3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
3AE5B 3AECB 3L4PA 1KRHA 2HTME 2QIEB 4N58A 4P6VF 1FIQA 4HRSA 4YTPB 4ZHOA 4ZOHC 3FC4A 4YTNB 1N63A 1E10A 2E3TA 1J7CA 2WP9B 1ZXIA 5EE3A 3VRBB 5MPOA 5EE1A 3AH7A 4YSZB 1NYRA 2JX5A 5H92C 2Q5WD 4HROA 3VR9B 2B76B 2DBYA 2WU5B 1T3QA 3ZYYX 2KMMA 3B9JA 3AM9A 1L0VB 2CU3A 1DOYA 1QOGA 1TKGA 2AX5A 4YTMB 1SIJA 3AE4B 3ETRA 1ZUD2 2WDVB 1VJKA 2LEKA 3P63A 2QJLA 3AEFB 1TYGB 1V8CA 1JROA 1GPXA 1DOXA 2WLBA 4LTUA 1FRRA 1FO4A 3KWLA 2WQYB 3SFDB 3SR6A 4YT0B 3NVZA 1AYFA 1R7SA 2MJEA 4ITKA 3AEAB 3AEGB 5GXGB 5G5GA 1NENB 1E0ZA 3NVWA 1QOFA 1B9RA 2WS3B 4US9A 1XLPA 4A9AA 1I7HA 1XLQA 1RWSA 2DWQA 3P4RB 1JQ4A 1QLBB 1V97A 1YQ4B 2W3RA 1XO3A 2ACZB 1RYJA 2WDRB 1AWDA 1NVID 2W55A 1N61A 1CJEA 1FMAD 4WQMA 5AUIA 1FXAA 3WCQA 1FM0D 1RM6C 3B2FA 4N6EB 2WU2B 4WWMA 3VRAB 4USAA 3HUIA 1E6EB 1KF6B 2H88B 1ZP0B 2PIAA 1L6UA 2L52A 3AMZA 1N60A 1JW9D 1EWYC 4KX6B 3ABVB 5EE9A 3P4SB 3W9CB 1FRDA 3AEEB 4YSXB 1SF0A 2M19A 3HRDD 2BS2B 1KFYB 1WRIA 2JQRB 3W5UB 3NRZA 1ZOYB 2K9XA 3AE6B 3LXFA 1WXQA 1SB3C 1JRPA 4C80A 1WWTA 3AE9B 4YSYB 3VR8B 3W5VB 1PDXA 3P4PB 3AE7B 2H89B 3AE3B 4C7YA 3BIID 5H8YE 2CJOA 1N62A 4YXDB 1XLOA 2PVGC 1NI3A 3RPFC 2G1EA 2CJNA 1QT9A 3AV8A 1VLBA 2EKIA 3SFEB 2M56B 1YQ3B 3DWMA 1E9MA 1FFUA 3P4QB 3AE8B 3CIRB 1RFKA 2BS3B 1TJEA 3AE2B 1IUEA 1E7PB 1PFDA 1OQQA 3AEBB 1VDVA 1DGJA 1N5WA 1JWBD 1N5XA 1TKYA 5C3JB 1QF6A 2W54A 2MJ3A 1NYQA 3HVZA 1TKEA 1FXIA 1WGKA 1WYGA 3NVVA 3NS1A 3AEDB 5C2TB 4FXCA 1XLNA 1JALA 4JWSC 1YJJA 2KAJA 1GAQB 3FAHA 1CZPA 1YJIA 1DOIA 4IDIA 5EE0A 5AUKA 2L83A 4ZHPA 4JWUC 2FBWB 3DWGC 3PO0A 1NEKB 3AN1A 1ROEA 1A70A 2N0SB 4N59A 3EUB2 1L6VA 2PKOA 3AB5A 2BS4B 1J7AA 1PUTA 4US8A 1JWAD 2PVOD 1L5PA 1F0ZA 2MJDA 2Y5CA 3P1MA 3CWIA 5G5HA 3B2GA 3LB8C 1OQRA 4JX1C 4C7ZA 2K22A 1OFFA 2OHFA 1UWMA 2W3SA 1J7BA 2BT6A 1FFVA 1QOBA 1QOAA 2K5PA 2WDQB 3NVYA 2MH7A 3AE1B
chains in the Genus database with same CATH superfamily
3PZ8A 3H7IA 9ICPA 3UINB 4QZAA 3ZRFA 1BPDA 3SHQA 4YTNB 3PY8A 2ZJ5A 2HDEA 5EE3A 5DCNA 5KG5A 3MGIA 4J9QA 1PGXA 5HHHA 2X38A 4RMAA 1KJTA 4CDGA 2BPSA 2WU5B 2DPJA 9ICAA 5ALEA 2KMMA 3T5JA 1ZQDA 3N9YC 3QXGA 3APCA 2JZPA 2AX5A 1MFWA 4I6PA 1D4BA 4IQVA 2KSOA 5DBAA 3PHWB 4K4GA 3I57A 1JROA 3R8BA 1FXTB 5KFYA 3A33B 4TQSA 2EMSA 3TL5A 1FO4A 5ALQA 5HHDG 2FI1A 2LI6A 5HR6A 3RB4A 3NVZA 2JSVX 3M6ZA 4JV0A 4QNLA 1PVPA 3L17A 3O13A 4KGTA 2BCSA 4QWBA 5HHIA 3F2DA 7ICPA 2LASA 3A4RA 4M00A 2DNFA 1X1MA 5DPWA 1V9JA 2WXJA 1CJEA 2QB1A 1S0NA 4WQMA 5AKKA 1FM0D 5AI9A 2M17A 2FAZA 4Q43A 1PK3A 3L5KA 8ICPA 3AMZA 5HMMA 2L52A 5AM4A 2E8MA 3MHSD 2JXTA 2WF9A 4DQSA 3ICXA 3KOOA 5AIAA 4NJ8A 4FO6A 3ML9A 3IG8A 1XSLA 3PRZA 3C0RB 3W5UB 5AEKB 1V9PA 3PO4A 1MJDA 3SMVA 2HHUA 2RDGA 3AE6B 8ICIA 1JRPA 1Q0WB 2G09A 2VH2A 4W9EA 3HW8A 2I38A 3K9OB 1ZQWA 1V5TA 2H89B 5KFSA 1X6JA 4NZLB 2P6RA 8ICOA 3PSFA 1L4ZB 4C4RA 4K4HA 2BBCA 2DAJA 2M56B 3EA6A 4FULA 4IQWA 1TS3A 3AE8B 3Q8LA 2YX8A 3ZI4A 7ICLA 3AE2B 4ICUA 1JUDA 1TAUA 4YR2A 1B1ZA 4UB3A 1DGJA 1TKYA 3RUIB 1X9SA 3WIMA 3KKAC 5KFRA 2LUMA 4B0EA 5J0PA 3RRHA 1WGKA 4WURA 2I2YA 5AUKA 4TUPA 4YXJA 5C0YA 4JWUC 5EWGA 2BTEA 1MHHE 4UQGA 1ZJMA 4EEWA 2CR5A 4NM2A 4PHPA 4DL6A 3WAPA 3PZDA 2JRIB 3T8MA 4YMNA 5HP4A 2IPKD 4FFDA 3EFCA 3DDHA 1UPHA 5L1JA 1ZETA 5DGAA 4KZ0A 1EWCA 5E6OA 3RAQA 4CRXA 3Q3MC 2ZCBA 2XY6A 3ALBA 2O6VB 1QOBA 3S6JA 3GU3A 1BT0A 2KG5A 3NHEB 3C1YA 4MF2A 4ICAA 2ZCCA 4NL9A 1SIFA 4CO7A 2LVQA 2K3UA 3AXCA 4K81A 3TEYA 4RUAA 2KDIA 4TQ1A 1SV4A 1RG6A 3G6VA 1FNWA 5G2NA 2G06A 3PT2B 2C22A 1HUZA 2V1YA 4M0AA 4DHJB 1P98A 3QAQA 2JZ3B 4HROA 1L5UA 1WJNA 1NOMA 2MSED 2N7EA 4RH6A 3FYHA 3ZW3A 4XE0A 2ASQA 3I63C 2Y5BB 1WGYA 4F4WA 1L0VB 2IA6A 2LGDA 4DS5A 4GC7A 4YTMB 5KFJA 2V3NA 4K7UA 4HJKA 2V3PA 2VZKB 5BYQA 2QMTA 4MJSB 1IP9A 3VTWA 2WXNA 3WKBA 4YT0B 3UM9A 3V6JA 2E1FA 5AI4A 3AEGB 3IT4B 2N9LA 5G5GA 1T7PA 4IKGA 4E71A 1E7UA 3R2IA 1TS2A 1XEEA 1T0QC 3BZKA 1DXSA 1EM7A 5I4DA 1F2RI 1OXJA 1ZQEA 1WXAA 1FMAD 3HM6X 2N7DA 2J6TA 4NJ7A 3DVGX 3OHAA 1KF6B 3R7QA 5F9LA 3RTVA 4O3MA 3RH5A 2CN1A 4CCHA 2MA9B 3KHGA 4UARA 2VH1A 4MGIE 3RNBC 5J0YA 1LVHA 4RT3A 4DS4A 1MG8A 2W7OA 4F4YA 3UQ2A 1SE3A 2FE8A 3JPRA 4M9JA 5CHFA 5ALYA 9ICNA 4AOFA 5AK5A 2F8LA 4EELA 4KLQA 3VR8B 1WXQA 4RQ4A 4RM8A 4XWTA 3TMPB 1LO5D 2LWPA 3W5VB 5DG9A 1UBIA 1HQRD 3W1SA 2PMZC 1YMHE 7ICQA 5IIKA 1KSPA 4R64A 3L54A 3DWMA 1X42A 2JRZA 5J8YA 3CIRB 3SZ2A 3PHXB 4XZ4A 4ANWA 2PE6B 5J2AA 3ZO5B 4I2BA 1PFDA 3ZTDA 4FADA 3MFHA 4TURA 2W8KA 4OJOA 1TKEA 1WUDA 2CRXA 1E8ZA 3H7SA 1YJJA 2BCRA 1CZPA 1SJED 3KQ4A 4IWOA 5D3IB 1P0RA 2AQ2B 1D5XC 1YZ7A 2VJ5A 2C2DA 1RFAA 1H8CA 4ECQA 1KTQA 3EWAA 3SENA 1HJPA 4US8A 1JWAD 4JWMA 1C3TA 3WK5A 2MJDA 5IIOA 2Y9TA 3UXOA 4F50A 9ICLA 3WU2U 1K51A 3N30A 2JYTA 4YN4A 1KOTA 1XC9A 4EYIB 4ED3A 2EZXA 4NLKA 5E6JA 4M8MA 3I3TB 3K9PB 3WAMA 2E6XA 3Q8BA 4URKA 2IOFA 1WWVA 2QIEB 4N58A 4DXAB 1ZQAA 3VCBA 4FLHA 4F7ZA 1N63A 5TSSA 1S0VA 4JV2A 2JEFA 1NYRA 1XF5L 5H92C 2DGZA 1BXTA 1WE7A 3NZUA 2HBMA 3PGEA 1ECWA 1T8EA 4C8OA 3GV5B 4HPPA 3C1ZA 3EYZA 1CK1A 2WXMA 2VA3A 2FLLA 1KRPA 1Q1OA 2AEHA 2WLBA 3U7DA 3SAFA 3QK0A 9ICCA 4BOZB 2INCC 2W04A 1A6SA 1R7SA 2KDBA 4CYEA 3ZDAA 3EFUA 4KLFA 3BVZA 1A77A 1T94A 2D5GA 2MBQA 4Z6DA 3O0FA 2R8IA 1NK7A 2HVIA 4HKZE 1BPYA 5KFPA 4MGKE 4I2AA 2W9MA 4R3DA 1I4HA 1Z00B 4C4SA 1FCLA 4RF0A 5ALMA 2K4PA 2QKQA 1LKYB 4R66A 5DPSA 1YX6B 1XQQA 2ON8A 1LXDA 1L6UA 1BNPA 4NPNA 1N60A 2Y1IA 3GIJA 4Y2TA 4FJYA 2R8GA 3D32A 1ZD2P 2WAQC 4F4ZA 2KOBA 1CI4A 2LZ6A 1WJUA 3Q8FA 2KTFA 4XDCA 4XRHA 4JGHB 2DZIA 4UASA 4J9MA 2ZTDA 4ECWA 4OW0A 2K4IA 5CHVC 9ICOA 4IR9A 3WKEA 4MJSA 2D07B 1TJEA 3QZ8A 5AKZA 2C9WB 1L2NA 2J4XA 4NLCA 1UF0A 4W9FA 2MJ3A 1FXIA 2ZTEA 4G11A 1WZ0A 3JPPA 4NLGA 2G0AA 3H40A 5DLFA 4FXCA 7ICRA 1GO3F 3MC1A 4A8XC 5ALTA 3AN1A 4F4XA 1A70A 2VIXA 5L9XA 4BJQA 4LNOA 1JI7A 2KEYA 3U2SC 4IWQA 4ANXA 5DDMA 4QZDA 2LYBA 3N20C 5F3XB 2C28A 3BY4B 1V85A 2CHXA 2IY1B 2Y5CA 2KFZA 3QUCA 2J0KA 3WKAA 3IT6B 3NZSA 4UB8U 2IDYA 4B6JA 4JK1A 3DHGC 4FJZA 2BPFA 3RZFA 4ICVA 4JV1A 5ALHA 2M9NA 4FZNA 3V60A 2W3SA 1HUOA 2LI5A 3BYYB 4HWIB 3SEIA 2WDQB 2LM4A 4YG2A 2G45B 4KLJA 4IQTA 3L13A 3QUTA 3AE5B 1WG8A 2KHVA 1SXTA 3E9SA 2YMQA 3CP8A 4UB5A 3L0WB 9ICWA 1TT5B 1IGCA 4YTPB 2ZIUB 4P7IA 3C5FA 1D3ZA 1I35A 3I1YA 2K8CB 2RDIA 2BQ3A 2UVVA 4IRCA 2M8SA 2RHFA 2R8JA 2DPIA 1DRGA 4OD0A 3I76A 5KG2A 4ED6A 3GIMA 4CF4A 2LD9A 5IO9A 5JHBA 4PGQA 4E0DA 1T0RC 2JVCA 3RD2A 2LPEA 5BPCA 5BYSA 3U4EG 2LRWA 5T8IA 2AJQA 1J19A 5KL1B 2H3FA 1NK6A 3SD5A 3KBBA 2HBLA 4MM3B 4TMAB 3C23A 1EF5A 2PXIA 8ICZA 1HA5A 2K39A 3KLSX 5J0UA 4ACOA 3VTVA 3PV8A 1TY2A 7ICNA 4C0ZA 5J0OA 5AKLA 2K8HA 1JXEA 1E0ZA 1K52A 2MSNA 4YXMA 1QOFA 1YN4A 2WHIA 1KFDA 2GBJA 1B9RA 3H6NA 1A76A 1F2RC 1ZQKA 2XK5B 2YMPA 2YTUA 5KFFA 1QLBB 2ACZB 3HHMA 2W3RA 1C4PA 1CQVA 4YWGG 4ZDVA 3CSTA 2ISOA 2FIFA 4WAAA 5FKAC 3ZNID 3RJHA 4N6EB 2KN5A 3A1QB 3KFUF 4ANVA 1SSNA 7ICSA 3H4DA 1SE9A 1SL2A 5AK6A 1ZP0B 3V62A 2KTQA 3A0BU 2ZJ8A 1I4QA 2EANA 3QZ7A 1XS9D 3VXWA 2RP5A 3P2BA 4MELA 2HHTA 4OJ6A 1WRIA 4MH0E 2NR2A 2C5LC 1YOVB 3QIJA 3UQBA 2J42A 4A8EA 3AE9B 1JRUA 1K5OA 1R4MI 2IHNA 2XGQA 8ICFA 1U45A 1GB4A 2ICIA 4BUGA 4S17A 3RR8A 4DL4A 1T3NA 2DQNB 4NJ6A 2WB1C 1K1QA 3DBLI 2LYAA 1Z1VA 4YL8A 3PPAA 1ZXHA 2YMMA 5ALNA 1ZQYA 2JXXA 1IM4A 2RDJA 3EZ5A 1UZXB 1JWBD 5LNK1 1STEA 2W54A 2G5HB 4DLEA 4O3OA 4OHJA 5KAFU 4WQOB 1V38A 3NS1A 3GOEA 4RQ3A 3SEBA 3JPOA 1TFRA 4QAYA 5EE0A 1DOIA 1JWUD 3PS6A 3IM1A 1ACCA 4GIVA 1WGHA 3QARA 3MFIA 4A3PA 3ZD9A 1GC7A 4P4PA 2IO3B 3B1LX 3GIKA 8ICGA 1LKYA 2IZVB 1OGWA 5KT2A 1U4BA 2J6SA 3ZDEA 4HXDA 4BX9C 2KWDA 3C29A 1PUZA 4A3OA 2LFIA 1J7BA 3QU5A 4DFMA 2FNJB 2K5PA 3H1UA 8ICUA 4JPSA 3OSPA 4JL9A 2OOBB 2R61A 1PQSA 3OJ3A 4HVBA 3H9DA 4M2YA 1QQ5A 1NKBA 2KN4A 1FIQA 1GC6A 1QQ7A 5FK9C 1E10A 4RT2A 1F5SA 2KNBA 4W9IA 3WK9A 4LJOB 2FLPA 1ZW7A 2DKZA 3TEZA 2B76B 2INNE 1SZPA 4ECTA 4RQ2A 5AKGA 4YFKA 3H8WA 2H5XA 2NO4A 2QJLA 2V4QA 1CUKA 8ICQA 1V8CA 1YJ1A 4WWOA 1F9JA 2FPKA 5AI6A 3SR6A 4PPXA 4KX3A 3ENEA 2N9PC 3GP7A 3V7KA 3F5AA 3MC8A 3U52E 2LJ5A 2HSZA 3NVWA 2UVWA 2KJ5A 4ECYA 2FUHB 2DLBA 4OJLA 3P4RB 4C8NA 3DV9A 3MC9A 1IIPA 1SV0A 4JMUA 1AWDA 2JUOA 3V05A 2WXFA 4NY0A 3BJYA 2PLPA 1ZQIA 2E8OA 2UVUA 3PZ7A 2ZEQA 8ICVA 1EO6A 1ZDXA 3QE9Y 2LBOA 4YD1A 1GB1A 2MHJA 1FNUA 2CPRA 4KX6B 2WXLA 2ZIUA 5JXVA 1QSYA 1KH0A 2G9HD 4MEXA 4Z6FA 4K7WA 5AZHA 4YSXB 2WHEA 2K8CA 1S0OA 4ARIA 3IFWB 4M47A 1JQ4A 2KJ6A 1B4FA 4DWFA 1TE2A 2KANA 1PDXA 5J2IA 3GB1A 3TI0A 5KFLA 3AE7B 1S9FA 4LLGM 1Y56A 4WAFA 4MM3A 4B0MA 4YVZA 1Q3VA 2A5UA 4RQ6A 3DBRI 9ICIA 2WTFA 1X2IA 9ICJA 9ICSA 4C4VB 4QZ8A 2DYMA 3TIXA 3PNCA 3Q8RB 2KC2A 1TAQA 4F8CB 3ETLA 2W9AA 2XK5A 4KN4A 4BXOB 1MQ3A 1V80A 1MG4A 4TKNA 1AW7A 1DK2A 3FKYA 4KSLC 8ICKA 4KN7A 3PO0A 2KZ3A 5AICA 2EZYA 3TARA 1X66A 3A1QA 3ZGZA 2IHMA 1Y88A 2KK0A 2OYYA 3RJFA 2KICA 1EU4A 1RXWA 4RNMA 3HPOA 4Q2JA 2NRTA 1C77A 4GIBA 4C7ZA 4KLHA 3X23A 3KTQA 1ZQPA 1DYQA 2C60A 2HJ8A 3IVFA 1DK3A 4RNNA 2C2RA 4GOCA 5ALWA 4ZRPA 5HNKA 3VUYA 2HOQA 3FM9A 5BO4B 3C21A 3NVYA 3HKZC 1XO1A 5J2FA 3NUHB 4QWDA 2HTME 4F92B 5KFEA 2VA2A 3HX0A 2Z0DB 3HK0A 2VANA 4II2B 4MF8A 1V86A 3J9CA 2JMGA 4C8MA 4M04A 5H2FU 1BUIC 1T3QA 4IRDA 2MBOA 2GOLA 5DPTA 3SQIA 4RNOA 1QOGA 4GLXA 9ICEA 3ISCA 1ZUD2 1VJKA 4RGOS 2L1AA 1TK5A 1D8YA 2JU6X 3ZD8A 1V5OA 1XCQL 4RQNA 4UB1A 3D2QA 1AYFA 3BYTB 4YR0A 4MH8A 4FN2A 3QHTA 4IG7B 4W9JA 2ZZPB 4P0PB 4RM9A 2DX5B 1KQQA 4ZYNA 3TJPA 3MDCA 3ZKJC 2KMCA 3F53A 2YEPF 1L3TA 1YQ4B 1TV9A 2MA1A 3ALRA 3PZPA 2ZVNA 4WWPA 5AUIA 3C2LA 3Q14C 3RYTA 4WWMA 4QWEA 3MJ5A 3N3KB 5ALRA 3HUIA 2H88B 4Q45A 4XYCA 3MTNB 3WKCA 1YD8U 4DL3A 2ZVOA 3JYUA 2FCQA 2MP2B 4QIWF 4DDID 3V7LA 4QZ9A 4I27A 1XT9B 3HIZA 4IWPA 5TISU 1FRDA 5B66U 2PFPA 5AK4A 2KXJA 3UI3A 3RJKA 2LYHA 1TK8A 3E2EA 2BYVE 1CEZA 2LM1A 3TEWA 2NRXA 3G6XA 2FPLA 1RAXA 5H8YE 1BGXT 1IBXB 1KLUD 2R2OA 3SFEB 1PGAA 2FJ6A 4PS8A 2WXOA 1PK1A 2AL6A 3M9OB 2MUTB 3SDLC 3DOWA 2SAKA 4XUSA 2IGGA 3PREA 3ZLZA 1WZ3A 1QF6A 4O3NA 1ZPSA 2HCFA 1WFYA 9ICXA 2KWUB 4GXJA 1XLNA 3N4MB 1VZ8A 2J7QB 2OJWA 4GXKA 2D3DA 2J0JA 2BW2A 3NOBA 4DQPA 7ICHA 1SE2A 3AU6A 1S97A 1P7DA 4PJ0U 1V1PB 2NTSA 4K1RB 1GJZA 4M9HA 1BVSA 1WGRA 5ALLA 4O9MA 2KMDA 5ALXA 2BDPA 2GWSA 2QCZA 1DGSA 3VH4B 3UMBA 2PFOA 4ELUA 3K1ZA 3ZJUA 4NQLB 5HI1A 1QCKA 2BPGA 1N48A 2UU7A 2F1IA 4F5PA 3OJ4B 3WALA 5ALVA 3HVDA 4UBBA 2J52A 4P4MA 1ZQLA 4P2HA 1ZQMA 2BKEA 3VTUA 3PSPA 1YNTE 2MH7A 4NY8A 2Q0ZX 4G9BA 3N28A 5JRTA 2PMZF 4XQ8A 5CX3A 1WGGA 2C7HA 2G4SA 7ICMA 3SAGA 4B9KA 3QC8B 2G5IB 5KT3A 1S77D 4AQ7A 7ICOA 1OEYA 5J2GA 4C4VA 3UPQA 3ZDDA 2NS5A 1T0SC 2NRWA 2C2EA 5AHXA 4QZCA 1SIJA 5KHOA 2WDVB 1SV0C 2D8CA 4HAIA 1N2XA 4BXOA 4F5RA 3OHBA 4XGAB 1GPXA 3OAWA 4DHZE 8ICMA 1FRRA 2PE9A 7ICKA 3BINA 3SFDB 4RQ7A 4DSJA 2IGHA 4IR1A 1Z4NA 4ZH4A 1P1AA 4QIWC 5KFDA 2F44A 3TADA 3AU5A 1ZQGA 4BVUC 5KFZA 4Y2RA 1XLQA 3RB0A 3C5GA 4C8LA 2L00B 4J6IA 1RPLA 1XO3A 3WKDA 2KJ9A 3EGRA 4I2IA 2ZNVB 3NUQA 2ISPA 3UMGA 4NLNA 2XVTA 4K7SA 2PEAA 9ICKA 3MR2A 2WF5A 1C76A 4CE6A 1OW5A 3MR3A 3DVNV 2KX3A 1D9FA 4UAUA 2MEKA 2D3GA 5IIMA 1YN3A 3BS5B 3HRDD 3GV7B 4KLOA 2R8KA 3QEBZ 4RCOA 2CS4A 3LXFA 4NJCA 2KMAA 4RGTA 5JTIA 3P4PB 3WK6A 1TY0A 3MR6A 5KNIA 1T0YA 3PW4A 3T3OA 1FD6A 3ZNGC 1E90A 3UQAA 3BQTA 1HXYD 3LK9A 2OM6A 1FFUA 1LGRA 4BFRA 2YY6A 1SWWA 3EECA 4KSKC 4PHAA 4DSKA 5AZFA 4UW9A 3ZXVA 3OWEB 3ZVVA 1IYFA 4U6PA 4P0PA 5HFYA 5C2TB 2HBKA 1MC8A 4ED1A 3TQ1A 1PZNA 2KAJA 4ZYSA 1MVKA 4ZHPA 2VJ4A 3KUDB 4A6QA 4RF1A 4EFOA 4YP3A 2HW3A 3KH0A 3VFKA 2L7RA 3EUB2 4NWIA 3Q8AA 2DKXA 4I2CA 4NQKE 1SL1A 3GFKB 3R66C 4LCDE 2XC9A 2A4ZA 2N9KA 3ZRCA 4BDPA 1KEJA 1F1HA 2C7NB 2PMVA 3QU4A 2AXTU 1O08A 2WAQF 1YX5B 8ICCA 3NZ3A 2BB6A 3NGDA 1C79A 2QB0B 4EX7A 5KG6A 3ORYA 2EH9A 4I2EA 3OJUA 1HEZE 2L32A 1M94A 4DCCA 5J2HA 3AE1B 2D3AA 3R3MA 3L4PA 1KRHA 3EPGA 1IG6A 4TUQA 3JPNA 7ICFA 2GOWA 3VRBB 2WP9B 1CRXA 3TBLD 3WAOA 2MUTA 5DQIA 5CHGA 4DO9A 3ZNZB 1HZ6A 2DAFA 3L3FX 3LWMA 2QC8A 2MBBB 4HLEA 2XIDA 3V3XA 3KHRA 3PLVA 5KG7A 1NK5A 5KFVA 1ZQHA 3AL0B 1RRBA 3M6KA 4KMOB 2JHDA 3GILA 3RBEA 1SXEA 1V1PA 1K1SA 1S0MA 2F77X 4ITKA 5J2EA 2MJEA 1ZDVA 2BQRA 2H3VA 4KTQA 2V4RA 2WYQA 7ICIA 2LHTA 2I1QA 3SAHA 5AM0A 2GBNA 2F2AB 1KKXA 5IP4D 4ZRQA 1RWSA 4JB3A 5AM1A 2V4LA 3UMCA 3Q3JA 2WXKA 4QW9A 2W55A 2BCQA 3MABA 1OQYA 4J9SA 4B9MA 2O6VD 2NCNA 5KFGA 4ED2A 5ALPA 3JSVA 3B0AA 3TANA 2LGIA 2FCMA 4QWAA 2RSUA 4W9GA 4J9RA 1WF9A 3IP4B 5EE9A 4JUZA 1SJHD 4OO1J 5GMVA 3P4SB 1XSPA 2Y1JA 3NJTA 5DB6A 1AN8A 3DVNU 2BS2B 3TAQA 1KFYB 1QZEA 2DZJA 2LXCA 1L6NA 1SB3C 2ZUDA 2K6QA 5DPRA 4DHJD 4EE2A 4PHEA 5J2BA 2AGOA 2DHZA 3T3NA 5D94A 5GTIU 4C7YA 3TEXA 4RGNA 4YXDB 5L1IA 1NK9A 1U48A 3M8RA 3KYDD 4KDLB 3AV8A 3AUOA 2MX2A 5IN7A 1UH6A 2VZKD 2O6VA 4DDGD 1Z19A 2WX0A 2H3QA 2BGFA 2A19A 2JYEA 2LHEA 5L1LA 5BOLA 2HD5B 2XCPA 5DBCA 4YMOA 5J2DA 2M0AA 5DB9A 3PMLA 2NPTB 2ZG6A 2RMMA 2N7JA 4PS3A 4MFAA 3LYSA 3C28A 1J2NA 7ICTA 4O5KA 2DZKA 2LVOA 4IL6U 2Y0SF 1XNSA 2IO0B 5KFIA 3BQ1A 1E8YA 8ICBA 3LJ3A 1RXVA 3PO5A 1L6VA 2LGYA 2A1AA 3DBLB 3ZQ4A 5J2RA 4ED7A 2XNAC 4I2JA 5AI5A 2PVOD 1F0ZA 1AROP 2ZPYA 3Q8MA 4KVGB 4CGZA 2I1KA 1OQRA 2IBIB 2WNMA 4MHVA 3C2MA 3SI8A 1Y8RC 2BWES 1GG3A 3BS5A 5ALUA 5KFBA 3RCZA 3ONSA 1ZQVA 5J0SA 2BCVA 9ICGA 4FE3A 5IINA 4UBCA 2KNJA 2IJ0A 3TUOA 4RQ1A 4XX5A 3T5KA 5FR3A 2KZRA 2Z0EB 3KUCB 2QARB 3EC8A 4HPLB 2WB1F 4HRSA 3VUWA 4ZOHC 3M9MB 5KHQA 2QEJC 2BB5A 2UVRA 3RI7C 4FHJA 1MN8A 2NBWB 4NAWB 5EWFA 1AARA 4NL9C 4O5CA 2XI9A 4ECVA 4I2FA 2FCSA 2DBYA 2D11A 4HCNB 2KLGA 2HHQA 3K75D 2D3CA 2JT4B 3BQ0A 2CU3A 1DOYA 1VCBA 2K1FA 3ETRA 3IHQB 3CYMA 2LKYA 2LEKA 3K1RB 2LMCA 4FZMA 4J9KA 3Q8CA 9ICFA 3ZJTA 5D49A 1ZQSA 1IPGA 2YB1A 1HZ5A 1OEYJ 1ZRMA 3E56A 4US9A 4DSLA 1I7HA 2GO7A 5KFQA 2BKFA 1JWMD 2FPMA 5KL8B 9ICRA 2WDRB 1L4DB 4AYBF 2J0MA 3RNAC 5DQGA 5HR7A 3GZNB 2GB1A 2QB0A 1VJ5A 4R8UB 2OEDA 2YEPB 2B6GA 3PTFC 1T4GA 3CF6E 5BMIA 3MR5A 2LHDA 2JF5A 2KHQA 2EZZA 3M63B 4PZOA 5IOIA 1L7YA 3B0XA 2O2VB 3AULA 4DL5A 4II3B 1VD2A 1SF0A 2WXPA 4M0WB 1WSPA 2L76A 3BDPA 2NVUI 2A1JB 2EAPA 1ZOYB 2AU0A 4MEMA 3UQ0A 3FILB 5KFCA 2L05A 4R63A 1UHUA 4DLGA 3ZDTA 5LXHA 4Y2VA 3AQFA 4RUCA 1F52A 1YN5A 1LM8B 4WWNA 5KT6A 2Y0SC 5AM2A 2ZJDA 1TVAA 3OLMD 1IUEA 5J29A 3W1SC 4ZRIA 4Z6EA 3HVZA 1HTQA 2N1WA 5CA7A 4QZHA 4DFPA 5JH5C 3AEDB 5J8YC 3RF9A 2EAOA 3T3FA 4KLLA 3M3JA 3ZDMC 2MU2A 3ZDCA 2RPVA 3GE3C 1L7PA 3DWGC 3RH4A 4MEYA 1IXRA 1C1YB 1KTKA 2WGSA 1S3SG 4M9LA 1E7VA 1V2YA 3ZJVA 3V6KA 1J7AA 2HBJA 4ECSA 8ICYA 2L0TA 3RH6A 1ZQFA 4ECRA 4I28A 2YMLA 2D6FC 2N4FA 3QX1A 4UB2A 4NLBA 2FE9A 2PFQA 3RJGA 5DB7A 5E79U 3QYPA 2I5HA 1OFFA 4DSEA 4O0IA 4F5NA 2M1MA 3RB3A 3UIOB 2I9GA 5DG7A 2BT6A 1XXGA 5J2KA 2ZTCA 5J0QA 5JU5A 3PRPB 1H4RA 3Q8EA 1C78A 4DF4A 2ZW1A 3KHHA 3URYA 7ICVA 3A4SC 3HP6A 1QH9A 1JXLA 2BCUA 1LB2B 2HOFA 4KLIA 2A3VA 3ZUNA 4Y2PA 2ATLA 5AKEA 4DL7A 4KLUA 1Z00A 1X9XA 2N9XA 3QUQA 5EE1A 4DQOC 2JEIA 4YSZB 2JX5A 3H8HA 5C1ZA 4RQ0A 2ZPNA 1WIAA 1P3QU 3APDA 4W9KA 4MDKE 2WXIA 2E1EA 3TAPA 2KFKB 5IIIA 3ONNA 3V7JA 2FMPA 3H8SA 4AYBC 2JH1A 4HEA1 4ECZA 4B6WA 4RGMA 2HMXA 3W1YA 3CW2C 4LDTB 2WXQA 4EBEA 1M6YA 4J3OD 4JWNA 9ICUA 2DYOA 2W9NA 2BDUA 4GDKB 2KACA 4WJOA 3LDAA 1N61A 1EU3A 4GFJA 1SE4A 1D5ZC 4B9VA 4FA6A 1BPZA 5AM5A 3Q6BA 2QSDA 3HKZF 2VA8A 3IBEA 1SGGA 2PIAA 3T79A 1J97A 1PYWD 2KKCA 2BQUA 2QARA 4BAXA 5ALSA 4O3PA 2ZW0A 4RQ8A 3BQ2A 4B9TA 3OG5A 1TS4A 4NAWA 2N1VA 2K9XA 4KDIC 2ZXHA 4YSYB 2KVCA 2OH2A 4DQIA 4DBGA 2PKEA 1JMLA 2B21A 3I9V1 2MBEA 3BQ7A 4G0NB 3RPFC 2IO1B 3KKAA 2CJNA 4RFBA 1YQ3B 3P4QB 1E9MA 1RYRA 4CHKA 3PVLA 1V1OA 1TZ1A 3RJEA 1T6BX 3UXPA 4AP9A 1E7PB 4GGQA 4WJ3B 1VDVA 4P4OA 3QU2A 4PGXA 4B9LA 1JMSA 3TKAA 5DB8A 3EHVA 5E6NA 8ICWA 4UAVA 3NVVA 4HJGE 1LQBA 2E5SA 3PVXA 5KG3A 4LNNA 4W9LA 1UD7A 3DVGY 1ROEA 1XD3B 4R8UA 2N0SB 4N59A 5DGBA 4F5OA 1O03A 2IOHA 5D3DA 1SKSA 5KFKA 1QKZA 1L5PA 2RPQA 3D2SA 1A0PA 1MSWD 4TUUA 2YQEA 1SBBB 7ICJA 4BZAA 2W9BB 3X0WA 2RDHA 5BMGA 1L7NA 1ZQUA 2FMSA 1JWSD 2O2VA 2XGPA 3KD3A 1Z2MA 3NS8A 4O3QA 1ISNA 4TUSA 1R4NI 4M0WA 3FDSA 2AGPA 1I42A 2A1JA 2DENB 5L1MA 1QOAA 3GZFA 2E8PA 2OCEA 3FILA 2HTHA 4KKIA 4EKUA 5KAIU 4MFFA 5KG0A 4MGZE 4DWIA 4RQMA 2G07A 4P6VF 2L5YA 4HDOA 4M6WB 1RDFA 4GXBA 2AL3A 2L3ZA 7ICEA 3KYCD 2E3TA 1WJ6A 2HDOA 4PHDA 4PYUA 3QX7A 2CHWA 4QZBA 2W8LA 4BGDA 5KT5A 4QZFA 1EXNA 2KQSA 3QQ8B 2FIDA 3O65B 1TKGA 3IHPC 2NO5A 5AKHA 3K4GA 5AK3A 1U49A 2JGAA 3KUZA 3P63A 3AI5A 1WRDB 1TYGB 2MRPA 4IW0A 5AZGA 1WX9A 3UGBB 2Y5PA 1UQVA 3H0MB 4IC7B 1F44A 2WQYB 2DF4B 4W9DA 3HJEA 3QEAZ 1NJXA 4L2YA 5KFMA 1KLGD 3H8MA 2UWQA 4DSFA 1UBQA 4ZRJA 1UA0A 4NV0A 4A9AA 1Z5SB 4GC6A 2K4EA 4DXFA 3PMNA 5J18A 1V97A 4BKTA 2KQ4X 4BKSD 1NVID 1RQLA 4L23A 3OPXA 5EDSA 1WX7A 1XO0A 8ICAA 4KLGA 2N1RA 2BKRB 2RGFA 2K0PA 3H7PB 3UXNA 2KZMA 2DL0A 2BYEA 4EEKA 2FLNA 2JH7A 4Z6CA 4PZNA 5ALZA 3JPTA 1KLNA 1ZQOA 1VR9A 4F2SA 4GN1A 2KFKA 9ICBA 4UAWA 1Z3EB 2KVZA 2EMTA 1FEZA 4L1BA 2RDBC 1N62A 2NBVB 3BZDB 2AWTA 4BKSA 2GBKA 2K8AA 1NKCA 4YCXA 4AWJA 1UA1A 4F2RA 2KX0A 1XU4A 4W9CA 4QJFB 2P6UA 2KE7A 3IG5A 2X8XX 2HHVA 3PW5A 2BHNA 4CF3A 1HE8A 1S1QB 2IGDA 4PL2A 1WM3A 3AEBB 3NY5A 2WF8A 2ZXIA 3Q3NC 1JCKB 1URJA 3CMMB 3SU8X 8ICRA 4BWMA 4HPMB 2C7MB 2XBBC 4JWSC 4KMUA 1QQRA 5EWEA 4UB4A 3JW0X 4GDKA 5D46A 1NJZA 5CB1A 3L08A 4XDDA 4B9UA 2D3BA 2BS4B 1XSNA 2MQJA 4I2GA 5KFTA 2BQQA 4YMMA 3RN9C 1Q5WB 3L16A 5KG4A 5KFOA 4HCPB 4D2KA 2G3QB 2KHWB 1KN5A 1ZQZA 2GBRA 3L10B 3IXSA 4JX1C 5J2CA 2J6UA 1YZ6A 3V61A 1UNSA 4EZ6A 3PW2A 1Z4OA 2AQ3B 3V6EB 2ESEA 1UCVA 3TFSA 2F8KA 2YLMA 2AH5A 1ZQRA 3Q3OC 1V49A 2BZFA 4J9PA 1M4VA 3KHLA 4DQRA 2EELA 3N7RC 4ZRKA 1KW4A 4OVZA 2K8BB 4ZHOA 3FC4A 4C8KA 2TSSA 5KG1A 3RMKC 1J7CA 3OJSA 3AH7A 1FPYA 2KTRB 5BYRA 2YB4A 5J0RA 3ZYYX 3AEVA 1NJWA 2RR9A 3RT3B 3ZTCA 1ET9A 1SWVA 4H2AA 5DKWA 3PR5B 4ELTA 1WGDA 3MP9A 3JPSA 1D8BA 2BYTA 4F93B 3H8JA 2JWZA 1E5WA 3H0RB 2WX1A 2XY7A 3MFGA 4HYKA 1K50A 1RZTA 2KK8A 3SD7A 1TS5A 1TGZB 1UGMA 1Q10A 5CRXA 1WMHB 2YN4A 2W9BA 5KFNA 4EENA 4LJXA 1ET6A 4UDUC 5D6JB 4B9NA 3I28A 4IM3A 5HKHA 3CNHA 1GOZA 5JZEB 5CR0A 3U30A 5ALDA 3CRXA 1MQ2A 2EAMA 3VRAB 4NAMA 5HG2A 3RB6A 3DBHI 4NLZA 2XICA 3S2AA 5DBBA 1N6ZA 5AKYA 2GMIC 3UIPB 2DFLA 1T5XD 1EWYC 1NBFC 1Z1BA 2M0NA 1A5RA 1COKA 4M6WA 4IOIE 5KFUA 2M19A 1E8WA 4DXGA 4R65A 2JQRB 4ED0A 1MI0A 5L1KA 1YQBA 2ZUCA 2KWVB 2HHXA 1OUQA 3Q69A 4FJVB 1QILA 1X6IA 4M02A 3T9LA 1E8XA 2QDFA 2PVGC 3ED5A 1QT9A 4JLCA 4XA5A 2LXAA 1ZE3D 1C4AA 4W9HA 1OQQA 1N5XA 4I6LB 5IAAC 1NYQA 4WJQA 3IRUA 2WF7A 1JALA 4WIPA 3FAHA 3N1ZC 4BKGA 3OTQA 4RNAA 1F77A 3TSSA 1RYUA 4RPZA 1C9FA 4OJPA 2JZZA 4NNJB 3P42A 4DQQA 1PUTA 4QZGA 5IKCM 3HWTA 3H7PA 1KM7A 2H3ZA 3M9NB 5G5HA 4C4TA 4A20A 2Q4TA 4J9NA 2K22A 1TAMA 3QNMA 4P0QB 1JN3A 1SXDA 2BR0A 3ISBA 2FDRA 1X9MA 4F5QA 4JE3B 5DQHA 2WXRA 4KKJA 2KC1A 3M7DA 2HHWA 3RNFC 4QZIA 4FS1A 1YIWA 2KJ8A 2ES6A 1NKEA 3AECB 1WX8A 3QWZB 3SV4A 5TZVA 4GSWA 2I6XA 4OZAA 1KFTA 3W2DA 3SYZA 3T5HA 4C56C 3QU9A 2JEJA 1XCTL 4RPYA 2I1JA 4OZCA 1K53A 4C00A 2LUEA 3N32A 2Q5WD 5BOMA 3WANA 1UUPA 1SEBD 1B43A 3PR4A 1AQ6A 1D6EC 1BPBA 2R18A 3NTUA 3PW7A 2MP2A 3ZNHB 2E8NA 1GNUA 1I4PA 3Q8KA 1FNVA 3A9KB 3AE4B 4Y2QA 4PK1A 4FBUA 1L0YB 1ZQCA 4F4KA 4YR3A 1DOXA 4KITB 4A90A 3Q3FA 2PI5A 3KWLA 8ICEA 5K4LA 2K60A 5ALJA 1K8RB 3GDXA 3GV8B 1IBXA 9ICVA 2G08A 2KJRA 4KIKB 2REXA 2HE7A 2DWQA 1WXVA 2KD0A 3I5JC 2ZUBA 1J8CA 1NNLA 1ZJNA 2KLCA 1BPXA 4Y2UA 1DOQA 1WCNA 2KZZA 3PV1A 1QLNA 4EUTA 4WJPA 5L83A 1RM6C 4DFJA 4KLEA 1VZ6A 1TBEA 2PJHA 4USAA 4I2DA 2L0FA 1SL0A 1ZQ1C 4FS2A 3U26A 3MBYA 2W7PA 4J9OA 2XN9C 4GB9A 3KZIU 2JV3A 2ASDA 4KLSA 4OZBA 1ZGUB 2K8BA 5KT7A 3W9CB 4QWCA 1ED1A 4LVSA 2MW5A 3BZCA 4K3BA 2KDMA 1F0MA 4ELVA 5GTHU 3PX0A 1RLFA 4MSQB 4BOSC 2ONQA 3BVMA 2KTRA 3EW9A 2PTLA 4AS1A 4MFCA 2D10A 5KFHA 3BIID 3A9JB 2KD1A 4Q8EA 8ICHA 1WM2A 2Z8LA 1KLVA 4F91B 3E58A 4DEZA 4I2HA 2G1EA 1BNOA 3OSNA 2B0CA 3MJWA 4EBCA 4CNQA 3HILA 2B3AA 1UT5A 1RFKA 5KTQA 2CXYA 2PPHA 1XWLA 3J81j 3QJZA 1QSLA 5B5EU 2KFNA 2WWZA 8ICJA 5AKXA 2JEGA 3BS7A 2F3NA 5J0WA 4S0RA 3RNGC 1WYGA 1WMHA 4UB6U 4NXZA 4PYZA 3AQEA 5ALFA 1EF1A 4F1SA 4REZA 2KT7A 2L83A 4G50A 4OVVA 3KWVA 2FBWB 4ASWC 9ICMA 3BWUD 4ANUA 3M1YA 2NMQA 2PKOA 4RPXA 4FHKA 2INPE 3Q8PB 4B9SA 4TQ0A 1NZPA 2WDTB 5T14A 2ALZA 1VRAB 1QTMA 3ISDA 4P1CC 4IC9A 3LB8C 5E6PA 3VC8A 3MGVA 4Y2SA 2KP7A 2ODGA 2AGQA 4AJWA 1D8LA 5AI8A 2PW9A 4LJPB 4X5VA 8ICNA 3LDZE 5IILA 1FFVA 3PX4A 3RRGA 2LGXA 3VQIA 2IBKA 3SV3A 3IAS1 4WJNA 4P1BC 1R4MB 2MWSB 1IV8A 1ZQNA 3GIIA 2KIWA 4LNIA 4AUQC 3WK8A 4CF5A 5DDYA 2FCNA 2BPCA 4Y2XA 4MACA 1UGJA 4J03A 2KDFB 4KLMA 1L8OA 2JWUA 5CTRC 5J17A 2JXJA 2PI4A 1GUAB 4E3CA 4GDLB 2YVCA 1FEHA 3B9JA 3AM9A 1COOA 2GLSA 1NK8A 2GLEA 3RBDA 2G4DB 4G3XB 3QCAA 4M9NA 1WR6E 2BVCA 3UF8A 2NYVA 1ZQTA 3VH3B 2RLTA 1TKDA 1L3SA 2RD0A 3BVGA 4OVUA 2JY6A 3LVVA 5DLGA 4GLSC 2LRUA 3AEAB 4U7CA 3THVA 2V9WA 1S76D 1ZRNA 2UYZB 3ML8A 3DHIC 1NZBA 3R9KA 3NG0A 4ED8A 3PRMB 5D7GA 4ECUA 3H4BA 4P0QA 5A0LA 2KVSA 2EQYA 2OXOA 3C8YA 1G6JA 2MCNB 5HMLA 1NK4A 5L95C 4YQWA 1C7YA 3RFAA 4KX5A 3B0YA 3WCQA 1FXAA 3B2FA 3TADC 2WU2B 2KV2A 1U9LA 1ZOLA 1E6EB 4PGYA 3GS2A 3MHZA 2XEWA 1FCCC 2KOXA 3VHTC 3ZDBA 1UT8A 3NASA 4IRKA 2W03A 1I4RA 3ABVB 4IM0A 3MDAA 4EOYA 1EUVB 2JPHA 2MBHA 5JUMA 3Q8SB 2K6DB 3WK4A 3JVZX 3NRZA 4M9GA 2ZIVB 2ZIXB 2DYBA 1NK0A 2GI9A 3TFRA 1NJYA 3U8ZA 1WI0A 2CJOA 3A9KA 3F2BA 3AU4A 1NI3A 1SKWA 5ALOA 1YT3A 4KLTA 4QZEA 1UWXA 3ECIA 1VLBA 2NRVA 2EDUA 3TACB 3QUBA 3F2CA 3M62B 3ZXRA 4A55A 4AP4C 2FUG1 1L8LA 4K3CA 1N5WA 5C3JB 2KJHB 1J2MA 2D2QA 4KIKA 2K89A 4M01A 5F9NA 5C5JA 1YJIA 4O3RA 2KYWA 1CMXB 9ICTA 2BGWA 4HDQA 3N7PD 4DFKA 2KVRA 4KZCA 3VUXA 3IDWA 4YD2A 4MT5A 4KV2A 4UAYA 2O6KA 2M4NA 3CWIA 2XY5A 1L0XB 5C23A 4IQUA 1WR1A 2NTTA 4B95A 1MPEA 8ICTA 1HEKA 3G6YA 1KFSA 4WH4A 9ICQA 1ZD3A 2RRDA 2LMRA 5D4BA 5DG8A 4JQWC 5IA7A 2GBMA 5LLIA 4FBJB 4LZDA 4OCZA 1ENFA 4UATA 5KFXA 5CWRA 5AIBA 3A9JA 1B0XA 2KKVA 3H0LB 3RNEC 5MPOA 1ZXIA 8ICSA 4DFDA 2SEBD 4FBTA 2W9CB 1IGDA 3DBRB 1R4NB 3VR9B 2W11A 1WCLA 1Q8KA 2F1JA 2ASLA 4O5EA 1C20A 1PVQA 2LGSA 1LFDA 1PGBA 1WXMA 1L3UA 2V4IB 3GQCA 3AEFB 1ZD5A 2JZBB 4PT5A 3DCGA 1B22A 5JHAA 1WYWB 2HHSA 4G3IA 4P16A 1RYSA 2KKPA 5GXGB 1WJ4A 2QILA 7ICGA 1NENB 4K4IA 2W82A 2Y9UA 1XLPA 2Z59B 3IAM1 5J0XA 4ACFA 4EX6A 1QQ6A 3IV6A 3B08A 4DK5A 3KZXA 3C2KA 2ASJA 4O1NA 1L3VA 2CHZA 1TZOA 1C4CA 1NI2A 3RNCC 2PFNA 2NPTA 2ZIWB 4KGSA 4DSIA 3KVFB 2RQ5A 4LNFA 2W43A 2P66A 4BWJA 4EBDA 1JW9D 2K25A 2HVHA 1KL9A 1S8OA 3R2TA 2NV3A 3V6HA 2L8JA 4EYHB 2V9HA 2OJRA 2CKHB 1I4GA 4LK0M 3D2NA 3DDCB 1OTRB 1S5LU 3LYYA 4F71A 1X9WA 4LNKA 5AKIA 4BBNF 4PS7A 4C80A 4RZRA 3JSVB 2HI0A 1HTOA 2AQ1B 4E74A 4LZGA 1P7FA 4GDLA 3AE3B 2F76X 4RQ5A 4M8NA 5KT4A 1XLOA 1NDDA 3M8SA 4Y2JA 4IM2A 1TIFA 4Q8FA 2R8HA 1MA7A 3RAXA 2BS3B 3ZIMA 2Z7JA 2DUYA 3JPQA 3NRWA 4Q44A 4KLDA 3AU2A 4I29A 8ICLA 4TSSA 1MHXA 2KWCA 3PSIA 2KSOB 1GAQB 7ICUA 2MLBA 5AM3A 3U7ZA 5CEHA 5CHWA 4GMVA 4HK2A 3AB5A 3N97B 3RR7A 4MGYE 3PSEB 3DPDA 1J0GA 4UAZA 5IIJA 3V72A 1LV5A 4F8RA 3M95A 2H3IA 3B2GA 4EZKA 5AI0A 2ZNVC 1U4AA 1SZHA 2IYDB 1Q3UA 4O3SA 3GZNI 3WA0A 2OHFA 2M0XA 3RZWC 5KFAA 1UWMA 4DL2A 1PK1B 2KN7A 3KW5B 2F1HA 2ZJAA 4PH5A 2ZIXA 2ZIVA 9ICHA 1ZQJA 2KQ7A 3VVWB 5ALIA 5LXIB 3QU7A 2JR5A 1U47A 1ZYQA 3DEEA 1ESFA 4ARCA 4I6NB 4NM1A 3V6CB 8ICXA 2QHOA 2XCAA 2R2QA 2AQ4A 5EOZA 3D6JA 2N9EB 2IOFK 1SGHA 2AHOB 1ZKHA 2NRZA 3PX6A 4N9F4 2GRIA 2OEHA 1WE6A 2IO2B 4PL1A 3RULA 3LWLA 2EKEC 4KGRA 2NBUA 2WF6A 4EEYA 4J9LA 1V6EA 3IG3A 3VAWA 1RQNA 3N7SC 1KDHA 1WXSA 4LTUA 3OGUA 3LVWA 2OWOA 3VDZA 3RJIA 3R7RA 5AKJA 3PSTA 3HM3A 1L7OA 4DOAA 1V81A 4MSMB 2WS3B 3GE8C 3RJJA 1P7EA 4IUMB 5ALGA 1WY8A 3MGHA 5ALKA 1RYJA 4JIOU 3DQVA 4DF8A 4QW8A 1H38A 2JRHA 2WFAA 3PW0A 4BBNC 1D5MC 5CJ7A 3MC0B 4DOBA 3N1XC 2GH1A 3QA8A 2BWFA 4EZ9A 3DBSA 2Y3AA 1JIHA 2BYFA 1I4XA 2HJ1A 2CU1A 4HKQA 2K4HA 4Y2YA 2XO7A 3E0FA 3EPIA 2W9CA 3APFA 2VRRB 1WWTA 5TR5A 1ZQXA 3RFZB 5D2MB 4DOCA 3N1YC 3DBHB 2WXHA 4X57B 2AQ0A 2INDC 3DHHC 3HT3A 2EKIA 2JZBA 1ZQQA 1Q46A 2IY0B 4DHZB 4FZLA 2HOIA 4EZLA 4OJ5A 2AYOB 4ECXA 1UELA 5G55A 1QSSA 1BMLC 3IN5A 2MAXA 2J53A 4LDTD 4CQNA 3A0HU 1VZ7A 1ZD4A 4XC2A 2LJIA 3T5LA 1S10A 2KO3A 3BK1A 4F72A 1N56A 1WH3A 2KFJA 3C19A 3F5EA 2VKQA 1ZQBA 2IMWP 4F3OA 2WXGA 4IDIA 5FR6A 1JX4A 1NEKB 2P35A 4RU9A 2LVPA 5BMHA 2DZMA 1PVRA 1SKRA 2KDEB 3PLUA 3CSFA 4TV3A 2ZIWA 2KIVA 5FP0A 3BK2A 2MRLA 3P1MA 4GXIA 1HIWA 2V3SA 4IS7A 1X40A 2QLTA 3TCAA 1KBUA 4GU2A 5KFWA 1TK0A 1L7MA 1WWUA 5CP2A 4AJYB 4EZJA 4XWWA 1P9DU 3WK7A 1BPEA 5J2JA 4TQRA 1D9DA 2FMQA 2V0GA 1TTNA 3Q2AC 3Q8QB 5J0TA 2BF8B 3AEEB
chains in the Genus database with same CATH topology
3AECB 3PZ8A 5FR3A 2R61A 2KN4A 1FIQA 4HRSA 4ZOHC 4OZAA 2QEJC 2BB5A 2HDEA 4YTNB 5FK9C 3W2DA 5EE3A 4C56C 1E10A 1XCTL 4OZCA 4NAWB 1PGXA 1K53A 2X38A 2Q5WD 3TEZA 1UUPA 1SEBD 2B76B 2DBYA 1D6EC 2INNE 2WU5B 2KMMA 1I4PA 3N9YC 2CU3A 1DOYA 2JZPA 1FNVA 2AX5A 3TUOA 3AE4B 3ETRA 1D4BA 2LEKA 2QJLA 1L0YB 3I57A 1V8CA 1JROA 3R8BA 1DOXA 4A90A 1FO4A 2LMCA 3KWLA 5HHDG 3SR6A 2JSVX 3NVZA 3GP7A 3Q8CA 3ZJTA 3U52E 3NVWA 3O13A 1IBXA 1HZ5A 2DLBA 3E56A 4KGTA 4US9A 1I7HA 2DWQA 1JWMD 3P4RB 2WDRB 1L4DB 1AWDA 3V05A 2WXFA 2WXJA 2GB1A 2PLPA 1CJEA 2OEDA 2YEPB 4WQMA 1FM0D 1RM6C 3PZ7A 1VZ6A 4USAA 5BMIA 1ZDXA 2LHDA 2XN9C 1GB1A 2L52A 3AMZA 1FNUA 4KX6B 4OZBA 2JXTA 2WXLA 3W9CB 5JXVA 1KH0A 2G9HD 4YSXB 1SF0A 2WXPA 2KDMA 3W5UB 1WSPA 4ARIA 1ZOYB 2ONQA 2RDGA 3AE6B 1JQ4A 3BVMA 1JRPA 3FILB 2PTLA 4AS1A 1PDXA 2I38A 3GB1A 3AE7B 2H89B 3BIID 4LLGM 1Y56A 4NZLB 2Z8LA 2G1EA 1YN5A 4WAFA 1L4ZB 2BBCA 2M56B 3EA6A 4B0MA 1TS3A 3AE8B 1RFKA 3AE2B 1IUEA 1B1ZA 1DGJA 1TKYA 2DYMA 3HVZA 2LUMA 4B0EA 1WGKA 4WURA 1WYGA 3AEDB 2I2YA 4REZA 1AW7A 5AUKA 2L83A 2RPVA 3KWVA 4JWUC 2FBWB 3DWGC 3PO0A 2BTEA 1MHHE 3BWUD 1KTKA 2NMQA 2PKOA 3ZGZA 2INPE 3ZJVA 1J7AA 4TQ0A 1VRAB 1EU4A 4Q2JA 2IPKD 1C77A 3LB8C 4C7ZA 1OFFA 1EWCA 2PW9A 1DYQA 4ZRPA 2BT6A 1FFVA 1QOBA 1XXGA 3NVYA 3VQIA 3Q8EA 1C78A 2ZW1A 3URYA 3IAS1 2K3UA 3TEYA 3NUHB 2HTME 4TQ1A 1FNWA 4MACA 1UGJA 5EE1A 4DQOC 4YSZB 2JX5A 3H8HA 3J9CA 4HROA 2JWUA 4RH6A 1BUIC 2WXIA 4XE0A 1T3QA 4GDLB 1FEHA 3B9JA 3AM9A 1L0VB 1QOGA 4YTMB 1ZUD2 2V3NA 1VJKA 4RGOS 2L1AA 2V3PA 2VZKB 4HEA1 2QMTA 5BYQA 2JU6X 4RGMA 1XCQL 2WXNA 3BVGA 4YT0B 1AYFA 4GLSC 3BYTB 3AEAB 3AEGB 3IT4B 2N9LA 5G5GA 2WXQA 4IKGA 4MH8A 3R2IA 1TS2A 1XEEA 4J3OD 2YEPF 5D7GA 1EM7A 5I4DA 1F2RI 1YQ4B 2DYOA 4GDKB 3C8YA 2KACA 1N61A 1FMAD 1EU3A 1SE4A 1D5ZC 1FXAA 5AUIA 3WCQA 3B2FA 2WU2B 4WWMA 3MJ5A 3HUIA 1E6EB 1KF6B 2H88B 2QSDA 3GS2A 3MHZA 1FCCC 2PIAA 1PYWD 1I4RA 3ABVB 1FRDA 2ZW0A 2FE8A 1SE3A 1TS4A 3UI3A 3NRZA 2K9XA 3VR8B 1WXQA 4XWTA 2GI9A 4YSYB 1LO5D 3W5VB 3TEWA 5H8YE 1HQRD 3W1SA 1JMLA 1YMHE 2CJOA 3I9V1 1NI3A 3RPFC 1IBXB 1KLUD 2CJNA 1UWXA 1VLBA 3SFEB 1PGAA 3DWMA 1YQ3B 3P4QB 1E9MA 4RFBA 2WXOA 3CIRB 1V1OA 1T6BX 1E7PB 1PFDA 2SAKA 4A55A 2IGGA 1VDVA 2FUG1 1N5WA 5C3JB 1QF6A 1ZPSA 1TKEA 3NVVA 4HJGE 1XLNA 1VZ8A 1YJJA 1CZPA 1SJED 1YJIA 3KQ4A 2BW2A 5D3IB 2AQ2B 1D5XC 1ROEA 1SE2A 2N0SB 4N59A 1V1PB 2NTSA 5D3DA 4US8A 1JWAD 4MT5A 1QKZA 1L5PA 2MJDA 1SBBB 3CWIA 3ZJUA 5HI1A 1L0XB 2RDHA 5BMGA 1JWSD 2NTTA 3HVDA 1K51A 1MPEA 2J52A 4M0WA 2JYTA 4WH4A 1QOAA 5E6JA 3FILA 1YNTE 4KKIA 2MH7A 1ENFA 2E6XA 3Q8BA 4N58A 2QIEB 4P6VF 1N63A 2E3TA 5TSSA 5MPOA 1ZXIA 1NYRA 1XF5L 2SEBD 5H92C 4AQ7A 1BXTA 1IGDA 3VR9B 1PGBA 1TKGA 1SIJA 1CK1A 2WDVB 2V4IB 2WXMA 3P63A 3AEFB 1TYGB 4PT5A 1GPXA 2WLBA 1FRRA 2Y5PA 2WQYB 3SFDB 2IGHA 4P16A 1R7SA 4L2YA 1KLGD 5GXGB 2QILA 1NENB 3BVZA 2D5GA 2W82A 1XLPA 4A9AA 1XLQA 4HKZE 4DXFA 1V97A 1XO3A 2KQ4X 3IAM1 1NVID 4R3DA 1I4HA 4L23A 3EGRA 1FCLA 4O1NA 4RF0A 1TZOA 1C4CA 4KGSA 2K0PA 2ON8A 1C76A 1L6UA 1N60A 1JW9D 3R2TA 2MEKA 1YN3A 1I4GA 4LK0M 3HRDD 3LYYA 4RCOA 3LXFA 4NJCA 4C80A 1VR9A 3Q8FA 4RGTA 2AQ1B 1P7FA 3P4PB 4XDCA 1TY0A 3AE3B 4L1BA 1N62A 3BZDB 1XLOA 3T3OA 1FD6A 4OW0A 1HXYD 1FFUA 2BS3B 1TJEA 3AEBB 2IGDA 2J4XA 1JCKB 3OWEB 2MJ3A 5HFYA 1FXIA 4TSSA 1MHXA 5C2TB 4FXCA 4JWSC 2KAJA 1GAQB 4ZYSA 1MVKA 1QQRA 4A8XC 4ZHPA 4A6QA 4RF1A 3AN1A 1A70A 3U7ZA 4XDDA 3U2SC 3EUB2 3AB5A 3Q8AA 2BS4B 2N9KA 4D2KA 2Y5CA 3B2GA 2PMVA 4JX1C 3IXSA 3IT6B 1UNSA 2IDYA 2OHFA 2AQ3B 3NZ3A 2BB6A 1C79A 1UWMA 2W3SA 3BYYB 1HEZE 2L32A 2WDQB 3AE1B 3AE5B 2EELA 1M4VA 1ESFA 1SXTA 3E9SA 4ARCA 3L4PA 1KRHA 4OVZA 4ZHOA 1IGCA 4YTPB 3FC4A 2TSSA 1J7CA 3VRBB 2WP9B 3AH7A 1HZ6A 2GRIA 5BYRA 3ZYYX 3V3XA 5BYSA 3U4EG 5T8IA 4KGRA 1ET9A 4H2AA 4MM3B 3MP9A 4TMAB 1HA5A 4LTUA 2BYTA 3KLSX 1TY2A 1V1PA 3MFGA 4ITKA 2MJEA 1ZDVA 1K50A 1E0ZA 1K52A 1QOFA 1TS5A 1YN4A 1B9RA 1Q10A 2WS3B 1F2RC 1P7EA 4ZRQA 1RWSA 1QLBB 2ACZB 2W3RA 1C4PA 1CQVA 1ET6A 1RYJA 4YWGG 2WXKA 4UDUC 2W55A 5FKAC 1GOZA 1D5MC 4N6EB 1SSNA 3MC0B 4NAMA 3VRAB 5HG2A 2LGIA 1ZP0B 1I4QA 1T5XD 1EWYC 2Y3AA 1SJHD 5EE9A 4IOIE 3P4SB 1I4XA 4HKQA 1AN8A 2M19A 2BS2B 4DXGA 1KFYB 1WRIA 2JQRB 1MI0A 2J42A 1SB3C 4EE2A 1WWTA 3AE9B 3Q69A 3RFZB 1QILA 3T3NA 4C7YA 1GB4A 3TEXA 2ICIA 4RGNA 4YXDB 2PVGC 2WXHA 1QT9A 3AV8A 2EKIA 2VZKD 1ZXHA 1ZE3D 1C4AA 1OQQA 2JYEA 2LHEA 5LNK1 1JWBD 1N5XA 1STEA 2W54A 1BMLC 1NYQA 2J53A 4CQNA 4OHJA 2M0AA 1VZ7A 2LJIA 3NS1A 3BK1A 3SEBA 1JALA 2N7JA 2RMMA 4WIPA 3FAHA 5EE0A 1DOIA 1JWUD 4IDIA 2WXGA 1ACCA 4RNAA 1F77A 3TSSA 1NEKB 1C9FA 5BMHA 3ZQ4A 1L6VA 3P42A 2XNAC 1PUTA 2PVOD 3BK2A 1F0ZA 3P1MA 5G5HA 1OQRA 2K22A 2WNMA 4XWWA 2KWDA 2LFIA 2V0GA 1J7BA 4JE3B 2WXRA 4KKJA 2K5PA 2IJ0A 4JPSA 3AEEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  3AEC B;  3L4P A;  1KRH A;  2HTM E;  2QIE B;  4N58 A;  4P6V F;  1FIQ A;  4HRS A;  4YTP B;  4ZHO A;  4ZOH C;  3FC4 A;  4YTN B;  1N63 A;  1E10 A;  2E3T A;  1J7C A;  2WP9 B;  1ZXI A;  5EE3 A;  3VRB B;  5MPO A;  5EE1 A;  3AH7 A;  4YSZ B;  1NYR A;  2JX5 A;  5H92 C;  2Q5W D;  4HRO A;  3VR9 B;  2B76 B;  2DBY A;  2WU5 B;  1T3Q A;  3ZYY X;  2KMM A;  3B9J A;  3AM9 A;  1L0V B;  2CU3 A;  1DOY A;  1QOG A;  1TKG A;  2AX5 A;  4YTM B;  1SIJ A;  3AE4 B;  3ETR A;  1ZUD 2;  2WDV B;  1VJK A;  2LEK A;  3P63 A;  2QJL A;  3AEF B;  1TYG B;  1V8C A;  1JRO A;  1GPX A;  1DOX A;  2WLB A;  4LTU A;  1FRR A;  1FO4 A;  3KWL A;  2WQY B;  3SFD B;  3SR6 A;  4YT0 B;  3NVZ A;  1AYF A;  1R7S A;  2MJE A;  4ITK A;  3AEA B;  3AEG B;  5GXG B;  5G5G A;  1NEN B;  1E0Z A;  3NVW A;  1QOF A;  1B9R A;  2WS3 B;  4US9 A;  1XLP A;  4A9A A;  1I7H A;  1XLQ A;  1RWS A;  2DWQ A;  3P4R B;  1JQ4 A;  1QLB B;  1V97 A;  1YQ4 B;  2W3R A;  1XO3 A;  2ACZ B;  1RYJ A;  2WDR B;  1AWD A;  1NVI D;  2W55 A;  1N61 A;  1CJE A;  1FMA D;  4WQM A;  5AUI A;  1FXA A;  3WCQ A;  1FM0 D;  1RM6 C;  3B2F A;  4N6E B;  2WU2 B;  4WWM A;  3VRA B;  4USA A;  3HUI A;  1E6E B;  1KF6 B;  2H88 B;  1ZP0 B;  2PIA A;  1L6U A;  2L52 A;  3AMZ A;  1N60 A;  1JW9 D;  1EWY C;  4KX6 B;  3ABV B;  5EE9 A;  3P4S B;  3W9C B;  1FRD A;  3AEE B;  4YSX B;  1SF0 A;  2M19 A;  3HRD D;  2BS2 B;  1KFY B;  1WRI A;  2JQR B;  3W5U B;  3NRZ A;  1ZOY B;  2K9X A;  3AE6 B;  3LXF A;  1WXQ A;  1SB3 C;  1JRP A;  4C80 A;  1WWT A;  3AE9 B;  4YSY B;  3VR8 B;  3W5V B;  1PDX A;  3P4P B;  3AE7 B;  2H89 B;  3AE3 B;  4C7Y A;  3BII D;  5H8Y E;  2CJO A;  1N62 A;  4YXD B;  1XLO A;  2PVG C;  1NI3 A;  3RPF C;  2G1E A;  2CJN A;  1QT9 A;  3AV8 A;  1VLB A;  2EKI A;  3SFE B;  2M56 B;  1YQ3 B;  3DWM A;  1E9M A;  1FFU A;  3P4Q B;  3AE8 B;  3CIR B;  1RFK A;  2BS3 B;  1TJE A;  3AE2 B;  1IUE A;  1E7P B;  1PFD A;  1OQQ A;  3AEB B;  1VDV A;  1DGJ A;  1N5W A;  1JWB D;  1N5X A;  1TKY A;  5C3J B;  1QF6 A;  2W54 A;  2MJ3 A;  1NYQ A;  3HVZ A;  1TKE A;  1FXI A;  1WGK A;  1WYG A;  3NVV A;  3NS1 A;  3AED B;  5C2T B;  4FXC A;  1XLN A;  1JAL A;  4JWS C;  1YJJ A;  2KAJ A;  1GAQ B;  3FAH A;  1CZP A;  1YJI A;  1DOI A;  4IDI A;  5EE0 A;  5AUK A;  2L83 A;  4ZHP A;  4JWU C;  2FBW B;  3DWG C;  3PO0 A;  1NEK B;  3AN1 A;  1ROE A;  1A70 A;  2N0S B;  4N59 A;  3EUB 2;  1L6V A;  2PKO A;  3AB5 A;  2BS4 B;  1J7A A;  1PUT A;  4US8 A;  1JWA D;  2PVO D;  1L5P A;  1F0Z A;  2MJD A;  2Y5C A;  3P1M A;  3CWI A;  5G5H A;  3B2G A;  3LB8 C;  1OQR A;  4JX1 C;  4C7Z A;  2K22 A;  1OFF A;  2OHF A;  1UWM A;  2W3S A;  1J7B A;  2BT6 A;  1FFV A;  1QOB A;  1QOA A;  2K5P A;  2WDQ B;  3NVY A;  2MH7 A;  3AE1 B; 
#chains in the Genus database with same CATH topology
 3PZ8 A;  3H7I A;  9ICP A;  3UIN B;  4QZA A;  3ZRF A;  1BPD A;  3SHQ A;  4YTN B;  3PY8 A;  2ZJ5 A;  2HDE A;  5EE3 A;  5DCN A;  5KG5 A;  3MGI A;  4J9Q A;  1PGX A;  5HHH A;  2X38 A;  4RMA A;  1KJT A;  4CDG A;  2BPS A;  2WU5 B;  2DPJ A;  9ICA A;  5ALE A;  2KMM A;  3T5J A;  1ZQD A;  3N9Y C;  3QXG A;  3APC A;  2JZP A;  2AX5 A;  1MFW A;  4I6P A;  1D4B A;  4IQV A;  2KSO A;  5DBA A;  3PHW B;  4K4G A;  3I57 A;  1JRO A;  3R8B A;  1FXT B;  5KFY A;  3A33 B;  4TQS A;  2EMS A;  3TL5 A;  1FO4 A;  5ALQ A;  5HHD G;  2FI1 A;  2LI6 A;  5HR6 A;  3RB4 A;  3NVZ A;  2JSV X;  3M6Z A;  4JV0 A;  4QNL A;  1PVP A;  3L17 A;  3O13 A;  4KGT A;  2BCS A;  4QWB A;  5HHI A;  3F2D A;  7ICP A;  2LAS A;  3A4R A;  4M00 A;  2DNF A;  1X1M A;  5DPW A;  1V9J A;  2WXJ A;  1CJE A;  2QB1 A;  1S0N A;  4WQM A;  5AKK A;  1FM0 D;  5AI9 A;  2M17 A;  2FAZ A;  4Q43 A;  1PK3 A;  3L5K A;  8ICP A;  3AMZ A;  5HMM A;  2L52 A;  5AM4 A;  2E8M A;  3MHS D;  2JXT A;  2WF9 A;  4DQS A;  3ICX A;  3KOO A;  5AIA A;  4NJ8 A;  4FO6 A;  3ML9 A;  3IG8 A;  1XSL A;  3PRZ A;  3C0R B;  3W5U B;  5AEK B;  1V9P A;  3PO4 A;  1MJD A;  3SMV A;  2HHU A;  2RDG A;  3AE6 B;  8ICI A;  1JRP A;  1Q0W B;  2G09 A;  2VH2 A;  4W9E A;  3HW8 A;  2I38 A;  3K9O B;  1ZQW A;  1V5T A;  2H89 B;  5KFS A;  1X6J A;  4NZL B;  2P6R A;  8ICO A;  3PSF A;  1L4Z B;  4C4R A;  4K4H A;  2BBC A;  2DAJ A;  2M56 B;  3EA6 A;  4FUL A;  4IQW A;  1TS3 A;  3AE8 B;  3Q8L A;  2YX8 A;  3ZI4 A;  7ICL A;  3AE2 B;  4ICU A;  1JUD A;  1TAU A;  4YR2 A;  1B1Z A;  4UB3 A;  1DGJ A;  1TKY A;  3RUI B;  1X9S A;  3WIM A;  3KKA C;  5KFR A;  2LUM A;  4B0E A;  5J0P A;  3RRH A;  1WGK A;  4WUR A;  2I2Y A;  5AUK A;  4TUP A;  4YXJ A;  5C0Y A;  4JWU C;  5EWG A;  2BTE A;  1MHH E;  4UQG A;  1ZJM A;  4EEW A;  2CR5 A;  4NM2 A;  4PHP A;  4DL6 A;  3WAP A;  3PZD A;  2JRI B;  3T8M A;  4YMN A;  5HP4 A;  2IPK D;  4FFD A;  3EFC A;  3DDH A;  1UPH A;  5L1J A;  1ZET A;  5DGA A;  4KZ0 A;  1EWC A;  5E6O A;  3RAQ A;  4CRX A;  3Q3M C;  2ZCB A;  2XY6 A;  3ALB A;  2O6V B;  1QOB A;  3S6J A;  3GU3 A;  1BT0 A;  2KG5 A;  3NHE B;  3C1Y A;  4MF2 A;  4ICA A;  2ZCC A;  4NL9 A;  1SIF A;  4CO7 A;  2LVQ A;  2K3U A;  3AXC A;  4K81 A;  3TEY A;  4RUA A;  2KDI A;  4TQ1 A;  1SV4 A;  1RG6 A;  3G6V A;  1FNW A;  5G2N A;  2G06 A;  3PT2 B;  2C22 A;  1HUZ A;  2V1Y A;  4M0A A;  4DHJ B;  1P98 A;  3QAQ A;  2JZ3 B;  4HRO A;  1L5U A;  1WJN A;  1NOM A;  2MSE D;  2N7E A;  4RH6 A;  3FYH A;  3ZW3 A;  4XE0 A;  2ASQ A;  3I63 C;  2Y5B B;  1WGY A;  4F4W A;  1L0V B;  2IA6 A;  2LGD A;  4DS5 A;  4GC7 A;  4YTM B;  5KFJ A;  2V3N A;  4K7U A;  4HJK A;  2V3P A;  2VZK B;  5BYQ A;  2QMT A;  4MJS B;  1IP9 A;  3VTW A;  2WXN A;  3WKB A;  4YT0 B;  3UM9 A;  3V6J A;  2E1F A;  5AI4 A;  3AEG B;  3IT4 B;  2N9L A;  5G5G A;  1T7P A;  4IKG A;  4E71 A;  1E7U A;  3R2I A;  1TS2 A;  1XEE A;  1T0Q C;  3BZK A;  1DXS A;  1EM7 A;  5I4D A;  1F2R I;  1OXJ A;  1ZQE A;  1WXA A;  1FMA D;  3HM6 X;  2N7D A;  2J6T A;  4NJ7 A;  3DVG X;  3OHA A;  1KF6 B;  3R7Q A;  5F9L A;  3RTV A;  4O3M A;  3RH5 A;  2CN1 A;  4CCH A;  2MA9 B;  3KHG A;  4UAR A;  2VH1 A;  4MGI E;  3RNB C;  5J0Y A;  1LVH A;  4RT3 A;  4DS4 A;  1MG8 A;  2W7O A;  4F4Y A;  3UQ2 A;  1SE3 A;  2FE8 A;  3JPR A;  4M9J A;  5CHF A;  5ALY A;  9ICN A;  4AOF A;  5AK5 A;  2F8L A;  4EEL A;  4KLQ A;  3VR8 B;  1WXQ A;  4RQ4 A;  4RM8 A;  4XWT A;  3TMP B;  1LO5 D;  2LWP A;  3W5V B;  5DG9 A;  1UBI A;  1HQR D;  3W1S A;  2PMZ C;  1YMH E;  7ICQ A;  5IIK A;  1KSP A;  4R64 A;  3L54 A;  3DWM A;  1X42 A;  2JRZ A;  5J8Y A;  3CIR B;  3SZ2 A;  3PHX B;  4XZ4 A;  4ANW A;  2PE6 B;  5J2A A;  3ZO5 B;  4I2B A;  1PFD A;  3ZTD A;  4FAD A;  3MFH A;  4TUR A;  2W8K A;  4OJO A;  1TKE A;  1WUD A;  2CRX A;  1E8Z A;  3H7S A;  1YJJ A;  2BCR A;  1CZP A;  1SJE D;  3KQ4 A;  4IWO A;  5D3I B;  1P0R A;  2AQ2 B;  1D5X C;  1YZ7 A;  2VJ5 A;  2C2D A;  1RFA A;  1H8C A;  4ECQ A;  1KTQ A;  3EWA A;  3SEN A;  1HJP A;  4US8 A;  1JWA D;  4JWM A;  1C3T A;  3WK5 A;  2MJD A;  5IIO A;  2Y9T A;  3UXO A;  4F50 A;  9ICL A;  3WU2 U;  1K51 A;  3N30 A;  2JYT A;  4YN4 A;  1KOT A;  1XC9 A;  4EYI B;  4ED3 A;  2EZX A;  4NLK A;  5E6J A;  4M8M A;  3I3T B;  3K9P B;  3WAM A;  2E6X A;  3Q8B A;  4URK A;  2IOF A;  1WWV A;  2QIE B;  4N58 A;  4DXA B;  1ZQA A;  3VCB A;  4FLH A;  4F7Z A;  1N63 A;  5TSS A;  1S0V A;  4JV2 A;  2JEF A;  1NYR A;  1XF5 L;  5H92 C;  2DGZ A;  1BXT A;  1WE7 A;  3NZU A;  2HBM A;  3PGE A;  1ECW A;  1T8E A;  4C8O A;  3GV5 B;  4HPP A;  3C1Z A;  3EYZ A;  1CK1 A;  2WXM A;  2VA3 A;  2FLL A;  1KRP A;  1Q1O A;  2AEH A;  2WLB A;  3U7D A;  3SAF A;  3QK0 A;  9ICC A;  4BOZ B;  2INC C;  2W04 A;  1A6S A;  1R7S A;  2KDB A;  4CYE A;  3ZDA A;  3EFU A;  4KLF A;  3BVZ A;  1A77 A;  1T94 A;  2D5G A;  2MBQ A;  4Z6D A;  3O0F A;  2R8I A;  1NK7 A;  2HVI A;  4HKZ E;  1BPY A;  5KFP A;  4MGK E;  4I2A A;  2W9M A;  4R3D A;  1I4H A;  1Z00 B;  4C4S A;  1FCL A;  4RF0 A;  5ALM A;  2K4P A;  2QKQ A;  1LKY B;  4R66 A;  5DPS A;  1YX6 B;  1XQQ A;  2ON8 A;  1LXD A;  1L6U A;  1BNP A;  4NPN A;  1N60 A;  2Y1I A;  3GIJ A;  4Y2T A;  4FJY A;  2R8G A;  3D32 A;  1ZD2 P;  2WAQ C;  4F4Z A;  2KOB A;  1CI4 A;  2LZ6 A;  1WJU A;  3Q8F A;  2KTF A;  4XDC A;  4XRH A;  4JGH B;  2DZI A;  4UAS A;  4J9M A;  2ZTD A;  4ECW A;  4OW0 A;  2K4I A;  5CHV C;  9ICO A;  4IR9 A;  3WKE A;  4MJS A;  2D07 B;  1TJE A;  3QZ8 A;  5AKZ A;  2C9W B;  1L2N A;  2J4X A;  4NLC A;  1UF0 A;  4W9F A;  2MJ3 A;  1FXI A;  2ZTE A;  4G11 A;  1WZ0 A;  3JPP A;  4NLG A;  2G0A A;  3H40 A;  5DLF A;  4FXC A;  7ICR A;  1GO3 F;  3MC1 A;  4A8X C;  5ALT A;  3AN1 A;  4F4X A;  1A70 A;  2VIX A;  5L9X A;  4BJQ A;  4LNO A;  1JI7 A;  2KEY A;  3U2S C;  4IWQ A;  4ANX A;  5DDM A;  4QZD A;  2LYB A;  3N20 C;  5F3X B;  2C28 A;  3BY4 B;  1V85 A;  2CHX A;  2IY1 B;  2Y5C A;  2KFZ A;  3QUC A;  2J0K A;  3WKA A;  3IT6 B;  3NZS A;  4UB8 U;  2IDY A;  4B6J A;  4JK1 A;  3DHG C;  4FJZ A;  2BPF A;  3RZF A;  4ICV A;  4JV1 A;  5ALH A;  2M9N A;  4FZN A;  3V60 A;  2W3S A;  1HUO A;  2LI5 A;  3BYY B;  4HWI B;  3SEI A;  2WDQ B;  2LM4 A;  4YG2 A;  2G45 B;  4KLJ A;  4IQT A;  3L13 A;  3QUT A;  3AE5 B;  1WG8 A;  2KHV A;  1SXT A;  3E9S A;  2YMQ A;  3CP8 A;  4UB5 A;  3L0W B;  9ICW A;  1TT5 B;  1IGC A;  4YTP B;  2ZIU B;  4P7I A;  3C5F A;  1D3Z A;  1I35 A;  3I1Y A;  2K8C B;  2RDI A;  2BQ3 A;  2UVV A;  4IRC A;  2M8S A;  2RHF A;  2R8J A;  2DPI A;  1DRG A;  4OD0 A;  3I76 A;  5KG2 A;  4ED6 A;  3GIM A;  4CF4 A;  2LD9 A;  5IO9 A;  5JHB A;  4PGQ A;  4E0D A;  1T0R C;  2JVC A;  3RD2 A;  2LPE A;  5BPC A;  5BYS A;  3U4E G;  2LRW A;  5T8I A;  2AJQ A;  1J19 A;  5KL1 B;  2H3F A;  1NK6 A;  3SD5 A;  3KBB A;  2HBL A;  4MM3 B;  4TMA B;  3C23 A;  1EF5 A;  2PXI A;  8ICZ A;  1HA5 A;  2K39 A;  3KLS X;  5J0U A;  4ACO A;  3VTV A;  3PV8 A;  1TY2 A;  7ICN A;  4C0Z A;  5J0O A;  5AKL A;  2K8H A;  1JXE A;  1E0Z A;  1K52 A;  2MSN A;  4YXM A;  1QOF A;  1YN4 A;  2WHI A;  1KFD A;  2GBJ A;  1B9R A;  3H6N A;  1A76 A;  1F2R C;  1ZQK A;  2XK5 B;  2YMP A;  2YTU A;  5KFF A;  1QLB B;  2ACZ B;  3HHM A;  2W3R A;  1C4P A;  1CQV A;  4YWG G;  4ZDV A;  3CST A;  2ISO A;  2FIF A;  4WAA A;  5FKA C;  3ZNI D;  3RJH A;  4N6E B;  2KN5 A;  3A1Q B;  3KFU F;  4ANV A;  1SSN A;  7ICS A;  3H4D A;  1SE9 A;  1SL2 A;  5AK6 A;  1ZP0 B;  3V62 A;  2KTQ A;  3A0B U;  2ZJ8 A;  1I4Q A;  2EAN A;  3QZ7 A;  1XS9 D;  3VXW A;  2RP5 A;  3P2B A;  4MEL A;  2HHT A;  4OJ6 A;  1WRI A;  4MH0 E;  2NR2 A;  2C5L C;  1YOV B;  3QIJ A;  3UQB A;  2J42 A;  4A8E A;  3AE9 B;  1JRU A;  1K5O A;  1R4M I;  2IHN A;  2XGQ A;  8ICF A;  1U45 A;  1GB4 A;  2ICI A;  4BUG A;  4S17 A;  3RR8 A;  4DL4 A;  1T3N A;  2DQN B;  4NJ6 A;  2WB1 C;  1K1Q A;  3DBL I;  2LYA A;  1Z1V A;  4YL8 A;  3PPA A;  1ZXH A;  2YMM A;  5ALN A;  1ZQY A;  2JXX A;  1IM4 A;  2RDJ A;  3EZ5 A;  1UZX B;  1JWB D;  5LNK 1;  1STE A;  2W54 A;  2G5H B;  4DLE A;  4O3O A;  4OHJ A;  5KAF U;  4WQO B;  1V38 A;  3NS1 A;  3GOE A;  4RQ3 A;  3SEB A;  3JPO A;  1TFR A;  4QAY A;  5EE0 A;  1DOI A;  1JWU D;  3PS6 A;  3IM1 A;  1ACC A;  4GIV A;  1WGH A;  3QAR A;  3MFI A;  4A3P A;  3ZD9 A;  1GC7 A;  4P4P A;  2IO3 B;  3B1L X;  3GIK A;  8ICG A;  1LKY A;  2IZV B;  1OGW A;  5KT2 A;  1U4B A;  2J6S A;  3ZDE A;  4HXD A;  4BX9 C;  2KWD A;  3C29 A;  1PUZ A;  4A3O A;  2LFI A;  1J7B A;  3QU5 A;  4DFM A;  2FNJ B;  2K5P A;  3H1U A;  8ICU A;  4JPS A;  3OSP A;  4JL9 A;  2OOB B;  2R61 A;  1PQS A;  3OJ3 A;  4HVB A;  3H9D A;  4M2Y A;  1QQ5 A;  1NKB A;  2KN4 A;  1FIQ A;  1GC6 A;  1QQ7 A;  5FK9 C;  1E10 A;  4RT2 A;  1F5S A;  2KNB A;  4W9I A;  3WK9 A;  4LJO B;  2FLP A;  1ZW7 A;  2DKZ A;  3TEZ A;  2B76 B;  2INN E;  1SZP A;  4ECT A;  4RQ2 A;  5AKG A;  4YFK A;  3H8W A;  2H5X A;  2NO4 A;  2QJL A;  2V4Q A;  1CUK A;  8ICQ A;  1V8C A;  1YJ1 A;  4WWO A;  1F9J A;  2FPK A;  5AI6 A;  3SR6 A;  4PPX A;  4KX3 A;  3ENE A;  2N9P C;  3GP7 A;  3V7K A;  3F5A A;  3MC8 A;  3U52 E;  2LJ5 A;  2HSZ A;  3NVW A;  2UVW A;  2KJ5 A;  4ECY A;  2FUH B;  2DLB A;  4OJL A;  3P4R B;  4C8N A;  3DV9 A;  3MC9 A;  1IIP A;  1SV0 A;  4JMU A;  1AWD A;  2JUO A;  3V05 A;  2WXF A;  4NY0 A;  3BJY A;  2PLP A;  1ZQI A;  2E8O A;  2UVU A;  3PZ7 A;  2ZEQ A;  8ICV A;  1EO6 A;  1ZDX A;  3QE9 Y;  2LBO A;  4YD1 A;  1GB1 A;  2MHJ A;  1FNU A;  2CPR A;  4KX6 B;  2WXL A;  2ZIU A;  5JXV A;  1QSY A;  1KH0 A;  2G9H D;  4MEX A;  4Z6F A;  4K7W A;  5AZH A;  4YSX B;  2WHE A;  2K8C A;  1S0O A;  4ARI A;  3IFW B;  4M47 A;  1JQ4 A;  2KJ6 A;  1B4F A;  4DWF A;  1TE2 A;  2KAN A;  1PDX A;  5J2I A;  3GB1 A;  3TI0 A;  5KFL A;  3AE7 B;  1S9F A;  4LLG M;  1Y56 A;  4WAF A;  4MM3 A;  4B0M A;  4YVZ A;  1Q3V A;  2A5U A;  4RQ6 A;  3DBR I;  9ICI A;  2WTF A;  1X2I A;  9ICJ A;  9ICS A;  4C4V B;  4QZ8 A;  2DYM A;  3TIX A;  3PNC A;  3Q8R B;  2KC2 A;  1TAQ A;  4F8C B;  3ETL A;  2W9A A;  2XK5 A;  4KN4 A;  4BXO B;  1MQ3 A;  1V80 A;  1MG4 A;  4TKN A;  1AW7 A;  1DK2 A;  3FKY A;  4KSL C;  8ICK A;  4KN7 A;  3PO0 A;  2KZ3 A;  5AIC A;  2EZY A;  3TAR A;  1X66 A;  3A1Q A;  3ZGZ A;  2IHM A;  1Y88 A;  2KK0 A;  2OYY A;  3RJF A;  2KIC A;  1EU4 A;  1RXW A;  4RNM A;  3HPO A;  4Q2J A;  2NRT A;  1C77 A;  4GIB A;  4C7Z A;  4KLH A;  3X23 A;  3KTQ A;  1ZQP A;  1DYQ A;  2C60 A;  2HJ8 A;  3IVF A;  1DK3 A;  4RNN A;  2C2R A;  4GOC A;  5ALW A;  4ZRP A;  5HNK A;  3VUY A;  2HOQ A;  3FM9 A;  5BO4 B;  3C21 A;  3NVY A;  3HKZ C;  1XO1 A;  5J2F A;  3NUH B;  4QWD A;  2HTM E;  4F92 B;  5KFE A;  2VA2 A;  3HX0 A;  2Z0D B;  3HK0 A;  2VAN A;  4II2 B;  4MF8 A;  1V86 A;  3J9C A;  2JMG A;  4C8M A;  4M04 A;  5H2F U;  1BUI C;  1T3Q A;  4IRD A;  2MBO A;  2GOL A;  5DPT A;  3SQI A;  4RNO A;  1QOG A;  4GLX A;  9ICE A;  3ISC A;  1ZUD 2;  1VJK A;  4RGO S;  2L1A A;  1TK5 A;  1D8Y A;  2JU6 X;  3ZD8 A;  1V5O A;  1XCQ L;  4RQN A;  4UB1 A;  3D2Q A;  1AYF A;  3BYT B;  4YR0 A;  4MH8 A;  4FN2 A;  3QHT A;  4IG7 B;  4W9J A;  2ZZP B;  4P0P B;  4RM9 A;  2DX5 B;  1KQQ A;  4ZYN A;  3TJP A;  3MDC A;  3ZKJ C;  2KMC A;  3F53 A;  2YEP F;  1L3T A;  1YQ4 B;  1TV9 A;  2MA1 A;  3ALR A;  3PZP A;  2ZVN A;  4WWP A;  5AUI A;  3C2L A;  3Q14 C;  3RYT A;  4WWM A;  4QWE A;  3MJ5 A;  3N3K B;  5ALR A;  3HUI A;  2H88 B;  4Q45 A;  4XYC A;  3MTN B;  3WKC A;  1YD8 U;  4DL3 A;  2ZVO A;  3JYU A;  2FCQ A;  2MP2 B;  4QIW F;  4DDI D;  3V7L A;  4QZ9 A;  4I27 A;  1XT9 B;  3HIZ A;  4IWP A;  5TIS U;  1FRD A;  5B66 U;  2PFP A;  5AK4 A;  2KXJ A;  3UI3 A;  3RJK A;  2LYH A;  1TK8 A;  3E2E A;  2BYV E;  1CEZ A;  2LM1 A;  3TEW A;  2NRX A;  3G6X A;  2FPL A;  1RAX A;  5H8Y E;  1BGX T;  1IBX B;  1KLU D;  2R2O A;  3SFE B;  1PGA A;  2FJ6 A;  4PS8 A;  2WXO A;  1PK1 A;  2AL6 A;  3M9O B;  2MUT B;  3SDL C;  3DOW A;  2SAK A;  4XUS A;  2IGG A;  3PRE A;  3ZLZ A;  1WZ3 A;  1QF6 A;  4O3N A;  1ZPS A;  2HCF A;  1WFY A;  9ICX A;  2KWU B;  4GXJ A;  1XLN A;  3N4M B;  1VZ8 A;  2J7Q B;  2OJW A;  4GXK A;  2D3D A;  2J0J A;  2BW2 A;  3NOB A;  4DQP A;  7ICH A;  1SE2 A;  3AU6 A;  1S97 A;  1P7D A;  4PJ0 U;  1V1P B;  2NTS A;  4K1R B;  1GJZ A;  4M9H A;  1BVS A;  1WGR A;  5ALL A;  4O9M A;  2KMD A;  5ALX A;  2BDP A;  2GWS A;  2QCZ A;  1DGS A;  3VH4 B;  3UMB A;  2PFO A;  4ELU A;  3K1Z A;  3ZJU A;  4NQL B;  5HI1 A;  1QCK A;  2BPG A;  1N48 A;  2UU7 A;  2F1I A;  4F5P A;  3OJ4 B;  3WAL A;  5ALV A;  3HVD A;  4UBB A;  2J52 A;  4P4M A;  1ZQL A;  4P2H A;  1ZQM A;  2BKE A;  3VTU A;  3PSP A;  1YNT E;  2MH7 A;  4NY8 A;  2Q0Z X;  4G9B A;  3N28 A;  5JRT A;  2PMZ F;  4XQ8 A;  5CX3 A;  1WGG A;  2C7H A;  2G4S A;  7ICM A;  3SAG A;  4B9K A;  3QC8 B;  2G5I B;  5KT3 A;  1S77 D;  4AQ7 A;  7ICO A;  1OEY A;  5J2G A;  4C4V A;  3UPQ A;  3ZDD A;  2NS5 A;  1T0S C;  2NRW A;  2C2E A;  5AHX A;  4QZC A;  1SIJ A;  5KHO A;  2WDV B;  1SV0 C;  2D8C A;  4HAI A;  1N2X A;  4BXO A;  4F5R A;  3OHB A;  4XGA B;  1GPX A;  3OAW A;  4DHZ E;  8ICM A;  1FRR A;  2PE9 A;  7ICK A;  3BIN A;  3SFD B;  4RQ7 A;  4DSJ A;  2IGH A;  4IR1 A;  1Z4N A;  4ZH4 A;  1P1A A;  4QIW C;  5KFD A;  2F44 A;  3TAD A;  3AU5 A;  1ZQG A;  4BVU C;  5KFZ A;  4Y2R A;  1XLQ A;  3RB0 A;  3C5G A;  4C8L A;  2L00 B;  4J6I A;  1RPL A;  1XO3 A;  3WKD A;  2KJ9 A;  3EGR A;  4I2I A;  2ZNV B;  3NUQ A;  2ISP A;  3UMG A;  4NLN A;  2XVT A;  4K7S A;  2PEA A;  9ICK A;  3MR2 A;  2WF5 A;  1C76 A;  4CE6 A;  1OW5 A;  3MR3 A;  3DVN V;  2KX3 A;  1D9F A;  4UAU A;  2MEK A;  2D3G A;  5IIM A;  1YN3 A;  3BS5 B;  3HRD D;  3GV7 B;  4KLO A;  2R8K A;  3QEB Z;  4RCO A;  2CS4 A;  3LXF A;  4NJC A;  2KMA A;  4RGT A;  5JTI A;  3P4P B;  3WK6 A;  1TY0 A;  3MR6 A;  5KNI A;  1T0Y A;  3PW4 A;  3T3O A;  1FD6 A;  3ZNG C;  1E90 A;  3UQA A;  3BQT A;  1HXY D;  3LK9 A;  2OM6 A;  1FFU A;  1LGR A;  4BFR A;  2YY6 A;  1SWW A;  3EEC A;  4KSK C;  4PHA A;  4DSK A;  5AZF A;  4UW9 A;  3ZXV A;  3OWE B;  3ZVV A;  1IYF A;  4U6P A;  4P0P A;  5HFY A;  5C2T B;  2HBK A;  1MC8 A;  4ED1 A;  3TQ1 A;  1PZN A;  2KAJ A;  4ZYS A;  1MVK A;  4ZHP A;  2VJ4 A;  3KUD B;  4A6Q A;  4RF1 A;  4EFO A;  4YP3 A;  2HW3 A;  3KH0 A;  3VFK A;  2L7R A;  3EUB 2;  4NWI A;  3Q8A A;  2DKX A;  4I2C A;  4NQK E;  1SL1 A;  3GFK B;  3R66 C;  4LCD E;  2XC9 A;  2A4Z A;  2N9K A;  3ZRC A;  4BDP A;  1KEJ A;  1F1H A;  2C7N B;  2PMV A;  3QU4 A;  2AXT U;  1O08 A;  2WAQ F;  1YX5 B;  8ICC A;  3NZ3 A;  2BB6 A;  3NGD A;  1C79 A;  2QB0 B;  4EX7 A;  5KG6 A;  3ORY A;  2EH9 A;  4I2E A;  3OJU A;  1HEZ E;  2L32 A;  1M94 A;  4DCC A;  5J2H A;  3AE1 B;  2D3A A;  3R3M A;  3L4P A;  1KRH A;  3EPG A;  1IG6 A;  4TUQ A;  3JPN A;  7ICF A;  2GOW A;  3VRB B;  2WP9 B;  1CRX A;  3TBL D;  3WAO A;  2MUT A;  5DQI A;  5CHG A;  4DO9 A;  3ZNZ B;  1HZ6 A;  2DAF A;  3L3F X;  3LWM A;  2QC8 A;  2MBB B;  4HLE A;  2XID A;  3V3X A;  3KHR A;  3PLV A;  5KG7 A;  1NK5 A;  5KFV A;  1ZQH A;  3AL0 B;  1RRB A;  3M6K A;  4KMO B;  2JHD A;  3GIL A;  3RBE A;  1SXE A;  1V1P A;  1K1S A;  1S0M A;  2F77 X;  4ITK A;  5J2E A;  2MJE A;  1ZDV A;  2BQR A;  2H3V A;  4KTQ A;  2V4R A;  2WYQ A;  7ICI A;  2LHT A;  2I1Q A;  3SAH A;  5AM0 A;  2GBN A;  2F2A B;  1KKX A;  5IP4 D;  4ZRQ A;  1RWS A;  4JB3 A;  5AM1 A;  2V4L A;  3UMC A;  3Q3J A;  2WXK A;  4QW9 A;  2W55 A;  2BCQ A;  3MAB A;  1OQY A;  4J9S A;  4B9M A;  2O6V D;  2NCN A;  5KFG A;  4ED2 A;  5ALP A;  3JSV A;  3B0A A;  3TAN A;  2LGI A;  2FCM A;  4QWA A;  2RSU A;  4W9G A;  4J9R A;  1WF9 A;  3IP4 B;  5EE9 A;  4JUZ A;  1SJH D;  4OO1 J;  5GMV A;  3P4S B;  1XSP A;  2Y1J A;  3NJT A;  5DB6 A;  1AN8 A;  3DVN U;  2BS2 B;  3TAQ A;  1KFY B;  1QZE A;  2DZJ A;  2LXC A;  1L6N A;  1SB3 C;  2ZUD A;  2K6Q A;  5DPR A;  4DHJ D;  4EE2 A;  4PHE A;  5J2B A;  2AGO A;  2DHZ A;  3T3N A;  5D94 A;  5GTI U;  4C7Y A;  3TEX A;  4RGN A;  4YXD B;  5L1I A;  1NK9 A;  1U48 A;  3M8R A;  3KYD D;  4KDL B;  3AV8 A;  3AUO A;  2MX2 A;  5IN7 A;  1UH6 A;  2VZK D;  2O6V A;  4DDG D;  1Z19 A;  2WX0 A;  2H3Q A;  2BGF A;  2A19 A;  2JYE A;  2LHE A;  5L1L A;  5BOL A;  2HD5 B;  2XCP A;  5DBC A;  4YMO A;  5J2D A;  2M0A A;  5DB9 A;  3PML A;  2NPT B;  2ZG6 A;  2RMM A;  2N7J A;  4PS3 A;  4MFA A;  3LYS A;  3C28 A;  1J2N A;  7ICT A;  4O5K A;  2DZK A;  2LVO A;  4IL6 U;  2Y0S F;  1XNS A;  2IO0 B;  5KFI A;  3BQ1 A;  1E8Y A;  8ICB A;  3LJ3 A;  1RXV A;  3PO5 A;  1L6V A;  2LGY A;  2A1A A;  3DBL B;  3ZQ4 A;  5J2R A;  4ED7 A;  2XNA C;  4I2J A;  5AI5 A;  2PVO D;  1F0Z A;  1ARO P;  2ZPY A;  3Q8M A;  4KVG B;  4CGZ A;  2I1K A;  1OQR A;  2IBI B;  2WNM A;  4MHV A;  3C2M A;  3SI8 A;  1Y8R C;  2BWE S;  1GG3 A;  3BS5 A;  5ALU A;  5KFB A;  3RCZ A;  3ONS A;  1ZQV A;  5J0S A;  2BCV A;  9ICG A;  4FE3 A;  5IIN A;  4UBC A;  2KNJ A;  2IJ0 A;  3TUO A;  4RQ1 A;  4XX5 A;  3T5K A;  5FR3 A;  2KZR A;  2Z0E B;  3KUC B;  2QAR B;  3EC8 A;  4HPL B;  2WB1 F;  4HRS A;  3VUW A;  4ZOH C;  3M9M B;  5KHQ A;  2QEJ C;  2BB5 A;  2UVR A;  3RI7 C;  4FHJ A;  1MN8 A;  2NBW B;  4NAW B;  5EWF A;  1AAR A;  4NL9 C;  4O5C A;  2XI9 A;  4ECV A;  4I2F A;  2FCS A;  2DBY A;  2D11 A;  4HCN B;  2KLG A;  2HHQ A;  3K75 D;  2D3C A;  2JT4 B;  3BQ0 A;  2CU3 A;  1DOY A;  1VCB A;  2K1F A;  3ETR A;  3IHQ B;  3CYM A;  2LKY A;  2LEK A;  3K1R B;  2LMC A;  4FZM A;  4J9K A;  3Q8C A;  9ICF A;  3ZJT A;  5D49 A;  1ZQS A;  1IPG A;  2YB1 A;  1HZ5 A;  1OEY J;  1ZRM A;  3E56 A;  4US9 A;  4DSL A;  1I7H A;  2GO7 A;  5KFQ A;  2BKF A;  1JWM D;  2FPM A;  5KL8 B;  9ICR A;  2WDR B;  1L4D B;  4AYB F;  2J0M A;  3RNA C;  5DQG A;  5HR7 A;  3GZN B;  2GB1 A;  2QB0 A;  1VJ5 A;  4R8U B;  2OED A;  2YEP B;  2B6G A;  3PTF C;  1T4G A;  3CF6 E;  5BMI A;  3MR5 A;  2LHD A;  2JF5 A;  2KHQ A;  2EZZ A;  3M63 B;  4PZO A;  5IOI A;  1L7Y A;  3B0X A;  2O2V B;  3AUL A;  4DL5 A;  4II3 B;  1VD2 A;  1SF0 A;  2WXP A;  4M0W B;  1WSP A;  2L76 A;  3BDP A;  2NVU I;  2A1J B;  2EAP A;  1ZOY B;  2AU0 A;  4MEM A;  3UQ0 A;  3FIL B;  5KFC A;  2L05 A;  4R63 A;  1UHU A;  4DLG A;  3ZDT A;  5LXH A;  4Y2V A;  3AQF A;  4RUC A;  1F52 A;  1YN5 A;  1LM8 B;  4WWN A;  5KT6 A;  2Y0S C;  5AM2 A;  2ZJD A;  1TVA A;  3OLM D;  1IUE A;  5J29 A;  3W1S C;  4ZRI A;  4Z6E A;  3HVZ A;  1HTQ A;  2N1W A;  5CA7 A;  4QZH A;  4DFP A;  5JH5 C;  3AED B;  5J8Y C;  3RF9 A;  2EAO A;  3T3F A;  4KLL A;  3M3J A;  3ZDM C;  2MU2 A;  3ZDC A;  2RPV A;  3GE3 C;  1L7P A;  3DWG C;  3RH4 A;  4MEY A;  1IXR A;  1C1Y B;  1KTK A;  2WGS A;  1S3S G;  4M9L A;  1E7V A;  1V2Y A;  3ZJV A;  3V6K A;  1J7A A;  2HBJ A;  4ECS A;  8ICY A;  2L0T A;  3RH6 A;  1ZQF A;  4ECR A;  4I28 A;  2YML A;  2D6F C;  2N4F A;  3QX1 A;  4UB2 A;  4NLB A;  2FE9 A;  2PFQ A;  3RJG A;  5DB7 A;  5E79 U;  3QYP A;  2I5H A;  1OFF A;  4DSE A;  4O0I A;  4F5N A;  2M1M A;  3RB3 A;  3UIO B;  2I9G A;  5DG7 A;  2BT6 A;  1XXG A;  5J2K A;  2ZTC A;  5J0Q A;  5JU5 A;  3PRP B;  1H4R A;  3Q8E A;  1C78 A;  4DF4 A;  2ZW1 A;  3KHH A;  3URY A;  7ICV A;  3A4S C;  3HP6 A;  1QH9 A;  1JXL A;  2BCU A;  1LB2 B;  2HOF A;  4KLI A;  2A3V A;  3ZUN A;  4Y2P A;  2ATL A;  5AKE A;  4DL7 A;  4KLU A;  1Z00 A;  1X9X A;  2N9X A;  3QUQ A;  5EE1 A;  4DQO C;  2JEI A;  4YSZ B;  2JX5 A;  3H8H A;  5C1Z A;  4RQ0 A;  2ZPN A;  1WIA A;  1P3Q U;  3APD A;  4W9K A;  4MDK E;  2WXI A;  2E1E A;  3TAP A;  2KFK B;  5III A;  3ONN A;  3V7J A;  2FMP A;  3H8S A;  4AYB C;  2JH1 A;  4HEA 1;  4ECZ A;  4B6W A;  4RGM A;  2HMX A;  3W1Y A;  3CW2 C;  4LDT B;  2WXQ A;  4EBE A;  1M6Y A;  4J3O D;  4JWN A;  9ICU A;  2DYO A;  2W9N A;  2BDU A;  4GDK B;  2KAC A;  4WJO A;  3LDA A;  1N61 A;  1EU3 A;  4GFJ A;  1SE4 A;  1D5Z C;  4B9V A;  4FA6 A;  1BPZ A;  5AM5 A;  3Q6B A;  2QSD A;  3HKZ F;  2VA8 A;  3IBE A;  1SGG A;  2PIA A;  3T79 A;  1J97 A;  1PYW D;  2KKC A;  2BQU A;  2QAR A;  4BAX A;  5ALS A;  4O3P A;  2ZW0 A;  4RQ8 A;  3BQ2 A;  4B9T A;  3OG5 A;  1TS4 A;  4NAW A;  2N1V A;  2K9X A;  4KDI C;  2ZXH A;  4YSY B;  2KVC A;  2OH2 A;  4DQI A;  4DBG A;  2PKE A;  1JML A;  2B21 A;  3I9V 1;  2MBE A;  3BQ7 A;  4G0N B;  3RPF C;  2IO1 B;  3KKA A;  2CJN A;  4RFB A;  1YQ3 B;  3P4Q B;  1E9M A;  1RYR A;  4CHK A;  3PVL A;  1V1O A;  1TZ1 A;  3RJE A;  1T6B X;  3UXP A;  4AP9 A;  1E7P B;  4GGQ A;  4WJ3 B;  1VDV A;  4P4O A;  3QU2 A;  4PGX A;  4B9L A;  1JMS A;  3TKA A;  5DB8 A;  3EHV A;  5E6N A;  8ICW A;  4UAV A;  3NVV A;  4HJG E;  1LQB A;  2E5S A;  3PVX A;  5KG3 A;  4LNN A;  4W9L A;  1UD7 A;  3DVG Y;  1ROE A;  1XD3 B;  4R8U A;  2N0S B;  4N59 A;  5DGB A;  4F5O A;  1O03 A;  2IOH A;  5D3D A;  1SKS A;  5KFK A;  1QKZ A;  1L5P A;  2RPQ A;  3D2S A;  1A0P A;  1MSW D;  4TUU A;  2YQE A;  1SBB B;  7ICJ A;  4BZA A;  2W9B B;  3X0W A;  2RDH A;  5BMG A;  1L7N A;  1ZQU A;  2FMS A;  1JWS D;  2O2V A;  2XGP A;  3KD3 A;  1Z2M A;  3NS8 A;  4O3Q A;  1ISN A;  4TUS A;  1R4N I;  4M0W A;  3FDS A;  2AGP A;  1I42 A;  2A1J A;  2DEN B;  5L1M A;  1QOA A;  3GZF A;  2E8P A;  2OCE A;  3FIL A;  2HTH A;  4KKI A;  4EKU A;  5KAI U;  4MFF A;  5KG0 A;  4MGZ E;  4DWI A;  4RQM A;  2G07 A;  4P6V F;  2L5Y A;  4HDO A;  4M6W B;  1RDF A;  4GXB A;  2AL3 A;  2L3Z A;  7ICE A;  3KYC D;  2E3T A;  1WJ6 A;  2HDO A;  4PHD A;  4PYU A;  3QX7 A;  2CHW A;  4QZB A;  2W8L A;  4BGD A;  5KT5 A;  4QZF A;  1EXN A;  2KQS A;  3QQ8 B;  2FID A;  3O65 B;  1TKG A;  3IHP C;  2NO5 A;  5AKH A;  3K4G A;  5AK3 A;  1U49 A;  2JGA A;  3KUZ A;  3P63 A;  3AI5 A;  1WRD B;  1TYG B;  2MRP A;  4IW0 A;  5AZG A;  1WX9 A;  3UGB B;  2Y5P A;  1UQV A;  3H0M B;  4IC7 B;  1F44 A;  2WQY B;  2DF4 B;  4W9D A;  3HJE A;  3QEA Z;  1NJX A;  4L2Y A;  5KFM A;  1KLG D;  3H8M A;  2UWQ A;  4DSF A;  1UBQ A;  4ZRJ A;  1UA0 A;  4NV0 A;  4A9A A;  1Z5S B;  4GC6 A;  2K4E A;  4DXF A;  3PMN A;  5J18 A;  1V97 A;  4BKT A;  2KQ4 X;  4BKS D;  1NVI D;  1RQL A;  4L23 A;  3OPX A;  5EDS A;  1WX7 A;  1XO0 A;  8ICA A;  4KLG A;  2N1R A;  2BKR B;  2RGF A;  2K0P A;  3H7P B;  3UXN A;  2KZM A;  2DL0 A;  2BYE A;  4EEK A;  2FLN A;  2JH7 A;  4Z6C A;  4PZN A;  5ALZ A;  3JPT A;  1KLN A;  1ZQO A;  1VR9 A;  4F2S A;  4GN1 A;  2KFK A;  9ICB A;  4UAW A;  1Z3E B;  2KVZ A;  2EMT A;  1FEZ A;  4L1B A;  2RDB C;  1N62 A;  2NBV B;  3BZD B;  2AWT A;  4BKS A;  2GBK A;  2K8A A;  1NKC A;  4YCX A;  4AWJ A;  1UA1 A;  4F2R A;  2KX0 A;  1XU4 A;  4W9C A;  4QJF B;  2P6U A;  2KE7 A;  3IG5 A;  2X8X X;  2HHV A;  3PW5 A;  2BHN A;  4CF3 A;  1HE8 A;  1S1Q B;  2IGD A;  4PL2 A;  1WM3 A;  3AEB B;  3NY5 A;  2WF8 A;  2ZXI A;  3Q3N C;  1JCK B;  1URJ A;  3CMM B;  3SU8 X;  8ICR A;  4BWM A;  4HPM B;  2C7M B;  2XBB C;  4JWS C;  4KMU A;  1QQR A;  5EWE A;  4UB4 A;  3JW0 X;  4GDK A;  5D46 A;  1NJZ A;  5CB1 A;  3L08 A;  4XDD A;  4B9U A;  2D3B A;  2BS4 B;  1XSN A;  2MQJ A;  4I2G A;  5KFT A;  2BQQ A;  4YMM A;  3RN9 C;  1Q5W B;  3L16 A;  5KG4 A;  5KFO A;  4HCP B;  4D2K A;  2G3Q B;  2KHW B;  1KN5 A;  1ZQZ A;  2GBR A;  3L10 B;  3IXS A;  4JX1 C;  5J2C A;  2J6U A;  1YZ6 A;  3V61 A;  1UNS A;  4EZ6 A;  3PW2 A;  1Z4O A;  2AQ3 B;  3V6E B;  2ESE A;  1UCV A;  3TFS A;  2F8K A;  2YLM A;  2AH5 A;  1ZQR A;  3Q3O C;  1V49 A;  2BZF A;  4J9P A;  1M4V A;  3KHL A;  4DQR A;  2EEL A;  3N7R C;  4ZRK A;  1KW4 A;  4OVZ A;  2K8B B;  4ZHO A;  3FC4 A;  4C8K A;  2TSS A;  5KG1 A;  3RMK C;  1J7C A;  3OJS A;  3AH7 A;  1FPY A;  2KTR B;  5BYR A;  2YB4 A;  5J0R A;  3ZYY X;  3AEV A;  1NJW A;  2RR9 A;  3RT3 B;  3ZTC A;  1ET9 A;  1SWV A;  4H2A A;  5DKW A;  3PR5 B;  4ELT A;  1WGD A;  3MP9 A;  3JPS A;  1D8B A;  2BYT A;  4F93 B;  3H8J A;  2JWZ A;  1E5W A;  3H0R B;  2WX1 A;  2XY7 A;  3MFG A;  4HYK A;  1K50 A;  1RZT A;  2KK8 A;  3SD7 A;  1TS5 A;  1TGZ B;  1UGM A;  1Q10 A;  5CRX A;  1WMH B;  2YN4 A;  2W9B A;  5KFN A;  4EEN A;  4LJX A;  1ET6 A;  4UDU C;  5D6J B;  4B9N A;  3I28 A;  4IM3 A;  5HKH A;  3CNH A;  1GOZ A;  5JZE B;  5CR0 A;  3U30 A;  5ALD A;  3CRX A;  1MQ2 A;  2EAM A;  3VRA B;  4NAM A;  5HG2 A;  3RB6 A;  3DBH I;  4NLZ A;  2XIC A;  3S2A A;  5DBB A;  1N6Z A;  5AKY A;  2GMI C;  3UIP B;  2DFL A;  1T5X D;  1EWY C;  1NBF C;  1Z1B A;  2M0N A;  1A5R A;  1COK A;  4M6W A;  4IOI E;  5KFU A;  2M19 A;  1E8W A;  4DXG A;  4R65 A;  2JQR B;  4ED0 A;  1MI0 A;  5L1K A;  1YQB A;  2ZUC A;  2KWV B;  2HHX A;  1OUQ A;  3Q69 A;  4FJV B;  1QIL A;  1X6I A;  4M02 A;  3T9L A;  1E8X A;  2QDF A;  2PVG C;  3ED5 A;  1QT9 A;  4JLC A;  4XA5 A;  2LXA A;  1ZE3 D;  1C4A A;  4W9H A;  1OQQ A;  1N5X A;  4I6L B;  5IAA C;  1NYQ A;  4WJQ A;  3IRU A;  2WF7 A;  1JAL A;  4WIP A;  3FAH A;  3N1Z C;  4BKG A;  3OTQ A;  4RNA A;  1F77 A;  3TSS A;  1RYU A;  4RPZ A;  1C9F A;  4OJP A;  2JZZ A;  4NNJ B;  3P42 A;  4DQQ A;  1PUT A;  4QZG A;  5IKC M;  3HWT A;  3H7P A;  1KM7 A;  2H3Z A;  3M9N B;  5G5H A;  4C4T A;  4A20 A;  2Q4T A;  4J9N A;  2K22 A;  1TAM A;  3QNM A;  4P0Q B;  1JN3 A;  1SXD A;  2BR0 A;  3ISB A;  2FDR A;  1X9M A;  4F5Q A;  4JE3 B;  5DQH A;  2WXR A;  4KKJ A;  2KC1 A;  3M7D A;  2HHW A;  3RNF C;  4QZI A;  4FS1 A;  1YIW A;  2KJ8 A;  2ES6 A;  1NKE A;  3AEC B;  1WX8 A;  3QWZ B;  3SV4 A;  5TZV A;  4GSW A;  2I6X A;  4OZA A;  1KFT A;  3W2D A;  3SYZ A;  3T5H A;  4C56 C;  3QU9 A;  2JEJ A;  1XCT L;  4RPY A;  2I1J A;  4OZC A;  1K53 A;  4C00 A;  2LUE A;  3N32 A;  2Q5W D;  5BOM A;  3WAN A;  1UUP A;  1SEB D;  1B43 A;  3PR4 A;  1AQ6 A;  1D6E C;  1BPB A;  2R18 A;  3NTU A;  3PW7 A;  2MP2 A;  3ZNH B;  2E8N A;  1GNU A;  1I4P A;  3Q8K A;  1FNV A;  3A9K B;  3AE4 B;  4Y2Q A;  4PK1 A;  4FBU A;  1L0Y B;  1ZQC A;  4F4K A;  4YR3 A;  1DOX A;  4KIT B;  4A90 A;  3Q3F A;  2PI5 A;  3KWL A;  8ICE A;  5K4L A;  2K60 A;  5ALJ A;  1K8R B;  3GDX A;  3GV8 B;  1IBX A;  9ICV A;  2G08 A;  2KJR A;  4KIK B;  2REX A;  2HE7 A;  2DWQ A;  1WXV A;  2KD0 A;  3I5J C;  2ZUB A;  1J8C A;  1NNL A;  1ZJN A;  2KLC A;  1BPX A;  4Y2U A;  1DOQ A;  1WCN A;  2KZZ A;  3PV1 A;  1QLN A;  4EUT A;  4WJP A;  5L83 A;  1RM6 C;  4DFJ A;  4KLE A;  1VZ6 A;  1TBE A;  2PJH A;  4USA A;  4I2D A;  2L0F A;  1SL0 A;  1ZQ1 C;  4FS2 A;  3U26 A;  3MBY A;  2W7P A;  4J9O A;  2XN9 C;  4GB9 A;  3KZI U;  2JV3 A;  2ASD A;  4KLS A;  4OZB A;  1ZGU B;  2K8B A;  5KT7 A;  3W9C B;  4QWC A;  1ED1 A;  4LVS A;  2MW5 A;  3BZC A;  4K3B A;  2KDM A;  1F0M A;  4ELV A;  5GTH U;  3PX0 A;  1RLF A;  4MSQ B;  4BOS C;  2ONQ A;  3BVM A;  2KTR A;  3EW9 A;  2PTL A;  4AS1 A;  4MFC A;  2D10 A;  5KFH A;  3BII D;  3A9J B;  2KD1 A;  4Q8E A;  8ICH A;  1WM2 A;  2Z8L A;  1KLV A;  4F91 B;  3E58 A;  4DEZ A;  4I2H A;  2G1E A;  1BNO A;  3OSN A;  2B0C A;  3MJW A;  4EBC A;  4CNQ A;  3HIL A;  2B3A A;  1UT5 A;  1RFK A;  5KTQ A;  2CXY A;  2PPH A;  1XWL A;  3J81 j;  3QJZ A;  1QSL A;  5B5E U;  2KFN A;  2WWZ A;  8ICJ A;  5AKX A;  2JEG A;  3BS7 A;  2F3N A;  5J0W A;  4S0R A;  3RNG C;  1WYG A;  1WMH A;  4UB6 U;  4NXZ A;  4PYZ A;  3AQE A;  5ALF A;  1EF1 A;  4F1S A;  4REZ A;  2KT7 A;  2L83 A;  4G50 A;  4OVV A;  3KWV A;  2FBW B;  4ASW C;  9ICM A;  3BWU D;  4ANU A;  3M1Y A;  2NMQ A;  2PKO A;  4RPX A;  4FHK A;  2INP E;  3Q8P B;  4B9S A;  4TQ0 A;  1NZP A;  2WDT B;  5T14 A;  2ALZ A;  1VRA B;  1QTM A;  3ISD A;  4P1C C;  4IC9 A;  3LB8 C;  5E6P A;  3VC8 A;  3MGV A;  4Y2S A;  2KP7 A;  2ODG A;  2AGQ A;  4AJW A;  1D8L A;  5AI8 A;  2PW9 A;  4LJP B;  4X5V A;  8ICN A;  3LDZ E;  5IIL A;  1FFV A;  3PX4 A;  3RRG A;  2LGX A;  3VQI A;  2IBK A;  3SV3 A;  3IAS 1;  4WJN A;  4P1B C;  1R4M B;  2MWS B;  1IV8 A;  1ZQN A;  3GII A;  2KIW A;  4LNI A;  4AUQ C;  3WK8 A;  4CF5 A;  5DDY A;  2FCN A;  2BPC A;  4Y2X A;  4MAC A;  1UGJ A;  4J03 A;  2KDF B;  4KLM A;  1L8O A;  2JWU A;  5CTR C;  5J17 A;  2JXJ A;  2PI4 A;  1GUA B;  4E3C A;  4GDL B;  2YVC A;  1FEH A;  3B9J A;  3AM9 A;  1COO A;  2GLS A;  1NK8 A;  2GLE A;  3RBD A;  2G4D B;  4G3X B;  3QCA A;  4M9N A;  1WR6 E;  2BVC A;  3UF8 A;  2NYV A;  1ZQT A;  3VH3 B;  2RLT A;  1TKD A;  1L3S A;  2RD0 A;  3BVG A;  4OVU A;  2JY6 A;  3LVV A;  5DLG A;  4GLS C;  2LRU A;  3AEA B;  4U7C A;  3THV A;  2V9W A;  1S76 D;  1ZRN A;  2UYZ B;  3ML8 A;  3DHI C;  1NZB A;  3R9K A;  3NG0 A;  4ED8 A;  3PRM B;  5D7G A;  4ECU A;  3H4B A;  4P0Q A;  5A0L A;  2KVS A;  2EQY A;  2OXO A;  3C8Y A;  1G6J A;  2MCN B;  5HML A;  1NK4 A;  5L95 C;  4YQW A;  1C7Y A;  3RFA A;  4KX5 A;  3B0Y A;  3WCQ A;  1FXA A;  3B2F A;  3TAD C;  2WU2 B;  2KV2 A;  1U9L A;  1ZOL A;  1E6E B;  4PGY A;  3GS2 A;  3MHZ A;  2XEW A;  1FCC C;  2KOX A;  3VHT C;  3ZDB A;  1UT8 A;  3NAS A;  4IRK A;  2W03 A;  1I4R A;  3ABV B;  4IM0 A;  3MDA A;  4EOY A;  1EUV B;  2JPH A;  2MBH A;  5JUM A;  3Q8S B;  2K6D B;  3WK4 A;  3JVZ X;  3NRZ A;  4M9G A;  2ZIV B;  2ZIX B;  2DYB A;  1NK0 A;  2GI9 A;  3TFR A;  1NJY A;  3U8Z A;  1WI0 A;  2CJO A;  3A9K A;  3F2B A;  3AU4 A;  1NI3 A;  1SKW A;  5ALO A;  1YT3 A;  4KLT A;  4QZE A;  1UWX A;  3ECI A;  1VLB A;  2NRV A;  2EDU A;  3TAC B;  3QUB A;  3F2C A;  3M62 B;  3ZXR A;  4A55 A;  4AP4 C;  2FUG 1;  1L8L A;  4K3C A;  1N5W A;  5C3J B;  2KJH B;  1J2M A;  2D2Q A;  4KIK A;  2K89 A;  4M01 A;  5F9N A;  5C5J A;  1YJI A;  4O3R A;  2KYW A;  1CMX B;  9ICT A;  2BGW A;  4HDQ A;  3N7P D;  4DFK A;  2KVR A;  4KZC A;  3VUX A;  3IDW A;  4YD2 A;  4MT5 A;  4KV2 A;  4UAY A;  2O6K A;  2M4N A;  3CWI A;  2XY5 A;  1L0X B;  5C23 A;  4IQU A;  1WR1 A;  2NTT A;  4B95 A;  1MPE A;  8ICT A;  1HEK A;  3G6Y A;  1KFS A;  4WH4 A;  9ICQ A;  1ZD3 A;  2RRD A;  2LMR A;  5D4B A;  5DG8 A;  4JQW C;  5IA7 A;  2GBM A;  5LLI A;  4FBJ B;  4LZD A;  4OCZ A;  1ENF A;  4UAT A;  5KFX A;  5CWR A;  5AIB A;  3A9J A;  1B0X A;  2KKV A;  3H0L B;  3RNE C;  5MPO A;  1ZXI A;  8ICS A;  4DFD A;  2SEB D;  4FBT A;  2W9C B;  1IGD A;  3DBR B;  1R4N B;  3VR9 B;  2W11 A;  1WCL A;  1Q8K A;  2F1J A;  2ASL A;  4O5E A;  1C20 A;  1PVQ A;  2LGS A;  1LFD A;  1PGB A;  1WXM A;  1L3U A;  2V4I B;  3GQC A;  3AEF B;  1ZD5 A;  2JZB B;  4PT5 A;  3DCG A;  1B22 A;  5JHA A;  1WYW B;  2HHS A;  4G3I A;  4P16 A;  1RYS A;  2KKP A;  5GXG B;  1WJ4 A;  2QIL A;  7ICG A;  1NEN B;  4K4I A;  2W82 A;  2Y9U A;  1XLP A;  2Z59 B;  3IAM 1;  5J0X A;  4ACF A;  4EX6 A;  1QQ6 A;  3IV6 A;  3B08 A;  4DK5 A;  3KZX A;  3C2K A;  2ASJ A;  4O1N A;  1L3V A;  2CHZ A;  1TZO A;  1C4C A;  1NI2 A;  3RNC C;  2PFN A;  2NPT A;  2ZIW B;  4KGS A;  4DSI A;  3KVF B;  2RQ5 A;  4LNF A;  2W43 A;  2P66 A;  4BWJ A;  4EBD A;  1JW9 D;  2K25 A;  2HVH A;  1KL9 A;  1S8O A;  3R2T A;  2NV3 A;  3V6H A;  2L8J A;  4EYH B;  2V9H A;  2OJR A;  2CKH B;  1I4G A;  4LK0 M;  3D2N A;  3DDC B;  1OTR B;  1S5L U;  3LYY A;  4F71 A;  1X9W A;  4LNK A;  5AKI A;  4BBN F;  4PS7 A;  4C80 A;  4RZR A;  3JSV B;  2HI0 A;  1HTO A;  2AQ1 B;  4E74 A;  4LZG A;  1P7F A;  4GDL A;  3AE3 B;  2F76 X;  4RQ5 A;  4M8N A;  5KT4 A;  1XLO A;  1NDD A;  3M8S A;  4Y2J A;  4IM2 A;  1TIF A;  4Q8F A;  2R8H A;  1MA7 A;  3RAX A;  2BS3 B;  3ZIM A;  2Z7J A;  2DUY A;  3JPQ A;  3NRW A;  4Q44 A;  4KLD A;  3AU2 A;  4I29 A;  8ICL A;  4TSS A;  1MHX A;  2KWC A;  3PSI A;  2KSO B;  1GAQ B;  7ICU A;  2MLB A;  5AM3 A;  3U7Z A;  5CEH A;  5CHW A;  4GMV A;  4HK2 A;  3AB5 A;  3N97 B;  3RR7 A;  4MGY E;  3PSE B;  3DPD A;  1J0G A;  4UAZ A;  5IIJ A;  3V72 A;  1LV5 A;  4F8R A;  3M95 A;  2H3I A;  3B2G A;  4EZK A;  5AI0 A;  2ZNV C;  1U4A A;  1SZH A;  2IYD B;  1Q3U A;  4O3S A;  3GZN I;  3WA0 A;  2OHF A;  2M0X A;  3RZW C;  5KFA A;  1UWM A;  4DL2 A;  1PK1 B;  2KN7 A;  3KW5 B;  2F1H A;  2ZJA A;  4PH5 A;  2ZIX A;  2ZIV A;  9ICH A;  1ZQJ A;  2KQ7 A;  3VVW B;  5ALI A;  5LXI B;  3QU7 A;  2JR5 A;  1U47 A;  1ZYQ A;  3DEE A;  1ESF A;  4ARC A;  4I6N B;  4NM1 A;  3V6C B;  8ICX A;  2QHO A;  2XCA A;  2R2Q A;  2AQ4 A;  5EOZ A;  3D6J A;  2N9E B;  2IOF K;  1SGH A;  2AHO B;  1ZKH A;  2NRZ A;  3PX6 A;  4N9F 4;  2GRI A;  2OEH A;  1WE6 A;  2IO2 B;  4PL1 A;  3RUL A;  3LWL A;  2EKE C;  4KGR A;  2NBU A;  2WF6 A;  4EEY A;  4J9L A;  1V6E A;  3IG3 A;  3VAW A;  1RQN A;  3N7S C;  1KDH A;  1WXS A;  4LTU A;  3OGU A;  3LVW A;  2OWO A;  3VDZ A;  3RJI A;  3R7R A;  5AKJ A;  3PST A;  3HM3 A;  1L7O A;  4DOA A;  1V81 A;  4MSM B;  2WS3 B;  3GE8 C;  3RJJ A;  1P7E A;  4IUM B;  5ALG A;  1WY8 A;  3MGH A;  5ALK A;  1RYJ A;  4JIO U;  3DQV A;  4DF8 A;  4QW8 A;  1H38 A;  2JRH A;  2WFA A;  3PW0 A;  4BBN C;  1D5M C;  5CJ7 A;  3MC0 B;  4DOB A;  3N1X C;  2GH1 A;  3QA8 A;  2BWF A;  4EZ9 A;  3DBS A;  2Y3A A;  1JIH A;  2BYF A;  1I4X A;  2HJ1 A;  2CU1 A;  4HKQ A;  2K4H A;  4Y2Y A;  2XO7 A;  3E0F A;  3EPI A;  2W9C A;  3APF A;  2VRR B;  1WWT A;  5TR5 A;  1ZQX A;  3RFZ B;  5D2M B;  4DOC A;  3N1Y C;  3DBH B;  2WXH A;  4X57 B;  2AQ0 A;  2IND C;  3DHH C;  3HT3 A;  2EKI A;  2JZB A;  1ZQQ A;  1Q46 A;  2IY0 B;  4DHZ B;  4FZL A;  2HOI A;  4EZL A;  4OJ5 A;  2AYO B;  4ECX A;  1UEL A;  5G55 A;  1QSS A;  1BML C;  3IN5 A;  2MAX A;  2J53 A;  4LDT D;  4CQN A;  3A0H U;  1VZ7 A;  1ZD4 A;  4XC2 A;  2LJI A;  3T5L A;  1S10 A;  2KO3 A;  3BK1 A;  4F72 A;  1N56 A;  1WH3 A;  2KFJ A;  3C19 A;  3F5E A;  2VKQ A;  1ZQB A;  2IMW P;  4F3O A;  2WXG A;  4IDI A;  5FR6 A;  1JX4 A;  1NEK B;  2P35 A;  4RU9 A;  2LVP A;  5BMH A;  2DZM A;  1PVR A;  1SKR A;  2KDE B;  3PLU A;  3CSF A;  4TV3 A;  2ZIW A;  2KIV A;  5FP0 A;  3BK2 A;  2MRL A;  3P1M A;  4GXI A;  1HIW A;  2V3S A;  4IS7 A;  1X40 A;  2QLT A;  3TCA A;  1KBU A;  4GU2 A;  5KFW A;  1TK0 A;  1L7M A;  1WWU A;  5CP2 A;  4AJY B;  4EZJ A;  4XWW A;  1P9D U;  3WK7 A;  1BPE A;  5J2J A;  4TQR A;  1D9D A;  2FMQ A;  2V0G A;  1TTN A;  3Q2A C;  3Q8Q B;  5J0T A;  2BF8 B;  3AEE B; 
#chains in the Genus database with same CATH homology
 3AEC B;  3PZ8 A;  5FR3 A;  2R61 A;  2KN4 A;  1FIQ A;  4HRS A;  4ZOH C;  4OZA A;  2QEJ C;  2BB5 A;  2HDE A;  4YTN B;  5FK9 C;  3W2D A;  5EE3 A;  4C56 C;  1E10 A;  1XCT L;  4OZC A;  4NAW B;  1PGX A;  1K53 A;  2X38 A;  2Q5W D;  3TEZ A;  1UUP A;  1SEB D;  2B76 B;  2DBY A;  1D6E C;  2INN E;  2WU5 B;  2KMM A;  1I4P A;  3N9Y C;  2CU3 A;  1DOY A;  2JZP A;  1FNV A;  2AX5 A;  3TUO A;  3AE4 B;  3ETR A;  1D4B A;  2LEK A;  2QJL A;  1L0Y B;  3I57 A;  1V8C A;  1JRO A;  3R8B A;  1DOX A;  4A90 A;  1FO4 A;  2LMC A;  3KWL A;  5HHD G;  3SR6 A;  2JSV X;  3NVZ A;  3GP7 A;  3Q8C A;  3ZJT A;  3U52 E;  3NVW A;  3O13 A;  1IBX A;  1HZ5 A;  2DLB A;  3E56 A;  4KGT A;  4US9 A;  1I7H A;  2DWQ A;  1JWM D;  3P4R B;  2WDR B;  1L4D B;  1AWD A;  3V05 A;  2WXF A;  2WXJ A;  2GB1 A;  2PLP A;  1CJE A;  2OED A;  2YEP B;  4WQM A;  1FM0 D;  1RM6 C;  3PZ7 A;  1VZ6 A;  4USA A;  5BMI A;  1ZDX A;  2LHD A;  2XN9 C;  1GB1 A;  2L52 A;  3AMZ A;  1FNU A;  4KX6 B;  4OZB A;  2JXT A;  2WXL A;  3W9C B;  5JXV A;  1KH0 A;  2G9H D;  4YSX B;  1SF0 A;  2WXP A;  2KDM A;  3W5U B;  1WSP A;  4ARI A;  1ZOY B;  2ONQ A;  2RDG A;  3AE6 B;  1JQ4 A;  3BVM A;  1JRP A;  3FIL B;  2PTL A;  4AS1 A;  1PDX A;  2I38 A;  3GB1 A;  3AE7 B;  2H89 B;  3BII D;  4LLG M;  1Y56 A;  4NZL B;  2Z8L A;  2G1E A;  1YN5 A;  4WAF A;  1L4Z B;  2BBC A;  2M56 B;  3EA6 A;  4B0M A;  1TS3 A;  3AE8 B;  1RFK A;  3AE2 B;  1IUE A;  1B1Z A;  1DGJ A;  1TKY A;  2DYM A;  3HVZ A;  2LUM A;  4B0E A;  1WGK A;  4WUR A;  1WYG A;  3AED B;  2I2Y A;  4REZ A;  1AW7 A;  5AUK A;  2L83 A;  2RPV A;  3KWV A;  4JWU C;  2FBW B;  3DWG C;  3PO0 A;  2BTE A;  1MHH E;  3BWU D;  1KTK A;  2NMQ A;  2PKO A;  3ZGZ A;  2INP E;  3ZJV A;  1J7A A;  4TQ0 A;  1VRA B;  1EU4 A;  4Q2J A;  2IPK D;  1C77 A;  3LB8 C;  4C7Z A;  1OFF A;  1EWC A;  2PW9 A;  1DYQ A;  4ZRP A;  2BT6 A;  1FFV A;  1QOB A;  1XXG A;  3NVY A;  3VQI A;  3Q8E A;  1C78 A;  2ZW1 A;  3URY A;  3IAS 1;  2K3U A;  3TEY A;  3NUH B;  2HTM E;  4TQ1 A;  1FNW A;  4MAC A;  1UGJ A;  5EE1 A;  4DQO C;  4YSZ B;  2JX5 A;  3H8H A;  3J9C A;  4HRO A;  2JWU A;  4RH6 A;  1BUI C;  2WXI A;  4XE0 A;  1T3Q A;  4GDL B;  1FEH A;  3B9J A;  3AM9 A;  1L0V B;  1QOG A;  4YTM B;  1ZUD 2;  2V3N A;  1VJK A;  4RGO S;  2L1A A;  2V3P A;  2VZK B;  4HEA 1;  2QMT A;  5BYQ A;  2JU6 X;  4RGM A;  1XCQ L;  2WXN A;  3BVG A;  4YT0 B;  1AYF A;  4GLS C;  3BYT B;  3AEA B;  3AEG B;  3IT4 B;  2N9L A;  5G5G A;  2WXQ A;  4IKG A;  4MH8 A;  3R2I A;  1TS2 A;  1XEE A;  4J3O D;  2YEP F;  5D7G A;  1EM7 A;  5I4D A;  1F2R I;  1YQ4 B;  2DYO A;  4GDK B;  3C8Y A;  2KAC A;  1N61 A;  1FMA D;  1EU3 A;  1SE4 A;  1D5Z C;  1FXA A;  5AUI A;  3WCQ A;  3B2F A;  2WU2 B;  4WWM A;  3MJ5 A;  3HUI A;  1E6E B;  1KF6 B;  2H88 B;  2QSD A;  3GS2 A;  3MHZ A;  1FCC C;  2PIA A;  1PYW D;  1I4R A;  3ABV B;  1FRD A;  2ZW0 A;  2FE8 A;  1SE3 A;  1TS4 A;  3UI3 A;  3NRZ A;  2K9X A;  3VR8 B;  1WXQ A;  4XWT A;  2GI9 A;  4YSY B;  1LO5 D;  3W5V B;  3TEW A;  5H8Y E;  1HQR D;  3W1S A;  1JML A;  1YMH E;  2CJO A;  3I9V 1;  1NI3 A;  3RPF C;  1IBX B;  1KLU D;  2CJN A;  1UWX A;  1VLB A;  3SFE B;  1PGA A;  3DWM A;  1YQ3 B;  3P4Q B;  1E9M A;  4RFB A;  2WXO A;  3CIR B;  1V1O A;  1T6B X;  1E7P B;  1PFD A;  2SAK A;  4A55 A;  2IGG A;  1VDV A;  2FUG 1;  1N5W A;  5C3J B;  1QF6 A;  1ZPS A;  1TKE A;  3NVV A;  4HJG E;  1XLN A;  1VZ8 A;  1YJJ A;  1CZP A;  1SJE D;  1YJI A;  3KQ4 A;  2BW2 A;  5D3I B;  2AQ2 B;  1D5X C;  1ROE A;  1SE2 A;  2N0S B;  4N59 A;  1V1P B;  2NTS A;  5D3D A;  4US8 A;  1JWA D;  4MT5 A;  1QKZ A;  1L5P A;  2MJD A;  1SBB B;  3CWI A;  3ZJU A;  5HI1 A;  1L0X B;  2RDH A;  5BMG A;  1JWS D;  2NTT A;  3HVD A;  1K51 A;  1MPE A;  2J52 A;  4M0W A;  2JYT A;  4WH4 A;  1QOA A;  5E6J A;  3FIL A;  1YNT E;  4KKI A;  2MH7 A;  1ENF A;  2E6X A;  3Q8B A;  4N58 A;  2QIE B;  4P6V F;  1N63 A;  2E3T A;  5TSS A;  5MPO A;  1ZXI A;  1NYR A;  1XF5 L;  2SEB D;  5H92 C;  4AQ7 A;  1BXT A;  1IGD A;  3VR9 B;  1PGB A;  1TKG A;  1SIJ A;  1CK1 A;  2WDV B;  2V4I B;  2WXM A;  3P63 A;  3AEF B;  1TYG B;  4PT5 A;  1GPX A;  2WLB A;  1FRR A;  2Y5P A;  2WQY B;  3SFD B;  2IGH A;  4P16 A;  1R7S A;  4L2Y A;  1KLG D;  5GXG B;  2QIL A;  1NEN B;  3BVZ A;  2D5G A;  2W82 A;  1XLP A;  4A9A A;  1XLQ A;  4HKZ E;  4DXF A;  1V97 A;  1XO3 A;  2KQ4 X;  3IAM 1;  1NVI D;  4R3D A;  1I4H A;  4L23 A;  3EGR A;  1FCL A;  4O1N A;  4RF0 A;  1TZO A;  1C4C A;  4KGS A;  2K0P A;  2ON8 A;  1C76 A;  1L6U A;  1N60 A;  1JW9 D;  3R2T A;  2MEK A;  1YN3 A;  1I4G A;  4LK0 M;  3HRD D;  3LYY A;  4RCO A;  3LXF A;  4NJC A;  4C80 A;  1VR9 A;  3Q8F A;  4RGT A;  2AQ1 B;  1P7F A;  3P4P B;  4XDC A;  1TY0 A;  3AE3 B;  4L1B A;  1N62 A;  3BZD B;  1XLO A;  3T3O A;  1FD6 A;  4OW0 A;  1HXY D;  1FFU A;  2BS3 B;  1TJE A;  3AEB B;  2IGD A;  2J4X A;  1JCK B;  3OWE B;  2MJ3 A;  5HFY A;  1FXI A;  4TSS A;  1MHX A;  5C2T B;  4FXC A;  4JWS C;  2KAJ A;  1GAQ B;  4ZYS A;  1MVK A;  1QQR A;  4A8X C;  4ZHP A;  4A6Q A;  4RF1 A;  3AN1 A;  1A70 A;  3U7Z A;  4XDD A;  3U2S C;  3EUB 2;  3AB5 A;  3Q8A A;  2BS4 B;  2N9K A;  4D2K A;  2Y5C A;  3B2G A;  2PMV A;  4JX1 C;  3IXS A;  3IT6 B;  1UNS A;  2IDY A;  2OHF A;  2AQ3 B;  3NZ3 A;  2BB6 A;  1C79 A;  1UWM A;  2W3S A;  3BYY B;  1HEZ E;  2L32 A;  2WDQ B;  3AE1 B;  3AE5 B;  2EEL A;  1M4V A;  1ESF A;  1SXT A;  3E9S A;  4ARC A;  3L4P A;  1KRH A;  4OVZ A;  4ZHO A;  1IGC A;  4YTP B;  3FC4 A;  2TSS A;  1J7C A;  3VRB B;  2WP9 B;  3AH7 A;  1HZ6 A;  2GRI A;  5BYR A;  3ZYY X;  3V3X A;  5BYS A;  3U4E G;  5T8I A;  4KGR A;  1ET9 A;  4H2A A;  4MM3 B;  3MP9 A;  4TMA B;  1HA5 A;  4LTU A;  2BYT A;  3KLS X;  1TY2 A;  1V1P A;  3MFG A;  4ITK A;  2MJE A;  1ZDV A;  1K50 A;  1E0Z A;  1K52 A;  1QOF A;  1TS5 A;  1YN4 A;  1B9R A;  1Q10 A;  2WS3 B;  1F2R C;  1P7E A;  4ZRQ A;  1RWS A;  1QLB B;  2ACZ B;  2W3R A;  1C4P A;  1CQV A;  1ET6 A;  1RYJ A;  4YWG G;  2WXK A;  4UDU C;  2W55 A;  5FKA C;  1GOZ A;  1D5M C;  4N6E B;  1SSN A;  3MC0 B;  4NAM A;  3VRA B;  5HG2 A;  2LGI A;  1ZP0 B;  1I4Q A;  1T5X D;  1EWY C;  2Y3A A;  1SJH D;  5EE9 A;  4IOI E;  3P4S B;  1I4X A;  4HKQ A;  1AN8 A;  2M19 A;  2BS2 B;  4DXG A;  1KFY B;  1WRI A;  2JQR B;  1MI0 A;  2J42 A;  1SB3 C;  4EE2 A;  1WWT A;  3AE9 B;  3Q69 A;  3RFZ B;  1QIL A;  3T3N A;  4C7Y A;  1GB4 A;  3TEX A;  2ICI A;  4RGN A;  4YXD B;  2PVG C;  2WXH A;  1QT9 A;  3AV8 A;  2EKI A;  2VZK D;  1ZXH A;  1ZE3 D;  1C4A A;  1OQQ A;  2JYE A;  2LHE A;  5LNK 1;  1JWB D;  1N5X A;  1STE A;  2W54 A;  1BML C;  1NYQ A;  2J53 A;  4CQN A;  4OHJ A;  2M0A A;  1VZ7 A;  2LJI A;  3NS1 A;  3BK1 A;  3SEB A;  1JAL A;  2N7J A;  2RMM A;  4WIP A;  3FAH A;  5EE0 A;  1DOI A;  1JWU D;  4IDI A;  2WXG A;  1ACC A;  4RNA A;  1F77 A;  3TSS A;  1NEK B;  1C9F A;  5BMH A;  3ZQ4 A;  1L6V A;  3P42 A;  2XNA C;  1PUT A;  2PVO D;  3BK2 A;  1F0Z A;  3P1M A;  5G5H A;  1OQR A;  2K22 A;  2WNM A;  4XWW A;  2KWD A;  2LFI A;  2V0G A;  1J7B A;  4JE3 B;  2WXR A;  4KKJ A;  2K5P A;  2IJ0 A;  4JPS A;  3AEE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...