3NVXA

Molecular mechanism of guidance cue recognition
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
383
structure length
379
Chain Sequence
SIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLTNNNYITTSIKVKDTLVCGTNNGNPKCWKIDGSDDPKHRGRGYAPYQNSKVTIISYNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGLRGAFVDKDGTYDKVYILFTDTIGSKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSRTIKTDNDTILYVFFDSPYSKSALCTYSMNTIKQSFSTSKLEGYTKQLPSPAPGICLPAGKVVSHTTFEVIEKYNVLDDIIKPLSNQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENSIYSFDTKSKQTRSSQVDARLFSVMVTSKPLFIADIGIGVGMPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
pubmed doi rcsb
molecule keywords Protein A39
molecule tags Viral protein
source organism Vaccinia virus
total genus 86
structure length 379
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3nvxA00
4YVDA 4ZOZA 3E0CA 4FWWA 4A7JA 4J79A 1XIPA 4PBYA 5GMKn 5I5MA 3CIKB 3EU7A 4N14A 4GMBA 4BH6A 4O3UB 5CYKB 4LGNA 1ERJA 3IJCA 3RN1D 3FM0A 3BG1A 2H68A 2YNOA 2I0TA 2PM6B 4GM3A 4J84A 1SHYB 5CXCA 2XL2A 2AGLA 3NVQA 4E54B 1PBYB 3EI3A 4J0XA 4CI2A 4O45A 5KDOB 2AGXA 3SHFA 2QXVA 4ZOVA 2P9LC 5H14A 5EM2A 3I8CA 3UR4A 3C5MA 2XU7A 4X60B 3RLMD 3I7LA 4L1QD 4ES0A 3IIWA 4FAVD 2GNQA 3KRXB 2YB8B 2H6NA 1OMWB 5H17A 2MTAH 3IKOA 5AJAA 3JPXA 2IUPA 2H6KA 2UZYB 1GP2B 3FRXA 4OWRA 4UI9R 4PNKB 5A2Qg 3PSCB 4JXMA 5GXHA 3PVUB 4JT5C 1R5MA 2H9MA 5FA5B 2AGYA 3OTTA 5B4WA 2CE8A 4A2MA 2OVQB 2OK6A 5IJ8E 2IURA 2YMUA 4ZOYA 5C9ZB 4IA9A 3OKYA 2B5LA 3C99A 4CI8A 2AH0A 2IWKA 4A0AB 1U4CA 3SVWD 4A2LA 2IUVA 3ODTA 3I7PA 2HESX 2CN2A 5HE2B 1SQJA 5EALA 3BG0A 4K3JB 2OVRB 4Y5RD 2UZXB 4J81A 4X63B 5GXIA 3DSMA 4Y7RA 4PBZA 1PI6A 4J8BA 2I3TA 2XYIA 4LG9A 2P9SC 3ORVD 2HJ4A 3I2NA 3EWEA 1P22A 3JZNA 4D0KA 5FLXg 4JSXC 5IGOA 3GFCA 2CE9A 5IGQA 4ERZA 4J73A 3GREA 2IWFA 1JJUB 3SBQA 1NR0A 5AMSA 3PXTD 1B9XA 3MKQA 5TF2A 5AFU3 1N6EA 4BUJC 3BWSA 2BCJB 2PM7B 5CXBB 4AEZA 3MMYA 4GGCA 5EMKB 4E5ZA 5EARA 5EMMB 3PE7A 4CY2A 2G99A 4GQ1A 2PM9A 2H47A 4XEIC 5SXMA 3JROA 5IC7A 1GG2B 1TYQC 3PVWB 1XKSA 4CY3A 1K8KC 1XHMA 4CY1A 3SXTD 1YFQA 2P9KC 2YBAA 2J56H 4QQEA 5HE0B 1PGUA 4PC0A 5CYKA 3UVMA 3F3FA 3RFHA 4ZOXA 4J87A 1NEXB 2AGZA 5FKSA 5K1CC 3L4OD 2I0SA 2AGWA 4FA4D 4L9OA 4R7AB 2AH1A 3VGZA 1JOFA 4A09B 4A08B 4E54A 4O3TB 4L3HD 3JAMg 3V5WB 4U1EI 4OZUA 5TEEA 4I79A 3EMHA 4K3ID 3V9FA 1TBGA 5HE3B 4JSVC 4JT6C 3AL9A 2QC5A 3DXKC 2GC7A 3L4MD 3UVNA 4JD2C 4CZXA 4J8GA 1GOTB 3VA6A 4FHLA 5C2WB 2O9KA 3KRWB 1VYHC 2I3SA 2TRCB 3EG6A 3I7KA 2YNPA 2GC4A 4FA9D 2Z2NA 2XL3A 1JMZB 5H1MA 3UVLA 2OVPB 2OIZA 2P9PC 1JMXB 2P9NC 3F3GA 3PXWD 3U4YA 1PEVA 3C75H 2IUQA 5GSAA 1GXRA 4ESGA 1OLZA 4AOWA 2W18A 4GGAA 2H13A 2HKRA 5FQDA 3MZLA 4GQ2P 3SBRA 5IT9g 2J57G 4QL1A 2HJBA 3RMZD 3EI4B 4G56B 4A0BB 4LG8A 5EMJB 4GQBB 5EMLB 3SFZA 3I7NA 4FB1D 4MK0B 5TEFA 4A0AA 4IMMA 3UKUC 2H9LA 4XYIA 3PSLA 4ZN4A 4HDJA 5EAMA 3SLED 3RN0D 3SN6B 2OK4A 5TDHB 3OKWA 3OL2B 4KFMB 3UVOA 3J81g 2B5MA 3NVXA 5I5IA 3RRMC 2HXCA 3HFQA 4CZYA 3SWSD 3K27A 3DXMC 3PXSD 3DWLC 2OJYA 4BL0A 3UKRC 4PXWA 1QNIA 3DM0A 4D6VA 1A0RB 3V7DB 3I7OA 1MG2A 5FKQA 2Z2OA 3I7HA 1SQ9A 3MZKA 1B9YA 4TZ4A 4H5IA 3EI1B 3FGBA 3J80g 3VH0A 3JZGA 5CXBA 3SMRA 2B5NA 5CXCB 2P9UC 3EI3B 3CFSB 3I89A 4L3GD 4QRJA 2CN3A 3F3PA 5EM2B 3B7FA 3NVNA 3EI1A 3OW8A 4J77A 5I5JA 4PSWB 2H6QA 3IJ0A 2CNXA 4GM9A 1N6FA 3C9CA 4J0WA 3RSEC 2CO0A 4JSPC 2AQ5A 4EWRA 2G9AA 2H14A 3N0EA 4X61B 4U7AA 4FA1D 3JB9L 4A09A 4A08A 4GM8A 2P9IC 2Q7QA 3AFCA 5THAA 2H3XA 4JSNC 3MXXA 2H9PA 4O9DA 3IIYA 4Z8LA 1RI6A 4ERQA 5HQGA 3JZHA 3SJLD 3W15A 5FXYA 4FA5D 1Q47A 2HKMA 5EAPA 3OKYB 4GZ8A 4GGDA 3ZWLB 3K26A 4XYHA 5HE1B 3SBPA 2IAAA 5HYNB 3OKTA 1S4UX 4X3EA 4CI1A 3P4FA 3MKSB 3SCYA 3AL8B 1U2VC 4QT8A 5JWZA 2CO0C 3JRPA 2Z2PA 3EI4A 4A0BA 1K32A 3UVKA 4A11B 4CI3A 2EBSA 2H9NA 5C2VB 3RFGA 1N6DA 1FWXA 3A0FA 4J82A 2PBIB 4CY5A 3CFVA 2B4EA 4FAND 3ULEC 1MDAH 1MG3A 4H5JA 5FKTA 2I0RA 3AL8A 2BBKH 5IJ7E 4NSXA 3AH8B 3EI2B 4CZVA 1L0QA 3N0DA 4A11A 3OL2A 5FKRA 2HYEA 4J78A 3IJ1A 4ERYA 4PSXB 4E5ZB 2J55H 3I8EA 2YNNA 2PM9B 4O1QD 3EI2A 5K19A 4J86A 4CC9A
chains in the Genus database with same CATH superfamily
4YVDA 4ZOZA 3E0CA 4FWWA 2EICA 4A7JA 1VZ3A 4J79A 1XIPA 4PBYA 5GMKn 5I5MA 3CIKB 3EU7A 4N14A 4GMBA 4BH6A 4O3UB 5CYKB 4LGNA 1ERJA 3IJCA 3RN1D 3FM0A 3ZDXA 3BG1A 2H68A 2YNOA 2I0TA 2PM6B 4GM3A 5FFOA 1GOGA 1SHYB 4J84A 1H2WA 2XL2A 5CXCA 4AMZA 2AGLA 3NVQA 4BCBA 4E54B 1O6FA 1PBYB 3EI3A 4J0XA 4CI2A 2VDNA 4O45A 5KDOB 2AGXA 3SHFA 2QXVA 4ZOVA 2P9LC 5H14A 1UOQA 5EM2A 4AMYA 3MUNA 3I8CA 3UR4A 3C5MA 2XU7A 4X60B 3RLMD 1O6GA 3I7LA 4L1QD 1GOHA 4ES0A 3O4HA 3IIWA 4FAVD 2GNQA 3KRXB 1GOFA 3IUJA 2YB8B 2H6NA 1OMWB 3EQ9A 4WK2A 5H17A 3K6SA 2MTAH 5C86A 1JV2A 3IKOA 5AJAA 3JPXA 2IUPA 2H6KA 2UZYB 1GP2B 3FRXA 4MMYA 4AN1A 3MVDK 4OWRA 4UI9R 4PNKB 5A2Qg 3PSCB 4JXMA 5GXHA 5FFGA 3PVUB 4MMXA 3QI0A 4JT5C 4RE6A 1R5MA 2H9MA 5FA5B 4DNUA 2AGYA 3OTTA 4UM8A 5B4WA 2CE8A 4A2MA 2OVQB 2OK6A 5IJ8E 2IURA 2YMUA 4ZOYA 5C9ZB 4IA9A 3IURA 3ZDZA 1UOPA 3OKYA 2B5LA 3C99A 4CI8A 2AH0A 2IWKA 4A0AB 3NIFA 1U4CA 3SVWD 4A2LA 2IUVA 3ODTA 3I7PA 1JTDB 2HESX 4RE5A 3EQ8A 4QAMA 2CN2A 5E6RA 5HE2B 1SQJA 5EALA 4NAAA 3BG0A 4K3JB 2QR5A 2OVRB 3IUNA 4Y5RD 2UZXB 3FCUA 4J81A 4X63B 5GXIA 3DSMA 4Y7RA 4NC4A 4PBZA 1PI6A 4J8BA 2I3TA 2XYIA 4LG9A 2P9SC 3ORVD 2HJ4A 3NIGA 3I2NA 3EWEA 1P22A 3JZNA 4D0KA 4D9SA 5FLXg 2WQ8A 4JSXC 5IGOA 3GFCA 2CE9A 3ZE0A 5IGQA 4ERZA 4J73A 3GREA 4O02A 2IWFA 1JJUB 3SBQA 3IUMA 1NR0A 5AMSA 3PXTD 5M5TA 1B9XA 3MKQA 5TF2A 5AFU3 1N6EA 4BUJC 3FCSA 3VI3A 3BWSA 2BCJB 2PM7B 5CXBB 4AEZA 3MMYA 4GGCA 5EMKB 4E5ZA 5EARA 5EMMB 3PE7A 2VZ3A 4WJKA 4CY2A 2G99A 4GQ1A 2PM9A 2H47A 4XEIC 5SXMA 3JROA 5IC7A 1GG2B 3MUOA 1U8CA 1TYQC 3PVWB 1XKSA 4AX4A 4CY3A 1K8KC 1XHMA 4CY1A 3SXTD 1YFQA 2P9KC 2YBAA 1UOOA 2J56H 4NENA 4QQEA 5HE0B 1PGUA 4PC0A 5CYKA 3UVMA 3F3FA 3RFHA 4ZOXA 4J87A 1NEXB 2AGZA 5FKSA 5K1CC 3L4OD 2I0SA 2AGWA 4FA4D 1VE7A 4L9OA 4R7AB 2AH1A 3VGZA 1JOFA 3EQ7A 4A09B 4A08B 4E54A 4O3TB 4L3HD 3JAMg 3V5WB 4U1EI 4OZUA 5TEEA 1VE6A 4I79A 3EMHA 4K3ID 3V9FA 1C9LA 1TBGA 4WK0A 5HE3B 4JSVC 4JT6C 3OF7A 3AL9A 3IUQA 2HU7A 2VDKA 2QC5A 3DXKC 4G1MA 2GC7A 3O4IA 3L4MD 3UVNA 4JD2C 1H2ZA 3O4JA 4CZXA 2BKLA 1GOTB 4J8GA 3VA6A 4BP9A 4FHLA 4BCCA 5C2WB 2O9KA 1E8MA 3KRWB 1VYHC 3ZDYA 2I3SA 2TRCB 4NBMA 3EG6A 3I7KA 2YNPA 4Z7QA 2GC4A 4FA9D 2Z2NA 2XL3A 1JMZB 4MMZA 5H1MA 3UVLA 2OVPB 3V4PA 2OIZA 2JKXA 2P9PC 1JMXB 2P9NC 3F3GA 3PXWD 3U4YA 1PEVA 3C75H 2IUQA 5GSAA 1K3IA 1GXRA 4ESGA 1OLZA 4AOWA 2W18A 4GGAA 2H13A 2HKRA 5FQDA 5M5VA 3MZLA 4GQ2P 3SBRA 5IT9g 2J57G 4QL1A 2HJBA 3RMZD 3EI4B 4G56B 4A0BB 3QHYB 2XE4A 4LG8A 5EMJB 2VDLA 4GQBB 5EMLB 3SFZA 5C92A 3I7NA 3GD1I 4UM9A 1I2MB 4FB1D 4MK0B 5TEFA 4A0AA 1YR2A 3IVMA 4JHNA 4IMMA 3UKUC 2H9LA 4IRZA 1M1XA 4Z7OA 4XYIA 3PSLA 4ZN4A 4HDJA 3IULA 5EAMA 3SLED 3RN0D 3SN6B 2OK4A 5TDHB 5M61A 3OKWA 3OL2B 4KFMB 3UVOA 3J81g 2B5MA 1L5GA 4G55A 3NVXA 5I5IA 2HU8A 3RRMC 2HXCA 2HU5A 3HFQA 4AN0A 4CZYA 3SWSD 3K27A 5M5SA 3DXMC 3PXSD 2VC2A 1UTCA 2XZGA 3DWLC 4O2WA 2OJYA 4BL0A 3UKRC 4PXWA 4DNWA 1QNIA 3DM0A 4D6VA 1A0RB 1TYEA 3I7OA 3V7DB 1MG2A 2VDOA 5FKQA 2Z2OA 3I7HA 1SQ9A 3MZKA 1B9YA 4L1MA 5E6UA 3V4VA 4TZ4A 4H5IA 3EI1B 3FGBA 4Z7NA 2XDWA 3J80g 3VH0A 3JZGA 5CXBA 3SMRA 2B5NA 5CXCB 2P9UC 3EI3B 1A12A 3K71A 3CFSB 3I89A 4L3GD 4G1EA 4QRJA 4DNVA 2CN3A 3F3PA 5EM2B 3B7FA 3NVNA 3EI1A 3GC3B 1H2YA 3OW8A 4J77A 3K72A 1VZ2A 5I5JA 2VDRA 2H6QA 3IJ0A 4PSWB 2CNXA 4GM9A 1N6FA 3C9CA 2VDPA 4J0WA 3RSEC 2QZPA 2CO0A 4JSPC 2AQ5A 4EWRA 2G9AA 5M5UA 2H14A 3N0EA 4X61B 4U7AA 5M5RA 4FA1D 3JB9L 4WK4A 4A09A 4A08A 4GM8A 4BCDA 2P9IC 2Q7QA 3AFCA 5THAA 2VDQA 2H3XA 4JSNC 3MXXA 2H9PA 4O9DA 3IIYA 4Z8LA 1RI6A 4ERQA 5HQGA 3JZHA 3SJLD 3W15A 5FXYA 2VZ1A 4FA5D 1Q47A 2HKMA 5EAPA 3OKYB 4GZ8A 4GGDA 2EIDA 3ZWLB 3K26A 4XYHA 3T3MA 1H2XA 5HE1B 3SBPA 2IAAA 5HYNB 3ZE2A 3OKTA 1S4UX 4X3EA 4CI1A 3P4FA 3IJEA 3MKSB 2EIBA 2EIEA 3SCYA 3O4GA 3AL8B 4BP8A 1U2VC 4QT8A 3ZE1A 5JWZA 2CO0C 3JRPA 2Z2PA 3EI4A 4A0BA 1K32A 1C9IA 3UVKA 4A11B 4CI3A 2EBSA 2H9NA 3VI4A 5C2VB 3RFGA 2VDMA 1N6DA 1FWXA 3A0FA 4J82A 2PBIB 4CY5A 3NIDA 3CFVA 2B4EA 4FAND 3ULEC 5E6SA 1MDAH 1MG3A 4H5JA 5FKTA 2I0RA 3AL8A 5HDBA 1BPOA 2BBKH 5IJ7E 4JHPC 1QFSA 1QFMA 4NSXA 3AH8B 3EI2B 4CZVA 1L0QA 3DDUA 3N0DA 4A11A 3OL2A 5FKRA 2HYEA 4J78A 3KCIA 3IJ1A 1E8NA 4ERYA 4PSXB 4E5ZB 2J55H 3I8EA 3T3PA 1E5TA 2YNNA 2PM9B 4O1QD 3EI2A 1T2XA 5K19A 4J86A 4CC9A
chains in the Genus database with same CATH topology
4YVDA 4ZOZA 3E0CA 4FWWA 4A7JA 4J79A 1XIPA 4PBYA 5GMKn 5I5MA 3CIKB 3EU7A 4N14A 4GMBA 4BH6A 4O3UB 5CYKB 4LGNA 1ERJA 3IJCA 3RN1D 3FM0A 3BG1A 2H68A 2YNOA 2I0TA 2PM6B 4GM3A 4J84A 1SHYB 5CXCA 2XL2A 2AGLA 3NVQA 4E54B 1PBYB 3EI3A 4J0XA 4CI2A 4O45A 5KDOB 2AGXA 3SHFA 2QXVA 4ZOVA 2P9LC 5H14A 5EM2A 3I8CA 3UR4A 3C5MA 2XU7A 4X60B 3RLMD 3I7LA 4L1QD 4ES0A 3IIWA 4FAVD 2GNQA 3KRXB 2YB8B 2H6NA 1OMWB 5H17A 2MTAH 3IKOA 5AJAA 3JPXA 2IUPA 2H6KA 2UZYB 1GP2B 3FRXA 4OWRA 4UI9R 4PNKB 5A2Qg 3PSCB 4JXMA 5GXHA 3PVUB 4JT5C 1R5MA 2H9MA 5FA5B 2AGYA 3OTTA 5B4WA 2CE8A 4A2MA 2OVQB 2OK6A 5IJ8E 2IURA 2YMUA 4ZOYA 5C9ZB 4IA9A 3OKYA 2B5LA 3C99A 4CI8A 2AH0A 2IWKA 4A0AB 1U4CA 3SVWD 4A2LA 2IUVA 3ODTA 3I7PA 2HESX 2CN2A 5HE2B 1SQJA 5EALA 3BG0A 4K3JB 2OVRB 4Y5RD 2UZXB 4J81A 4X63B 5GXIA 3DSMA 4Y7RA 4PBZA 1PI6A 4J8BA 2I3TA 2XYIA 4LG9A 2P9SC 3ORVD 2HJ4A 3I2NA 3EWEA 1P22A 3JZNA 4D0KA 5FLXg 4JSXC 5IGOA 3GFCA 2CE9A 5IGQA 4ERZA 4J73A 3GREA 2IWFA 1JJUB 3SBQA 1NR0A 5AMSA 3PXTD 1B9XA 3MKQA 5TF2A 5AFU3 1N6EA 4BUJC 3BWSA 2BCJB 2PM7B 5CXBB 4AEZA 3MMYA 4GGCA 5EMKB 4E5ZA 5EARA 5EMMB 3PE7A 4CY2A 2G99A 4GQ1A 2PM9A 2H47A 4XEIC 5SXMA 3JROA 5IC7A 1GG2B 1TYQC 3PVWB 1XKSA 4CY3A 1K8KC 1XHMA 4CY1A 3SXTD 1YFQA 2P9KC 2YBAA 2J56H 4QQEA 5HE0B 1PGUA 4PC0A 5CYKA 3UVMA 3F3FA 3RFHA 4ZOXA 4J87A 1NEXB 2AGZA 5FKSA 5K1CC 3L4OD 2I0SA 2AGWA 4FA4D 4L9OA 4R7AB 2AH1A 3VGZA 1JOFA 4A09B 4A08B 4E54A 4O3TB 4L3HD 3JAMg 3V5WB 4U1EI 4OZUA 5TEEA 4I79A 3EMHA 4K3ID 3V9FA 1TBGA 5HE3B 4JSVC 4JT6C 3AL9A 2QC5A 3DXKC 2GC7A 3L4MD 3UVNA 4JD2C 4CZXA 4J8GA 1GOTB 3VA6A 4FHLA 5C2WB 2O9KA 3KRWB 1VYHC 2I3SA 2TRCB 3EG6A 3I7KA 2YNPA 2GC4A 4FA9D 2Z2NA 2XL3A 1JMZB 5H1MA 3UVLA 2OVPB 2OIZA 2P9PC 1JMXB 2P9NC 3F3GA 3PXWD 3U4YA 1PEVA 3C75H 2IUQA 5GSAA 1GXRA 4ESGA 1OLZA 4AOWA 2W18A 4GGAA 2H13A 2HKRA 5FQDA 3MZLA 4GQ2P 3SBRA 5IT9g 2J57G 4QL1A 2HJBA 3RMZD 3EI4B 4G56B 4A0BB 4LG8A 5EMJB 4GQBB 5EMLB 3SFZA 3I7NA 4FB1D 4MK0B 5TEFA 4A0AA 4IMMA 3UKUC 2H9LA 4XYIA 3PSLA 4ZN4A 4HDJA 5EAMA 3SLED 3RN0D 3SN6B 2OK4A 5TDHB 3OKWA 3OL2B 4KFMB 3UVOA 3J81g 2B5MA 3NVXA 5I5IA 3RRMC 2HXCA 3HFQA 4CZYA 3SWSD 3K27A 3DXMC 3PXSD 3DWLC 2OJYA 4BL0A 3UKRC 4PXWA 1QNIA 3DM0A 4D6VA 1A0RB 3V7DB 3I7OA 1MG2A 5FKQA 2Z2OA 3I7HA 1SQ9A 3MZKA 1B9YA 4TZ4A 4H5IA 3EI1B 3FGBA 3J80g 3VH0A 3JZGA 5CXBA 3SMRA 2B5NA 5CXCB 2P9UC 3EI3B 3CFSB 3I89A 4L3GD 4QRJA 2CN3A 3F3PA 5EM2B 3B7FA 3NVNA 3EI1A 3OW8A 4J77A 5I5JA 4PSWB 2H6QA 3IJ0A 2CNXA 4GM9A 1N6FA 3C9CA 4J0WA 3RSEC 2CO0A 4JSPC 2AQ5A 4EWRA 2G9AA 2H14A 3N0EA 4X61B 4U7AA 4FA1D 3JB9L 4A09A 4A08A 4GM8A 2P9IC 2Q7QA 3AFCA 5THAA 2H3XA 4JSNC 3MXXA 2H9PA 4O9DA 3IIYA 4Z8LA 1RI6A 4ERQA 5HQGA 3JZHA 3SJLD 3W15A 5FXYA 4FA5D 1Q47A 2HKMA 5EAPA 3OKYB 4GZ8A 4GGDA 3ZWLB 3K26A 4XYHA 5HE1B 3SBPA 2IAAA 5HYNB 3OKTA 1S4UX 4X3EA 4CI1A 3P4FA 3MKSB 3SCYA 3AL8B 1U2VC 4QT8A 5JWZA 2CO0C 3JRPA 2Z2PA 3EI4A 4A0BA 1K32A 3UVKA 4A11B 4CI3A 2EBSA 2H9NA 5C2VB 3RFGA 1N6DA 1FWXA 3A0FA 4J82A 2PBIB 4CY5A 3CFVA 2B4EA 4FAND 3ULEC 1MDAH 1MG3A 4H5JA 5FKTA 2I0RA 3AL8A 2BBKH 5IJ7E 4NSXA 3AH8B 3EI2B 4CZVA 1L0QA 3N0DA 4A11A 3OL2A 5FKRA 2HYEA 4J78A 3IJ1A 4ERYA 4PSXB 4E5ZB 2J55H 3I8EA 2YNNA 2PM9B 4O1QD 3EI2A 5K19A 4J86A 4CC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YVD A;  4ZOZ A;  3E0C A;  4FWW A;  4A7J A;  4J79 A;  1XIP A;  4PBY A;  5GMK n;  5I5M A;  3CIK B;  3EU7 A;  4N14 A;  4GMB A;  4BH6 A;  4O3U B;  5CYK B;  4LGN A;  1ERJ A;  3IJC A;  3RN1 D;  3FM0 A;  3BG1 A;  2H68 A;  2YNO A;  2I0T A;  2PM6 B;  4GM3 A;  4J84 A;  1SHY B;  5CXC A;  2XL2 A;  2AGL A;  3NVQ A;  4E54 B;  1PBY B;  3EI3 A;  4J0X A;  4CI2 A;  4O45 A;  5KDO B;  2AGX A;  3SHF A;  2QXV A;  4ZOV A;  2P9L C;  5H14 A;  5EM2 A;  3I8C A;  3UR4 A;  3C5M A;  2XU7 A;  4X60 B;  3RLM D;  3I7L A;  4L1Q D;  4ES0 A;  3IIW A;  4FAV D;  2GNQ A;  3KRX B;  2YB8 B;  2H6N A;  1OMW B;  5H17 A;  2MTA H;  3IKO A;  5AJA A;  3JPX A;  2IUP A;  2H6K A;  2UZY B;  1GP2 B;  3FRX A;  4OWR A;  4UI9 R;  4PNK B;  5A2Q g;  3PSC B;  4JXM A;  5GXH A;  3PVU B;  4JT5 C;  1R5M A;  2H9M A;  5FA5 B;  2AGY A;  3OTT A;  5B4W A;  2CE8 A;  4A2M A;  2OVQ B;  2OK6 A;  5IJ8 E;  2IUR A;  2YMU A;  4ZOY A;  5C9Z B;  4IA9 A;  3OKY A;  2B5L A;  3C99 A;  4CI8 A;  2AH0 A;  2IWK A;  4A0A B;  1U4C A;  3SVW D;  4A2L A;  2IUV A;  3ODT A;  3I7P A;  2HES X;  2CN2 A;  5HE2 B;  1SQJ A;  5EAL A;  3BG0 A;  4K3J B;  2OVR B;  4Y5R D;  2UZX B;  4J81 A;  4X63 B;  5GXI A;  3DSM A;  4Y7R A;  4PBZ A;  1PI6 A;  4J8B A;  2I3T A;  2XYI A;  4LG9 A;  2P9S C;  3ORV D;  2HJ4 A;  3I2N A;  3EWE A;  1P22 A;  3JZN A;  4D0K A;  5FLX g;  4JSX C;  5IGO A;  3GFC A;  2CE9 A;  5IGQ A;  4ERZ A;  4J73 A;  3GRE A;  2IWF A;  1JJU B;  3SBQ A;  1NR0 A;  5AMS A;  3PXT D;  1B9X A;  3MKQ A;  5TF2 A;  5AFU 3;  1N6E A;  4BUJ C;  3BWS A;  2BCJ B;  2PM7 B;  5CXB B;  4AEZ A;  3MMY A;  4GGC A;  5EMK B;  4E5Z A;  5EAR A;  5EMM B;  3PE7 A;  4CY2 A;  2G99 A;  4GQ1 A;  2PM9 A;  2H47 A;  4XEI C;  5SXM A;  3JRO A;  5IC7 A;  1GG2 B;  1TYQ C;  3PVW B;  1XKS A;  4CY3 A;  1K8K C;  1XHM A;  4CY1 A;  3SXT D;  1YFQ A;  2P9K C;  2YBA A;  2J56 H;  4QQE A;  5HE0 B;  1PGU A;  4PC0 A;  5CYK A;  3UVM A;  3F3F A;  3RFH A;  4ZOX A;  4J87 A;  1NEX B;  2AGZ A;  5FKS A;  5K1C C;  3L4O D;  2I0S A;  2AGW A;  4FA4 D;  4L9O A;  4R7A B;  2AH1 A;  3VGZ A;  1JOF A;  4A09 B;  4A08 B;  4E54 A;  4O3T B;  4L3H D;  3JAM g;  3V5W B;  4U1E I;  4OZU A;  5TEE A;  4I79 A;  3EMH A;  4K3I D;  3V9F A;  1TBG A;  5HE3 B;  4JSV C;  4JT6 C;  3AL9 A;  2QC5 A;  3DXK C;  2GC7 A;  3L4M D;  3UVN A;  4JD2 C;  4CZX A;  4J8G A;  1GOT B;  3VA6 A;  4FHL A;  5C2W B;  2O9K A;  3KRW B;  1VYH C;  2I3S A;  2TRC B;  3EG6 A;  3I7K A;  2YNP A;  2GC4 A;  4FA9 D;  2Z2N A;  2XL3 A;  1JMZ B;  5H1M A;  3UVL A;  2OVP B;  2OIZ A;  2P9P C;  1JMX B;  2P9N C;  3F3G A;  3PXW D;  3U4Y A;  1PEV A;  3C75 H;  2IUQ A;  5GSA A;  1GXR A;  4ESG A;  1OLZ A;  4AOW A;  2W18 A;  4GGA A;  2H13 A;  2HKR A;  5FQD A;  3MZL A;  4GQ2 P;  3SBR A;  5IT9 g;  2J57 G;  4QL1 A;  2HJB A;  3RMZ D;  3EI4 B;  4G56 B;  4A0B B;  4LG8 A;  5EMJ B;  4GQB B;  5EML B;  3SFZ A;  3I7N A;  4FB1 D;  4MK0 B;  5TEF A;  4A0A A;  4IMM A;  3UKU C;  2H9L A;  4XYI A;  3PSL A;  4ZN4 A;  4HDJ A;  5EAM A;  3SLE D;  3RN0 D;  3SN6 B;  2OK4 A;  5TDH B;  3OKW A;  3OL2 B;  4KFM B;  3UVO A;  3J81 g;  2B5M A;  3NVX A;  5I5I A;  3RRM C;  2HXC A;  3HFQ A;  4CZY A;  3SWS D;  3K27 A;  3DXM C;  3PXS D;  3DWL C;  2OJY A;  4BL0 A;  3UKR C;  4PXW A;  1QNI A;  3DM0 A;  4D6V A;  1A0R B;  3V7D B;  3I7O A;  1MG2 A;  5FKQ A;  2Z2O A;  3I7H A;  1SQ9 A;  3MZK A;  1B9Y A;  4TZ4 A;  4H5I A;  3EI1 B;  3FGB A;  3J80 g;  3VH0 A;  3JZG A;  5CXB A;  3SMR A;  2B5N A;  5CXC B;  2P9U C;  3EI3 B;  3CFS B;  3I89 A;  4L3G D;  4QRJ A;  2CN3 A;  3F3P A;  5EM2 B;  3B7F A;  3NVN A;  3EI1 A;  3OW8 A;  4J77 A;  5I5J A;  4PSW B;  2H6Q A;  3IJ0 A;  2CNX A;  4GM9 A;  1N6F A;  3C9C A;  4J0W A;  3RSE C;  2CO0 A;  4JSP C;  2AQ5 A;  4EWR A;  2G9A A;  2H14 A;  3N0E A;  4X61 B;  4U7A A;  4FA1 D;  3JB9 L;  4A09 A;  4A08 A;  4GM8 A;  2P9I C;  2Q7Q A;  3AFC A;  5THA A;  2H3X A;  4JSN C;  3MXX A;  2H9P A;  4O9D A;  3IIY A;  4Z8L A;  1RI6 A;  4ERQ A;  5HQG A;  3JZH A;  3SJL D;  3W15 A;  5FXY A;  4FA5 D;  1Q47 A;  2HKM A;  5EAP A;  3OKY B;  4GZ8 A;  4GGD A;  3ZWL B;  3K26 A;  4XYH A;  5HE1 B;  3SBP A;  2IAA A;  5HYN B;  3OKT A;  1S4U X;  4X3E A;  4CI1 A;  3P4F A;  3MKS B;  3SCY A;  3AL8 B;  1U2V C;  4QT8 A;  5JWZ A;  2CO0 C;  3JRP A;  2Z2P A;  3EI4 A;  4A0B A;  1K32 A;  3UVK A;  4A11 B;  4CI3 A;  2EBS A;  2H9N A;  5C2V B;  3RFG A;  1N6D A;  1FWX A;  3A0F A;  4J82 A;  2PBI B;  4CY5 A;  3CFV A;  2B4E A;  4FAN D;  3ULE C;  1MDA H;  1MG3 A;  4H5J A;  5FKT A;  2I0R A;  3AL8 A;  2BBK H;  5IJ7 E;  4NSX A;  3AH8 B;  3EI2 B;  4CZV A;  1L0Q A;  3N0D A;  4A11 A;  3OL2 A;  5FKR A;  2HYE A;  4J78 A;  3IJ1 A;  4ERY A;  4PSX B;  4E5Z B;  2J55 H;  3I8E A;  2YNN A;  2PM9 B;  4O1Q D;  3EI2 A;  5K19 A;  4J86 A;  4CC9 A; 
#chains in the Genus database with same CATH topology
 4YVD A;  4ZOZ A;  3E0C A;  4FWW A;  2EIC A;  4A7J A;  1VZ3 A;  4J79 A;  1XIP A;  4PBY A;  5GMK n;  5I5M A;  3CIK B;  3EU7 A;  4N14 A;  4GMB A;  4BH6 A;  4O3U B;  5CYK B;  4LGN A;  1ERJ A;  3IJC A;  3RN1 D;  3FM0 A;  3ZDX A;  3BG1 A;  2H68 A;  2YNO A;  2I0T A;  2PM6 B;  4GM3 A;  5FFO A;  1GOG A;  1SHY B;  4J84 A;  1H2W A;  2XL2 A;  5CXC A;  4AMZ A;  2AGL A;  3NVQ A;  4BCB A;  4E54 B;  1O6F A;  1PBY B;  3EI3 A;  4J0X A;  4CI2 A;  2VDN A;  4O45 A;  5KDO B;  2AGX A;  3SHF A;  2QXV A;  4ZOV A;  2P9L C;  5H14 A;  1UOQ A;  5EM2 A;  4AMY A;  3MUN A;  3I8C A;  3UR4 A;  3C5M A;  2XU7 A;  4X60 B;  3RLM D;  1O6G A;  3I7L A;  4L1Q D;  1GOH A;  4ES0 A;  3O4H A;  3IIW A;  4FAV D;  2GNQ A;  3KRX B;  1GOF A;  3IUJ A;  2YB8 B;  2H6N A;  1OMW B;  3EQ9 A;  4WK2 A;  5H17 A;  3K6S A;  2MTA H;  5C86 A;  1JV2 A;  3IKO A;  5AJA A;  3JPX A;  2IUP A;  2H6K A;  2UZY B;  1GP2 B;  3FRX A;  4MMY A;  4AN1 A;  3MVD K;  4OWR A;  4UI9 R;  4PNK B;  5A2Q g;  3PSC B;  4JXM A;  5GXH A;  5FFG A;  3PVU B;  4MMX A;  3QI0 A;  4JT5 C;  4RE6 A;  1R5M A;  2H9M A;  5FA5 B;  4DNU A;  2AGY A;  3OTT A;  4UM8 A;  5B4W A;  2CE8 A;  4A2M A;  2OVQ B;  2OK6 A;  5IJ8 E;  2IUR A;  2YMU A;  4ZOY A;  5C9Z B;  4IA9 A;  3IUR A;  3ZDZ A;  1UOP A;  3OKY A;  2B5L A;  3C99 A;  4CI8 A;  2AH0 A;  2IWK A;  4A0A B;  3NIF A;  1U4C A;  3SVW D;  4A2L A;  2IUV A;  3ODT A;  3I7P A;  1JTD B;  2HES X;  4RE5 A;  3EQ8 A;  4QAM A;  2CN2 A;  5E6R A;  5HE2 B;  1SQJ A;  5EAL A;  4NAA A;  3BG0 A;  4K3J B;  2QR5 A;  2OVR B;  3IUN A;  4Y5R D;  2UZX B;  3FCU A;  4J81 A;  4X63 B;  5GXI A;  3DSM A;  4Y7R A;  4NC4 A;  4PBZ A;  1PI6 A;  4J8B A;  2I3T A;  2XYI A;  4LG9 A;  2P9S C;  3ORV D;  2HJ4 A;  3NIG A;  3I2N A;  3EWE A;  1P22 A;  3JZN A;  4D0K A;  4D9S A;  5FLX g;  2WQ8 A;  4JSX C;  5IGO A;  3GFC A;  2CE9 A;  3ZE0 A;  5IGQ A;  4ERZ A;  4J73 A;  3GRE A;  4O02 A;  2IWF A;  1JJU B;  3SBQ A;  3IUM A;  1NR0 A;  5AMS A;  3PXT D;  5M5T A;  1B9X A;  3MKQ A;  5TF2 A;  5AFU 3;  1N6E A;  4BUJ C;  3FCS A;  3VI3 A;  3BWS A;  2BCJ B;  2PM7 B;  5CXB B;  4AEZ A;  3MMY A;  4GGC A;  5EMK B;  4E5Z A;  5EAR A;  5EMM B;  3PE7 A;  2VZ3 A;  4WJK A;  4CY2 A;  2G99 A;  4GQ1 A;  2PM9 A;  2H47 A;  4XEI C;  5SXM A;  3JRO A;  5IC7 A;  1GG2 B;  3MUO A;  1U8C A;  1TYQ C;  3PVW B;  1XKS A;  4AX4 A;  4CY3 A;  1K8K C;  1XHM A;  4CY1 A;  3SXT D;  1YFQ A;  2P9K C;  2YBA A;  1UOO A;  2J56 H;  4NEN A;  4QQE A;  5HE0 B;  1PGU A;  4PC0 A;  5CYK A;  3UVM A;  3F3F A;  3RFH A;  4ZOX A;  4J87 A;  1NEX B;  2AGZ A;  5FKS A;  5K1C C;  3L4O D;  2I0S A;  2AGW A;  4FA4 D;  1VE7 A;  4L9O A;  4R7A B;  2AH1 A;  3VGZ A;  1JOF A;  3EQ7 A;  4A09 B;  4A08 B;  4E54 A;  4O3T B;  4L3H D;  3JAM g;  3V5W B;  4U1E I;  4OZU A;  5TEE A;  1VE6 A;  4I79 A;  3EMH A;  4K3I D;  3V9F A;  1C9L A;  1TBG A;  4WK0 A;  5HE3 B;  4JSV C;  4JT6 C;  3OF7 A;  3AL9 A;  3IUQ A;  2HU7 A;  2VDK A;  2QC5 A;  3DXK C;  4G1M A;  2GC7 A;  3O4I A;  3L4M D;  3UVN A;  4JD2 C;  1H2Z A;  3O4J A;  4CZX A;  2BKL A;  1GOT B;  4J8G A;  3VA6 A;  4BP9 A;  4FHL A;  4BCC A;  5C2W B;  2O9K A;  1E8M A;  3KRW B;  1VYH C;  3ZDY A;  2I3S A;  2TRC B;  4NBM A;  3EG6 A;  3I7K A;  2YNP A;  4Z7Q A;  2GC4 A;  4FA9 D;  2Z2N A;  2XL3 A;  1JMZ B;  4MMZ A;  5H1M A;  3UVL A;  2OVP B;  3V4P A;  2OIZ A;  2JKX A;  2P9P C;  1JMX B;  2P9N C;  3F3G A;  3PXW D;  3U4Y A;  1PEV A;  3C75 H;  2IUQ A;  5GSA A;  1K3I A;  1GXR A;  4ESG A;  1OLZ A;  4AOW A;  2W18 A;  4GGA A;  2H13 A;  2HKR A;  5FQD A;  5M5V A;  3MZL A;  4GQ2 P;  3SBR A;  5IT9 g;  2J57 G;  4QL1 A;  2HJB A;  3RMZ D;  3EI4 B;  4G56 B;  4A0B B;  3QHY B;  2XE4 A;  4LG8 A;  5EMJ B;  2VDL A;  4GQB B;  5EML B;  3SFZ A;  5C92 A;  3I7N A;  3GD1 I;  4UM9 A;  1I2M B;  4FB1 D;  4MK0 B;  5TEF A;  4A0A A;  1YR2 A;  3IVM A;  4JHN A;  4IMM A;  3UKU C;  2H9L A;  4IRZ A;  1M1X A;  4Z7O A;  4XYI A;  3PSL A;  4ZN4 A;  4HDJ A;  3IUL A;  5EAM A;  3SLE D;  3RN0 D;  3SN6 B;  2OK4 A;  5TDH B;  5M61 A;  3OKW A;  3OL2 B;  4KFM B;  3UVO A;  3J81 g;  2B5M A;  1L5G A;  4G55 A;  3NVX A;  5I5I A;  2HU8 A;  3RRM C;  2HXC A;  2HU5 A;  3HFQ A;  4AN0 A;  4CZY A;  3SWS D;  3K27 A;  5M5S A;  3DXM C;  3PXS D;  2VC2 A;  1UTC A;  2XZG A;  3DWL C;  4O2W A;  2OJY A;  4BL0 A;  3UKR C;  4PXW A;  4DNW A;  1QNI A;  3DM0 A;  4D6V A;  1A0R B;  1TYE A;  3I7O A;  3V7D B;  1MG2 A;  2VDO A;  5FKQ A;  2Z2O A;  3I7H A;  1SQ9 A;  3MZK A;  1B9Y A;  4L1M A;  5E6U A;  3V4V A;  4TZ4 A;  4H5I A;  3EI1 B;  3FGB A;  4Z7N A;  2XDW A;  3J80 g;  3VH0 A;  3JZG A;  5CXB A;  3SMR A;  2B5N A;  5CXC B;  2P9U C;  3EI3 B;  1A12 A;  3K71 A;  3CFS B;  3I89 A;  4L3G D;  4G1E A;  4QRJ A;  4DNV A;  2CN3 A;  3F3P A;  5EM2 B;  3B7F A;  3NVN A;  3EI1 A;  3GC3 B;  1H2Y A;  3OW8 A;  4J77 A;  3K72 A;  1VZ2 A;  5I5J A;  2VDR A;  2H6Q A;  3IJ0 A;  4PSW B;  2CNX A;  4GM9 A;  1N6F A;  3C9C A;  2VDP A;  4J0W A;  3RSE C;  2QZP A;  2CO0 A;  4JSP C;  2AQ5 A;  4EWR A;  2G9A A;  5M5U A;  2H14 A;  3N0E A;  4X61 B;  4U7A A;  5M5R A;  4FA1 D;  3JB9 L;  4WK4 A;  4A09 A;  4A08 A;  4GM8 A;  4BCD A;  2P9I C;  2Q7Q A;  3AFC A;  5THA A;  2VDQ A;  2H3X A;  4JSN C;  3MXX A;  2H9P A;  4O9D A;  3IIY A;  4Z8L A;  1RI6 A;  4ERQ A;  5HQG A;  3JZH A;  3SJL D;  3W15 A;  5FXY A;  2VZ1 A;  4FA5 D;  1Q47 A;  2HKM A;  5EAP A;  3OKY B;  4GZ8 A;  4GGD A;  2EID A;  3ZWL B;  3K26 A;  4XYH A;  3T3M A;  1H2X A;  5HE1 B;  3SBP A;  2IAA A;  5HYN B;  3ZE2 A;  3OKT A;  1S4U X;  4X3E A;  4CI1 A;  3P4F A;  3IJE A;  3MKS B;  2EIB A;  2EIE A;  3SCY A;  3O4G A;  3AL8 B;  4BP8 A;  1U2V C;  4QT8 A;  3ZE1 A;  5JWZ A;  2CO0 C;  3JRP A;  2Z2P A;  3EI4 A;  4A0B A;  1K32 A;  1C9I A;  3UVK A;  4A11 B;  4CI3 A;  2EBS A;  2H9N A;  3VI4 A;  5C2V B;  3RFG A;  2VDM A;  1N6D A;  1FWX A;  3A0F A;  4J82 A;  2PBI B;  4CY5 A;  3NID A;  3CFV A;  2B4E A;  4FAN D;  3ULE C;  5E6S A;  1MDA H;  1MG3 A;  4H5J A;  5FKT A;  2I0R A;  3AL8 A;  5HDB A;  1BPO A;  2BBK H;  5IJ7 E;  4JHP C;  1QFS A;  1QFM A;  4NSX A;  3AH8 B;  3EI2 B;  4CZV A;  1L0Q A;  3DDU A;  3N0D A;  4A11 A;  3OL2 A;  5FKR A;  2HYE A;  4J78 A;  3KCI A;  3IJ1 A;  1E8N A;  4ERY A;  4PSX B;  4E5Z B;  2J55 H;  3I8E A;  3T3P A;  1E5T A;  2YNN A;  2PM9 B;  4O1Q D;  3EI2 A;  1T2X A;  5K19 A;  4J86 A;  4CC9 A; 
#chains in the Genus database with same CATH homology
 4YVD A;  4ZOZ A;  3E0C A;  4FWW A;  4A7J A;  4J79 A;  1XIP A;  4PBY A;  5GMK n;  5I5M A;  3CIK B;  3EU7 A;  4N14 A;  4GMB A;  4BH6 A;  4O3U B;  5CYK B;  4LGN A;  1ERJ A;  3IJC A;  3RN1 D;  3FM0 A;  3BG1 A;  2H68 A;  2YNO A;  2I0T A;  2PM6 B;  4GM3 A;  4J84 A;  1SHY B;  5CXC A;  2XL2 A;  2AGL A;  3NVQ A;  4E54 B;  1PBY B;  3EI3 A;  4J0X A;  4CI2 A;  4O45 A;  5KDO B;  2AGX A;  3SHF A;  2QXV A;  4ZOV A;  2P9L C;  5H14 A;  5EM2 A;  3I8C A;  3UR4 A;  3C5M A;  2XU7 A;  4X60 B;  3RLM D;  3I7L A;  4L1Q D;  4ES0 A;  3IIW A;  4FAV D;  2GNQ A;  3KRX B;  2YB8 B;  2H6N A;  1OMW B;  5H17 A;  2MTA H;  3IKO A;  5AJA A;  3JPX A;  2IUP A;  2H6K A;  2UZY B;  1GP2 B;  3FRX A;  4OWR A;  4UI9 R;  4PNK B;  5A2Q g;  3PSC B;  4JXM A;  5GXH A;  3PVU B;  4JT5 C;  1R5M A;  2H9M A;  5FA5 B;  2AGY A;  3OTT A;  5B4W A;  2CE8 A;  4A2M A;  2OVQ B;  2OK6 A;  5IJ8 E;  2IUR A;  2YMU A;  4ZOY A;  5C9Z B;  4IA9 A;  3OKY A;  2B5L A;  3C99 A;  4CI8 A;  2AH0 A;  2IWK A;  4A0A B;  1U4C A;  3SVW D;  4A2L A;  2IUV A;  3ODT A;  3I7P A;  2HES X;  2CN2 A;  5HE2 B;  1SQJ A;  5EAL A;  3BG0 A;  4K3J B;  2OVR B;  4Y5R D;  2UZX B;  4J81 A;  4X63 B;  5GXI A;  3DSM A;  4Y7R A;  4PBZ A;  1PI6 A;  4J8B A;  2I3T A;  2XYI A;  4LG9 A;  2P9S C;  3ORV D;  2HJ4 A;  3I2N A;  3EWE A;  1P22 A;  3JZN A;  4D0K A;  5FLX g;  4JSX C;  5IGO A;  3GFC A;  2CE9 A;  5IGQ A;  4ERZ A;  4J73 A;  3GRE A;  2IWF A;  1JJU B;  3SBQ A;  1NR0 A;  5AMS A;  3PXT D;  1B9X A;  3MKQ A;  5TF2 A;  5AFU 3;  1N6E A;  4BUJ C;  3BWS A;  2BCJ B;  2PM7 B;  5CXB B;  4AEZ A;  3MMY A;  4GGC A;  5EMK B;  4E5Z A;  5EAR A;  5EMM B;  3PE7 A;  4CY2 A;  2G99 A;  4GQ1 A;  2PM9 A;  2H47 A;  4XEI C;  5SXM A;  3JRO A;  5IC7 A;  1GG2 B;  1TYQ C;  3PVW B;  1XKS A;  4CY3 A;  1K8K C;  1XHM A;  4CY1 A;  3SXT D;  1YFQ A;  2P9K C;  2YBA A;  2J56 H;  4QQE A;  5HE0 B;  1PGU A;  4PC0 A;  5CYK A;  3UVM A;  3F3F A;  3RFH A;  4ZOX A;  4J87 A;  1NEX B;  2AGZ A;  5FKS A;  5K1C C;  3L4O D;  2I0S A;  2AGW A;  4FA4 D;  4L9O A;  4R7A B;  2AH1 A;  3VGZ A;  1JOF A;  4A09 B;  4A08 B;  4E54 A;  4O3T B;  4L3H D;  3JAM g;  3V5W B;  4U1E I;  4OZU A;  5TEE A;  4I79 A;  3EMH A;  4K3I D;  3V9F A;  1TBG A;  5HE3 B;  4JSV C;  4JT6 C;  3AL9 A;  2QC5 A;  3DXK C;  2GC7 A;  3L4M D;  3UVN A;  4JD2 C;  4CZX A;  4J8G A;  1GOT B;  3VA6 A;  4FHL A;  5C2W B;  2O9K A;  3KRW B;  1VYH C;  2I3S A;  2TRC B;  3EG6 A;  3I7K A;  2YNP A;  2GC4 A;  4FA9 D;  2Z2N A;  2XL3 A;  1JMZ B;  5H1M A;  3UVL A;  2OVP B;  2OIZ A;  2P9P C;  1JMX B;  2P9N C;  3F3G A;  3PXW D;  3U4Y A;  1PEV A;  3C75 H;  2IUQ A;  5GSA A;  1GXR A;  4ESG A;  1OLZ A;  4AOW A;  2W18 A;  4GGA A;  2H13 A;  2HKR A;  5FQD A;  3MZL A;  4GQ2 P;  3SBR A;  5IT9 g;  2J57 G;  4QL1 A;  2HJB A;  3RMZ D;  3EI4 B;  4G56 B;  4A0B B;  4LG8 A;  5EMJ B;  4GQB B;  5EML B;  3SFZ A;  3I7N A;  4FB1 D;  4MK0 B;  5TEF A;  4A0A A;  4IMM A;  3UKU C;  2H9L A;  4XYI A;  3PSL A;  4ZN4 A;  4HDJ A;  5EAM A;  3SLE D;  3RN0 D;  3SN6 B;  2OK4 A;  5TDH B;  3OKW A;  3OL2 B;  4KFM B;  3UVO A;  3J81 g;  2B5M A;  3NVX A;  5I5I A;  3RRM C;  2HXC A;  3HFQ A;  4CZY A;  3SWS D;  3K27 A;  3DXM C;  3PXS D;  3DWL C;  2OJY A;  4BL0 A;  3UKR C;  4PXW A;  1QNI A;  3DM0 A;  4D6V A;  1A0R B;  3V7D B;  3I7O A;  1MG2 A;  5FKQ A;  2Z2O A;  3I7H A;  1SQ9 A;  3MZK A;  1B9Y A;  4TZ4 A;  4H5I A;  3EI1 B;  3FGB A;  3J80 g;  3VH0 A;  3JZG A;  5CXB A;  3SMR A;  2B5N A;  5CXC B;  2P9U C;  3EI3 B;  3CFS B;  3I89 A;  4L3G D;  4QRJ A;  2CN3 A;  3F3P A;  5EM2 B;  3B7F A;  3NVN A;  3EI1 A;  3OW8 A;  4J77 A;  5I5J A;  4PSW B;  2H6Q A;  3IJ0 A;  2CNX A;  4GM9 A;  1N6F A;  3C9C A;  4J0W A;  3RSE C;  2CO0 A;  4JSP C;  2AQ5 A;  4EWR A;  2G9A A;  2H14 A;  3N0E A;  4X61 B;  4U7A A;  4FA1 D;  3JB9 L;  4A09 A;  4A08 A;  4GM8 A;  2P9I C;  2Q7Q A;  3AFC A;  5THA A;  2H3X A;  4JSN C;  3MXX A;  2H9P A;  4O9D A;  3IIY A;  4Z8L A;  1RI6 A;  4ERQ A;  5HQG A;  3JZH A;  3SJL D;  3W15 A;  5FXY A;  4FA5 D;  1Q47 A;  2HKM A;  5EAP A;  3OKY B;  4GZ8 A;  4GGD A;  3ZWL B;  3K26 A;  4XYH A;  5HE1 B;  3SBP A;  2IAA A;  5HYN B;  3OKT A;  1S4U X;  4X3E A;  4CI1 A;  3P4F A;  3MKS B;  3SCY A;  3AL8 B;  1U2V C;  4QT8 A;  5JWZ A;  2CO0 C;  3JRP A;  2Z2P A;  3EI4 A;  4A0B A;  1K32 A;  3UVK A;  4A11 B;  4CI3 A;  2EBS A;  2H9N A;  5C2V B;  3RFG A;  1N6D A;  1FWX A;  3A0F A;  4J82 A;  2PBI B;  4CY5 A;  3CFV A;  2B4E A;  4FAN D;  3ULE C;  1MDA H;  1MG3 A;  4H5J A;  5FKT A;  2I0R A;  3AL8 A;  2BBK H;  5IJ7 E;  4NSX A;  3AH8 B;  3EI2 B;  4CZV A;  1L0Q A;  3N0D A;  4A11 A;  3OL2 A;  5FKR A;  2HYE A;  4J78 A;  3IJ1 A;  4ERY A;  4PSX B;  4E5Z B;  2J55 H;  3I8E A;  2YNN A;  2PM9 B;  4O1Q D;  3EI2 A;  5K19 A;  4J86 A;  4CC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...