 5IT9g 2Z2NA 1GOTB 4CY5A 2BCJB 4BP8A 4CY1A 5CYKA 5FLXg 4NC4A 4A08B 3EI2A 3I7PA 1PBYB 1JV2A 4ZOXA 4JT6C 3IUQA 4FAVD 2P9SC 4QRJA 4ZOVA 2J57G 2MTAH 2JKXA 3QHYB 4WJKA 5C2VB 3AH8B 3CFSB 5AJAA 3MMYA 2EICA 4QL1A 3MVDK 2O9KA 4A11B 4GMBA 4KFMB 3ULEC 2EBSA 2XYIA 1NEXB 2AH1A 4BH6A 4AN1A 3DSMA 4BL0A 4J8BA 4NENA 1U8CA 4O2WA 2BKLA 3NIDA 2WQ8A 2CN3A 4DNUA 2QC5A 2B5LA 1O6FA 1VYHC 2AGLA 4AN0A 4O3UB 2OK6A 1M1XA 4RE5A 3RFHA 5FFOA 1H2ZA 3UR4A 3NVNA 3ZE2A 2HU8A 1B9YA 4O3TB 4AOWA 5FFGA 4ZOYA 4GZ8A 2H6QA 2Q7QA 2QZPA 4O9DA 2B5NA 2GC4A 4A08A 4JT5C 3F3FA 4FB1D 3L4OD 3OKYB 1SHYB 3O4JA 4RE6A 3IURA 3EQ7A 3BG1A 1VZ2A 3SHFA 5M5VA 5SXMA 2HKMA 5HE1B 3EI4A 5EAMA 3SVWD 5TEEA 3GC3B 4IRZA 4CI1A 3V7DB 2YNPA 1SQ9A 2H14A 3PXTD 2IWFA 3JAMg 4PC0A 4A7JA 1N6EA 1OLZA 3MUOA 5K1CC 1JTDB 2HJ4A 4CI2A 2IAAA 3PXSD 4WK2A 3SXTD 4CZXA 3C99A 2EIEA 4IMMA 3RLMD 5IC7A 3A0FA 3RSEC 1H2WA 4U7AA 2XL2A 1R5MA 3EMHA 2QR5A 3JPXA 3I89A 4Y5RD 3RN0D 4JXMA 4PNKB 4UM9A 4NAAA 5H17A 1B9XA 4MMXA 4J82A 5CXBB 1P22A 3EI3A 3OKTA 4BCDA 4GGAA 1MG3A 3MKQA 5EM2A 2VZ3A 4LG9A 4K3JB 3K26A 2VDKA 4AMYA 5CXBA 4J84A 4QQEA 5FKSA 3SBRA 5GXHA 1A0RB 2B4EA 1TBGA 2GC7A 4I79A 4NBMA 2VDPA 2AGWA 2AH0A 4QT8A 5A2Qg 5C9ZB 3B7FA 4EWRA 2BBKH 1MG2A 4H5IA 4O02A 5EMLB 5IJ8E 3UVKA 2HXCA 4U1EI 3JB9L 2CE9A 3L4MD 5FKRA 3UVOA 4D9SA 4Z8LA 3EQ9A 3AFCA 1GG2B 5GMKn 3IUJA 4JHNA 3ZDYA 1U2VC 1JMZB 2HKRA 5IGOA 5KDOB 4PSXB 2H13A 2XE4A 3PE7A 4J78A 3SMRA 1YR2A 3J80g 3I7HA 3I7OA 3MKSB 4K3ID 3SWSD 5H1MA 2I0RA 3K6SA 2AGXA 2J56H 1FWXA 3ZE0A 4J79A 2QXVA 4CI3A 2IUPA 4GM8A 3JZGA 3OKWA 3V9FA 4NSXA 3OTTA 4CI8A 3EI1B 4QAMA 1TYQC 5I5JA 4GQ1A 3PSLA 2I3TA 4D6VA 2OVQB 4J86A 2CO0C 5AMSA 3UVMA 3MUNA 3RFGA 4JSNC 4O1QD 1UTCA 2VC2A 4FA9D 3C5MA 2J55H 3OW8A 2H9PA 2YBAA 5EMJB 1UOQA 3FRXA 3O4HA 3K72A 4XYIA 1TYEA 2I3SA 3UKRC 3UVLA 4A0BA 4DNVA 4ES0A 3IIYA 3J81g 2EIDA 3EI1A 5EM2B 3K27A 2AQ5A 4JSVC 4UI9R 5JWZA 2H47A 5HDBA 2XL3A 4X63B 2XZGA 1S4UX 5E6UA 3N0EA 3AL8A 4E54B 4J0XA 3DXKC 2VDMA 4FWWA 2CE8A 2AGYA 3VGZA 4FA5D 4Z7OA 5C2WB 1E5TA 4Y7RA 4X60B 4J0WA 3NIFA 1NR0A 4J77A 5EARA 2OJYA 3SLED 1RI6A 3I7NA 5HE3B 4GM9A 4PSWB 3VI3A 4J8GA 4GGCA 4J87A 5EALA 2PM6B 1I2MB 2OVRB 3IUMA 2XDWA 1N6DA 4JSPC 5TDHB 5K19A 4ZN4A 3EI4B 1GOHA 3BWSA 3OKYA 4PBZA 3SBQA 4CZVA 5IJ7E 3IULA 4ERYA 4G55A 4CY3A 5AFU3 1H2XA 4GQBB 4OZUA 3RMZD 4E5ZA 3I2NA 4GM3A 1GP2B 2VDOA 4L1QD 5HQGA 3SJLD 1SQJA 3MXXA 2I0SA 4MK0B 4R7AB 4DNWA 3QI0A 3EWEA 5M5SA 4A2LA 2G99A 4G56B 3E0CA 4E5ZB 2IWKA 5TF2A 4XEIC 3IJ0A 3NVQA 1GOFA 4J81A 1OMWB 4WK0A 4CC9A 1YFQA 3I8CA 4O45A 3W15A 4E54A 5FA5B 1VZ3A 4BCBA 3VH0A 3IJCA 4L3GD 3IKOA 4G1MA 2P9LC 4A0AB 3AL9A 1K3IA 1JOFA 3HFQA 4CZYA 2CO0A 3I7LA 3JZHA 3FGBA 1JMXB 3V4VA 4ERZA 5FQDA 3IJEA 3T3PA 3T3MA 4BP9A 4ERQA 3ORVD 2H6NA 2OVPB 2PBIB 3IVMA 1Q47A 4MMYA 2UZYB 3MZKA 4BUJC 1K8KC 2VDQA 2PM7B 3O4GA 4HDJA 5FXYA 3AL8B 2EIBA 3VI4A 5GXIA 3CFVA 5CXCA 1XHMA 3O4IA 5I5IA 4JD2C 5IGQA 3RRMC 2P9KC 4AEZA 1GOGA 1XIPA 2P9PC 4L3HD 4A0BB 5CYKB 2H9MA 1PEVA 2YMUA 4LGNA 5CXCB 3NVXA 3P4FA 3UVNA 4A09A 3I8EA 1JJUB 2HU5A 4GQ2P 1PGUA 4X3EA 4AX4A 3IUNA 2HJBA 3BG0A 3MZLA 4GGDA 4PXWA 3FCUA 2P9NC 2OIZA 4N14A 4A09B 3C9CA 1UOOA 4FAND 2VDLA 3GFCA 1VE7A 1QFSA 4TZ4A 4PBYA 3ODTA 2VDNA 3DDUA 3PXWD 3SN6B 5HE2B 3KRXB 1PI6A 2IUVA 2HYEA 2IURA 4G1EA 3V5WB 1XKSA 2H68A 2YNOA 4OWRA 3OL2B 2XU7A 3ZWLB 4Z7QA 1A12A 5B4WA 2H6KA 5HYNB 3VA6A 1N6FA 4YVDA 4Z7NA 4D0KA 3FCSA 4A2MA 5E6RA 1T2XA 5I5MA 2G9AA 2AGZA 3EG6A 1K32A 4ESGA 3OF7A 3EI2B 5M61A 4J73A 5EMKB 3EI3B 3NIGA 3UKUC 4A0AA 2P9UC 2PM9A 4WK4A 5TEFA 3SFZA 2HU7A 2YNNA 4UM8A 3EU7A 3KCIA 4JHPC 2PM9B 4CY2A 1E8NA 1VE6A 3PSCB 3SBPA 2HESX 4ZOZA 4AMZA 2VDRA 2W18A 4JSXC 5FKTA
chains in the Genus database with same CATH topology
3JZNA 4H5JA 2YB8B 2Z2PA 5THAA 4FA1D 3DM0A 1QNIA 2CNXA 1ERJA 2H3XA 4IA9A 1U4CA 2H9NA 3CIKB 5GSAA 3F3PA 2I0TA 4X61B 3RN1D 3FM0A 2OK4A 3JRPA 5H14A 3U4YA 2B5MA 3PVWB 2Z2OA 1MDAH 4FA4D 3JROA 3IIWA 3DWLC 2H9LA 3C75H 4A11A 3DXMC 5EAPA 5HE0B 4L9OA 2GNQA 4XYHA 4LG8A 4FHLA 3KRWB 2IUQA 1GXRA 3F3GA 2TRCB 3IJ1A 3SCYA 2CN2A 2UZXB 3GREA 3OL2A 2P9IC 3I7KA 5FKQA 3PVUB 3N0DA 5EMMB 1L0QA 5IT9g 2Z2NA 1GOTB 4CY5A 2BCJB 5FLXg 4CY1A 5CYKA 4A08B 3EI2A 3I7PA 1PBYB 4ZOXA 4JT6C 4FAVD 2P9SC 4QRJA 4ZOVA 2J57G 2MTAH 5C2VB 3AH8B 3CFSB 5AJAA 3MMYA 4QL1A 2O9KA 4A11B 4GMBA 4KFMB 3ULEC 2EBSA 2XYIA 1NEXB 2AH1A 4BH6A 3DSMA 4BL0A 4J8BA 2CN3A 2QC5A 2B5LA 1VYHC 2AGLA 4O3UB 2OK6A 3RFHA 3UR4A 3NVNA 4O3TB 1B9YA 4AOWA 4ZOYA 4GZ8A 2H6QA 2Q7QA 4O9DA 2B5NA 2GC4A 4A08A 4JT5C 3F3FA 4FB1D 3L4OD 3OKYB 1SHYB 3BG1A 3SHFA 5SXMA 2HKMA 5HE1B 3EI4A 5EAMA 3SVWD 5TEEA 4CI1A 3V7DB 2YNPA 1SQ9A 2H14A 3PXTD 2IWFA 3JAMg 4PC0A 4A7JA 1N6EA 1OLZA 5K1CC 2HJ4A 4CI2A 2IAAA 3PXSD 3SXTD 4CZXA 3C99A 4IMMA 3RLMD 5IC7A 3A0FA 3RSEC 4U7AA 2XL2A 1R5MA 3EMHA 3JPXA 3I89A 4Y5RD 3RN0D 4JXMA 4PNKB 5H17A 1B9XA 4J82A 5CXBB 1P22A 3EI3A 3OKTA 4GGAA 1MG3A 3MKQA 5EM2A 4LG9A 4K3JB 3K26A 5CXBA 4J84A 4QQEA 5FKSA 3SBRA 5GXHA 1A0RB 2B4EA 1TBGA 2GC7A 4I79A 2AGWA 2AH0A 4QT8A 5A2Qg 5C9ZB 3B7FA 4EWRA 2BBKH 1MG2A 4H5IA 5EMLB 5IJ8E 3UVKA 2HXCA 4U1EI 3JB9L 2CE9A 3L4MD 5FKRA 3UVOA 4Z8LA 3AFCA 1GG2B 5GMKn 1U2VC 1JMZB 2HKRA 5IGOA 5KDOB 4PSXB 2H13A 3PE7A 4J78A 3SMRA 3J80g 3I7HA 3I7OA 3MKSB 4K3ID 3SWSD 5H1MA 2I0RA 2AGXA 2J56H 1FWXA 4J79A 2QXVA 4CI3A 2IUPA 4GM8A 3JZGA 3OKWA 3V9FA 4NSXA 3OTTA 4CI8A 3EI1B 1TYQC 5I5JA 4GQ1A 3PSLA 2I3TA 4D6VA 2OVQB 4J86A 2CO0C 5AMSA 3UVMA 3RFGA 4JSNC 4O1QD 4FA9D 3C5MA 2J55H 3OW8A 2H9PA 2YBAA 5EMJB 3FRXA 4XYIA 2I3SA 3UKRC 3UVLA 4A0BA 4ES0A 3IIYA 3J81g 3EI1A 5EM2B 3K27A 4JSVC 2AQ5A 4UI9R 5JWZA 2H47A 2XL3A 4X63B 1S4UX 3N0EA 3AL8A 4E54B 4J0XA 3DXKC 4FWWA 2CE8A 2AGYA 3VGZA 4FA5D 5C2WB 4Y7RA 4X60B 4J0WA 1NR0A 4J77A 5EARA 2OJYA 3SLED 1RI6A 3I7NA 5HE3B 4GM9A 4PSWB 4J8GA 4GGCA 4J87A 5EALA 2PM6B 2OVRB 1N6DA 4JSPC 5TDHB 5K19A 4ZN4A 3EI4B 3BWSA 3OKYA 4PBZA 3SBQA 4CZVA 5IJ7E 4ERYA 4CY3A 5AFU3 4GQBB 4OZUA 3RMZD 4E5ZA 3I2NA 4GM3A 1GP2B 4L1QD 5HQGA 3SJLD 1SQJA 3MXXA 2I0SA 4MK0B 4R7AB 3EWEA 4A2LA 2G99A 4G56B 3E0CA 4E5ZB 2IWKA 5TF2A 4XEIC 3IJ0A 3NVQA 4J81A 1OMWB 4CC9A 1YFQA 3I8CA 4O45A 3W15A 4E54A 5FA5B 3VH0A 3IJCA 4L3GD 3IKOA 4A0AB 2P9LC 3AL9A 1JOFA 3HFQA 4CZYA 2CO0A 3I7LA 3JZHA 3FGBA 1JMXB 4ERZA 5FQDA 4ERQA 3ORVD 2H6NA 2OVPB 2PBIB 1Q47A 2UZYB 3MZKA 4BUJC 1K8KC 2PM7B 4HDJA 5FXYA 3AL8B 5GXIA 3CFVA 5CXCA 1XHMA 5I5IA 4JD2C 5IGQA 3RRMC 2P9KC 4AEZA 1XIPA 2P9PC 4L3HD 4A0BB 5CYKB 2H9MA 1PEVA 2YMUA 4LGNA 5CXCB 3NVXA 3P4FA 3UVNA 4A09A 3I8EA 1JJUB 4GQ2P 1PGUA 4X3EA 2HJBA 3BG0A 3MZLA 4GGDA 4PXWA 2P9NC 2OIZA 4N14A 4A09B 3C9CA 4FAND 3GFCA 4TZ4A 4PBYA 3ODTA 3PXWD 3SN6B 5HE2B 3KRXB 1PI6A 2IUVA 2HYEA 2IURA 3V5WB 1XKSA 2H68A 2YNOA 4OWRA 3OL2B 2XU7A 3ZWLB 5B4WA 5HYNB 2H6KA 3VA6A 1N6FA 4YVDA 4D0KA 4A2MA 5I5MA 2G9AA 2AGZA 3EG6A 1K32A 4ESGA 3EI2B 4J73A 5EMKB 3EI3B 3UKUC 4A0AA 2P9UC 2PM9A 5TEFA 3SFZA 2YNNA 3EU7A 2PM9B 4CY2A 3SBPA 3PSCB 2HESX 4ZOZA 2W18A 4JSXC 5FKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZN A;  4H5J A;  2YB8 B;  2Z2P A;  5THA A;  4FA1 D;  3DM0 A;  1QNI A;  2CNX A;  1ERJ A;  2H3X A;  4IA9 A;  1U4C A;  2H9N A;  3CIK B;  5GSA A;  3F3P A;  2I0T A;  4X61 B;  3RN1 D;  3FM0 A;  2OK4 A;  3JRP A;  5H14 A;  3U4Y A;  2B5M A;  3PVW B;  2Z2O A;  1MDA H;  4FA4 D;  3JRO A;  3IIW A;  3DWL C;  2H9L A;  3C75 H;  4A11 A;  3DXM C;  5EAP A;  5HE0 B;  4L9O A;  2GNQ A;  4XYH A;  4LG8 A;  4FHL A;  3KRW B;  2IUQ A;  1GXR A;  3F3G A;  2TRC B;  3IJ1 A;  3SCY A;  2CN2 A;  2UZX B;  3GRE A;  3OL2 A;  2P9I C;  3I7K A;  5FKQ A;  3PVU B;  3N0D A;  5EMM B;  1L0Q A;  5IT9 g;  2Z2N A;  1GOT B;  4CY5 A;  2BCJ B;  5FLX g;  4CY1 A;  5CYK A;  4A08 B;  3EI2 A;  3I7P A;  1PBY B;  4ZOX A;  4JT6 C;  4FAV D;  2P9S C;  4QRJ A;  4ZOV A;  2J57 G;  2MTA H;  5C2V B;  3AH8 B;  3CFS B;  5AJA A;  3MMY A;  4QL1 A;  2O9K A;  4A11 B;  4GMB A;  4KFM B;  3ULE C;  2EBS A;  2XYI A;  1NEX B;  2AH1 A;  4BH6 A;  3DSM A;  4BL0 A;  4J8B A;  2CN3 A;  2QC5 A;  2B5L A;  1VYH C;  2AGL A;  4O3U B;  2OK6 A;  3RFH A;  3UR4 A;  3NVN A;  4O3T B;  1B9Y A;  4AOW A;  4ZOY A;  4GZ8 A;  2H6Q A;  2Q7Q A;  4O9D A;  2B5N A;  2GC4 A;  4A08 A;  4JT5 C;  3F3F A;  4FB1 D;  3L4O D;  3OKY B;  1SHY B;  3BG1 A;  3SHF A;  5SXM A;  2HKM A;  5HE1 B;  3EI4 A;  5EAM A;  3SVW D;  5TEE A;  4CI1 A;  3V7D B;  2YNP A;  1SQ9 A;  2H14 A;  3PXT D;  2IWF A;  3JAM g;  4PC0 A;  4A7J A;  1N6E A;  1OLZ A;  5K1C C;  2HJ4 A;  4CI2 A;  2IAA A;  3PXS D;  3SXT D;  4CZX A;  3C99 A;  4IMM A;  3RLM D;  5IC7 A;  3A0F A;  3RSE C;  4U7A A;  2XL2 A;  1R5M A;  3EMH A;  3JPX A;  3I89 A;  4Y5R D;  3RN0 D;  4JXM A;  4PNK B;  5H17 A;  1B9X A;  4J82 A;  5CXB B;  1P22 A;  3EI3 A;  3OKT A;  4GGA A;  1MG3 A;  3MKQ A;  5EM2 A;  4LG9 A;  4K3J B;  3K26 A;  5CXB A;  4J84 A;  4QQE A;  5FKS A;  3SBR A;  5GXH A;  1A0R B;  2B4E A;  1TBG A;  2GC7 A;  4I79 A;  2AGW A;  2AH0 A;  4QT8 A;  5A2Q g;  5C9Z B;  3B7F A;  4EWR A;  2BBK H;  1MG2 A;  4H5I A;  5EML B;  5IJ8 E;  3UVK A;  2HXC A;  4U1E I;  3JB9 L;  2CE9 A;  3L4M D;  5FKR A;  3UVO A;  4Z8L A;  3AFC A;  1GG2 B;  5GMK n;  1U2V C;  1JMZ B;  2HKR A;  5IGO A;  5KDO B;  4PSX B;  2H13 A;  3PE7 A;  4J78 A;  3SMR A;  3J80 g;  3I7H A;  3I7O A;  3MKS B;  4K3I D;  3SWS D;  5H1M A;  2I0R A;  2AGX A;  2J56 H;  1FWX A;  4J79 A;  2QXV A;  4CI3 A;  2IUP A;  4GM8 A;  3JZG A;  3OKW A;  3V9F A;  4NSX A;  3OTT A;  4CI8 A;  3EI1 B;  1TYQ C;  5I5J A;  4GQ1 A;  3PSL A;  2I3T A;  4D6V A;  2OVQ B;  4J86 A;  2CO0 C;  5AMS A;  3UVM A;  3RFG A;  4JSN C;  4O1Q D;  4FA9 D;  3C5M A;  2J55 H;  3OW8 A;  2H9P A;  2YBA A;  5EMJ B;  3FRX A;  4XYI A;  2I3S A;  3UKR C;  3UVL A;  4A0B A;  4ES0 A;  3IIY A;  3J81 g;  3EI1 A;  5EM2 B;  3K27 A;  4JSV C;  2AQ5 A;  4UI9 R;  5JWZ A;  2H47 A;  2XL3 A;  4X63 B;  1S4U X;  3N0E A;  3AL8 A;  4E54 B;  4J0X A;  3DXK C;  4FWW A;  2CE8 A;  2AGY A;  3VGZ A;  4FA5 D;  5C2W B;  4Y7R A;  4X60 B;  4J0W A;  1NR0 A;  4J77 A;  5EAR A;  2OJY A;  3SLE D;  1RI6 A;  3I7N A;  5HE3 B;  4GM9 A;  4PSW B;  4J8G A;  4GGC A;  4J87 A;  5EAL A;  2PM6 B;  2OVR B;  1N6D A;  4JSP C;  5TDH B;  5K19 A;  4ZN4 A;  3EI4 B;  3BWS A;  3OKY A;  4PBZ A;  3SBQ A;  4CZV A;  5IJ7 E;  4ERY A;  4CY3 A;  5AFU 3;  4GQB B;  4OZU A;  3RMZ D;  4E5Z A;  3I2N A;  4GM3 A;  1GP2 B;  4L1Q D;  5HQG A;  3SJL D;  1SQJ A;  3MXX A;  2I0S A;  4MK0 B;  4R7A B;  3EWE A;  4A2L A;  2G99 A;  4G56 B;  3E0C A;  4E5Z B;  2IWK A;  5TF2 A;  4XEI C;  3IJ0 A;  3NVQ A;  4J81 A;  1OMW B;  4CC9 A;  1YFQ A;  3I8C A;  4O45 A;  3W15 A;  4E54 A;  5FA5 B;  3VH0 A;  3IJC A;  4L3G D;  3IKO A;  4A0A B;  2P9L C;  3AL9 A;  1JOF A;  3HFQ A;  4CZY A;  2CO0 A;  3I7L A;  3JZH A;  3FGB A;  1JMX B;  4ERZ A;  5FQD A;  4ERQ A;  3ORV D;  2H6N A;  2OVP B;  2PBI B;  1Q47 A;  2UZY B;  3MZK A;  4BUJ C;  1K8K C;  2PM7 B;  4HDJ A;  5FXY A;  3AL8 B;  5GXI A;  3CFV A;  5CXC A;  1XHM A;  5I5I A;  4JD2 C;  5IGQ A;  3RRM C;  2P9K C;  4AEZ A;  1XIP A;  2P9P C;  4L3H D;  4A0B B;  5CYK B;  2H9M A;  1PEV A;  2YMU A;  4LGN A;  5CXC B;  3NVX A;  3P4F A;  3UVN A;  4A09 A;  3I8E A;  1JJU B;  4GQ2 P;  1PGU A;  4X3E A;  2HJB A;  3BG0 A;  3MZL A;  4GGD A;  4PXW A;  2P9N C;  2OIZ A;  4N14 A;  4A09 B;  3C9C A;  4FAN D;  3GFC A;  4TZ4 A;  4PBY A;  3ODT A;  3PXW D;  3SN6 B;  5HE2 B;  3KRX B;  1PI6 A;  2IUV A;  2HYE A;  2IUR A;  3V5W B;  1XKS A;  2H68 A;  2YNO A;  4OWR A;  3OL2 B;  2XU7 A;  3ZWL B;  5B4W A;  5HYN B;  2H6K A;  3VA6 A;  1N6F A;  4YVD A;  4D0K A;  4A2M A;  5I5M A;  2G9A A;  2AGZ A;  3EG6 A;  1K32 A;  4ESG A;  3EI2 B;  4J73 A;  5EMK B;  3EI3 B;  3UKU C;  4A0A A;  2P9U C;  2PM9 A;  5TEF A;  3SFZ A;  2YNN A;  3EU7 A;  2PM9 B;  4CY2 A;  3SBP A;  3PSC B;  2HES X;  4ZOZ A;  2W18 A;  4JSX C;  5FKT A; 
#chains in the Genus database with same CATH topology
 1BPO A;  3JZN A;  4H5J A;  2YB8 B;  2Z2P A;  5M5U A;  5THA A;  3GD1 I;  4FA1 D;  3DM0 A;  1C9I A;  1QNI A;  1L5G A;  1ERJ A;  2CNX A;  4BCC A;  2H3X A;  4IA9 A;  5E6S A;  5M5T A;  1U4C A;  2H9N A;  3CIK B;  5GSA A;  3F3P A;  3K71 A;  3EQ8 A;  1O6G A;  2I0T A;  4X61 B;  3RN1 D;  1E8M A;  3FM0 A;  2OK4 A;  3JRP A;  5H14 A;  3U4Y A;  2B5M A;  3PVW B;  2Z2O A;  1MDA H;  4FA4 D;  3JRO A;  3IIW A;  3DWL C;  2H9L A;  3C75 H;  4A11 A;  3DXM C;  5EAP A;  3ZDX A;  4MMZ A;  5HE0 B;  2VZ1 A;  4L9O A;  1UOP A;  2GNQ A;  4L1M A;  3ZE1 A;  4XYH A;  1QFM A;  5C92 A;  4LG8 A;  1C9L A;  4FHL A;  1H2Y A;  3KRW B;  3ZDZ A;  2IUQ A;  1GXR A;  3F3G A;  3V4P A;  2TRC B;  3IJ1 A;  3SCY A;  2CN2 A;  2UZX B;  3GRE A;  5M5R A;  3OL2 A;  5C86 A;  2P9I C;  3I7K A;  5FKQ A;  3PVU B;  3N0D A;  5EMM B;  1L0Q A;  5IT9 g;  2Z2N A;  1GOT B;  4CY5 A;  2BCJ B;  4BP8 A;  4CY1 A;  5CYK A;  5FLX g;  4NC4 A;  4A08 B;  3EI2 A;  3I7P A;  1PBY B;  1JV2 A;  4ZOX A;  4JT6 C;  3IUQ A;  4FAV D;  2P9S C;  4QRJ A;  4ZOV A;  2J57 G;  2MTA H;  2JKX A;  3QHY B;  4WJK A;  5C2V B;  3AH8 B;  3CFS B;  5AJA A;  3MMY A;  2EIC A;  4QL1 A;  3MVD K;  2O9K A;  4A11 B;  4GMB A;  4KFM B;  3ULE C;  2EBS A;  2XYI A;  1NEX B;  2AH1 A;  4BH6 A;  4AN1 A;  3DSM A;  4BL0 A;  4J8B A;  4NEN A;  1U8C A;  4O2W A;  2BKL A;  3NID A;  2WQ8 A;  2CN3 A;  4DNU A;  2QC5 A;  2B5L A;  1O6F A;  1VYH C;  2AGL A;  4AN0 A;  4O3U B;  2OK6 A;  1M1X A;  4RE5 A;  3RFH A;  5FFO A;  1H2Z A;  3UR4 A;  3NVN A;  3ZE2 A;  2HU8 A;  1B9Y A;  4O3T B;  4AOW A;  5FFG A;  4ZOY A;  4GZ8 A;  2H6Q A;  2Q7Q A;  2QZP A;  4O9D A;  2B5N A;  2GC4 A;  4A08 A;  4JT5 C;  3F3F A;  4FB1 D;  3L4O D;  3OKY B;  1SHY B;  3O4J A;  4RE6 A;  3IUR A;  3EQ7 A;  3BG1 A;  1VZ2 A;  3SHF A;  5M5V A;  5SXM A;  2HKM A;  5HE1 B;  3EI4 A;  5EAM A;  3SVW D;  5TEE A;  3GC3 B;  4IRZ A;  4CI1 A;  3V7D B;  2YNP A;  1SQ9 A;  2H14 A;  3PXT D;  2IWF A;  3JAM g;  4PC0 A;  4A7J A;  1N6E A;  1OLZ A;  3MUO A;  5K1C C;  1JTD B;  2HJ4 A;  4CI2 A;  2IAA A;  3PXS D;  4WK2 A;  3SXT D;  4CZX A;  3C99 A;  2EIE A;  4IMM A;  3RLM D;  5IC7 A;  3A0F A;  3RSE C;  1H2W A;  4U7A A;  2XL2 A;  1R5M A;  3EMH A;  2QR5 A;  3JPX A;  3I89 A;  4Y5R D;  3RN0 D;  4JXM A;  4PNK B;  4UM9 A;  4NAA A;  5H17 A;  1B9X A;  4MMX A;  4J82 A;  5CXB B;  1P22 A;  3EI3 A;  3OKT A;  4BCD A;  4GGA A;  1MG3 A;  3MKQ A;  5EM2 A;  2VZ3 A;  4LG9 A;  4K3J B;  3K26 A;  2VDK A;  4AMY A;  5CXB A;  4J84 A;  4QQE A;  5FKS A;  3SBR A;  5GXH A;  1A0R B;  2B4E A;  1TBG A;  2GC7 A;  4I79 A;  4NBM A;  2VDP A;  2AGW A;  2AH0 A;  4QT8 A;  5A2Q g;  5C9Z B;  3B7F A;  4EWR A;  2BBK H;  1MG2 A;  4H5I A;  4O02 A;  5EML B;  5IJ8 E;  3UVK A;  2HXC A;  4U1E I;  3JB9 L;  2CE9 A;  3L4M D;  5FKR A;  3UVO A;  4D9S A;  4Z8L A;  3EQ9 A;  3AFC A;  1GG2 B;  5GMK n;  3IUJ A;  4JHN A;  3ZDY A;  1U2V C;  1JMZ B;  2HKR A;  5IGO A;  5KDO B;  4PSX B;  2H13 A;  2XE4 A;  3PE7 A;  4J78 A;  3SMR A;  1YR2 A;  3J80 g;  3I7H A;  3I7O A;  3MKS B;  4K3I D;  3SWS D;  5H1M A;  2I0R A;  3K6S A;  2AGX A;  2J56 H;  1FWX A;  3ZE0 A;  4J79 A;  2QXV A;  4CI3 A;  2IUP A;  4GM8 A;  3JZG A;  3OKW A;  3V9F A;  4NSX A;  3OTT A;  4CI8 A;  3EI1 B;  4QAM A;  1TYQ C;  5I5J A;  4GQ1 A;  3PSL A;  2I3T A;  4D6V A;  2OVQ B;  4J86 A;  2CO0 C;  5AMS A;  3UVM A;  3MUN A;  3RFG A;  4JSN C;  4O1Q D;  1UTC A;  2VC2 A;  4FA9 D;  3C5M A;  2J55 H;  3OW8 A;  2H9P A;  2YBA A;  5EMJ B;  1UOQ A;  3FRX A;  3O4H A;  3K72 A;  4XYI A;  1TYE A;  2I3S A;  3UKR C;  3UVL A;  4A0B A;  4DNV A;  4ES0 A;  3IIY A;  3J81 g;  2EID A;  3EI1 A;  5EM2 B;  3K27 A;  2AQ5 A;  4JSV C;  4UI9 R;  5JWZ A;  2H47 A;  5HDB A;  2XL3 A;  4X63 B;  2XZG A;  1S4U X;  5E6U A;  3N0E A;  3AL8 A;  4E54 B;  4J0X A;  3DXK C;  2VDM A;  4FWW A;  2CE8 A;  2AGY A;  3VGZ A;  4FA5 D;  4Z7O A;  5C2W B;  1E5T A;  4Y7R A;  4X60 B;  4J0W A;  3NIF A;  1NR0 A;  4J77 A;  5EAR A;  2OJY A;  3SLE D;  1RI6 A;  3I7N A;  5HE3 B;  4GM9 A;  4PSW B;  3VI3 A;  4J8G A;  4GGC A;  4J87 A;  5EAL A;  2PM6 B;  1I2M B;  2OVR B;  3IUM A;  2XDW A;  1N6D A;  4JSP C;  5TDH B;  5K19 A;  4ZN4 A;  3EI4 B;  1GOH A;  3BWS A;  3OKY A;  4PBZ A;  3SBQ A;  4CZV A;  5IJ7 E;  3IUL A;  4ERY A;  4G55 A;  4CY3 A;  5AFU 3;  1H2X A;  4GQB B;  4OZU A;  3RMZ D;  4E5Z A;  3I2N A;  4GM3 A;  1GP2 B;  2VDO A;  4L1Q D;  5HQG A;  3SJL D;  1SQJ A;  3MXX A;  2I0S A;  4MK0 B;  4R7A B;  4DNW A;  3QI0 A;  3EWE A;  5M5S A;  4A2L A;  2G99 A;  4G56 B;  3E0C A;  4E5Z B;  2IWK A;  5TF2 A;  4XEI C;  3IJ0 A;  3NVQ A;  1GOF A;  4J81 A;  1OMW B;  4WK0 A;  4CC9 A;  1YFQ A;  3I8C A;  4O45 A;  3W15 A;  4E54 A;  5FA5 B;  1VZ3 A;  4BCB A;  3VH0 A;  3IJC A;  4L3G D;  3IKO A;  4G1M A;  2P9L C;  4A0A B;  3AL9 A;  1K3I A;  1JOF A;  3HFQ A;  4CZY A;  2CO0 A;  3I7L A;  3JZH A;  3FGB A;  1JMX B;  3V4V A;  4ERZ A;  5FQD A;  3IJE A;  3T3P A;  3T3M A;  4BP9 A;  4ERQ A;  3ORV D;  2H6N A;  2OVP B;  2PBI B;  3IVM A;  1Q47 A;  4MMY A;  2UZY B;  3MZK A;  4BUJ C;  1K8K C;  2VDQ A;  2PM7 B;  3O4G A;  4HDJ A;  5FXY A;  3AL8 B;  2EIB A;  3VI4 A;  5GXI A;  3CFV A;  5CXC A;  1XHM A;  3O4I A;  5I5I A;  4JD2 C;  5IGQ A;  3RRM C;  2P9K C;  4AEZ A;  1GOG A;  1XIP A;  2P9P C;  4L3H D;  4A0B B;  5CYK B;  2H9M A;  1PEV A;  2YMU A;  4LGN A;  5CXC B;  3NVX A;  3P4F A;  3UVN A;  4A09 A;  3I8E A;  1JJU B;  2HU5 A;  4GQ2 P;  1PGU A;  4X3E A;  4AX4 A;  3IUN A;  2HJB A;  3BG0 A;  3MZL A;  4GGD A;  4PXW A;  3FCU A;  2P9N C;  2OIZ A;  4N14 A;  4A09 B;  3C9C A;  1UOO A;  4FAN D;  2VDL A;  3GFC A;  1VE7 A;  1QFS A;  4TZ4 A;  4PBY A;  3ODT A;  2VDN A;  3DDU A;  3PXW D;  3SN6 B;  5HE2 B;  3KRX B;  1PI6 A;  2IUV A;  2HYE A;  2IUR A;  4G1E A;  3V5W B;  1XKS A;  2H68 A;  2YNO A;  4OWR A;  3OL2 B;  2XU7 A;  3ZWL B;  4Z7Q A;  1A12 A;  5B4W A;  2H6K A;  5HYN B;  3VA6 A;  1N6F A;  4YVD A;  4Z7N A;  4D0K A;  3FCS A;  4A2M A;  5E6R A;  1T2X A;  5I5M A;  2G9A A;  2AGZ A;  3EG6 A;  1K32 A;  4ESG A;  3OF7 A;  3EI2 B;  5M61 A;  4J73 A;  5EMK B;  3EI3 B;  3NIG A;  3UKU C;  4A0A A;  2P9U C;  2PM9 A;  4WK4 A;  5TEF A;  3SFZ A;  2HU7 A;  2YNN A;  4UM8 A;  3EU7 A;  3KCI A;  4JHP C;  2PM9 B;  4CY2 A;  1E8N A;  1VE6 A;  3PSC B;  3SBP A;  2HES X;  4ZOZ A;  4AMZ A;  2VDR A;  2W18 A;  4JSX C;  5FKT A; 
#chains in the Genus database with same CATH homology
 3JZN A;  4H5J A;  2YB8 B;  2Z2P A;  5THA A;  4FA1 D;  3DM0 A;  1QNI A;  2CNX A;  1ERJ A;  2H3X A;  4IA9 A;  1U4C A;  2H9N A;  3CIK B;  5GSA A;  3F3P A;  2I0T A;  4X61 B;  3RN1 D;  3FM0 A;  2OK4 A;  3JRP A;  5H14 A;  3U4Y A;  2B5M A;  3PVW B;  2Z2O A;  1MDA H;  4FA4 D;  3JRO A;  3IIW A;  3DWL C;  2H9L A;  3C75 H;  4A11 A;  3DXM C;  5EAP A;  5HE0 B;  4L9O A;  2GNQ A;  4XYH A;  4LG8 A;  4FHL A;  3KRW B;  2IUQ A;  1GXR A;  3F3G A;  2TRC B;  3IJ1 A;  3SCY A;  2CN2 A;  2UZX B;  3GRE A;  3OL2 A;  2P9I C;  3I7K A;  5FKQ A;  3PVU B;  3N0D A;  5EMM B;  1L0Q A;  5IT9 g;  2Z2N A;  1GOT B;  4CY5 A;  2BCJ B;  5FLX g;  4CY1 A;  5CYK A;  4A08 B;  3EI2 A;  3I7P A;  1PBY B;  4ZOX A;  4JT6 C;  4FAV D;  2P9S C;  4QRJ A;  4ZOV A;  2J57 G;  2MTA H;  5C2V B;  3AH8 B;  3CFS B;  5AJA A;  3MMY A;  4QL1 A;  2O9K A;  4A11 B;  4GMB A;  4KFM B;  3ULE C;  2EBS A;  2XYI A;  1NEX B;  2AH1 A;  4BH6 A;  3DSM A;  4BL0 A;  4J8B A;  2CN3 A;  2QC5 A;  2B5L A;  1VYH C;  2AGL A;  4O3U B;  2OK6 A;  3RFH A;  3UR4 A;  3NVN A;  4O3T B;  1B9Y A;  4AOW A;  4ZOY A;  4GZ8 A;  2H6Q A;  2Q7Q A;  4O9D A;  2B5N A;  2GC4 A;  4A08 A;  4JT5 C;  3F3F A;  4FB1 D;  3L4O D;  3OKY B;  1SHY B;  3BG1 A;  3SHF A;  5SXM A;  2HKM A;  5HE1 B;  3EI4 A;  5EAM A;  3SVW D;  5TEE A;  4CI1 A;  3V7D B;  2YNP A;  1SQ9 A;  2H14 A;  3PXT D;  2IWF A;  3JAM g;  4PC0 A;  4A7J A;  1N6E A;  1OLZ A;  5K1C C;  2HJ4 A;  4CI2 A;  2IAA A;  3PXS D;  3SXT D;  4CZX A;  3C99 A;  4IMM A;  3RLM D;  5IC7 A;  3A0F A;  3RSE C;  4U7A A;  2XL2 A;  1R5M A;  3EMH A;  3JPX A;  3I89 A;  4Y5R D;  3RN0 D;  4JXM A;  4PNK B;  5H17 A;  1B9X A;  4J82 A;  5CXB B;  1P22 A;  3EI3 A;  3OKT A;  4GGA A;  1MG3 A;  3MKQ A;  5EM2 A;  4LG9 A;  4K3J B;  3K26 A;  5CXB A;  4J84 A;  4QQE A;  5FKS A;  3SBR A;  5GXH A;  1A0R B;  2B4E A;  1TBG A;  2GC7 A;  4I79 A;  2AGW A;  2AH0 A;  4QT8 A;  5A2Q g;  5C9Z B;  3B7F A;  4EWR A;  2BBK H;  1MG2 A;  4H5I A;  5EML B;  5IJ8 E;  3UVK A;  2HXC A;  4U1E I;  3JB9 L;  2CE9 A;  3L4M D;  5FKR A;  3UVO A;  4Z8L A;  3AFC A;  1GG2 B;  5GMK n;  1U2V C;  1JMZ B;  2HKR A;  5IGO A;  5KDO B;  4PSX B;  2H13 A;  3PE7 A;  4J78 A;  3SMR A;  3J80 g;  3I7H A;  3I7O A;  3MKS B;  4K3I D;  3SWS D;  5H1M A;  2I0R A;  2AGX A;  2J56 H;  1FWX A;  4J79 A;  2QXV A;  4CI3 A;  2IUP A;  4GM8 A;  3JZG A;  3OKW A;  3V9F A;  4NSX A;  3OTT A;  4CI8 A;  3EI1 B;  1TYQ C;  5I5J A;  4GQ1 A;  3PSL A;  2I3T A;  4D6V A;  2OVQ B;  4J86 A;  2CO0 C;  5AMS A;  3UVM A;  3RFG A;  4JSN C;  4O1Q D;  4FA9 D;  3C5M A;  2J55 H;  3OW8 A;  2H9P A;  2YBA A;  5EMJ B;  3FRX A;  4XYI A;  2I3S A;  3UKR C;  3UVL A;  4A0B A;  4ES0 A;  3IIY A;  3J81 g;  3EI1 A;  5EM2 B;  3K27 A;  4JSV C;  2AQ5 A;  4UI9 R;  5JWZ A;  2H47 A;  2XL3 A;  4X63 B;  1S4U X;  3N0E A;  3AL8 A;  4E54 B;  4J0X A;  3DXK C;  4FWW A;  2CE8 A;  2AGY A;  3VGZ A;  4FA5 D;  5C2W B;  4Y7R A;  4X60 B;  4J0W A;  1NR0 A;  4J77 A;  5EAR A;  2OJY A;  3SLE D;  1RI6 A;  3I7N A;  5HE3 B;  4GM9 A;  4PSW B;  4J8G A;  4GGC A;  4J87 A;  5EAL A;  2PM6 B;  2OVR B;  1N6D A;  4JSP C;  5TDH B;  5K19 A;  4ZN4 A;  3EI4 B;  3BWS A;  3OKY A;  4PBZ A;  3SBQ A;  4CZV A;  5IJ7 E;  4ERY A;  4CY3 A;  5AFU 3;  4GQB B;  4OZU A;  3RMZ D;  4E5Z A;  3I2N A;  4GM3 A;  1GP2 B;  4L1Q D;  5HQG A;  3SJL D;  1SQJ A;  3MXX A;  2I0S A;  4MK0 B;  4R7A B;  3EWE A;  4A2L A;  2G99 A;  4G56 B;  3E0C A;  4E5Z B;  2IWK A;  5TF2 A;  4XEI C;  3IJ0 A;  3NVQ A;  4J81 A;  1OMW B;  4CC9 A;  1YFQ A;  3I8C A;  4O45 A;  3W15 A;  4E54 A;  5FA5 B;  3VH0 A;  3IJC A;  4L3G D;  3IKO A;  4A0A B;  2P9L C;  3AL9 A;  1JOF A;  3HFQ A;  4CZY A;  2CO0 A;  3I7L A;  3JZH A;  3FGB A;  1JMX B;  4ERZ A;  5FQD A;  4ERQ A;  3ORV D;  2H6N A;  2OVP B;  2PBI B;  1Q47 A;  2UZY B;  3MZK A;  4BUJ C;  1K8K C;  2PM7 B;  4HDJ A;  5FXY A;  3AL8 B;  5GXI A;  3CFV A;  5CXC A;  1XHM A;  5I5I A;  4JD2 C;  5IGQ A;  3RRM C;  2P9K C;  4AEZ A;  1XIP A;  2P9P C;  4L3H D;  4A0B B;  5CYK B;  2H9M A;  1PEV A;  2YMU A;  4LGN A;  5CXC B;  3NVX A;  3P4F A;  3UVN A;  4A09 A;  3I8E A;  1JJU B;  4GQ2 P;  1PGU A;  4X3E A;  2HJB A;  3BG0 A;  3MZL A;  4GGD A;  4PXW A;  2P9N C;  2OIZ A;  4N14 A;  4A09 B;  3C9C A;  4FAN D;  3GFC A;  4TZ4 A;  4PBY A;  3ODT A;  3PXW D;  3SN6 B;  5HE2 B;  3KRX B;  1PI6 A;  2IUV A;  2HYE A;  2IUR A;  3V5W B;  1XKS A;  2H68 A;  2YNO A;  4OWR A;  3OL2 B;  2XU7 A;  3ZWL B;  5B4W A;  5HYN B;  2H6K A;  3VA6 A;  1N6F A;  4YVD A;  4D0K A;  4A2M A;  5I5M A;  2G9A A;  2AGZ A;  3EG6 A;  1K32 A;  4ESG A;  3EI2 B;  4J73 A;  5EMK B;  3EI3 B;  3UKU C;  4A0A A;  2P9U C;  2PM9 A;  5TEF A;  3SFZ A;  2YNN A;  3EU7 A;  2PM9 B;  4CY2 A;  3SBP A;  3PSC B;  2HES X;  4ZOZ A;  2W18 A;  4JSX C;  5FKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...