3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
3P4SB 1FMAD 1XO3A 3P4RB 1WYGA 4P6VF 3AN1A 2JQRB 1NYRA 4YXDB 3B2FA 3NVZA 2PIAA 4US9A 3SR6A 3B2GA 1L6VA 4JWUC 4US8A 3P1MA 2OHFA 3BIID 3EUB2 2WS3B 3AV8A 3SFEB 1KF6B 2WU2B 3W5VB 4N59A 1N60A 2MH7A 5C2TB 1YJIA 2W3SA 2EKIA 4KX6B 1FIQA 4USAA 1ROEA 3AMZA 2JX5A 3NVVA 1OQQA 1VLBA 1J7CA 1YQ4B 2PVGC 3AEBB 3CWIA 3LB8C 5AUIA 2W54A 3AE8B 3WCQA 2WLBA 1DOYA 4LTUA 1FRDA 1WWTA 1TJEA 3AE4B 1XLQA 3DWGC 4YT0B 3HRDD 1KFYB 1XLOA 1NYQA 4JX1C 2E3TA 1NVID 4A9AA 2WDVB 2MJEA 1I7HA 1N5WA 4HROA 2KAJA 3P4PB 3FAHA 4WQMA 2Q5WD 3KWLA 3NRZA 2HTME 3AE3B 1N5XA 1IUEA 1QF6A 1E7PB 2K5PA 4FXCA 1R7SA 5G5GA 2MJ3A 1TKYA 2BS2B 4ZOHC 4C7YA 2WDQB 2WP9B 3AE2B 1SB3C 1YJJA 3ETRA 1QOFA 1RFKA 2WDRB 3P4QB 4YSZB 1QOAA 1ZP0B 3VRBB 5EE9A 1V97A 1E10A 3B9JA 3AEGB 1GAQB 3FC4A 1DOXA 1SIJA 2FBWB 1TKGA 3VRAB 2QIEB 3AE7B 2W3RA 1AYFA 1JALA 1YQ3B 3AECB 1JWAD 1N63A 1DOIA 4C7ZA 2L52A 2M56B 1NENB 1EWYC 3P63A 3SFDB 2AX5A 1JRPA 4IDIA 3DWMA 1SF0A 4HRSA 5EE0A 4ZHOA 1N61A 1RM6C 2DBYA 4N58A 2BS3B 2KMMA 3AE9B 5C3JB 1QOBA 5EE3A 2WQYB 3HUIA 2K9XA 1E6EB 3AE1B 1E9MA 1L6UA 1JROA 2LEKA 3VR9B 4YTPB 1FXAA 1L0VB 1OFFA 1UWMA 4YSYB 3NVWA 1PFDA 3AEAB 4ITKA 2H88B 1PUTA 1DGJA 3CIRB 5GXGB 1WGKA 1FRRA 1NEKB 1V8CA 2B76B 3AE5B 3AEDB 3VR8B 4YSXB 2CJNA 1FXIA 2MJDA 1QT9A 1XLNA 5EE1A 1GPXA 1RYJA 1N62A 2QJLA 3AEEB 3W9CB 1NI3A 1RWSA 1VDVA 3W5UB 5MPOA 2BT6A 1FFUA 3PO0A 3AB5A 3HVZA 1JW9D 1XLPA 5H8YE 5G5HA 1A70A 1WXQA 2WU5B 5H92C 3ZYYX 1F0ZA 2H89B 2M19A 4YTMB 4JWSC 1QLBB 2G1EA 1QOGA 2BS4B 1WRIA 1T3QA 1B9RA 2K22A 1J7AA 3NVYA 1OQRA 4ZHPA 1FFVA 1J7BA 1TYGB 2CU3A 1CZPA 3AE6B 3NS1A 2ACZB 1JQ4A 3AEFB 2L83A 4WWMA 4C80A 2Y5CA 2PVOD 1ZOYB 4N6EB 3ABVB 2CJOA 1FO4A 2PKOA 4YTNB 1E0ZA 2W55A 1AWDA 3L4PA 1PDXA 2DWQA 1TKEA 2N0SB 1ZUD2 3RPFC 1KRHA 3AH7A 3LXFA 1FM0D 1JWBD 1VJKA 1L5PA 3AM9A 1CJEA 5AUKA 1ZXIA
chains in the Genus database with same CATH superfamily
2PI5A 1NDDA 1Y8RC 2IDYA 2XGQA 4YXDB 2BQRA 2HVIA 2JWUA 3AQFA 1SXEA 5AM3A 2K8AA 2PW9A 1L6VA 2EMSA 2JEIA 3KZIU 1BNPA 3TACB 2ZIXA 4QZAA 3IG3A 1KF6B 3RUIB 4NY8A 2EANA 3TQ1A 3M62B 1V1PB 1V80A 1IXRA 3DHIC 1F52A 3LYYA 1HEZE 4PL2A 2GLEA 2P66A 2RDJA 7ICPA 2K4HA 2BPFA 2GB1A 2Y1IA 3N1ZC 3U2SC 2VZKD 1X6JA 3HRDD 1X9WA 3VC8A 1KTQA 1UQVA 3HK0A 3EFCA 4QWEA 2ASLA 1TS4A 1ZQJA 2BDPA 3PO4A 1H4RA 3UIPB 4RQ6A 1KFTA 3G6VA 2N4FA 5IN7A 4DQRA 3C23A 5DG7A 4GIBA 4FXCA 2DPJA 2HHVA 4X57B 4F93B 1MVKA 1TS5A 2LKYA 3I76A 1SKWA 4EZ6A 3ETRA 2BCVA 1P7FA 1KOTA 1WGGA 3E9SA 4KLIA 1S77D 5HHHA 4TV3A 1SZHA 1ZRNA 2MAXA 2XCAA 9ICBA 4I2FA 3DVGX 4KIKB 2WXMA 1SE9A 3ZXRA 2R8IA 1JWUD 3ZLZA 2B0CA 5DGAA 3MDAA 2KKPA 2ZVNA 4P1BC 3ETLA 5KL1B 4A8XC 2BBCA 3KUDB 3T79A 4UB5A 1S5LU 5T14A 4NJ6A 2GO7A 9ICSA 3RH5A 8ICYA 2KMMA 5CEHA 3AE9B 2IO1B 4ANXA 4PHPA 3HUIA 5GTHU 4TSSA 4YTPB 2ZUCA 5KFIA 1D5XC 2E5SA 2JT4B 1DK3A 1KL9A 4KLJA 1OEYJ 2M0XA 5HG2A 3VHTC 1RQLA 4OJ5A 1E8WA 2J0KA 2KMAA 3BY4B 4ZRIA 2KZRA 7ICNA 4CDGA 1XSNA 1LB2B 3TEZA 3IM1A 3T5LA 4DCCA 7ICQA 2KWUB 2OH2A 4C4VA 2RR9A 3W5UB 2ONQA 2DUYA 3AB5A 4EELA 3ZYYX 1F0ZA 1WG8A 3A0HU 4Y2YA 4YWGG 4I2JA 4AUQC 1D8LA 2IO3B 2I6XA 2MUTA 5AZGA 2EZYA 5DBCA 3E58A 2W8KA 3PX6A 1ZOYB 2E8NA 1RDFA 5D3DA 5DGBA 1RZTA 2XC9A 4KVGB 4JWNA 1F9JA 4QW9A 1TKEA 2VH1A 5KAFU 3MABA 3PV8A 3AEVA 1X42A 1ZDVA 3SV4A 1CRXA 2JYEA 1SV4A 5ALXA 1N6ZA 1VRAB 2AQ1B 2PFOA 4EFOA 4P6VF 3IN5A 3U7DA 1NJXA 1URJA 5AIAA 5FP0A 5HKHA 5L1KA 4EBEA 2LBOA 2WS3B 4G0NB 2ZIWA 1CUKA 4DF8A 2ZCCA 3MJWA 2W9AA 3UIOB 3T5JA 5KFZA 2EZZA 1X9MA 2FCQA 2IGHA 4LDTB 4MFFA 2JX5A 2BPCA 1D8YA 3N30A 5DG8A 4XWTA 1B4FA 3BZKA 2UVUA 4ASWC 3TSSA 5KG2A 2CKHB 1F2RI 3B0YA 5DPSA 4QW8A 3LYSA 4K3CA 3PW0A 5KT2A 3H4BA 3SZ2A 4R64A 1IGCA 4F4KA 2LMRA 4FO6A 4HROA 2F8KA 1ZD2P 1U9LA 4HPPA 2AQ2B 4UW9A 4K7UA 3EECA 3SAHA 4OJOA 3F2DA 1Q3VA 4IL6U 4XX5A 4G50A 2K0PA 5D3IB 3RJKA 1SB3C 4NXZA 1XCQL 1EF1A 2DKZA 3QX7A 5J0TA 1L7NA 1MG4A 1XNSA 1SE2A 3Q2AC 3KQ4A 3QUCA 1UT8A 2FCSA 2EDUA 2FBWB 2FPMA 4MJSA 2QIEB 1L2NA 1D4BA 3OJSA 1V5OA 2N7JA 2MBEA 4MHVA 2N1VA 1JWAD 3AECB 3UM9A 4PGQA 3SDLC 4BKSD 2WF7A 4L2YA 4MM3A 3HKZC 1T0SC 2FCMA 2RD0A 1B43A 1B0XA 3IHPC 5LLIA 4ZHOA 5ALWA 2C28A 2JEGA 3A33B 2G4DB 5F9NA 3KUCB 3WK9A 4HEA1 8ICAA 4F92B 2WXFA 1Z5SB 1UHUA 5KAIU 4REZA 8ICVA 1V6EA 4G3IA 1Z2MA 3JW0X 5KFMA 4ECUA 1FRRA 1MA7A 4II2B 2XY6A 4JLCA 1COKA 3GE8C 2NBUA 2ZEQA 4S17A 3TEXA 2H3QA 1L7YA 2X8XX 1RWSA 8ICXA 2KN5A 3DBSA 4KMUA 2ZIVB 4UB8U 3R7QA 5G5HA 1QH9A 1FCLA 4RGTA 2NS5A 4ZHPA 1QSSA 1GC6A 4E74A 4BDPA 8ICCA 3KWVA 1WM3A 4K4HA 2CU3A 4EZKA 4CF4A 2C9WB 2KOXA 4ACFA 1U4AA 2WXLA 1XS9D 3N7SC 1K52A 3I63C 1P7DA 7ICEA 3VVWB 1RPLA 2DWQA 3N32A 2N0SB 2K89A 1KRHA 2J6TA 4KSKC 3QYPA 4K4IA 1HE8A 2KK8A 3CSTA 3ZNHB 5EDSA 2LVOA 3F53A 3GDXA 4AOFA 7ICJA 1YX5B 2QILA 5IIKA 4P7IA 3JPQA 5DPTA 1O08A 3B2GA 3MFGA 2WXHA 4RFBA 3RJFA 3AV8A 2JRIB 2KXJA 2A1JA 2ZZPB 4YMOA 1FIQA 2O2VB 5J2AA 3RD2A 2MHJA 3WCQA 3WK6A 1WGRA 4TUPA 3TFSA 4KX5A 5J2EA 3A4RA 3UQ0A 4IM0A 4QWCA 2G5IB 3R8BA 4PS8A 2Q5WD 2MBBB 5KL8B 2WX1A 1ZQKA 3JPRA 3AL0B 3QXGA 2W7PA 2OJWA 3FKYA 2D2QA 2R8KA 2MP2B 5DB8A 4GU2A 1T3NA 2BPGA 4BKGA 1IM4A 5ALSA 5HI1A 4DFMA 5J2BA 4O1NA 3X0WA 1S0MA 4KLMA 3R2TA 1YQ3B 4PS7A 4DL2A 4NAMA 4MDKE 4CF5A 3BQ7A 2G0AA 4KDIC 2KZZA 2CPRA 1SF0A 4N9F4 4Y2QA 3ZNGC 1N61A 3H0MB 4ECWA 2DQNB 3SEIA 2RGFA 1SE4A 3U30A 3ZDDA 3RFAA 1ZQSA 5BMHA 4MSMB 4H2AA 3VXWA 4O5EA 4DWIA 4J9OA 1KN5A 2K8BB 4MGIE 4NLKA 2KE7A 4RUAA 1J2NA 1VR9A 5J0OA 2RDGA 5J2IA 2WXIA 1S0OA 1K50A 5T8IA 2QLTA 1WX9A 3QC8B 4I6LB 2ZJ8A 4F7ZA 2XN9C 1I4QA 1WZ3A 5ALMA 4QIWF 4AQ7A 2G06A 2J0JA 4YR0A 2RHFA 1SXTA 2KFZA 8ICRA 2LM4A 3OWEB 1TBEA 4IQWA 3DBLI 1XLPA 2KZ3A 5H8YE 1KLNA 2V4LA 5CR0A 3GQCA 1XD3B 2H89B 3DBRI 4TMAB 5K4LA 1QOGA 1B9RA 2QARB 3NVYA 3ZXVA 2K8CA 2KO3A 4BBNF 4B6JA 2N9LA 5AICA 2ATLA 1SIFA 2BQUA 3NZUA 4YR3A 2KANA 9ICVA 5AKIA 4BOSC 2FE9A 2BCSA 5L95C 2LM1A 3KHGA 3TARA 1R4NI 1L5PA 1BPYA 2K4EA 3P4SB 3JPOA 2W9NA 3AN1A 5A0LA 7ICIA 3Q3FA 1LKYA 5ALJA 3KOOA 4P0PB 5DPRA 4KDLB 2MCNB 1OEYA 5LXIB 5ALUA 4GLSC 4DHJD 3A1QB 3Q8EA 2L0FA 2BCQA 1Y56A 3ONNA 2JF5A 4CO7A 4O3QA 1VLBA 2KDBA 3PVLA 2G08A 3EHVA 4PL1A 1WWTA 4DSKA 1DOQA 5CTRC 4I6NB 4TUQA 4HPMB 4DWFA 1NYQA 1DGSA 1ZPSA 5AHXA 2WXJA 8ICFA 3RMKC 5ALPA 3WU2U 3NOBA 2KX0A 3KTQA 5KNIA 1TK0A 3UXOA 3Q8CA 2L3ZA 4TQSA 1JMLA 1V49A 3L5KA 2LYBA 1N5XA 1QSYA 4MGZE 1BT0A 4G9BA 4P4MA 1GG3A 2BKRB 5ALKA 5J18A 2BS2B 5JHAA 5KFTA 4GXJA 5HR7A 2KIWA 5JTIA 3GV7B 2I1QA 1ZQQA 3O13A 4B9NA 1ZQYA 2KKCA 5J0PA 3V3XA 4RMAA 1SIJA 3AI5A 4KKJA 4TURA 2FIDA 1EF5A 5CX3A 3DVNU 3H7SA 3BZCA 2F76X 5GTIU 4RPXA 4NAWA 4Z6FA 1EWYC 1TS2A 8ICKA 3SENA 1IPGA 4DXAB 4W9LA 4MELA 4EEYA 1QKZA 2BS3B 1NJYA 4B6WA 4QZ9A 4P4OA 2YQEA 2VRRB 1L6UA 1T94A 4YSYB 3MHZA 3QUTA 1UWXA 4FJVB 1PGBA 3CIRB 4QAYA 1L7MA 3SI8A 3ZIMA 5L1LA 1HUZA 4GSWA 5J2FA 5JH5C 4AJYB 4PHAA 4JB3A 3RBEA 2BT6A 4Y2XA 3O65B 1Z4NA 3BQ1A 2LGYA 5KT5A 3RT3B 8ICLA 2QMTA 2XY5A 2E8OA 2D07B 4YTMB 1U49A 3K9PB 3A4SC 2BPSA 2KJ9A 4FN2A 1DRGA 4Y2VA 2WF5A 1CQVA 2KP7A 3IG8A 1Y88A 4I28A 4ECZA 3X23A 3AXCA 5ALVA 2ZUDA 3BZDB 3KKAC 4K7SA 3MR3A 1ZJNA 1XO0A 1KLVA 3PSPA 1AWDA 3V61A 5CRXA 4CCHA 4BXOB 5KG1A 2CHZA 3S6JA 4UB2A 5EOZA 1RYRA 1P1AA 1KBUA 4FHKA 3FILB 4CQNA 1VJKA 3ED5A 4EZ9A 3A9JB 2DZJA 5L1MA 5JHBA 2PFNA 3N20C 2DKXA 4YD2A 2L05A 4DSFA 4RH6A 1ZQFA 2LGSA 2WX0A 2ZPNA 3P1MA 2KN7A 2IPKD 4MGKE 1TGZB 1A0PA 1L3VA 3TI0A 2W3SA 2WFAA 3AUOA 2L8JA 3TJPA 4W9CA 3QZ7A 2KACA 3L0WB 1J8CA 4M6WB 4AYBF 1C20A 4MH0E 4WJQA 3RJEA 4LTUA 3QUQA 2D8CA 2VH2A 4K81A 4M00A 2WF6A 3QZ8A 4FBJB 3WK7A 2BF8B 2HDOA 2KVCA 3PX0A 2IY1B 3E0FA 3RJIA 3THVA 4ACOA 3GZFA 1AN8A 4GDKB 1ZQDA 3DCGA 4YVZA 2FLLA 2GMIC 4J9NA 3GE3C 2R18A 2XY7A 2MEKA 3NRZA 5AI9A 4IUMB 4QWBA 1T8EA 2FMSA 2K5PA 3ZDCA 2MW5A 1N56A 3GP7A 1JI7A 3ZTDA 1RQNA 3I28A 4O5KA 2WDQB 1OXJA 1YJJA 2YMMA 1ZQXA 1RFKA 2DYMA 4OVZA 5ALLA 1QOAA 2INPE 3ZI4A 2J53A 4YMNA 8ICOA 4EBDA 2VKQA 2JRHA 2W9BA 1M4VA 1UBIA 1V5TA 4XA5A 1LXDA 1T4GA 2BYTA 4C8OA 4W9EA 2ZW1A 1KRPA 3ENEA 2IY0B 1XC9A 4GB9A 4WIPA 4RM8A 4PHDA 3IVFA 2FMQA 4I2CA 2JXTA 4WJNA 4HCPB 3TBLD 1RXVA 2LYAA 4B95A 3TADC 3SEBA 5EE3A 4DFJA 1BXTA 2WQYB 3AU2A 4UATA 5KFPA 8ICSA 2F1HA 3T3OA 2ZIUB 4Q45A 3PW5A 1PFDA 5L9XA 1ZQNA 1B1ZA 4XZ4A 3R9KA 3ZD8A 1SL2A 1D9FA 4IRDA 4EKUA 1TKDA 3HWTA 1XLNA 4W9GA 2BHNA 3WK8A 1I4HA 2IOFA 1Z3EB 4F4YA 1S1QB 1K51A 4EEKA 7ICUA 2EAOA 3DOWA 4R3DA 5E6OA 3PO0A 4TQ1A 4EYIB 2Z59B 1MFWA 4F5RA 2INNE 4AWJA 1ED1A 4UBCA 2MLBA 4KLUA 2M17A 5AKEA 4DSJA 2KJ5A 5J0XA 2BS4B 1T3QA 4HXDA 2K22A 2ZVOA 2LXAA 1TYGB 5AKGA 3I9V1 1TK5A 2G4SA 3QIJA 4ICUA 4WWMA 2Y5CA 7ICVA 2PVOD 1GC7A 2MX2A 2OXOA 4U6PA 2R2QA 5AM5A 2C7NB 4IR9A 1JCKB 3PHWB 1LQBA 4ZRQA 1P7EA 1WF9A 2KSOB 5IAAC 2JGAA 3DBHB 4KLGA 5HHIA 2BZFA 5KG5A 4Z6CA 4PT5A 4DSLA 3BQTA 4KGRA 2KNJA 4RQ5A 2KQ4X 2N7EA 1X6IA 4F2SA 3BYTB 3JPTA 3BVMA 1NOMA 4GDLB 2IGGA 3A9KB 4E71A 1A77A 5IILA 2NCNA 4KLDA 2GBJA 2EKIA 2F1JA 1X9XA 1ZQRA 2BWES 4IR1A 3H8WA 4KIKA 1SWWA 4J9RA 4RT3A 4DQQA 2HBKA 2JXJA 5ALGA 1S9FA 3W1YA 2AH5A 4GIVA 2I2YA 3BYYB 2WF9A 3SQIA 4NWIA 3VUWA 2FAZA 4L1BA 4F3OA 3VFKA 8ICJA 3TAPA 5IA7A 2KAJA 3N7PD 3P4PB 1C79A 1I4PA 2OEHA 1ZXHA 3K9OB 4MEYA 3V60A 1TS3A 1TZOA 4NQKE 3N1YC 2ZCBA 5AK3A 2KTQA 1KDHA 1UGJA 4G11A 1M6YA 1L3TA 4IC7B 3LWMA 3AU5A 1ZQOA 5FR3A 5D2MB 2E6XA 9ICCA 5TSSA 5EWFA 5KT7A 4DBGA 2D11A 1PK1A 4KLEA 2PKEA 3P63A 1C7YA 5AI4A 1JRPA 4F50A 3MC1A 2OM6A 1MPEA 1BPZA 4RQ4A 4N58A 3E2EA 1Z4OA 4ECVA 9ICRA 3ZGZA 2FCNA 3RRHA 4DL4A 3L17A 3QUBA 5E79U 1H8CA 5IIJA 4DDID 2NRZA 2ASQA 2PXIA 1E6EB 1WR6E 3AE1B 2W7OA 4LNIA 2RLTA 3VR9B 1C78A 3RBDA 5BMGA 2JXXA 2INCC 4DL6A 2D3CA 4J9QA 4GN1A 3PRMB 1G6JA 4F91B 1WGKA 3GILA 3DHHC 3IP4B 1JXEA 2QC8A 4EOYA 2BB5A 3RTVA 1SZPA 3KH0A 4DHZB 1KLUD 2FUHB 1U4BA 3PY8A 1UD7A 2R8GA 1FFUA 7ICHA 4WJOA 4CF3A 5H92C 2GOLA 4MF2A 2BQQA 1KQQA 1ZQPA 4LJXA 1ZQCA 4KGTA 5J2KA 2DL0A 5KFCA 2MWSB 5G2NA 1D8BA 1YNTE 3OSNA 5L1IA 2HHTA 2L83A 4XE0A 3U4EG 1YZ7A 5ALDA 2KVZA 2E8PA 9ICIA 2G07A 3ABVB 3MTNB 3M63B 1FO4A 4YTNB 2XBBC 2AL6A 4YL8A 4ED2A 1H38A 3H1UA 4HJGE 2QB0A 2FDRA 3RPFC 5ALHA 4PHEA 4C0ZA 3GZNB 4B9UA 4C8LA 1YJ1A 4BAXA 2L5YA 3U26A 1WYGA 2KV2A 3B2FA 1IV8A 3CSFA 1SL1A 2HOFA 5FR6A 2YEPF 3CMMB 3J9CA 3V72A 1X2IA 2KHQA 4I2EA 2WYQA 4UAUA 2HBLA 2ZIXB 3EPGA 3Q8QB 2ZXHA 2KDEB 3PT2B 1ROEA 2DZIA 2DZKA 3ZQ4A 4J9KA 2J52A 4QIWC 2W54A 2CU1A 4KX3A 4B0EA 4YG2A 5CWRA 2VANA 5ALRA 2B3AA 4DF4A 3PREA 2K39A 4PPXA 3HM6X 5D94A 4JX1C 2KMDA 3I1YA 1E7UA 4KSLC 3H8SA 2N9PC 1NK5A 4W9IA 2DPIA 1L7OA 2RP5A 3FAHA 4QZGA 3ZDAA 1ECWA 2HCFA 4IQVA 4ZRJA 4BX9C 1WGYA 9ICFA 1IUEA 2YMLA 7ICMA 1TTNA 4RZRA 5DQHA 3RB0A 5G5GA 1R7SA 1Q1OA 2N9XA 2HOQA 4FA6A 4F72A 1MHXA 5DPWA 4YSZB 3ML8A 1PK3A 4HDQA 4C4RA 1V97A 2B21A 4DL3A 3AEGB 5D4BA 1Z00A 4MGYE 2F8LA 3AE7B 2V4QA 3VH4B 4JMUA 5AKHA 4WURA 5AKZA 2INDC 1SV0C 5KFDA 5DBAA 1KW4A 5EWGA 3NASA 3UPQA 1RM6C 1L8LA 1NK6A 1FCCC 5KFRA 4J3OD 3RH6A 4O3RA 1QOBA 3PMNA 4Q8FA 3EZ5A 1YD8U 3HPOA 5DLGA 3AU4A 1L0VB 4XDCA 2EAMA 3B08A 1X66A 2VA3A 4F4WA 4ITKA 1GB4A 1AARA 4IM3A 4WH4A 2ZXIA 1SL0A 3GB1A 3PZ8A 2CJNA 4LJOB 1GPXA 1KKXA 4C4VB 3JYUA 3KKAA 1KH0A 3L54A 2IMWP 3PZDA 1ZD5A 3HVZA 2IBIB 2I5HA 3V7LA 3F2CA 4IW0A 4K3BA 3IAM1 1YOVB 4JGHB 3VUXA 2RQ5A 2VZKB 1BUIC 5KG0A 2LZ6A 1HIWA 4C80A 2O2VA 4NL9C 8ICEA 1T6BX 3P2BA 4JIOU 1C9FA 1E0ZA 3H6NA 2BCUA 4BFRA 2E1EA 1WX8A 5DQIA 1WJ6A 2QCZA 4KGSA 5CHFA 4M9HA 3LXFA 4YXMA 2Q0ZX 1PGAA 5BYRA 1ACCA 1ZXIA 3K1RB 2B6GA 5J8YA 4K4GA 2NBVB 4LLGM 1VZ8A 2Z0DB 4F1SA 3TMPB 4KLLA 1UCVA 1K5OA 2WB1F 4I2BA 3ZKJC 1IGDA 1X40A 3EUB2 3RB6A 3Q8FA 3V05A 3NG0A 2ZIWB 2CR5A 2D3DA 3OSPA 9ICMA 5IIOA 3H9DA 3Q8AA 4N59A 2WHEA 3MR6A 1SE3A 5KHOA 3RI7C 3ISDA 4RM9A 2KFKA 5AM4A 2Z8LA 3W1SC 4CHKA 7ICLA 1OQYA 5CJ7A 1MJDA 3QU2A 1U48A 2XK5A 5KFNA 4RQ2A 2IO2B 2ZJDA 3QJZA 2ZTDA 1MSWD 2KTRA 5KFGA 3ZO5B 4GXBA 3BK2A 2HBJA 2HHXA 2KN4A 3MC0B 1XXGA 5J0WA 5KFJA 5AM2A 5HR6A 3RR8A 1HA5A 1IIPA 5DCNA 3KZXA 3ECIA 1HUOA 4P0QB 2M9NA 3APDA 2EKEC 3D32A 1E7PB 4UBBA 2XGPA 1YMHE 2KG5A 4C7YA 3HILA 5IP4D 2UYZB 4KLTA 1RG6A 1NZBA 2WDRB 2F3NA 3V6HA 2PLPA 3R3MA 1EU3A 4OD0A 2JZBA 4ED1A 4MJSB 3C8YA 3KYDD 2O6VD 2YB1A 1DOIA 4C7ZA 2BTEA 2C2RA 1BPDA 4BOZB 3L16A 4RF1A 5J29A 4HVBA 4OVVA 1L4ZB 2Y0SC 2DBYA 2OCEA 3PSEB 4M9JA 2PMZC 9ICPA 2TSSA 3C1ZA 2VA2A 2DZMA 4R8UA 3M9NB 1N48A 1K8RB 3C1YA 3VH3B 3ZRFA 2JH1A 5IIMA 1NJZA 4KLFA 2YEPB 2W11A 4EYHB 2X38A 4FLHA 3SV3A 2W9CB 3WAMA 2KC2A 1F77A 2WXPA 4K1RB 2RPVA 2AQ0A 4II3B 1WXSA 1JWMD 4ECSA 2LVPA 5ALNA 4YP3A 3M3JA 3OLMD 4ELUA 4FS2A 1WMHA 3LVVA 2AQ3B 2WGSA 3ORYA 3F2BA 5EWEA 3S2AA 9ICKA 3GU3A 2BKFA 2FJ6A 4JV2A 4EENA 2EELA 3RR7A 4HJKA 1DK2A 3SYZA 4GOCA 1ZQVA 2OJRA 1YX6B 4CRXA 3SD5A 3A1QA 2AHOB 2LPEA 2DNFA 3K1ZA 4LK0M 8ICWA 4O3NA 4XYCA 5LNK1 1S10A 3Q8BA 2XICA 4QZDA 1UPHA 3EPIA 4UARA 4EUTA 2VA8A 4PGYA 2VJ4A 3RF9A 2LHEA 2GH1A 2FE8A 2BR0A 5F9LA 4XDDA 1L3SA 2XVTA 4PZNA 2LWPA 1LFDA 4Y2SA 3JSVA 1NZPA 2FIFA 2WTFA 4DL5A 4DFKA 2GLSA 2HDEA 4IM2A 3OHAA 3Q69A 1HZ5A 3VTVA 1Q10A 4HCNB 2Z7JA 3ZDEA 1B22A 2KQ7A 5AM1A 4JPSA 5DLFA 3H7PA 1NKCA 1V1OA 4US8A 3PW2A 1QCKA 1YT3A 1PVQA 1FPYA 2O6VA 4AJWA 2YTUA 2A1JB 4F71A 1L5UA 3GIMA 2V9WA 4FBTA 4USAA 4BVUC 2KJ6A 1T0QC 3D6JA 2OWOA 1U45A 2KMCA 2VJ5A 2HI0A 3H0RB 3DWGC 2NTTA 4MSQB 1JWSD 3ZJUA 2ESEA 2M0NA 3I3TB 3KUZA 3QNMA 1UZXB 4URKA 3JPPA 2K4IA 4M2YA 3UQAA 3KFUF 3QA8A 4M8NA 4RQ8A 4YQWA 3BWUD 2QHOA 3IV6A 1BMLC 4KKIA 4DO9A 2REXA 2ICIA 3BINA 3TEYA 5FKAC 4PGXA 3BK1A 1MG8A 4IKGA 3PRZA 3RZFA 1NK7A 2UVVA 2HHQA 3UF8A 2NRTA 2UU7A 1ZRMA 1SJED 3VRBB 3H4DA 1WJUA 1TFRA 2LI6A 3LVWA 1SBBB 2IOHA 4IG7B 4UQGA 1ZQTA 1TAMA 1L0YB 1YIWA 4A20A 1NENB 5AM0A 4AS1A 1QSLA 4FJYA 2MA9B 1JN3A 1XO1A 4P2HA 1WI0A 1LO5D 4IDIA 1P3QU 3MGVA 3TL5A 1X9SA 2H3VA 2WNMA 3PLUA 4O9MA 5HMMA 2CS4A 4RQ1A 4NJ7A 4RCOA 2WAQC 4M01A 3GV8B 3I57A 4M0WA 1T0RC 3B0XA 3C28A 1I4XA 1SXDA 3NVWA 2H3IA 2D10A 2RDBC 3GIJA 4BGDA 3BQ0A 4O5CA 1EWCA 3C19A 4YSXB 1P0RA 3PV1A 2JZPA 2MJDA 2KD0A 2RPQA 3FILA 5AI0A 1N62A 2RDIA 1FNVA 2EMTA 2V4RA 2ASJA 1STEA 3KVFB 2JHDA 5MPOA 1PUZA 3SAFA 5KT6A 5CP2A 1C4PA 2WU5B 3PHXB 3BVZA 4R63A 4Y2TA 4UB6U 2M19A 2O6KA 3TKAA 4EBCA 1QQ5A 3HKZF 3T5KA 3E56A 9ICOA 1NJWA 2ODGA 4MACA 2K8CB 4Z6DA 2R8JA 4R65A 4MFCA 5HHDG 2K60A 3OTQA 1ET6A 1XQQA 4GFJA 2NBWB 3AE6B 1K1QA 4F4ZA 1IYFA 3QX1A 4DXFA 3VTWA 3KBBA 3MFIA 4DS4A 5BPCA 4M6WA 2CJOA 1TT5B 1ZW7A 1WUDA 5DDMA 4RUCA 4RQ3A 5J0RA 1KTKA 3GIIA 1NK8A 1YN5A 2KK0A 2C60A 2AEHA 3OPXA 1ENFA 4ELTA 1WGHA 5C1ZA 5HMLA 5D46A 4GXIA 3H0LB 1R4MI 3KD3A 2J4XA 4F5PA 3PW7A 2K4PA 4ECRA 3MDCA 5AI5A 5DB7A 5CHWA 1LKYB 5KFOA 1TE2A 5D7GA 3BDPA 3UMGA 1SGHA 1Q0WB 4M04A 3RN9C 4UDUC 3SHQA 2LD9A 1YJIA 5IOIA 3C21A 5TISU 2KDMA 3AMZA 2KQSA 2M1MA 4QZ8A 1E8ZA 2WXGA 5ALIA 4GLXA 1RYSA 4I2GA 4KTQA 2D3GA 4YT0B 2CRXA 3Q8MA 4MT5A 3A0BU 1YN4A 4OZBA 2NMQA 4JV1A 5L1JA 4O3SA 5KFAA 3ICXA 4NM2A 4ZYSA 2AGPA 2YMPA 1ESFA 4NNJB 4FZNA 4O3MA 3TANA 3Q8RB 2KWCA 3NTUA 3ISBA 4QWAA 2ZIUA 1TKYA 2XEWA 4P1CC 2JUOA 2A5UA 3J81j 2M8SA 5C23A 5J2GA 1ZQ1C 3B9JA 1FXTB 1GAQB 1WY8A 4Y2PA 1ZD3A 3AU6A 3UGBB 2ON8A 3KHRA 1L7PA 2CHWA 2LYHA 3BS5B 1EO6A 2LHDA 2NPTA 2FMPA 3ZDMC 2DLBA 4OCZA 5AKYA 1QQ7A 2QSDA 5AKKA 1IBXA 5KFQA 2HD5B 1UA0A 4KLOA 3QU4A 3LDAA 4TKNA 2W43A 3MGHA 1HQRD 2GBRA 4WWPA 2HMXA 1WXAA 4P16A 4KITB 4LCDE 4PK1A 1ZQEA 2JZZA 5G55A 3T3NA 4NLCA 1NBFC 2LRUA 3H8HA 2KD1A 3WK5A 3MHSD 3DBHI 2BKEA 4RT2A 2L7RA 5GXGB 3AE5B 4C8KA 3M8RA 3CYMA 1F0MA 1MC8A 2HJ1A 4QNLA 2AYOB 5EE1A 2KSOA 4NL9A 3QWZB 4KZCA 3DPDA 4DHJB 3C5FA 9ICGA 1C77A 2F2AB 1WXQA 1SKRA 4NV0A 2JRZA 2N9KA 1I4RA 2I1KA 4FJZA 4KN7A 1J7AA 2G9HD 1UT5A 1KSPA 1F1HA 3IXSA 5B5EU 4XQ8A 2XIDA 2G45B 3TFRA 2ACZB 3EA6A 1Q3UA 1QZEA 1C4AA 2L32A 3N1XC 2V9HA 3N28A 1ZQZA 3RNEC 4U7CA 3SAGA 3K4GA 4BUGA 5KT4A 1QILA 3EWAA 2JMGA 3LK9A 1Q5WB 4EZLA 1CJEA 3OJ4B 1E7VA 7ICGA 2H3FA 8ICHA 2RMMA 1NK4A 3L08A 1GNUA 4I27A 1NYRA 4OHJA 1FD6A 1JUDA 3LDZE 2RSUA 1VCBA 4AP4C 4RU9A 3L3FX 2RRDA 3PNCA 3UINB 3I5JC 1V1PA 2BYVE 2FPKA 4M47A 2LUEA 3NS8A 4KX6B 4KLHA 2GRIA 2PVGC 2AXTU 3LB8C 2IOFK 9ICXA 3IRUA 3KHLA 2PE6B 2JEFA 2ZW0A 4ANWA 4XGAB 1UA1A 1UBQA 4Q44A 5IKCM 4FADA 3HW8A 2ZNVB 5BOLA 1XWLA 3V7JA 2MJEA 1NNLA 4WQOB 1JMSA 1ZQUA 1S8OA 3RNCC 5CHGA 3KWLA 5AK6A 1SSNA 4F5OA 2HTME 2L0TA 4KMOB 4XRHA 4MEXA 2NRWA 5IIIA 1O03A 4NQLB 3LJ3A 5DB6A 4UAZA 4XUSA 4ZOHC 2KX3A 1UGMA 2P6RA 1QOFA 1BPXA 1XF5L 3PO5A 4YMMA 3DVNV 3M6ZA 2HHUA 5AI6A 4IRCA 4PH5A 3HP6A 2WXRA 3HHMA 2W9BB 3N3KB 5J2DA 3IT4B 1ZE3D 4RQ0A 3ALBA 2GBNA 1TVAA 2V3NA 2AX5A 3PVXA 3V62A 4CYEA 4HRSA 4DLEA 3RB4A 1S76D 1WXMA 4MEMA 2Y3AA 4O3OA 2BQ3A 1FNUA 2N1RA 2I38A 3EC8A 3QARA 3UMCA 5KFKA 3GFKB 3R7RA 4DQOC 3IG5A 3GIKA 4JUZA 1FNWA 3PS6A 2LEKA 2PTLA 1UH6A 4Q8EA 1J97A 4C56C 2HHWA 1MQ3A 3GZNI 2M0AA 3NZ3A 1A6SA 1VZ6A 3PLVA 4BKTA 2AWTA 2B76B 3M7DA 2BYFA 3FYHA 3MC9A 2E1FA 1VD2A 4WAAA 4ZDVA 3W9CB 3RH4A 2ISOA 1Q46A 1OTRB 1WE7A 3V7KA 2KLGA 4E0DA 7ICSA 4RNOA 1V38A 5JUMA 3PR5B 4RGOS 4G3XB 3WKBA 5J2RA 5KFFA 3RAQA 4KLQA 2HW3A 2K3UA 1WRIA 7ICFA 2IA6A 1FFVA 4ED8A 2PEAA 1IG6A 3GOEA 3APFA 3GV5B 1S0NA 4Y2UA 1WGDA 2KTFA 4N6EB 1ZQMA 4DHZE 2GI9A 2C22A 4IWOA 4OVUA 2DHZA 1SWVA 3PZPA 2CHXA 4ZRPA 2N7DA 3WK4A 3DEEA 4DL7A 2ZG6A 1T7PA 3EYZA 1ZQBA 3OJUA 4NLGA 5AKJA 1CMXB 3D2SA 3NY5A 1JX4A 2DENB 1SJHD 1UUPA 3VAWA 4M9NA 3NVZA 3SR6A 2OHFA 5BYSA 3SFEB 5LXHA 1TZ1A 2WU2B 2UVWA 4I29A 2MBHA 4WWNA 5IO9A 1Q8KA 2PFQA 2KZMA 1F44A 1V9JA 8ICZA 4NPNA 2XI9A 4B9VA 2ZTCA 4IQUA 4C00A 3AEBB 1YQ4B 5BOMA 4Q43A 1P9DU 3NUQA 3IBEA 4CE6A 4W9KA 1QQRA 2J6UA 4RQ7A 3RRGA 1CK1A 2FLPA 1KFYB 3Q6BA 1MHHE 2G09A 3H7IA 3RULA 4GC6A 2WF8A 4F5NA 1I7HA 2ASDA 3KW5B 4EX6A 2KFNA 5AK5A 2AQ4A 2ZJ5A 1D9DA 2LGDA 3PSTA 4F8RA 3ZUNA 4DSIA 2BW2A 3AE3B 2N9EB 3PTFC 2JPHA 2MJ3A 1BPEA 2WDTB 2AL3A 2GOWA 1EM7A 3AE2B 1ZJMA 5KFLA 3MGIA 3P4QB 1ZP0B 4TQ0A 5EE9A 9ICEA 1ZYQA 4CGZA 3WKDA 3FC4A 2FPLA 3ZJTA 2MRPA 3RFZB 9ICAA 3V6KA 1YZ6A 1AYFA 3RNFC 8ICTA 4Z6EA 3EGRA 5KFXA 3CF6E 1PK1B 3ML9A 3RB3A 1RLFA 1J2MA 2KOBA 3MR5A 2PPHA 3IFWB 4NJCA 4Y2JA 5EE0A 1E5WA 2PMVA 3KYCD 2BB6A 4BBNC 4RNMA 5BO4B 5L83A 4ARIA 4ED3A 2MRLA 1JROA 2EQYA 4QZFA 4C4TA 4PYUA 1UWMA 2ZTEA 3NUHB 2G3QB 2JSVX 2WHIA 4UB4A 2MA1A 3SU8X 4YCXA 1ZETA 2F77X 9ICQA 3NGDA 2F1IA 2KLCA 4HKZE 3RNBC 5CHVC 4YFKA 1ZKHA 5J2HA 3PSFA 2ZIVA 1QLNA 3R66C 4M8MA 3H8MA 2V3PA 1KFDA 1FEZA 2LFIA 4PJ0U 4ED0A 2K8HA 4DDGD 4C4SA 1J7BA 3BQ2A 2LJIA 3Q14C 4F8CB 3NS1A 1SKSA 2ZJAA 4LZGA 1ZQHA 4I6PA 9ICLA 5JRTA 2SEBD 2WXQA 3O0FA 2K25A 2NR2A 2PKOA 3OG5A 1ZDXA 4K7WA 2ALZA 1BNOA 4YXJA 1ISNA 2YX8A 2KVRA 2QB0B 3AH7A 3N7RC 1L8OA 1C76A 4QWDA 1L3UA 5E6JA 4Q2JA 8ICUA 1V81A 3RJHA 1T5XD 1E90A 1TAQA 7ICKA 2FLNA 4AP9A 1ZQGA 4P0QA 2UWQA 1V9PA 3HJEA 4MFAA 2WXOA 4US9A 3PSIA 1ET9A 4L23A 3ZJVA 5C0YA 1V2YA 3BIID 2Y5PA 5H2FU 4ELVA 2MUTB 3DV9A 1YQBA 4O0IA 1QTMA 1WFYA 1GO3F 5JXVA 2ZNVC 4ZYNA 5ALEA 5AUIA 4CNQA 4IC9A 4UAWA 4PZOA 3ZVVA 5FK9C 8ICPA 4J9MA 2WLBA 3T3FA 1BPBA 1TJEA 1WIAA 2LI5A 2GBKA 3T8MA 1L0XB 2DFLA 4LVSA 1PVRA 4OJLA 4IWQA 4DQSA 2H3ZA 2LVQA 2KJRA 3PPAA 3QU9A 4GC7A 3UXPA 4DOBA 3NRWA 4UASA 2MU2A 4LZDA 1GUAB 2MBOA 1A76A 1AQ6A 1K1SA 2IO0B 3TCAA 4RPZA 2ES6A 4DSEA 3VCBA 3UQ2A 2MP2A 2W9CA 3URYA 3NJTA 2WWZA 5D49A 2KC1A 5KFBA 5DB9A 4DS5A 2PJHA 3V6EB 1Z00B 1WWUA 4UAVA 5GMVA 3N4MB 3OHBA 1KLGD 1EXNA 2LHTA 4LNFA 3B1LX 4EEWA 1D5ZC 2Z0EB 3QEAZ 1N2XA 2F44A 4NLZA 2IHMA 2BYEA 2DGZA 1C1YB 1HTQA 3PRPB 2IYDB 4F5QA 2HJ8A 2GBMA 3HVDA 2NTSA 4TQRA 3C0RB 4DOCA 2NRVA 3VDZA 4A8EA 3G6YA 3RJGA 1KFSA 4OJ6A 2K9XA 2LRWA 3UQBA 2K8BA 4J03A 3VTUA 5C5JA 4KZ0A 2HBMA 1FXAA 4ZRKA 5KFYA 2A19A 1S97A 4FZLA 3BVGA 5DDYA 3RCZA 4HLEA 4ANVA 3TADA 1V85A 1S0VA 3ALRA 5DKWA 4I2HA 2JV3A 3UMBA 1WCLA 1RYJA 2QJLA 2D5GA 3D2NA 1NI3A 5ALYA 1RYUA 1TY0A 1WX7A 1VZ7A 2FNJB 3V6JA 2KICA 5J2JA 1A70A 4MF8A 2JEJA 4MM3B 3UXNA 3ZNID 3CW2C 2LUMA 2QARA 4A90A 4FBUA 4HAIA 1WCNA 2VIXA 9ICWA 4GMVA 4NZLB 1CZPA 3V6CB 2AJQA 1LGRA 4BKSA 4ZH4A 5DQGA 2D3BA 4AYBC 4D2KA 2C7HA 1RAXA 3U7ZA 1L6NA 3LWLA 4DQIA 4I2IA 5JU5A 1SEBD 1DYQA 1FM0D 3H8JA 1ZOLA 3B0AA 5KG6A 3RJJA 4A3PA 1OUQA 3ZW3A 3CNHA 2ZPYA 4BWJA 2OEDA 5KFVA 1LVHA 4RNAA 1MI0A 9ICTA 4P0PA 2PIAA 4ECTA 4JWUC 9ICHA 2W04A 2HSZA 5JZEB 3TAQA 1N60A 7ICTA 2W9MA 2MH7A 2K6DB 5C2TB 4ECYA 4KLSA 2W03A 2HTHA 4ED7A 1D5MC 2KFKB 3NVVA 1EU4A 1OQQA 1C3TA 2KYWA 4FE3A 3GS2A 5AZHA 3BJYA 1E8YA 1DOYA 2XK5B 4WAFA 1XLQA 4A3OA 1IP9A 4NLBA 2KTRB 3L10B 5KG3A 1FEHA 1NVID 3IDWA 2DF4B 3C2LA 2DAFA 3Q3OC 5AZFA 3Q8KA 1GJZA 9ICJA 1BVSA 4M0AA 1UNSA 5AKLA 2IGDA 2RDHA 4B9TA 3Q3JA 3ZDTA 1KJTA 2QKQA 1PYWD 4TUSA 2J6SA 5AKXA 2MSNA 4YN4A 1F5SA 2AGOA 2YMQA 2PE9A 3M9OB 2ISPA 2C7MB 3ZNZB 1XT9B 8ICMA 1T0YA 5AIBA 3Q8PB 2KHWB 2KNBA 4RGMA 4RGNA 2NO5A 2R8HA 1E10A 3Q8SB 1RFAA 1DOXA 1CI4A 1JXLA 1TKGA 3WAPA 3VRAB 2JZBB 2HVHA 3PGEA 2BWFA 1JALA 3U52E 4OJPA 4R66A 4FFDA 4Y2RA 5BYQA 2W8LA 3T9LA 3DWMA 1I4GA 3MFHA 3AQEA 1MQ2A 2L1AA 2L00B 1Z1VA 4R8UB 1V86A 2CXYA 2DAJA 1PQSA 2BCRA 1J19A 2Y1JA 1XEEA 4QZIA 1GOZA 3WKCA 2JYTA 4JQWC 4GGQA 2EAPA 3QU7A 1OFFA 2Y5BB 5ALZA 5KT3A 2YN4A 7ICRA 2DYBA 3AEAB 4XWWA 1PUTA 4NY0A 3AEDB 3VR8B 1QT9A 4W9HA 2JZ3B 1A5RA 3N97B 3AEEB 3TIXA 3JVZX 5KFSA 3M6KA 4UAYA 1PGXA 4WJPA 1WMHB 3M8SA 1I35A 1WZ0A 8ICQA 1JW9D 3QU5A 1HZ6A 1XSLA 4C8NA 2NYVA 2KJ8A 5F3XB 4J6IA 1QLBB 2G1EA 4O3PA 2KT7A 2BDUA 4X5VA 2V3SA 2UVRA 1OQRA 4IQTA 1ZQIA 3QCAA 3QEBZ 3C2KA 1HJPA 4IRKA 3QE9Y 3MJ5A 5J0YA 4FZMA 3Q3NC 2W55A 1NI2A 4BXOA 4EX7A 2I1JA 5E6PA 4ANUA 1NKEA 1K53A 2LJ5A 2KKVA 3IAS1 2DYOA 3IHQB 4QZCA 2P6UA 3ZDBA 3A9JA 3SD7A 3JSVB 5AK4A 4UB3A 2BGFA 1FMAD 1XO3A 3P4RB 5J0SA 2HOIA 2JQRB 4MH8A 3NZSA 1XSPA 4IS7A 2C2EA 3H7PB 1X1MA 2FI1A 3Q3MC 1XCTL 4B9LA 2DX5B 2K6QA 5KFEA 3C29A 3DBLB 8ICBA 3QHTA 2O6VB 5I4DA 4B9SA 3DBRB 4DLGA 4JK1A 7ICOA 3F5EA 1JIHA 4TUUA 1PZNA 1J0GA 5DBBA 3BS5A 3AE8B 3ZRCA 1DXSA 1LM8B 2LASA 4OW0A 2NRXA 1TK8A 3WA0A 4YD1A 4M9GA 1LV5A 4YR2A 4KV2A 1XLOA 1UF0A 3C5GA 1XU4A 3Q8LA 3HX0A 4DXGA 4GDKA 2M4NA 1N5WA 4LNOA 4B9KA 4FULA 4ED6A 1R4NB 1WH3A 3P42A 1WRDB 3BS7A 2JU6X 4E3CA 1P98A 2KDIA 5B66U 2LXCA 2KVSA 2J42A 8ICGA 2WP9B 1QF6A 2BGWA 1NK0A 3WAOA 1GB1A 2MBQA 2KHVA 1WSPA 1WYWB 3HIZA 1S3SG 3M9MB 5ALFA 2LMCA 4JWMA 4RF0A 4DEZA 1F2RC 2IJ0A 4EE2A 1EUVB 1HEKA 1N63A 3ZD9A 2QB1A 4M9LA 1ZQLA 2KJHB 4J9SA 4NJ8A 1TV9A 2HE7A 5ALQA 5E6NA 5AI8A 3MBYA 1WR1A 2ZUBA 3DDCB 5D6JB 5C3JB 3SMVA 3MC8A 2Q4TA 1E9MA 2YB4A 1SV0A 2J0MA 4M0WB 3D2QA 3WKAA 4B0MA 2AU0A 2CN1A 4NLNA 2GWSA 2H88B 1WXVA 2KEYA 5ALOA 2OYYA 3OJ3A 3QQ8B 3CP8A 5BMIA 4RQMA 2A4ZA 4NAWB 5DG9A 5IINA 4NM1A 2QEJC 1CEZA 3DQVA 1C4CA 3U8ZA 5KFWA 4HKQA 2LGXA 2D6FC 4J9PA 4ECQA 1ZGUB 2K1FA 4LJPB 2Y0SF 3MP9A 3TUOA 2PMZF 2IBKA 1Z1BA 1D6EC 4WJ3B 4ECXA 1U47A 9ICUA 2OOBB 3AEFB 4W9DA 2EH9A 2KIVA 2D3AA 3C2MA 5J8YC 3DHGC 2V4IB 2A1AA 3WKEA 3VUYA 1PDXA 1ZQAA 2G5HB 4HK2A 3AM9A 4JE3B 3DDHA 4QZHA 1YN3A 3KHHA 3PR4A 4S0RA 2NO4A 3PW4A 2JY6A 2MQJA 4HPLB 1L4DB 2MSED 4HWIB 1WWVA 4I2AA 2KWDA 3N9YC 4RNNA 2BVCA 4OO1J 9ICNA 1R4MB 1TIFA 4EZJA 2LGIA 3TEWA 4F4XA 2PI4A 2FUG1 4GDLA 3A9KA 3W5VB 3WANA 3R2IA 3QAQA 4QZEA 2YLMA 1ZD4A 5KFHA 3EW9A 1RXWA 2WXKA 2WXNA 2XNAC 4A6QA 2Y9TA 2YVCA 5KG7A 3QK0A 5KTQA 4FS1A 1J7CA 2KDFB 3CWIA 5HFYA 2QDFA 4DOAA 4F2RA 8ICNA 4XC2A 1FRDA 2J7QB 3AE4B 1QQ6A 3RNAC 5AEKB 3FM9A 3PMLA 2C5LC 5TZVA 3W1SA 2E3TA 4A9AA 2E8MA 1WJ4A 3H40A 2WDVB 1ZQWA 4KN4A 3PX4A 2L76A 4FHJA 2PFPA 4WQMA 5ALTA 1AW7A 3JPSA 4C8MA 5TR5A 5J0UA 4W9FA 1D3ZA 4ICVA 3ISCA 4JV0A 4J9LA 3DVGY 1VJ5A 1COOA 2JH7A 1TAUA 4HDOA 4HYKA 3RNGC 2P35A 5KG4A 1WM2A 1HXYD 3JPNA 2I9GA 4M02A 4WWOA 2JR5A 3FDSA 4OZCA 4ICAA 2NPTB 2W3RA 2XO7A 3ZTCA 4BZAA 5J2CA 1AROP 2L52A 3HM3A 4DK5A 2M56B 1HTOA 4A55A 4RPYA 5KHQA 1E8XA 1NK9A 4I2DA 3APCA 3SFDB 1IBXB 2KFJA 5HNKA 3VQIA 4IWPA 4P4PA 2YY6A 3HT3A 2IZVB 1BGXT 8ICIA 1RRBA 1MN8A 3RAXA 2R61A 2V0GA 4GXKA 3AULA 4PYZA 1UELA 3KLSX 4PS3A 3RZWC 3CRXA 1OW5A 5J0QA 4UB1A 1Z19A 2NV3A 4BWMA 4ARCA 4W9JA 1DGJA 3MR2A 1NEKB 1V8CA 3EFUA 3UI3A 3M95A 2W82A 1FXIA 2NVUI 3IT6B 2Y9UA 5HP4A 3RYTA 1VDVA 5KFUA 1PVPA 2A3VA 4LDTD 4OZAA 2C2DA 1WE6A 2WB1C 3K75D 4DFDA 1TY2A 2JVCA 1KM7A 2R2OA 4QJFB 4JWSC 5CB1A 2IHNA 3ONSA 1SGGA 2AGQA 4DQPA 4DFPA 3OAWA 2H5XA 2XCPA 2V1YA 3WIMA 1JQ4A 3PZ7A 1M94A 1I42A 4LNKA 2WAQF 5J17A 4IOIE 3F5AA 3OGUA 3M1YA 4RQNA 4B9MA 3L13A 3WALA 2EZXA 4QZBA 3T5HA 2SAKA 3W2DA 1NKBA 4BJQA 2JWZA 2KWVB 5CA7A 3L4PA 1ZUD2 4LNNA 3G6XA 1OGWA 3NHEB 1KEJA 4JL9A 1JWBD 1JRUA 2N1WA 5AUKA 2HHSA 1WJNA
chains in the Genus database with same CATH topology
1T5XD 3Q69A 1HZ5A 1Q10A 2IDYA 4YXDB 2JWUA 4JPSA 4RH6A 2WXOA 4US9A 1ET9A 2PW9A 1L6VA 1V1OA 4US8A 3P1MA 4L23A 3ZJVA 3BIID 2Y5PA 2IPKD 1KF6B 1V1PB 2W3SA 5JXVA 4USAA 2KACA 3LYYA 1HEZE 5AUIA 5FK9C 2WLBA 4LTUA 2GB1A 1TJEA 3DWGC 3U2SC 2VZKD 3HRDD 2NTTA 1L0XB 1JWSD 3ZJUA 1AN8A 4GDKB 1TS4A 3BWUD 1BMLC 2MEKA 3NRZA 4KKIA 2ICIA 2K5PA 3GP7A 4FXCA 3TEYA 5FKAC 1MVKA 1TS5A 3BK1A 2WDQB 3URYA 4IKGA 1YJJA 3ETRA 1RFKA 4OVZA 2DYMA 1P7FA 1QOAA 1SJED 2INPE 3VRBB 3E9SA 2J53A 2WXMA 1SBBB 1M4VA 1JWUD 1KLGD 1D5ZC 1L0YB 2BYTA 1NENB 2ZW1A 4AS1A 4WIPA 4IDIA 2BBCA 4A8XC 1LO5D 2WNMA 3HVDA 2NTSA 2JXTA 2KMMA 3AE9B 3SEBA 4RCOA 5EE3A 2WQYB 1BXTA 2K9XA 3HUIA 3I57A 4M0WA 4TSSA 4YTPB 1D5XC 1FXAA 3T3OA 5HG2A 1I4XA 3NVWA 1PFDA 3BVGA 1B1ZA 1EWCA 4YSXB 3TEZA 2JZPA 2MJDA 1XLNA 3FILA 1RYJA 1N62A 1FNVA 2QJLA 1I4HA 2D5GA 1STEA 1NI3A 1K51A 3W5UB 1TY0A 5MPOA 2ONQA 1VZ7A 4R3DA 3PO0A 3AB5A 1C4PA 4TQ1A 1A70A 2WU5B 2INNE 3ZYYX 1F0ZA 3BVZA 4MM3B 2M19A 2LUMA 4YWGG 4A90A 2BS4B 1T3QA 2K22A 3E56A 4MACA 4NZLB 5HHDG 1TYGB 1ET6A 1CZPA 3AE6B 3I9V1 4DXFA 4WWMA 2Y5CA 2PVOD 1ZOYB 4D2KA 2CJOA 3U7ZA 5D3DA 1KTKA 1YN5A 1TKEA 1ENFA 1JCKB 1SEBD 1DYQA 1FM0D 1P7EA 4ZRQA 1ZDVA 2JYEA 1VRAB 2AQ1B 2J4XA 4P6VF 4PT5A 2OEDA 4KGRA 4RNAA 1MI0A 2KQ4X 2PIAA 3BYTB 4JWUC 5D7GA 3BVMA 2WS3B 4GDLB 2IGGA 4UDUC 1N60A 2MH7A 5C2TB 1YJIA 2EKIA 2IGHA 2KDMA 3AMZA 1D5MC 2JX5A 3NVVA 1EU4A 1OQQA 2WXGA 4XWTA 3GS2A 1DOYA 4WAFA 1XLQA 4YT0B 3TSSA 2I2YA 1F2RI 3BYYB 4MT5A 1YN4A 4OZBA 2NMQA 1FEHA 1NVID 4L1BA 1IGCA 4HROA 4ZYSA 1ESFA 2KAJA 3P4PB 1C79A 1I4PA 1UNSA 1ZXHA 1TS3A 1TZOA 2IGDA 2AQ2B 2RDHA 1PYWD 2K0PA 5D3IB 1TKYA 1SB3C 1XCQL 1UGJA 1SE2A 4RGMA 3KQ4A 4RGNA 1E10A 3B9JA 1GAQB 1DOXA 5FR3A 2FBWB 2E6XA 2ON8A 1TKGA 2LHDA 5TSSA 3VRAB 2QIEB 2BTEA 1D4BA 2N7JA 1JALA 3AECB 2DLBA 1JWAD 2QSDA 3U52E 1IBXA 3P63A 5BYQA 4L2YA 1JRPA 3DWMA 1MPEA 1I4GA 4ZHOA 1HQRD 4N58A 3ZGZA 2L1AA 4P16A 1E6EB 3AE1B 4HEA1 1XEEA 2WXFA 3T3NA 1GOZA 2JYTA 3VR9B 1C78A 3H8HA 5BMGA 1OFFA 4REZA 3AEAB 4XWWA 1PUTA 5GXGB 1WGKA 1FRRA 3AE5B 3AEDB 3VR8B 2BB5A 1QT9A 3TEXA 5EE1A 1KLUD 3AEEB 1PGXA 1RWSA 1FFUA 5H92C 1JW9D 1C77A 5G5HA 1HZ6A 1WXQA 1FCLA 4RGTA 4KGTA 1QLBB 2G1EA 2N9KA 1I4RA 1YNTE 4ZHPA 1J7AA 2G9HD 1OQRA 3IXSA 3KWVA 2CU3A 2ACZB 3EA6A 2L32A 1C4AA 2L83A 4XE0A 3U4EG 2WXLA 3MJ5A 1K52A 3ABVB 1FO4A 4YTNB 2W55A 2DWQA 4HJGE 2N0SB 3RPFC 1K53A 1KRHA 1QILA 3IAS1 2DYOA 1CJEA 2RMMA 1FMAD 1XO3A 3P4RB 1WYGA 2JQRB 1NYRA 2QILA 3B2FA 4MH8A 4OHJA 1FD6A 3B2GA 2YEPF 3MFGA 2WXHA 3J9CA 4RFBA 1XCTL 3AV8A 1V1PA 5I4DA 4KX6B 1FIQA 1ROEA 2GRIA 3ZQ4A 2PVGC 3WCQA 2J52A 3LB8C 2W54A 3AE8B 4B0EA 4OW0A 2ZW0A 1XLOA 3R8BA 4JX1C 4DXGA 2MJEA 1N5WA 3FAHA 2Q5WD 3KWLA 1SSNA 3P42A 2JU6X 2HTME 1IUEA 1R7SA 5G5GA 4ZOHC 2J42A 2WP9B 1QF6A 1MHXA 1QOFA 1XF5L 4YSZB 1GB1A 1WSPA 5HI1A 1V97A 3AEGB 4O1NA 2LMCA 2WXRA 4RF0A 3AE7B 1F2RC 2IJ0A 4EE2A 3R2TA 1YQ3B 3IT4B 1ZE3D 4NAMA 1N63A 4WURA 2V3NA 2AX5A 1SF0A 4HRSA 1N61A 1RM6C 2Y3AA 1FNUA 2I38A 1FCCC 1SE4A 4J3OD 5BMHA 5C3JB 1QOBA 4H2AA 4DQOC 1E9MA 1FNWA 2LEKA 2PTLA 1VR9A 4B0MA 4C56C 1L0VB 2RDGA 4XDCA 2WXIA 1K50A 2H88B 2M0AA 3NZ3A 1VZ6A 4ITKA 5T8IA 1GB4A 4WH4A 2B76B 3GB1A 3PZ8A 2CJNA 2XN9C 1GPXA 1I4QA 3W9CB 4AQ7A 5BMIA 1KH0A 1SXTA 3OWEB 4NAWB 5H8YE 3HVZA 1XLPA 2QEJC 2H89B 1C4CA 4RGOS 4HKQA 4TMAB 2K3UA 3IAM1 1QOGA 1WRIA 1B9RA 3NVYA 1FFVA 3MP9A 3TUOA 1D6EC 2VZKB 1BUIC 3AEFB 4C80A 2N9LA 1T6BX 4N6EB 2GI9A 1C9FA 2V4IB 1E0ZA 1PDXA 4ZRPA 4KGSA 3LXFA 5BYRA 1PGAA 1L5PA 3AM9A 4JE3B 1ACCA 1ZXIA 1YN3A 3P4SB 3AN1A 4LLGM 1SJHD 1L4DB 1UUPA 1VZ8A 3NVZA 2KWDA 3N9YC 3SR6A 3TEWA 2OHFA 2LGIA 5BYSA 1IGDA 3EUB2 2FUG1 3Q8FA 3V05A 3SFEB 4GLSC 2WU2B 3W5VB 4N59A 3R2IA 3Q8AA 1SE3A 2WXKA 2XNAC 3Q8EA 2WXNA 1Y56A 2Z8LA 4A6QA 3AEBB 1VLBA 1J7CA 1YQ4B 3CWIA 5HFYA 1FRDA 1WWTA 1QQRA 3AE4B 1CK1A 1KFYB 3BK2A 1MHHE 1NYQA 1ZPSA 2KN4A 2E3TA 2WXJA 3MC0B 2WDVB 3W1SA 4A9AA 1I7HA 1XXGA 3Q8CA 1HA5A 4WQMA 1AW7A 1JMLA 2BW2A 3AE3B 1N5XA 1E7PB 2MJ3A 1YMHE 2BS2B 4C7YA 1EM7A 3AE2B 2WDRB 3P4QB 1ZP0B 4TQ0A 5EE9A 2PLPA 3O13A 3V3XA 1HXYD 3FC4A 3ZJTA 1EU3A 1SIJA 4KKJA 3RFZB 3C8YA 4OZCA 2W3RA 1AYFA 1DOIA 2L52A 4C7ZA 3EGRA 2M56B 1EWYC 4A55A 1TS2A 1IBXB 3SFDB 4RF1A 4NJCA 3VQIA 5EE0A 1L4ZB 2DBYA 2PMVA 1QKZA 2BS3B 2TSSA 2BB6A 4ARIA 2R61A 2V0GA 1L6UA 1JROA 2YEPB 3KLSX 2X38A 1UWMA 4YSYB 3MHZA 1UWXA 1F77A 4ARCA 1PGBA 2WXPA 3NUHB 1DGJA 2RPVA 2JSVX 3CIRB 1NEKB 1V8CA 3UI3A 1JWMD 1FXIA 2W82A 3IT6B 4HKZE 2AQ3B 1VDVA 2BT6A 4OZAA 2QMTA 4YTMB 1TY2A 4JWSC 2EELA 2V3PA 2LFIA 1J7BA 2LJIA 1JQ4A 3NS1A 3PZ7A 4LK0M 1CQVA 5LNK1 3Q8BA 2SEBD 4IOIE 2WXQA 3BZDB 2PKOA 1ZDXA 2SAKA 3W2DA 2LHEA 2FE8A 1AWDA 4XDDA 3L4PA 1ZUD2 4CQNA 3AH7A 1C76A 3FILB 5E6JA 1JWBD 1VJKA 4Q2JA 5AUKA 2HDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S B;  1FMA D;  1XO3 A;  3P4R B;  1WYG A;  4P6V F;  3AN1 A;  2JQR B;  1NYR A;  4YXD B;  3B2F A;  3NVZ A;  2PIA A;  4US9 A;  3SR6 A;  3B2G A;  1L6V A;  4JWU C;  4US8 A;  3P1M A;  2OHF A;  3BII D;  3EUB 2;  2WS3 B;  3AV8 A;  3SFE B;  1KF6 B;  2WU2 B;  3W5V B;  4N59 A;  1N60 A;  2MH7 A;  5C2T B;  1YJI A;  2W3S A;  2EKI A;  4KX6 B;  1FIQ A;  4USA A;  1ROE A;  3AMZ A;  2JX5 A;  3NVV A;  1OQQ A;  1VLB A;  1J7C A;  1YQ4 B;  2PVG C;  3AEB B;  3CWI A;  3LB8 C;  5AUI A;  2W54 A;  3AE8 B;  3WCQ A;  2WLB A;  1DOY A;  4LTU A;  1FRD A;  1WWT A;  1TJE A;  3AE4 B;  1XLQ A;  3DWG C;  4YT0 B;  3HRD D;  1KFY B;  1XLO A;  1NYQ A;  4JX1 C;  2E3T A;  1NVI D;  4A9A A;  2WDV B;  2MJE A;  1I7H A;  1N5W A;  4HRO A;  2KAJ A;  3P4P B;  3FAH A;  4WQM A;  2Q5W D;  3KWL A;  3NRZ A;  2HTM E;  3AE3 B;  1N5X A;  1IUE A;  1QF6 A;  1E7P B;  2K5P A;  4FXC A;  1R7S A;  5G5G A;  2MJ3 A;  1TKY A;  2BS2 B;  4ZOH C;  4C7Y A;  2WDQ B;  2WP9 B;  3AE2 B;  1SB3 C;  1YJJ A;  3ETR A;  1QOF A;  1RFK A;  2WDR B;  3P4Q B;  4YSZ B;  1QOA A;  1ZP0 B;  3VRB B;  5EE9 A;  1V97 A;  1E10 A;  3B9J A;  3AEG B;  1GAQ B;  3FC4 A;  1DOX A;  1SIJ A;  2FBW B;  1TKG A;  3VRA B;  2QIE B;  3AE7 B;  2W3R A;  1AYF A;  1JAL A;  1YQ3 B;  3AEC B;  1JWA D;  1N63 A;  1DOI A;  4C7Z A;  2L52 A;  2M56 B;  1NEN B;  1EWY C;  3P63 A;  3SFD B;  2AX5 A;  1JRP A;  4IDI A;  3DWM A;  1SF0 A;  4HRS A;  5EE0 A;  4ZHO A;  1N61 A;  1RM6 C;  2DBY A;  4N58 A;  2BS3 B;  2KMM A;  3AE9 B;  5C3J B;  1QOB A;  5EE3 A;  2WQY B;  3HUI A;  2K9X A;  1E6E B;  3AE1 B;  1E9M A;  1L6U A;  1JRO A;  2LEK A;  3VR9 B;  4YTP B;  1FXA A;  1L0V B;  1OFF A;  1UWM A;  4YSY B;  3NVW A;  1PFD A;  3AEA B;  4ITK A;  2H88 B;  1PUT A;  1DGJ A;  3CIR B;  5GXG B;  1WGK A;  1FRR A;  1NEK B;  1V8C A;  2B76 B;  3AE5 B;  3AED B;  3VR8 B;  4YSX B;  2CJN A;  1FXI A;  2MJD A;  1QT9 A;  1XLN A;  5EE1 A;  1GPX A;  1RYJ A;  1N62 A;  2QJL A;  3AEE B;  3W9C B;  1NI3 A;  1RWS A;  1VDV A;  3W5U B;  5MPO A;  2BT6 A;  1FFU A;  3PO0 A;  3AB5 A;  3HVZ A;  1JW9 D;  1XLP A;  5H8Y E;  5G5H A;  1A70 A;  1WXQ A;  2WU5 B;  5H92 C;  3ZYY X;  1F0Z A;  2H89 B;  2M19 A;  4YTM B;  4JWS C;  1QLB B;  2G1E A;  1QOG A;  2BS4 B;  1WRI A;  1T3Q A;  1B9R A;  2K22 A;  1J7A A;  3NVY A;  1OQR A;  4ZHP A;  1FFV A;  1J7B A;  1TYG B;  2CU3 A;  1CZP A;  3AE6 B;  3NS1 A;  2ACZ B;  1JQ4 A;  3AEF B;  2L83 A;  4WWM A;  4C80 A;  2Y5C A;  2PVO D;  1ZOY B;  4N6E B;  3ABV B;  2CJO A;  1FO4 A;  2PKO A;  4YTN B;  1E0Z A;  2W55 A;  1AWD A;  3L4P A;  1PDX A;  2DWQ A;  1TKE A;  2N0S B;  1ZUD 2;  3RPF C;  1KRH A;  3AH7 A;  3LXF A;  1FM0 D;  1JWB D;  1VJK A;  1L5P A;  3AM9 A;  1CJE A;  5AUK A;  1ZXI A; 
#chains in the Genus database with same CATH topology
 2PI5 A;  1NDD A;  1Y8R C;  2IDY A;  2XGQ A;  4YXD B;  2BQR A;  2HVI A;  2JWU A;  3AQF A;  1SXE A;  5AM3 A;  2K8A A;  2PW9 A;  1L6V A;  2EMS A;  2JEI A;  3KZI U;  1BNP A;  3TAC B;  2ZIX A;  4QZA A;  3IG3 A;  1KF6 B;  3RUI B;  4NY8 A;  2EAN A;  3TQ1 A;  3M62 B;  1V1P B;  1V80 A;  1IXR A;  3DHI C;  1F52 A;  3LYY A;  1HEZ E;  4PL2 A;  2GLE A;  2P66 A;  2RDJ A;  7ICP A;  2K4H A;  2BPF A;  2GB1 A;  2Y1I A;  3N1Z C;  3U2S C;  2VZK D;  1X6J A;  3HRD D;  1X9W A;  3VC8 A;  1KTQ A;  1UQV A;  3HK0 A;  3EFC A;  4QWE A;  2ASL A;  1TS4 A;  1ZQJ A;  2BDP A;  3PO4 A;  1H4R A;  3UIP B;  4RQ6 A;  1KFT A;  3G6V A;  2N4F A;  5IN7 A;  4DQR A;  3C23 A;  5DG7 A;  4GIB A;  4FXC A;  2DPJ A;  2HHV A;  4X57 B;  4F93 B;  1MVK A;  1TS5 A;  2LKY A;  3I76 A;  1SKW A;  4EZ6 A;  3ETR A;  2BCV A;  1P7F A;  1KOT A;  1WGG A;  3E9S A;  4KLI A;  1S77 D;  5HHH A;  4TV3 A;  1SZH A;  1ZRN A;  2MAX A;  2XCA A;  9ICB A;  4I2F A;  3DVG X;  4KIK B;  2WXM A;  1SE9 A;  3ZXR A;  2R8I A;  1JWU D;  3ZLZ A;  2B0C A;  5DGA A;  3MDA A;  2KKP A;  2ZVN A;  4P1B C;  3ETL A;  5KL1 B;  4A8X C;  2BBC A;  3KUD B;  3T79 A;  4UB5 A;  1S5L U;  5T14 A;  4NJ6 A;  2GO7 A;  9ICS A;  3RH5 A;  8ICY A;  2KMM A;  5CEH A;  3AE9 B;  2IO1 B;  4ANX A;  4PHP A;  3HUI A;  5GTH U;  4TSS A;  4YTP B;  2ZUC A;  5KFI A;  1D5X C;  2E5S A;  2JT4 B;  1DK3 A;  1KL9 A;  4KLJ A;  1OEY J;  2M0X A;  5HG2 A;  3VHT C;  1RQL A;  4OJ5 A;  1E8W A;  2J0K A;  2KMA A;  3BY4 B;  4ZRI A;  2KZR A;  7ICN A;  4CDG A;  1XSN A;  1LB2 B;  3TEZ A;  3IM1 A;  3T5L A;  4DCC A;  7ICQ A;  2KWU B;  2OH2 A;  4C4V A;  2RR9 A;  3W5U B;  2ONQ A;  2DUY A;  3AB5 A;  4EEL A;  3ZYY X;  1F0Z A;  1WG8 A;  3A0H U;  4Y2Y A;  4YWG G;  4I2J A;  4AUQ C;  1D8L A;  2IO3 B;  2I6X A;  2MUT A;  5AZG A;  2EZY A;  5DBC A;  3E58 A;  2W8K A;  3PX6 A;  1ZOY B;  2E8N A;  1RDF A;  5D3D A;  5DGB A;  1RZT A;  2XC9 A;  4KVG B;  4JWN A;  1F9J A;  4QW9 A;  1TKE A;  2VH1 A;  5KAF U;  3MAB A;  3PV8 A;  3AEV A;  1X42 A;  1ZDV A;  3SV4 A;  1CRX A;  2JYE A;  1SV4 A;  5ALX A;  1N6Z A;  1VRA B;  2AQ1 B;  2PFO A;  4EFO A;  4P6V F;  3IN5 A;  3U7D A;  1NJX A;  1URJ A;  5AIA A;  5FP0 A;  5HKH A;  5L1K A;  4EBE A;  2LBO A;  2WS3 B;  4G0N B;  2ZIW A;  1CUK A;  4DF8 A;  2ZCC A;  3MJW A;  2W9A A;  3UIO B;  3T5J A;  5KFZ A;  2EZZ A;  1X9M A;  2FCQ A;  2IGH A;  4LDT B;  4MFF A;  2JX5 A;  2BPC A;  1D8Y A;  3N30 A;  5DG8 A;  4XWT A;  1B4F A;  3BZK A;  2UVU A;  4ASW C;  3TSS A;  5KG2 A;  2CKH B;  1F2R I;  3B0Y A;  5DPS A;  4QW8 A;  3LYS A;  4K3C A;  3PW0 A;  5KT2 A;  3H4B A;  3SZ2 A;  4R64 A;  1IGC A;  4F4K A;  2LMR A;  4FO6 A;  4HRO A;  2F8K A;  1ZD2 P;  1U9L A;  4HPP A;  2AQ2 B;  4UW9 A;  4K7U A;  3EEC A;  3SAH A;  4OJO A;  3F2D A;  1Q3V A;  4IL6 U;  4XX5 A;  4G50 A;  2K0P A;  5D3I B;  3RJK A;  1SB3 C;  4NXZ A;  1XCQ L;  1EF1 A;  2DKZ A;  3QX7 A;  5J0T A;  1L7N A;  1MG4 A;  1XNS A;  1SE2 A;  3Q2A C;  3KQ4 A;  3QUC A;  1UT8 A;  2FCS A;  2EDU A;  2FBW B;  2FPM A;  4MJS A;  2QIE B;  1L2N A;  1D4B A;  3OJS A;  1V5O A;  2N7J A;  2MBE A;  4MHV A;  2N1V A;  1JWA D;  3AEC B;  3UM9 A;  4PGQ A;  3SDL C;  4BKS D;  2WF7 A;  4L2Y A;  4MM3 A;  3HKZ C;  1T0S C;  2FCM A;  2RD0 A;  1B43 A;  1B0X A;  3IHP C;  5LLI A;  4ZHO A;  5ALW A;  2C28 A;  2JEG A;  3A33 B;  2G4D B;  5F9N A;  3KUC B;  3WK9 A;  4HEA 1;  8ICA A;  4F92 B;  2WXF A;  1Z5S B;  1UHU A;  5KAI U;  4REZ A;  8ICV A;  1V6E A;  4G3I A;  1Z2M A;  3JW0 X;  5KFM A;  4ECU A;  1FRR A;  1MA7 A;  4II2 B;  2XY6 A;  4JLC A;  1COK A;  3GE8 C;  2NBU A;  2ZEQ A;  4S17 A;  3TEX A;  2H3Q A;  1L7Y A;  2X8X X;  1RWS A;  8ICX A;  2KN5 A;  3DBS A;  4KMU A;  2ZIV B;  4UB8 U;  3R7Q A;  5G5H A;  1QH9 A;  1FCL A;  4RGT A;  2NS5 A;  4ZHP A;  1QSS A;  1GC6 A;  4E74 A;  4BDP A;  8ICC A;  3KWV A;  1WM3 A;  4K4H A;  2CU3 A;  4EZK A;  4CF4 A;  2C9W B;  2KOX A;  4ACF A;  1U4A A;  2WXL A;  1XS9 D;  3N7S C;  1K52 A;  3I63 C;  1P7D A;  7ICE A;  3VVW B;  1RPL A;  2DWQ A;  3N32 A;  2N0S B;  2K89 A;  1KRH A;  2J6T A;  4KSK C;  3QYP A;  4K4I A;  1HE8 A;  2KK8 A;  3CST A;  3ZNH B;  5EDS A;  2LVO A;  3F53 A;  3GDX A;  4AOF A;  7ICJ A;  1YX5 B;  2QIL A;  5IIK A;  4P7I A;  3JPQ A;  5DPT A;  1O08 A;  3B2G A;  3MFG A;  2WXH A;  4RFB A;  3RJF A;  3AV8 A;  2JRI B;  2KXJ A;  2A1J A;  2ZZP B;  4YMO A;  1FIQ A;  2O2V B;  5J2A A;  3RD2 A;  2MHJ A;  3WCQ A;  3WK6 A;  1WGR A;  4TUP A;  3TFS A;  4KX5 A;  5J2E A;  3A4R A;  3UQ0 A;  4IM0 A;  4QWC A;  2G5I B;  3R8B A;  4PS8 A;  2Q5W D;  2MBB B;  5KL8 B;  2WX1 A;  1ZQK A;  3JPR A;  3AL0 B;  3QXG A;  2W7P A;  2OJW A;  3FKY A;  2D2Q A;  2R8K A;  2MP2 B;  5DB8 A;  4GU2 A;  1T3N A;  2BPG A;  4BKG A;  1IM4 A;  5ALS A;  5HI1 A;  4DFM A;  5J2B A;  4O1N A;  3X0W A;  1S0M A;  4KLM A;  3R2T A;  1YQ3 B;  4PS7 A;  4DL2 A;  4NAM A;  4MDK E;  4CF5 A;  3BQ7 A;  2G0A A;  4KDI C;  2KZZ A;  2CPR A;  1SF0 A;  4N9F 4;  4Y2Q A;  3ZNG C;  1N61 A;  3H0M B;  4ECW A;  2DQN B;  3SEI A;  2RGF A;  1SE4 A;  3U30 A;  3ZDD A;  3RFA A;  1ZQS A;  5BMH A;  4MSM B;  4H2A A;  3VXW A;  4O5E A;  4DWI A;  4J9O A;  1KN5 A;  2K8B B;  4MGI E;  4NLK A;  2KE7 A;  4RUA A;  1J2N A;  1VR9 A;  5J0O A;  2RDG A;  5J2I A;  2WXI A;  1S0O A;  1K50 A;  5T8I A;  2QLT A;  1WX9 A;  3QC8 B;  4I6L B;  2ZJ8 A;  4F7Z A;  2XN9 C;  1I4Q A;  1WZ3 A;  5ALM A;  4QIW F;  4AQ7 A;  2G06 A;  2J0J A;  4YR0 A;  2RHF A;  1SXT A;  2KFZ A;  8ICR A;  2LM4 A;  3OWE B;  1TBE A;  4IQW A;  3DBL I;  1XLP A;  2KZ3 A;  5H8Y E;  1KLN A;  2V4L A;  5CR0 A;  3GQC A;  1XD3 B;  2H89 B;  3DBR I;  4TMA B;  5K4L A;  1QOG A;  1B9R A;  2QAR B;  3NVY A;  3ZXV A;  2K8C A;  2KO3 A;  4BBN F;  4B6J A;  2N9L A;  5AIC A;  2ATL A;  1SIF A;  2BQU A;  3NZU A;  4YR3 A;  2KAN A;  9ICV A;  5AKI A;  4BOS C;  2FE9 A;  2BCS A;  5L95 C;  2LM1 A;  3KHG A;  3TAR A;  1R4N I;  1L5P A;  1BPY A;  2K4E A;  3P4S B;  3JPO A;  2W9N A;  3AN1 A;  5A0L A;  7ICI A;  3Q3F A;  1LKY A;  5ALJ A;  3KOO A;  4P0P B;  5DPR A;  4KDL B;  2MCN B;  1OEY A;  5LXI B;  5ALU A;  4GLS C;  4DHJ D;  3A1Q B;  3Q8E A;  2L0F A;  2BCQ A;  1Y56 A;  3ONN A;  2JF5 A;  4CO7 A;  4O3Q A;  1VLB A;  2KDB A;  3PVL A;  2G08 A;  3EHV A;  4PL1 A;  1WWT A;  4DSK A;  1DOQ A;  5CTR C;  4I6N B;  4TUQ A;  4HPM B;  4DWF A;  1NYQ A;  1DGS A;  1ZPS A;  5AHX A;  2WXJ A;  8ICF A;  3RMK C;  5ALP A;  3WU2 U;  3NOB A;  2KX0 A;  3KTQ A;  5KNI A;  1TK0 A;  3UXO A;  3Q8C A;  2L3Z A;  4TQS A;  1JML A;  1V49 A;  3L5K A;  2LYB A;  1N5X A;  1QSY A;  4MGZ E;  1BT0 A;  4G9B A;  4P4M A;  1GG3 A;  2BKR B;  5ALK A;  5J18 A;  2BS2 B;  5JHA A;  5KFT A;  4GXJ A;  5HR7 A;  2KIW A;  5JTI A;  3GV7 B;  2I1Q A;  1ZQQ A;  3O13 A;  4B9N A;  1ZQY A;  2KKC A;  5J0P A;  3V3X A;  4RMA A;  1SIJ A;  3AI5 A;  4KKJ A;  4TUR A;  2FID A;  1EF5 A;  5CX3 A;  3DVN U;  3H7S A;  3BZC A;  2F76 X;  5GTI U;  4RPX A;  4NAW A;  4Z6F A;  1EWY C;  1TS2 A;  8ICK A;  3SEN A;  1IPG A;  4DXA B;  4W9L A;  4MEL A;  4EEY A;  1QKZ A;  2BS3 B;  1NJY A;  4B6W A;  4QZ9 A;  4P4O A;  2YQE A;  2VRR B;  1L6U A;  1T94 A;  4YSY B;  3MHZ A;  3QUT A;  1UWX A;  4FJV B;  1PGB A;  3CIR B;  4QAY A;  1L7M A;  3SI8 A;  3ZIM A;  5L1L A;  1HUZ A;  4GSW A;  5J2F A;  5JH5 C;  4AJY B;  4PHA A;  4JB3 A;  3RBE A;  2BT6 A;  4Y2X A;  3O65 B;  1Z4N A;  3BQ1 A;  2LGY A;  5KT5 A;  3RT3 B;  8ICL A;  2QMT A;  2XY5 A;  2E8O A;  2D07 B;  4YTM B;  1U49 A;  3K9P B;  3A4S C;  2BPS A;  2KJ9 A;  4FN2 A;  1DRG A;  4Y2V A;  2WF5 A;  1CQV A;  2KP7 A;  3IG8 A;  1Y88 A;  4I28 A;  4ECZ A;  3X23 A;  3AXC A;  5ALV A;  2ZUD A;  3BZD B;  3KKA C;  4K7S A;  3MR3 A;  1ZJN A;  1XO0 A;  1KLV A;  3PSP A;  1AWD A;  3V61 A;  5CRX A;  4CCH A;  4BXO B;  5KG1 A;  2CHZ A;  3S6J A;  4UB2 A;  5EOZ A;  1RYR A;  1P1A A;  1KBU A;  4FHK A;  3FIL B;  4CQN A;  1VJK A;  3ED5 A;  4EZ9 A;  3A9J B;  2DZJ A;  5L1M A;  5JHB A;  2PFN A;  3N20 C;  2DKX A;  4YD2 A;  2L05 A;  4DSF A;  4RH6 A;  1ZQF A;  2LGS A;  2WX0 A;  2ZPN A;  3P1M A;  2KN7 A;  2IPK D;  4MGK E;  1TGZ B;  1A0P A;  1L3V A;  3TI0 A;  2W3S A;  2WFA A;  3AUO A;  2L8J A;  3TJP A;  4W9C A;  3QZ7 A;  2KAC A;  3L0W B;  1J8C A;  4M6W B;  4AYB F;  1C20 A;  4MH0 E;  4WJQ A;  3RJE A;  4LTU A;  3QUQ A;  2D8C A;  2VH2 A;  4K81 A;  4M00 A;  2WF6 A;  3QZ8 A;  4FBJ B;  3WK7 A;  2BF8 B;  2HDO A;  2KVC A;  3PX0 A;  2IY1 B;  3E0F A;  3RJI A;  3THV A;  4ACO A;  3GZF A;  1AN8 A;  4GDK B;  1ZQD A;  3DCG A;  4YVZ A;  2FLL A;  2GMI C;  4J9N A;  3GE3 C;  2R18 A;  2XY7 A;  2MEK A;  3NRZ A;  5AI9 A;  4IUM B;  4QWB A;  1T8E A;  2FMS A;  2K5P A;  3ZDC A;  2MW5 A;  1N56 A;  3GP7 A;  1JI7 A;  3ZTD A;  1RQN A;  3I28 A;  4O5K A;  2WDQ B;  1OXJ A;  1YJJ A;  2YMM A;  1ZQX A;  1RFK A;  2DYM A;  4OVZ A;  5ALL A;  1QOA A;  2INP E;  3ZI4 A;  2J53 A;  4YMN A;  8ICO A;  4EBD A;  2VKQ A;  2JRH A;  2W9B A;  1M4V A;  1UBI A;  1V5T A;  4XA5 A;  1LXD A;  1T4G A;  2BYT A;  4C8O A;  4W9E A;  2ZW1 A;  1KRP A;  3ENE A;  2IY0 B;  1XC9 A;  4GB9 A;  4WIP A;  4RM8 A;  4PHD A;  3IVF A;  2FMQ A;  4I2C A;  2JXT A;  4WJN A;  4HCP B;  3TBL D;  1RXV A;  2LYA A;  4B95 A;  3TAD C;  3SEB A;  5EE3 A;  4DFJ A;  1BXT A;  2WQY B;  3AU2 A;  4UAT A;  5KFP A;  8ICS A;  2F1H A;  3T3O A;  2ZIU B;  4Q45 A;  3PW5 A;  1PFD A;  5L9X A;  1ZQN A;  1B1Z A;  4XZ4 A;  3R9K A;  3ZD8 A;  1SL2 A;  1D9F A;  4IRD A;  4EKU A;  1TKD A;  3HWT A;  1XLN A;  4W9G A;  2BHN A;  3WK8 A;  1I4H A;  2IOF A;  1Z3E B;  4F4Y A;  1S1Q B;  1K51 A;  4EEK A;  7ICU A;  2EAO A;  3DOW A;  4R3D A;  5E6O A;  3PO0 A;  4TQ1 A;  4EYI B;  2Z59 B;  1MFW A;  4F5R A;  2INN E;  4AWJ A;  1ED1 A;  4UBC A;  2MLB A;  4KLU A;  2M17 A;  5AKE A;  4DSJ A;  2KJ5 A;  5J0X A;  2BS4 B;  1T3Q A;  4HXD A;  2K22 A;  2ZVO A;  2LXA A;  1TYG B;  5AKG A;  3I9V 1;  1TK5 A;  2G4S A;  3QIJ A;  4ICU A;  4WWM A;  2Y5C A;  7ICV A;  2PVO D;  1GC7 A;  2MX2 A;  2OXO A;  4U6P A;  2R2Q A;  5AM5 A;  2C7N B;  4IR9 A;  1JCK B;  3PHW B;  1LQB A;  4ZRQ A;  1P7E A;  1WF9 A;  2KSO B;  5IAA C;  2JGA A;  3DBH B;  4KLG A;  5HHI A;  2BZF A;  5KG5 A;  4Z6C A;  4PT5 A;  4DSL A;  3BQT A;  4KGR A;  2KNJ A;  4RQ5 A;  2KQ4 X;  2N7E A;  1X6I A;  4F2S A;  3BYT B;  3JPT A;  3BVM A;  1NOM A;  4GDL B;  2IGG A;  3A9K B;  4E71 A;  1A77 A;  5IIL A;  2NCN A;  4KLD A;  2GBJ A;  2EKI A;  2F1J A;  1X9X A;  1ZQR A;  2BWE S;  4IR1 A;  3H8W A;  4KIK A;  1SWW A;  4J9R A;  4RT3 A;  4DQQ A;  2HBK A;  2JXJ A;  5ALG A;  1S9F A;  3W1Y A;  2AH5 A;  4GIV A;  2I2Y A;  3BYY B;  2WF9 A;  3SQI A;  4NWI A;  3VUW A;  2FAZ A;  4L1B A;  4F3O A;  3VFK A;  8ICJ A;  3TAP A;  5IA7 A;  2KAJ A;  3N7P D;  3P4P B;  1C79 A;  1I4P A;  2OEH A;  1ZXH A;  3K9O B;  4MEY A;  3V60 A;  1TS3 A;  1TZO A;  4NQK E;  3N1Y C;  2ZCB A;  5AK3 A;  2KTQ A;  1KDH A;  1UGJ A;  4G11 A;  1M6Y A;  1L3T A;  4IC7 B;  3LWM A;  3AU5 A;  1ZQO A;  5FR3 A;  5D2M B;  2E6X A;  9ICC A;  5TSS A;  5EWF A;  5KT7 A;  4DBG A;  2D11 A;  1PK1 A;  4KLE A;  2PKE A;  3P63 A;  1C7Y A;  5AI4 A;  1JRP A;  4F50 A;  3MC1 A;  2OM6 A;  1MPE A;  1BPZ A;  4RQ4 A;  4N58 A;  3E2E A;  1Z4O A;  4ECV A;  9ICR A;  3ZGZ A;  2FCN A;  3RRH A;  4DL4 A;  3L17 A;  3QUB A;  5E79 U;  1H8C A;  5IIJ A;  4DDI D;  2NRZ A;  2ASQ A;  2PXI A;  1E6E B;  1WR6 E;  3AE1 B;  2W7O A;  4LNI A;  2RLT A;  3VR9 B;  1C78 A;  3RBD A;  5BMG A;  2JXX A;  2INC C;  4DL6 A;  2D3C A;  4J9Q A;  4GN1 A;  3PRM B;  1G6J A;  4F91 B;  1WGK A;  3GIL A;  3DHH C;  3IP4 B;  1JXE A;  2QC8 A;  4EOY A;  2BB5 A;  3RTV A;  1SZP A;  3KH0 A;  4DHZ B;  1KLU D;  2FUH B;  1U4B A;  3PY8 A;  1UD7 A;  2R8G A;  1FFU A;  7ICH A;  4WJO A;  4CF3 A;  5H92 C;  2GOL A;  4MF2 A;  2BQQ A;  1KQQ A;  1ZQP A;  4LJX A;  1ZQC A;  4KGT A;  5J2K A;  2DL0 A;  5KFC A;  2MWS B;  5G2N A;  1D8B A;  1YNT E;  3OSN A;  5L1I A;  2HHT A;  2L83 A;  4XE0 A;  3U4E G;  1YZ7 A;  5ALD A;  2KVZ A;  2E8P A;  9ICI A;  2G07 A;  3ABV B;  3MTN B;  3M63 B;  1FO4 A;  4YTN B;  2XBB C;  2AL6 A;  4YL8 A;  4ED2 A;  1H38 A;  3H1U A;  4HJG E;  2QB0 A;  2FDR A;  3RPF C;  5ALH A;  4PHE A;  4C0Z A;  3GZN B;  4B9U A;  4C8L A;  1YJ1 A;  4BAX A;  2L5Y A;  3U26 A;  1WYG A;  2KV2 A;  3B2F A;  1IV8 A;  3CSF A;  1SL1 A;  2HOF A;  5FR6 A;  2YEP F;  3CMM B;  3J9C A;  3V72 A;  1X2I A;  2KHQ A;  4I2E A;  2WYQ A;  4UAU A;  2HBL A;  2ZIX B;  3EPG A;  3Q8Q B;  2ZXH A;  2KDE B;  3PT2 B;  1ROE A;  2DZI A;  2DZK A;  3ZQ4 A;  4J9K A;  2J52 A;  4QIW C;  2W54 A;  2CU1 A;  4KX3 A;  4B0E A;  4YG2 A;  5CWR A;  2VAN A;  5ALR A;  2B3A A;  4DF4 A;  3PRE A;  2K39 A;  4PPX A;  3HM6 X;  5D94 A;  4JX1 C;  2KMD A;  3I1Y A;  1E7U A;  4KSL C;  3H8S A;  2N9P C;  1NK5 A;  4W9I A;  2DPI A;  1L7O A;  2RP5 A;  3FAH A;  4QZG A;  3ZDA A;  1ECW A;  2HCF A;  4IQV A;  4ZRJ A;  4BX9 C;  1WGY A;  9ICF A;  1IUE A;  2YML A;  7ICM A;  1TTN A;  4RZR A;  5DQH A;  3RB0 A;  5G5G A;  1R7S A;  1Q1O A;  2N9X A;  2HOQ A;  4FA6 A;  4F72 A;  1MHX A;  5DPW A;  4YSZ B;  3ML8 A;  1PK3 A;  4HDQ A;  4C4R A;  1V97 A;  2B21 A;  4DL3 A;  3AEG B;  5D4B A;  1Z00 A;  4MGY E;  2F8L A;  3AE7 B;  2V4Q A;  3VH4 B;  4JMU A;  5AKH A;  4WUR A;  5AKZ A;  2IND C;  1SV0 C;  5KFD A;  5DBA A;  1KW4 A;  5EWG A;  3NAS A;  3UPQ A;  1RM6 C;  1L8L A;  1NK6 A;  1FCC C;  5KFR A;  4J3O D;  3RH6 A;  4O3R A;  1QOB A;  3PMN A;  4Q8F A;  3EZ5 A;  1YD8 U;  3HPO A;  5DLG A;  3AU4 A;  1L0V B;  4XDC A;  2EAM A;  3B08 A;  1X66 A;  2VA3 A;  4F4W A;  4ITK A;  1GB4 A;  1AAR A;  4IM3 A;  4WH4 A;  2ZXI A;  1SL0 A;  3GB1 A;  3PZ8 A;  2CJN A;  4LJO B;  1GPX A;  1KKX A;  4C4V B;  3JYU A;  3KKA A;  1KH0 A;  3L54 A;  2IMW P;  3PZD A;  1ZD5 A;  3HVZ A;  2IBI B;  2I5H A;  3V7L A;  3F2C A;  4IW0 A;  4K3B A;  3IAM 1;  1YOV B;  4JGH B;  3VUX A;  2RQ5 A;  2VZK B;  1BUI C;  5KG0 A;  2LZ6 A;  1HIW A;  4C80 A;  2O2V A;  4NL9 C;  8ICE A;  1T6B X;  3P2B A;  4JIO U;  1C9F A;  1E0Z A;  3H6N A;  2BCU A;  4BFR A;  2E1E A;  1WX8 A;  5DQI A;  1WJ6 A;  2QCZ A;  4KGS A;  5CHF A;  4M9H A;  3LXF A;  4YXM A;  2Q0Z X;  1PGA A;  5BYR A;  1ACC A;  1ZXI A;  3K1R B;  2B6G A;  5J8Y A;  4K4G A;  2NBV B;  4LLG M;  1VZ8 A;  2Z0D B;  4F1S A;  3TMP B;  4KLL A;  1UCV A;  1K5O A;  2WB1 F;  4I2B A;  3ZKJ C;  1IGD A;  1X40 A;  3EUB 2;  3RB6 A;  3Q8F A;  3V05 A;  3NG0 A;  2ZIW B;  2CR5 A;  2D3D A;  3OSP A;  9ICM A;  5IIO A;  3H9D A;  3Q8A A;  4N59 A;  2WHE A;  3MR6 A;  1SE3 A;  5KHO A;  3RI7 C;  3ISD A;  4RM9 A;  2KFK A;  5AM4 A;  2Z8L A;  3W1S C;  4CHK A;  7ICL A;  1OQY A;  5CJ7 A;  1MJD A;  3QU2 A;  1U48 A;  2XK5 A;  5KFN A;  4RQ2 A;  2IO2 B;  2ZJD A;  3QJZ A;  2ZTD A;  1MSW D;  2KTR A;  5KFG A;  3ZO5 B;  4GXB A;  3BK2 A;  2HBJ A;  2HHX A;  2KN4 A;  3MC0 B;  1XXG A;  5J0W A;  5KFJ A;  5AM2 A;  5HR6 A;  3RR8 A;  1HA5 A;  1IIP A;  5DCN A;  3KZX A;  3ECI A;  1HUO A;  4P0Q B;  2M9N A;  3APD A;  2EKE C;  3D32 A;  1E7P B;  4UBB A;  2XGP A;  1YMH E;  2KG5 A;  4C7Y A;  3HIL A;  5IP4 D;  2UYZ B;  4KLT A;  1RG6 A;  1NZB A;  2WDR B;  2F3N A;  3V6H A;  2PLP A;  3R3M A;  1EU3 A;  4OD0 A;  2JZB A;  4ED1 A;  4MJS B;  3C8Y A;  3KYD D;  2O6V D;  2YB1 A;  1DOI A;  4C7Z A;  2BTE A;  2C2R A;  1BPD A;  4BOZ B;  3L16 A;  4RF1 A;  5J29 A;  4HVB A;  4OVV A;  1L4Z B;  2Y0S C;  2DBY A;  2OCE A;  3PSE B;  4M9J A;  2PMZ C;  9ICP A;  2TSS A;  3C1Z A;  2VA2 A;  2DZM A;  4R8U A;  3M9N B;  1N48 A;  1K8R B;  3C1Y A;  3VH3 B;  3ZRF A;  2JH1 A;  5IIM A;  1NJZ A;  4KLF A;  2YEP B;  2W11 A;  4EYH B;  2X38 A;  4FLH A;  3SV3 A;  2W9C B;  3WAM A;  2KC2 A;  1F77 A;  2WXP A;  4K1R B;  2RPV A;  2AQ0 A;  4II3 B;  1WXS A;  1JWM D;  4ECS A;  2LVP A;  5ALN A;  4YP3 A;  3M3J A;  3OLM D;  4ELU A;  4FS2 A;  1WMH A;  3LVV A;  2AQ3 B;  2WGS A;  3ORY A;  3F2B A;  5EWE A;  3S2A A;  9ICK A;  3GU3 A;  2BKF A;  2FJ6 A;  4JV2 A;  4EEN A;  2EEL A;  3RR7 A;  4HJK A;  1DK2 A;  3SYZ A;  4GOC A;  1ZQV A;  2OJR A;  1YX6 B;  4CRX A;  3SD5 A;  3A1Q A;  2AHO B;  2LPE A;  2DNF A;  3K1Z A;  4LK0 M;  8ICW A;  4O3N A;  4XYC A;  5LNK 1;  1S10 A;  3Q8B A;  2XIC A;  4QZD A;  1UPH A;  3EPI A;  4UAR A;  4EUT A;  2VA8 A;  4PGY A;  2VJ4 A;  3RF9 A;  2LHE A;  2GH1 A;  2FE8 A;  2BR0 A;  5F9L A;  4XDD A;  1L3S A;  2XVT A;  4PZN A;  2LWP A;  1LFD A;  4Y2S A;  3JSV A;  1NZP A;  2FIF A;  2WTF A;  4DL5 A;  4DFK A;  2GLS A;  2HDE A;  4IM2 A;  3OHA A;  3Q69 A;  1HZ5 A;  3VTV A;  1Q10 A;  4HCN B;  2Z7J A;  3ZDE A;  1B22 A;  2KQ7 A;  5AM1 A;  4JPS A;  5DLF A;  3H7P A;  1NKC A;  1V1O A;  4US8 A;  3PW2 A;  1QCK A;  1YT3 A;  1PVQ A;  1FPY A;  2O6V A;  4AJW A;  2YTU A;  2A1J B;  4F71 A;  1L5U A;  3GIM A;  2V9W A;  4FBT A;  4USA A;  4BVU C;  2KJ6 A;  1T0Q C;  3D6J A;  2OWO A;  1U45 A;  2KMC A;  2VJ5 A;  2HI0 A;  3H0R B;  3DWG C;  2NTT A;  4MSQ B;  1JWS D;  3ZJU A;  2ESE A;  2M0N A;  3I3T B;  3KUZ A;  3QNM A;  1UZX B;  4URK A;  3JPP A;  2K4I A;  4M2Y A;  3UQA A;  3KFU F;  3QA8 A;  4M8N A;  4RQ8 A;  4YQW A;  3BWU D;  2QHO A;  3IV6 A;  1BML C;  4KKI A;  4DO9 A;  2REX A;  2ICI A;  3BIN A;  3TEY A;  5FKA C;  4PGX A;  3BK1 A;  1MG8 A;  4IKG A;  3PRZ A;  3RZF A;  1NK7 A;  2UVV A;  2HHQ A;  3UF8 A;  2NRT A;  2UU7 A;  1ZRM A;  1SJE D;  3VRB B;  3H4D A;  1WJU A;  1TFR A;  2LI6 A;  3LVW A;  1SBB B;  2IOH A;  4IG7 B;  4UQG A;  1ZQT A;  1TAM A;  1L0Y B;  1YIW A;  4A20 A;  1NEN B;  5AM0 A;  4AS1 A;  1QSL A;  4FJY A;  2MA9 B;  1JN3 A;  1XO1 A;  4P2H A;  1WI0 A;  1LO5 D;  4IDI A;  1P3Q U;  3MGV A;  3TL5 A;  1X9S A;  2H3V A;  2WNM A;  3PLU A;  4O9M A;  5HMM A;  2CS4 A;  4RQ1 A;  4NJ7 A;  4RCO A;  2WAQ C;  4M01 A;  3GV8 B;  3I57 A;  4M0W A;  1T0R C;  3B0X A;  3C28 A;  1I4X A;  1SXD A;  3NVW A;  2H3I A;  2D10 A;  2RDB C;  3GIJ A;  4BGD A;  3BQ0 A;  4O5C A;  1EWC A;  3C19 A;  4YSX B;  1P0R A;  3PV1 A;  2JZP A;  2MJD A;  2KD0 A;  2RPQ A;  3FIL A;  5AI0 A;  1N62 A;  2RDI A;  1FNV A;  2EMT A;  2V4R A;  2ASJ A;  1STE A;  3KVF B;  2JHD A;  5MPO A;  1PUZ A;  3SAF A;  5KT6 A;  5CP2 A;  1C4P A;  2WU5 B;  3PHX B;  3BVZ A;  4R63 A;  4Y2T A;  4UB6 U;  2M19 A;  2O6K A;  3TKA A;  4EBC A;  1QQ5 A;  3HKZ F;  3T5K A;  3E56 A;  9ICO A;  1NJW A;  2ODG A;  4MAC A;  2K8C B;  4Z6D A;  2R8J A;  4R65 A;  4MFC A;  5HHD G;  2K60 A;  3OTQ A;  1ET6 A;  1XQQ A;  4GFJ A;  2NBW B;  3AE6 B;  1K1Q A;  4F4Z A;  1IYF A;  3QX1 A;  4DXF A;  3VTW A;  3KBB A;  3MFI A;  4DS4 A;  5BPC A;  4M6W A;  2CJO A;  1TT5 B;  1ZW7 A;  1WUD A;  5DDM A;  4RUC A;  4RQ3 A;  5J0R A;  1KTK A;  3GII A;  1NK8 A;  1YN5 A;  2KK0 A;  2C60 A;  2AEH A;  3OPX A;  1ENF A;  4ELT A;  1WGH A;  5C1Z A;  5HML A;  5D46 A;  4GXI A;  3H0L B;  1R4M I;  3KD3 A;  2J4X A;  4F5P A;  3PW7 A;  2K4P A;  4ECR A;  3MDC A;  5AI5 A;  5DB7 A;  5CHW A;  1LKY B;  5KFO A;  1TE2 A;  5D7G A;  3BDP A;  3UMG A;  1SGH A;  1Q0W B;  4M04 A;  3RN9 C;  4UDU C;  3SHQ A;  2LD9 A;  1YJI A;  5IOI A;  3C21 A;  5TIS U;  2KDM A;  3AMZ A;  2KQS A;  2M1M A;  4QZ8 A;  1E8Z A;  2WXG A;  5ALI A;  4GLX A;  1RYS A;  4I2G A;  4KTQ A;  2D3G A;  4YT0 B;  2CRX A;  3Q8M A;  4MT5 A;  3A0B U;  1YN4 A;  4OZB A;  2NMQ A;  4JV1 A;  5L1J A;  4O3S A;  5KFA A;  3ICX A;  4NM2 A;  4ZYS A;  2AGP A;  2YMP A;  1ESF A;  4NNJ B;  4FZN A;  4O3M A;  3TAN A;  3Q8R B;  2KWC A;  3NTU A;  3ISB A;  4QWA A;  2ZIU A;  1TKY A;  2XEW A;  4P1C C;  2JUO A;  2A5U A;  3J81 j;  2M8S A;  5C23 A;  5J2G A;  1ZQ1 C;  3B9J A;  1FXT B;  1GAQ B;  1WY8 A;  4Y2P A;  1ZD3 A;  3AU6 A;  3UGB B;  2ON8 A;  3KHR A;  1L7P A;  2CHW A;  2LYH A;  3BS5 B;  1EO6 A;  2LHD A;  2NPT A;  2FMP A;  3ZDM C;  2DLB A;  4OCZ A;  5AKY A;  1QQ7 A;  2QSD A;  5AKK A;  1IBX A;  5KFQ A;  2HD5 B;  1UA0 A;  4KLO A;  3QU4 A;  3LDA A;  4TKN A;  2W43 A;  3MGH A;  1HQR D;  2GBR A;  4WWP A;  2HMX A;  1WXA A;  4P16 A;  4KIT B;  4LCD E;  4PK1 A;  1ZQE A;  2JZZ A;  5G55 A;  3T3N A;  4NLC A;  1NBF C;  2LRU A;  3H8H A;  2KD1 A;  3WK5 A;  3MHS D;  3DBH I;  2BKE A;  4RT2 A;  2L7R A;  5GXG B;  3AE5 B;  4C8K A;  3M8R A;  3CYM A;  1F0M A;  1MC8 A;  2HJ1 A;  4QNL A;  2AYO B;  5EE1 A;  2KSO A;  4NL9 A;  3QWZ B;  4KZC A;  3DPD A;  4DHJ B;  3C5F A;  9ICG A;  1C77 A;  2F2A B;  1WXQ A;  1SKR A;  4NV0 A;  2JRZ A;  2N9K A;  1I4R A;  2I1K A;  4FJZ A;  4KN7 A;  1J7A A;  2G9H D;  1UT5 A;  1KSP A;  1F1H A;  3IXS A;  5B5E U;  4XQ8 A;  2XID A;  2G45 B;  3TFR A;  2ACZ B;  3EA6 A;  1Q3U A;  1QZE A;  1C4A A;  2L32 A;  3N1X C;  2V9H A;  3N28 A;  1ZQZ A;  3RNE C;  4U7C A;  3SAG A;  3K4G A;  4BUG A;  5KT4 A;  1QIL A;  3EWA A;  2JMG A;  3LK9 A;  1Q5W B;  4EZL A;  1CJE A;  3OJ4 B;  1E7V A;  7ICG A;  2H3F A;  8ICH A;  2RMM A;  1NK4 A;  3L08 A;  1GNU A;  4I27 A;  1NYR A;  4OHJ A;  1FD6 A;  1JUD A;  3LDZ E;  2RSU A;  1VCB A;  4AP4 C;  4RU9 A;  3L3F X;  2RRD A;  3PNC A;  3UIN B;  3I5J C;  1V1P A;  2BYV E;  2FPK A;  4M47 A;  2LUE A;  3NS8 A;  4KX6 B;  4KLH A;  2GRI A;  2PVG C;  2AXT U;  3LB8 C;  2IOF K;  9ICX A;  3IRU A;  3KHL A;  2PE6 B;  2JEF A;  2ZW0 A;  4ANW A;  4XGA B;  1UA1 A;  1UBQ A;  4Q44 A;  5IKC M;  4FAD A;  3HW8 A;  2ZNV B;  5BOL A;  1XWL A;  3V7J A;  2MJE A;  1NNL A;  4WQO B;  1JMS A;  1ZQU A;  1S8O A;  3RNC C;  5CHG A;  3KWL A;  5AK6 A;  1SSN A;  4F5O A;  2HTM E;  2L0T A;  4KMO B;  4XRH A;  4MEX A;  2NRW A;  5III A;  1O03 A;  4NQL B;  3LJ3 A;  5DB6 A;  4UAZ A;  4XUS A;  4ZOH C;  2KX3 A;  1UGM A;  2P6R A;  1QOF A;  1BPX A;  1XF5 L;  3PO5 A;  4YMM A;  3DVN V;  3M6Z A;  2HHU A;  5AI6 A;  4IRC A;  4PH5 A;  3HP6 A;  2WXR A;  3HHM A;  2W9B B;  3N3K B;  5J2D A;  3IT4 B;  1ZE3 D;  4RQ0 A;  3ALB A;  2GBN A;  1TVA A;  2V3N A;  2AX5 A;  3PVX A;  3V62 A;  4CYE A;  4HRS A;  4DLE A;  3RB4 A;  1S76 D;  1WXM A;  4MEM A;  2Y3A A;  4O3O A;  2BQ3 A;  1FNU A;  2N1R A;  2I38 A;  3EC8 A;  3QAR A;  3UMC A;  5KFK A;  3GFK B;  3R7R A;  4DQO C;  3IG5 A;  3GIK A;  4JUZ A;  1FNW A;  3PS6 A;  2LEK A;  2PTL A;  1UH6 A;  4Q8E A;  1J97 A;  4C56 C;  2HHW A;  1MQ3 A;  3GZN I;  2M0A A;  3NZ3 A;  1A6S A;  1VZ6 A;  3PLV A;  4BKT A;  2AWT A;  2B76 B;  3M7D A;  2BYF A;  3FYH A;  3MC9 A;  2E1F A;  1VD2 A;  4WAA A;  4ZDV A;  3W9C B;  3RH4 A;  2ISO A;  1Q46 A;  1OTR B;  1WE7 A;  3V7K A;  2KLG A;  4E0D A;  7ICS A;  4RNO A;  1V38 A;  5JUM A;  3PR5 B;  4RGO S;  4G3X B;  3WKB A;  5J2R A;  5KFF A;  3RAQ A;  4KLQ A;  2HW3 A;  2K3U A;  1WRI A;  7ICF A;  2IA6 A;  1FFV A;  4ED8 A;  2PEA A;  1IG6 A;  3GOE A;  3APF A;  3GV5 B;  1S0N A;  4Y2U A;  1WGD A;  2KTF A;  4N6E B;  1ZQM A;  4DHZ E;  2GI9 A;  2C22 A;  4IWO A;  4OVU A;  2DHZ A;  1SWV A;  3PZP A;  2CHX A;  4ZRP A;  2N7D A;  3WK4 A;  3DEE A;  4DL7 A;  2ZG6 A;  1T7P A;  3EYZ A;  1ZQB A;  3OJU A;  4NLG A;  5AKJ A;  1CMX B;  3D2S A;  3NY5 A;  1JX4 A;  2DEN B;  1SJH D;  1UUP A;  3VAW A;  4M9N A;  3NVZ A;  3SR6 A;  2OHF A;  5BYS A;  3SFE B;  5LXH A;  1TZ1 A;  2WU2 B;  2UVW A;  4I29 A;  2MBH A;  4WWN A;  5IO9 A;  1Q8K A;  2PFQ A;  2KZM A;  1F44 A;  1V9J A;  8ICZ A;  4NPN A;  2XI9 A;  4B9V A;  2ZTC A;  4IQU A;  4C00 A;  3AEB B;  1YQ4 B;  5BOM A;  4Q43 A;  1P9D U;  3NUQ A;  3IBE A;  4CE6 A;  4W9K A;  1QQR A;  2J6U A;  4RQ7 A;  3RRG A;  1CK1 A;  2FLP A;  1KFY B;  3Q6B A;  1MHH E;  2G09 A;  3H7I A;  3RUL A;  4GC6 A;  2WF8 A;  4F5N A;  1I7H A;  2ASD A;  3KW5 B;  4EX6 A;  2KFN A;  5AK5 A;  2AQ4 A;  2ZJ5 A;  1D9D A;  2LGD A;  3PST A;  4F8R A;  3ZUN A;  4DSI A;  2BW2 A;  3AE3 B;  2N9E B;  3PTF C;  2JPH A;  2MJ3 A;  1BPE A;  2WDT B;  2AL3 A;  2GOW A;  1EM7 A;  3AE2 B;  1ZJM A;  5KFL A;  3MGI A;  3P4Q B;  1ZP0 B;  4TQ0 A;  5EE9 A;  9ICE A;  1ZYQ A;  4CGZ A;  3WKD A;  3FC4 A;  2FPL A;  3ZJT A;  2MRP A;  3RFZ B;  9ICA A;  3V6K A;  1YZ6 A;  1AYF A;  3RNF C;  8ICT A;  4Z6E A;  3EGR A;  5KFX A;  3CF6 E;  1PK1 B;  3ML9 A;  3RB3 A;  1RLF A;  1J2M A;  2KOB A;  3MR5 A;  2PPH A;  3IFW B;  4NJC A;  4Y2J A;  5EE0 A;  1E5W A;  2PMV A;  3KYC D;  2BB6 A;  4BBN C;  4RNM A;  5BO4 B;  5L83 A;  4ARI A;  4ED3 A;  2MRL A;  1JRO A;  2EQY A;  4QZF A;  4C4T A;  4PYU A;  1UWM A;  2ZTE A;  3NUH B;  2G3Q B;  2JSV X;  2WHI A;  4UB4 A;  2MA1 A;  3SU8 X;  4YCX A;  1ZET A;  2F77 X;  9ICQ A;  3NGD A;  2F1I A;  2KLC A;  4HKZ E;  3RNB C;  5CHV C;  4YFK A;  1ZKH A;  5J2H A;  3PSF A;  2ZIV A;  1QLN A;  3R66 C;  4M8M A;  3H8M A;  2V3P A;  1KFD A;  1FEZ A;  2LFI A;  4PJ0 U;  4ED0 A;  2K8H A;  4DDG D;  4C4S A;  1J7B A;  3BQ2 A;  2LJI A;  3Q14 C;  4F8C B;  3NS1 A;  1SKS A;  2ZJA A;  4LZG A;  1ZQH A;  4I6P A;  9ICL A;  5JRT A;  2SEB D;  2WXQ A;  3O0F A;  2K25 A;  2NR2 A;  2PKO A;  3OG5 A;  1ZDX A;  4K7W A;  2ALZ A;  1BNO A;  4YXJ A;  1ISN A;  2YX8 A;  2KVR A;  2QB0 B;  3AH7 A;  3N7R C;  1L8O A;  1C76 A;  4QWD A;  1L3U A;  5E6J A;  4Q2J A;  8ICU A;  1V81 A;  3RJH A;  1T5X D;  1E90 A;  1TAQ A;  7ICK A;  2FLN A;  4AP9 A;  1ZQG A;  4P0Q A;  2UWQ A;  1V9P A;  3HJE A;  4MFA A;  2WXO A;  4US9 A;  3PSI A;  1ET9 A;  4L23 A;  3ZJV A;  5C0Y A;  1V2Y A;  3BII D;  2Y5P A;  5H2F U;  4ELV A;  2MUT B;  3DV9 A;  1YQB A;  4O0I A;  1QTM A;  1WFY A;  1GO3 F;  5JXV A;  2ZNV C;  4ZYN A;  5ALE A;  5AUI A;  4CNQ A;  4IC9 A;  4UAW A;  4PZO A;  3ZVV A;  5FK9 C;  8ICP A;  4J9M A;  2WLB A;  3T3F A;  1BPB A;  1TJE A;  1WIA A;  2LI5 A;  2GBK A;  3T8M A;  1L0X B;  2DFL A;  4LVS A;  1PVR A;  4OJL A;  4IWQ A;  4DQS A;  2H3Z A;  2LVQ A;  2KJR A;  3PPA A;  3QU9 A;  4GC7 A;  3UXP A;  4DOB A;  3NRW A;  4UAS A;  2MU2 A;  4LZD A;  1GUA B;  2MBO A;  1A76 A;  1AQ6 A;  1K1S A;  2IO0 B;  3TCA A;  4RPZ A;  2ES6 A;  4DSE A;  3VCB A;  3UQ2 A;  2MP2 A;  2W9C A;  3URY A;  3NJT A;  2WWZ A;  5D49 A;  2KC1 A;  5KFB A;  5DB9 A;  4DS5 A;  2PJH A;  3V6E B;  1Z00 B;  1WWU A;  4UAV A;  5GMV A;  3N4M B;  3OHB A;  1KLG D;  1EXN A;  2LHT A;  4LNF A;  3B1L X;  4EEW A;  1D5Z C;  2Z0E B;  3QEA Z;  1N2X A;  2F44 A;  4NLZ A;  2IHM A;  2BYE A;  2DGZ A;  1C1Y B;  1HTQ A;  3PRP B;  2IYD B;  4F5Q A;  2HJ8 A;  2GBM A;  3HVD A;  2NTS A;  4TQR A;  3C0R B;  4DOC A;  2NRV A;  3VDZ A;  4A8E A;  3G6Y A;  3RJG A;  1KFS A;  4OJ6 A;  2K9X A;  2LRW A;  3UQB A;  2K8B A;  4J03 A;  3VTU A;  5C5J A;  4KZ0 A;  2HBM A;  1FXA A;  4ZRK A;  5KFY A;  2A19 A;  1S97 A;  4FZL A;  3BVG A;  5DDY A;  3RCZ A;  4HLE A;  4ANV A;  3TAD A;  1V85 A;  1S0V A;  3ALR A;  5DKW A;  4I2H A;  2JV3 A;  3UMB A;  1WCL A;  1RYJ A;  2QJL A;  2D5G A;  3D2N A;  1NI3 A;  5ALY A;  1RYU A;  1TY0 A;  1WX7 A;  1VZ7 A;  2FNJ B;  3V6J A;  2KIC A;  5J2J A;  1A70 A;  4MF8 A;  2JEJ A;  4MM3 B;  3UXN A;  3ZNI D;  3CW2 C;  2LUM A;  2QAR A;  4A90 A;  4FBU A;  4HAI A;  1WCN A;  2VIX A;  9ICW A;  4GMV A;  4NZL B;  1CZP A;  3V6C B;  2AJQ A;  1LGR A;  4BKS A;  4ZH4 A;  5DQG A;  2D3B A;  4AYB C;  4D2K A;  2C7H A;  1RAX A;  3U7Z A;  1L6N A;  3LWL A;  4DQI A;  4I2I A;  5JU5 A;  1SEB D;  1DYQ A;  1FM0 D;  3H8J A;  1ZOL A;  3B0A A;  5KG6 A;  3RJJ A;  4A3P A;  1OUQ A;  3ZW3 A;  3CNH A;  2ZPY A;  4BWJ A;  2OED A;  5KFV A;  1LVH A;  4RNA A;  1MI0 A;  9ICT A;  4P0P A;  2PIA A;  4ECT A;  4JWU C;  9ICH A;  2W04 A;  2HSZ A;  5JZE B;  3TAQ A;  1N60 A;  7ICT A;  2W9M A;  2MH7 A;  2K6D B;  5C2T B;  4ECY A;  4KLS A;  2W03 A;  2HTH A;  4ED7 A;  1D5M C;  2KFK B;  3NVV A;  1EU4 A;  1OQQ A;  1C3T A;  2KYW A;  4FE3 A;  3GS2 A;  5AZH A;  3BJY A;  1E8Y A;  1DOY A;  2XK5 B;  4WAF A;  1XLQ A;  4A3O A;  1IP9 A;  4NLB A;  2KTR B;  3L10 B;  5KG3 A;  1FEH A;  1NVI D;  3IDW A;  2DF4 B;  3C2L A;  2DAF A;  3Q3O C;  5AZF A;  3Q8K A;  1GJZ A;  9ICJ A;  1BVS A;  4M0A A;  1UNS A;  5AKL A;  2IGD A;  2RDH A;  4B9T A;  3Q3J A;  3ZDT A;  1KJT A;  2QKQ A;  1PYW D;  4TUS A;  2J6S A;  5AKX A;  2MSN A;  4YN4 A;  1F5S A;  2AGO A;  2YMQ A;  2PE9 A;  3M9O B;  2ISP A;  2C7M B;  3ZNZ B;  1XT9 B;  8ICM A;  1T0Y A;  5AIB A;  3Q8P B;  2KHW B;  2KNB A;  4RGM A;  4RGN A;  2NO5 A;  2R8H A;  1E10 A;  3Q8S B;  1RFA A;  1DOX A;  1CI4 A;  1JXL A;  1TKG A;  3WAP A;  3VRA B;  2JZB B;  2HVH A;  3PGE A;  2BWF A;  1JAL A;  3U52 E;  4OJP A;  4R66 A;  4FFD A;  4Y2R A;  5BYQ A;  2W8L A;  3T9L A;  3DWM A;  1I4G A;  3MFH A;  3AQE A;  1MQ2 A;  2L1A A;  2L00 B;  1Z1V A;  4R8U B;  1V86 A;  2CXY A;  2DAJ A;  1PQS A;  2BCR A;  1J19 A;  2Y1J A;  1XEE A;  4QZI A;  1GOZ A;  3WKC A;  2JYT A;  4JQW C;  4GGQ A;  2EAP A;  3QU7 A;  1OFF A;  2Y5B B;  5ALZ A;  5KT3 A;  2YN4 A;  7ICR A;  2DYB A;  3AEA B;  4XWW A;  1PUT A;  4NY0 A;  3AED B;  3VR8 B;  1QT9 A;  4W9H A;  2JZ3 B;  1A5R A;  3N97 B;  3AEE B;  3TIX A;  3JVZ X;  5KFS A;  3M6K A;  4UAY A;  1PGX A;  4WJP A;  1WMH B;  3M8S A;  1I35 A;  1WZ0 A;  8ICQ A;  1JW9 D;  3QU5 A;  1HZ6 A;  1XSL A;  4C8N A;  2NYV A;  2KJ8 A;  5F3X B;  4J6I A;  1QLB B;  2G1E A;  4O3P A;  2KT7 A;  2BDU A;  4X5V A;  2V3S A;  2UVR A;  1OQR A;  4IQT A;  1ZQI A;  3QCA A;  3QEB Z;  3C2K A;  1HJP A;  4IRK A;  3QE9 Y;  3MJ5 A;  5J0Y A;  4FZM A;  3Q3N C;  2W55 A;  1NI2 A;  4BXO A;  4EX7 A;  2I1J A;  5E6P A;  4ANU A;  1NKE A;  1K53 A;  2LJ5 A;  2KKV A;  3IAS 1;  2DYO A;  3IHQ B;  4QZC A;  2P6U A;  3ZDB A;  3A9J A;  3SD7 A;  3JSV B;  5AK4 A;  4UB3 A;  2BGF A;  1FMA D;  1XO3 A;  3P4R B;  5J0S A;  2HOI A;  2JQR B;  4MH8 A;  3NZS A;  1XSP A;  4IS7 A;  2C2E A;  3H7P B;  1X1M A;  2FI1 A;  3Q3M C;  1XCT L;  4B9L A;  2DX5 B;  2K6Q A;  5KFE A;  3C29 A;  3DBL B;  8ICB A;  3QHT A;  2O6V B;  5I4D A;  4B9S A;  3DBR B;  4DLG A;  4JK1 A;  7ICO A;  3F5E A;  1JIH A;  4TUU A;  1PZN A;  1J0G A;  5DBB A;  3BS5 A;  3AE8 B;  3ZRC A;  1DXS A;  1LM8 B;  2LAS A;  4OW0 A;  2NRX A;  1TK8 A;  3WA0 A;  4YD1 A;  4M9G A;  1LV5 A;  4YR2 A;  4KV2 A;  1XLO A;  1UF0 A;  3C5G A;  1XU4 A;  3Q8L A;  3HX0 A;  4DXG A;  4GDK A;  2M4N A;  1N5W A;  4LNO A;  4B9K A;  4FUL A;  4ED6 A;  1R4N B;  1WH3 A;  3P42 A;  1WRD B;  3BS7 A;  2JU6 X;  4E3C A;  1P98 A;  2KDI A;  5B66 U;  2LXC A;  2KVS A;  2J42 A;  8ICG A;  2WP9 B;  1QF6 A;  2BGW A;  1NK0 A;  3WAO A;  1GB1 A;  2MBQ A;  2KHV A;  1WSP A;  1WYW B;  3HIZ A;  1S3S G;  3M9M B;  5ALF A;  2LMC A;  4JWM A;  4RF0 A;  4DEZ A;  1F2R C;  2IJ0 A;  4EE2 A;  1EUV B;  1HEK A;  1N63 A;  3ZD9 A;  2QB1 A;  4M9L A;  1ZQL A;  2KJH B;  4J9S A;  4NJ8 A;  1TV9 A;  2HE7 A;  5ALQ A;  5E6N A;  5AI8 A;  3MBY A;  1WR1 A;  2ZUB A;  3DDC B;  5D6J B;  5C3J B;  3SMV A;  3MC8 A;  2Q4T A;  1E9M A;  2YB4 A;  1SV0 A;  2J0M A;  4M0W B;  3D2Q A;  3WKA A;  4B0M A;  2AU0 A;  2CN1 A;  4NLN A;  2GWS A;  2H88 B;  1WXV A;  2KEY A;  5ALO A;  2OYY A;  3OJ3 A;  3QQ8 B;  3CP8 A;  5BMI A;  4RQM A;  2A4Z A;  4NAW B;  5DG9 A;  5IIN A;  4NM1 A;  2QEJ C;  1CEZ A;  3DQV A;  1C4C A;  3U8Z A;  5KFW A;  4HKQ A;  2LGX A;  2D6F C;  4J9P A;  4ECQ A;  1ZGU B;  2K1F A;  4LJP B;  2Y0S F;  3MP9 A;  3TUO A;  2PMZ F;  2IBK A;  1Z1B A;  1D6E C;  4WJ3 B;  4ECX A;  1U47 A;  9ICU A;  2OOB B;  3AEF B;  4W9D A;  2EH9 A;  2KIV A;  2D3A A;  3C2M A;  5J8Y C;  3DHG C;  2V4I B;  2A1A A;  3WKE A;  3VUY A;  1PDX A;  1ZQA A;  2G5H B;  4HK2 A;  3AM9 A;  4JE3 B;  3DDH A;  4QZH A;  1YN3 A;  3KHH A;  3PR4 A;  4S0R A;  2NO4 A;  3PW4 A;  2JY6 A;  2MQJ A;  4HPL B;  1L4D B;  2MSE D;  4HWI B;  1WWV A;  4I2A A;  2KWD A;  3N9Y C;  4RNN A;  2BVC A;  4OO1 J;  9ICN A;  1R4M B;  1TIF A;  4EZJ A;  2LGI A;  3TEW A;  4F4X A;  2PI4 A;  2FUG 1;  4GDL A;  3A9K A;  3W5V B;  3WAN A;  3R2I A;  3QAQ A;  4QZE A;  2YLM A;  1ZD4 A;  5KFH A;  3EW9 A;  1RXW A;  2WXK A;  2WXN A;  2XNA C;  4A6Q A;  2Y9T A;  2YVC A;  5KG7 A;  3QK0 A;  5KTQ A;  4FS1 A;  1J7C A;  2KDF B;  3CWI A;  5HFY A;  2QDF A;  4DOA A;  4F2R A;  8ICN A;  4XC2 A;  1FRD A;  2J7Q B;  3AE4 B;  1QQ6 A;  3RNA C;  5AEK B;  3FM9 A;  3PML A;  2C5L C;  5TZV A;  3W1S A;  2E3T A;  4A9A A;  2E8M A;  1WJ4 A;  3H40 A;  2WDV B;  1ZQW A;  4KN4 A;  3PX4 A;  2L76 A;  4FHJ A;  2PFP A;  4WQM A;  5ALT A;  1AW7 A;  3JPS A;  4C8M A;  5TR5 A;  5J0U A;  4W9F A;  1D3Z A;  4ICV A;  3ISC A;  4JV0 A;  4J9L A;  3DVG Y;  1VJ5 A;  1COO A;  2JH7 A;  1TAU A;  4HDO A;  4HYK A;  3RNG C;  2P35 A;  5KG4 A;  1WM2 A;  1HXY D;  3JPN A;  2I9G A;  4M02 A;  4WWO A;  2JR5 A;  3FDS A;  4OZC A;  4ICA A;  2NPT B;  2W3R A;  2XO7 A;  3ZTC A;  4BZA A;  5J2C A;  1ARO P;  2L52 A;  3HM3 A;  4DK5 A;  2M56 B;  1HTO A;  4A55 A;  4RPY A;  5KHQ A;  1E8X A;  1NK9 A;  4I2D A;  3APC A;  3SFD B;  1IBX B;  2KFJ A;  5HNK A;  3VQI A;  4IWP A;  4P4P A;  2YY6 A;  3HT3 A;  2IZV B;  1BGX T;  8ICI A;  1RRB A;  1MN8 A;  3RAX A;  2R61 A;  2V0G A;  4GXK A;  3AUL A;  4PYZ A;  1UEL A;  3KLS X;  4PS3 A;  3RZW C;  3CRX A;  1OW5 A;  5J0Q A;  4UB1 A;  1Z19 A;  2NV3 A;  4BWM A;  4ARC A;  4W9J A;  1DGJ A;  3MR2 A;  1NEK B;  1V8C A;  3EFU A;  3UI3 A;  3M95 A;  2W82 A;  1FXI A;  2NVU I;  3IT6 B;  2Y9U A;  5HP4 A;  3RYT A;  1VDV A;  5KFU A;  1PVP A;  2A3V A;  4LDT D;  4OZA A;  2C2D A;  1WE6 A;  2WB1 C;  3K75 D;  4DFD A;  1TY2 A;  2JVC A;  1KM7 A;  2R2O A;  4QJF B;  4JWS C;  5CB1 A;  2IHN A;  3ONS A;  1SGG A;  2AGQ A;  4DQP A;  4DFP A;  3OAW A;  2H5X A;  2XCP A;  2V1Y A;  3WIM A;  1JQ4 A;  3PZ7 A;  1M94 A;  1I42 A;  4LNK A;  2WAQ F;  5J17 A;  4IOI E;  3F5A A;  3OGU A;  3M1Y A;  4RQN A;  4B9M A;  3L13 A;  3WAL A;  2EZX A;  4QZB A;  3T5H A;  2SAK A;  3W2D A;  1NKB A;  4BJQ A;  2JWZ A;  2KWV B;  5CA7 A;  3L4P A;  1ZUD 2;  4LNN A;  3G6X A;  1OGW A;  3NHE B;  1KEJ A;  4JL9 A;  1JWB D;  1JRU A;  2N1W A;  5AUK A;  2HHS A;  1WJN A; 
#chains in the Genus database with same CATH homology
 1T5X D;  3Q69 A;  1HZ5 A;  1Q10 A;  2IDY A;  4YXD B;  2JWU A;  4JPS A;  4RH6 A;  2WXO A;  4US9 A;  1ET9 A;  2PW9 A;  1L6V A;  1V1O A;  4US8 A;  3P1M A;  4L23 A;  3ZJV A;  3BII D;  2Y5P A;  2IPK D;  1KF6 B;  1V1P B;  2W3S A;  5JXV A;  4USA A;  2KAC A;  3LYY A;  1HEZ E;  5AUI A;  5FK9 C;  2WLB A;  4LTU A;  2GB1 A;  1TJE A;  3DWG C;  3U2S C;  2VZK D;  3HRD D;  2NTT A;  1L0X B;  1JWS D;  3ZJU A;  1AN8 A;  4GDK B;  1TS4 A;  3BWU D;  1BML C;  2MEK A;  3NRZ A;  4KKI A;  2ICI A;  2K5P A;  3GP7 A;  4FXC A;  3TEY A;  5FKA C;  1MVK A;  1TS5 A;  3BK1 A;  2WDQ B;  3URY A;  4IKG A;  1YJJ A;  3ETR A;  1RFK A;  4OVZ A;  2DYM A;  1P7F A;  1QOA A;  1SJE D;  2INP E;  3VRB B;  3E9S A;  2J53 A;  2WXM A;  1SBB B;  1M4V A;  1JWU D;  1KLG D;  1D5Z C;  1L0Y B;  2BYT A;  1NEN B;  2ZW1 A;  4AS1 A;  4WIP A;  4IDI A;  2BBC A;  4A8X C;  1LO5 D;  2WNM A;  3HVD A;  2NTS A;  2JXT A;  2KMM A;  3AE9 B;  3SEB A;  4RCO A;  5EE3 A;  2WQY B;  1BXT A;  2K9X A;  3HUI A;  3I57 A;  4M0W A;  4TSS A;  4YTP B;  1D5X C;  1FXA A;  3T3O A;  5HG2 A;  1I4X A;  3NVW A;  1PFD A;  3BVG A;  1B1Z A;  1EWC A;  4YSX B;  3TEZ A;  2JZP A;  2MJD A;  1XLN A;  3FIL A;  1RYJ A;  1N62 A;  1FNV A;  2QJL A;  1I4H A;  2D5G A;  1STE A;  1NI3 A;  1K51 A;  3W5U B;  1TY0 A;  5MPO A;  2ONQ A;  1VZ7 A;  4R3D A;  3PO0 A;  3AB5 A;  1C4P A;  4TQ1 A;  1A70 A;  2WU5 B;  2INN E;  3ZYY X;  1F0Z A;  3BVZ A;  4MM3 B;  2M19 A;  2LUM A;  4YWG G;  4A90 A;  2BS4 B;  1T3Q A;  2K22 A;  3E56 A;  4MAC A;  4NZL B;  5HHD G;  1TYG B;  1ET6 A;  1CZP A;  3AE6 B;  3I9V 1;  4DXF A;  4WWM A;  2Y5C A;  2PVO D;  1ZOY B;  4D2K A;  2CJO A;  3U7Z A;  5D3D A;  1KTK A;  1YN5 A;  1TKE A;  1ENF A;  1JCK B;  1SEB D;  1DYQ A;  1FM0 D;  1P7E A;  4ZRQ A;  1ZDV A;  2JYE A;  1VRA B;  2AQ1 B;  2J4X A;  4P6V F;  4PT5 A;  2OED A;  4KGR A;  4RNA A;  1MI0 A;  2KQ4 X;  2PIA A;  3BYT B;  4JWU C;  5D7G A;  3BVM A;  2WS3 B;  4GDL B;  2IGG A;  4UDU C;  1N60 A;  2MH7 A;  5C2T B;  1YJI A;  2EKI A;  2IGH A;  2KDM A;  3AMZ A;  1D5M C;  2JX5 A;  3NVV A;  1EU4 A;  1OQQ A;  2WXG A;  4XWT A;  3GS2 A;  1DOY A;  4WAF A;  1XLQ A;  4YT0 B;  3TSS A;  2I2Y A;  1F2R I;  3BYY B;  4MT5 A;  1YN4 A;  4OZB A;  2NMQ A;  1FEH A;  1NVI D;  4L1B A;  1IGC A;  4HRO A;  4ZYS A;  1ESF A;  2KAJ A;  3P4P B;  1C79 A;  1I4P A;  1UNS A;  1ZXH A;  1TS3 A;  1TZO A;  2IGD A;  2AQ2 B;  2RDH A;  1PYW D;  2K0P A;  5D3I B;  1TKY A;  1SB3 C;  1XCQ L;  1UGJ A;  1SE2 A;  4RGM A;  3KQ4 A;  4RGN A;  1E10 A;  3B9J A;  1GAQ B;  1DOX A;  5FR3 A;  2FBW B;  2E6X A;  2ON8 A;  1TKG A;  2LHD A;  5TSS A;  3VRA B;  2QIE B;  2BTE A;  1D4B A;  2N7J A;  1JAL A;  3AEC B;  2DLB A;  1JWA D;  2QSD A;  3U52 E;  1IBX A;  3P63 A;  5BYQ A;  4L2Y A;  1JRP A;  3DWM A;  1MPE A;  1I4G A;  4ZHO A;  1HQR D;  4N58 A;  3ZGZ A;  2L1A A;  4P16 A;  1E6E B;  3AE1 B;  4HEA 1;  1XEE A;  2WXF A;  3T3N A;  1GOZ A;  2JYT A;  3VR9 B;  1C78 A;  3H8H A;  5BMG A;  1OFF A;  4REZ A;  3AEA B;  4XWW A;  1PUT A;  5GXG B;  1WGK A;  1FRR A;  3AE5 B;  3AED B;  3VR8 B;  2BB5 A;  1QT9 A;  3TEX A;  5EE1 A;  1KLU D;  3AEE B;  1PGX A;  1RWS A;  1FFU A;  5H92 C;  1JW9 D;  1C77 A;  5G5H A;  1HZ6 A;  1WXQ A;  1FCL A;  4RGT A;  4KGT A;  1QLB B;  2G1E A;  2N9K A;  1I4R A;  1YNT E;  4ZHP A;  1J7A A;  2G9H D;  1OQR A;  3IXS A;  3KWV A;  2CU3 A;  2ACZ B;  3EA6 A;  2L32 A;  1C4A A;  2L83 A;  4XE0 A;  3U4E G;  2WXL A;  3MJ5 A;  1K52 A;  3ABV B;  1FO4 A;  4YTN B;  2W55 A;  2DWQ A;  4HJG E;  2N0S B;  3RPF C;  1K53 A;  1KRH A;  1QIL A;  3IAS 1;  2DYO A;  1CJE A;  2RMM A;  1FMA D;  1XO3 A;  3P4R B;  1WYG A;  2JQR B;  1NYR A;  2QIL A;  3B2F A;  4MH8 A;  4OHJ A;  1FD6 A;  3B2G A;  2YEP F;  3MFG A;  2WXH A;  3J9C A;  4RFB A;  1XCT L;  3AV8 A;  1V1P A;  5I4D A;  4KX6 B;  1FIQ A;  1ROE A;  2GRI A;  3ZQ4 A;  2PVG C;  3WCQ A;  2J52 A;  3LB8 C;  2W54 A;  3AE8 B;  4B0E A;  4OW0 A;  2ZW0 A;  1XLO A;  3R8B A;  4JX1 C;  4DXG A;  2MJE A;  1N5W A;  3FAH A;  2Q5W D;  3KWL A;  1SSN A;  3P42 A;  2JU6 X;  2HTM E;  1IUE A;  1R7S A;  5G5G A;  4ZOH C;  2J42 A;  2WP9 B;  1QF6 A;  1MHX A;  1QOF A;  1XF5 L;  4YSZ B;  1GB1 A;  1WSP A;  5HI1 A;  1V97 A;  3AEG B;  4O1N A;  2LMC A;  2WXR A;  4RF0 A;  3AE7 B;  1F2R C;  2IJ0 A;  4EE2 A;  3R2T A;  1YQ3 B;  3IT4 B;  1ZE3 D;  4NAM A;  1N63 A;  4WUR A;  2V3N A;  2AX5 A;  1SF0 A;  4HRS A;  1N61 A;  1RM6 C;  2Y3A A;  1FNU A;  2I38 A;  1FCC C;  1SE4 A;  4J3O D;  5BMH A;  5C3J B;  1QOB A;  4H2A A;  4DQO C;  1E9M A;  1FNW A;  2LEK A;  2PTL A;  1VR9 A;  4B0M A;  4C56 C;  1L0V B;  2RDG A;  4XDC A;  2WXI A;  1K50 A;  2H88 B;  2M0A A;  3NZ3 A;  1VZ6 A;  4ITK A;  5T8I A;  1GB4 A;  4WH4 A;  2B76 B;  3GB1 A;  3PZ8 A;  2CJN A;  2XN9 C;  1GPX A;  1I4Q A;  3W9C B;  4AQ7 A;  5BMI A;  1KH0 A;  1SXT A;  3OWE B;  4NAW B;  5H8Y E;  3HVZ A;  1XLP A;  2QEJ C;  2H89 B;  1C4C A;  4RGO S;  4HKQ A;  4TMA B;  2K3U A;  3IAM 1;  1QOG A;  1WRI A;  1B9R A;  3NVY A;  1FFV A;  3MP9 A;  3TUO A;  1D6E C;  2VZK B;  1BUI C;  3AEF B;  4C80 A;  2N9L A;  1T6B X;  4N6E B;  2GI9 A;  1C9F A;  2V4I B;  1E0Z A;  1PDX A;  4ZRP A;  4KGS A;  3LXF A;  5BYR A;  1PGA A;  1L5P A;  3AM9 A;  4JE3 B;  1ACC A;  1ZXI A;  1YN3 A;  3P4S B;  3AN1 A;  4LLG M;  1SJH D;  1L4D B;  1UUP A;  1VZ8 A;  3NVZ A;  2KWD A;  3N9Y C;  3SR6 A;  3TEW A;  2OHF A;  2LGI A;  5BYS A;  1IGD A;  3EUB 2;  2FUG 1;  3Q8F A;  3V05 A;  3SFE B;  4GLS C;  2WU2 B;  3W5V B;  4N59 A;  3R2I A;  3Q8A A;  1SE3 A;  2WXK A;  2XNA C;  3Q8E A;  2WXN A;  1Y56 A;  2Z8L A;  4A6Q A;  3AEB B;  1VLB A;  1J7C A;  1YQ4 B;  3CWI A;  5HFY A;  1FRD A;  1WWT A;  1QQR A;  3AE4 B;  1CK1 A;  1KFY B;  3BK2 A;  1MHH E;  1NYQ A;  1ZPS A;  2KN4 A;  2E3T A;  2WXJ A;  3MC0 B;  2WDV B;  3W1S A;  4A9A A;  1I7H A;  1XXG A;  3Q8C A;  1HA5 A;  4WQM A;  1AW7 A;  1JML A;  2BW2 A;  3AE3 B;  1N5X A;  1E7P B;  2MJ3 A;  1YMH E;  2BS2 B;  4C7Y A;  1EM7 A;  3AE2 B;  2WDR B;  3P4Q B;  1ZP0 B;  4TQ0 A;  5EE9 A;  2PLP A;  3O13 A;  3V3X A;  1HXY D;  3FC4 A;  3ZJT A;  1EU3 A;  1SIJ A;  4KKJ A;  3RFZ B;  3C8Y A;  4OZC A;  2W3R A;  1AYF A;  1DOI A;  2L52 A;  4C7Z A;  3EGR A;  2M56 B;  1EWY C;  4A55 A;  1TS2 A;  1IBX B;  3SFD B;  4RF1 A;  4NJC A;  3VQI A;  5EE0 A;  1L4Z B;  2DBY A;  2PMV A;  1QKZ A;  2BS3 B;  2TSS A;  2BB6 A;  4ARI A;  2R61 A;  2V0G A;  1L6U A;  1JRO A;  2YEP B;  3KLS X;  2X38 A;  1UWM A;  4YSY B;  3MHZ A;  1UWX A;  1F77 A;  4ARC A;  1PGB A;  2WXP A;  3NUH B;  1DGJ A;  2RPV A;  2JSV X;  3CIR B;  1NEK B;  1V8C A;  3UI3 A;  1JWM D;  1FXI A;  2W82 A;  3IT6 B;  4HKZ E;  2AQ3 B;  1VDV A;  2BT6 A;  4OZA A;  2QMT A;  4YTM B;  1TY2 A;  4JWS C;  2EEL A;  2V3P A;  2LFI A;  1J7B A;  2LJI A;  1JQ4 A;  3NS1 A;  3PZ7 A;  4LK0 M;  1CQV A;  5LNK 1;  3Q8B A;  2SEB D;  4IOI E;  2WXQ A;  3BZD B;  2PKO A;  1ZDX A;  2SAK A;  3W2D A;  2LHE A;  2FE8 A;  1AWD A;  4XDD A;  3L4P A;  1ZUD 2;  4CQN A;  3AH7 A;  1C76 A;  3FIL B;  5E6J A;  1JWB D;  1VJK A;  4Q2J A;  5AUK A;  2HDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...