3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
1J7AA 3B2FA 1L6VA 2JQRB 4IDIA 4P6VF 3AH7A 2WS3B 2WLBA 3L4PA 1ZUD2 1N61A 1E7PB 2LEKA 3AECB 1XLNA 1QOGA 3PO0A 3B2GA 2CJOA 1OFFA 2MJ3A 1JROA 3AV8A 1WRIA 3AE5B 1L0VB 1V8CA 1TKYA 4HROA 4JX1C 1QOFA 1E9MA 5C3JB 1SB3C 2EKIA 1DOYA 1T3QA 3NVVA 1TKGA 2PKOA 3LXFA 4N6EB 1GPXA 4ZOHC 1NVID 4ITKA 3AE7B 4A9AA 4ZHOA 2MJDA 1NEKB 3AEGB 1QOBA 1TYGB 1N60A 1N63A 3P4SB 2AX5A 1KRHA 4C80A 1FMAD 2PVGC 4WQMA 1JQ4A 3ZYYX 3FC4A 2B76B 1CJEA 1VLBA 3ETRA 2KAJA 4N59A 5G5GA 1AWDA 1ZOYB 3HVZA 3NVYA 4YSXB 4ZHPA 5EE9A 2W3RA 1J7CA 2G1EA 1FFUA 1N5XA 2WP9B 4N58A 1B9RA 2M56B 1DOIA 3ABVB 2K22A 3NS1A 1OQQA 3B9JA 3P4PB 1UWMA 2FBWB 1DGJA 2DWQA 1TJEA 2BS3B 2KMMA 2L52A 1A70A 2N0SB 1FXIA 2PIAA 2W55A 3AE8B 1ZXIA 3SR6A 1L6UA 1E10A 1EWYC 3AN1A 1RWSA 3P4RB 1QLBB 3AB5A 1XO3A 2H88B 4C7ZA 3P1MA 2K9XA 4US8A 2W3SA 3NVWA 5EE1A 5GXGB 1PUTA 1TKEA 2M19A 1QT9A 3BIID 1KF6B 4KX6B 1E0ZA 2W54A 3DWGC 5G5HA 2WDRB 1YQ3B 3P4QB 1GAQB 1PDXA 1JWAD 3AE9B 4WWMA 1VDVA 5C2TB 1FFVA 1FRDA 1RM6C 1XLOA 3WCQA 1V97A 1SIJA 1QF6A 1FM0D 4HRSA 3AEAB 1WGKA 2WU2B 1YJIA 3AEBB 3CWIA 3NRZA 1JWBD 4C7YA 1OQRA 1ROEA 2ACZB 2WDQB 4LTUA 1JRPA 3VRAB 1VJKA 3AE6B 1F0ZA 1L5PA 5AUIA 1DOXA 2MJEA 3AEFB 4USAA 1KFYB 3AEEB 1N5WA 1IUEA 1J7BA 3P63A 2CJNA 1NI3A 5H92C 1JALA 1NYRA 3EUB2 2DBYA 2K5PA 2BS2B 3HUIA 3KWLA 4JWSC 1N62A 2Q5WD 4YSYB 1PFDA 3AE4B 1RYJA 1WWTA 3AE1B 3SFDB 4US9A 4YTNB 1SF0A 5EE0A 1FIQA 3W5UB 1WXQA 1FRRA 4YT0B 2QJLA 2CU3A 1YQ4B 1YJJA 1CZPA 3AE2B 2BS4B 3AE3B 1E6EB 2OHFA 4YTPB 4YSZB 1XLPA 1JW9D 1AYFA 3DWMA 1R7SA 5H8YE 3RPFC 3FAHA 4FXCA 3LB8C 1FO4A 1ZP0B 2MH7A 2WDVB 5MPOA 3W9CB 3AM9A 2BT6A 2Y5CA 3VR8B 1NENB 1RFKA 5AUKA 3W5VB 2QIEB 1WYGA 3AMZA 1QOAA 1I7HA 2JX5A 3HRDD 2PVOD 3VRBB 1XLQA 3NVZA 2HTME 5EE3A 4YXDB 4JWUC 3SFEB 2H89B 3CIRB 3VR9B 2L83A 1NYQA 3AEDB 4YTMB 1FXAA 2WQYB 2E3TA 2WU5B
chains in the Genus database with same CATH superfamily
4PZNA 5AZHA 4LZGA 2KD1A 4IQTA 3SAHA 2V4RA 3QUQA 1FCLA 1A0PA 1JROA 2C2DA 4WJPA 4R65A 4NNJB 4JE3B 1SZHA 2B6GA 2KFKB 5KT3A 5DDMA 2IGGA 1DOYA 4N6EB 2N7DA 3MGIA 4IKGA 5DPRA 1WGDA 1TS3A 1TAUA 3PHXB 1EF1A 1V1PB 3L54A 2YY6A 3IG8A 1V80A 3ZYYX 4BFRA 4OJPA 7ICKA 1YN3A 1VZ6A 1ZXHA 1UBIA 2OYYA 8ICKA 3T79A 4JPSA 1EF5A 1U4AA 2I1JA 4BGDA 1QTMA 3J9CA 1KL9A 3ABVB 4DCCA 2N7JA 4KLOA 2CRXA 4CQNA 2L52A 4B0EA 4MELA 4WH4A 1L6UA 3SD7A 4OHJA 4EZKA 2PE9A 2PI5A 4KVGB 1ZQYA 4NY0A 3T5LA 4ANUA 4C00A 4ZYSA 3PO4A 4DQIA 4IR1A 5EE1A 2GOWA 4XDDA 1KN5A 1TKDA 1OXJA 1PUTA 2R61A 3F2DA 1DXSA 3QU2A 2QDFA 4DFMA 1WX9A 3HIZA 9ICHA 4WWMA 2C5LC 1IBXA 2WAQC 9ICNA 1V5TA 3AXCA 9ICKA 3LDZE 4K1RB 1SIJA 3RZWC 3WKCA 5KFHA 2ZW0A 1BNPA 4MM3B 2ZZPB 3N1XC 5FP0A 2WDQB 4JLCA 1WMHA 4ED0A 1WXVA 5KAIU 1BVSA 5AUIA 2DPIA 4FHKA 2ZJ5A 5HG2A 3UQ2A 1NJWA 3VUWA 2LJIA 2WYQA 4EKUA 2MP2A 2NBVB 1MPEA 5BO4B 4DLEA 1HUOA 1TZ1A 3APDA 5H2FU 1F0MA 3M9NB 3I5JC 5KFIA 3U7ZA 3PPAA 4UB8U 2NRZA 3Q8MA 3F2CA 4UB4A 1JN3A 1A6SA 4IWQA 4RGMA 4YSZB 1UT5A 4W9IA 1TAQA 1MG4A 5TZVA 2KNJA 2Q4TA 4DF8A 4B6JA 1MHHE 2BW2A 2MBHA 3NG0A 3UXNA 5J0WA 3LB8C 4BZAA 2KG5A 3RFAA 7ICEA 4C4VB 2YMLA 4YCXA 2KSOA 4F5OA 2KX0A 5KFEA 8ICLA 1NZBA 3BK1A 4II3B 4J03A 2G3QB 4LJOB 4P1CC 2O6KA 2DYMA 1WJUA 2BDPA 1C1YB 4ZRQA 5CEHA 5EE3A 2AGPA 4KLSA 3IVFA 2KJ8A 1RG6A 3QX7A 4A8EA 2FLPA 2GBMA 2KQ7A 2C22A 4M02A 1T5XD 5HHDG 4C4VA 4F4YA 5IIIA 1A76A 4F4ZA 1ZQDA 3ZDDA 4UARA 4ECWA 1WGRA 3QJZA 3UI3A 4C8KA 2KNBA 4DS5A 1QQ6A 5D3IB 5D4BA 3AE5B 2MRPA 4Q8FA 3H4DA 3KHRA 3BK2A 4JX1C 4RPYA 5CHFA 1L7PA 5TISU 4DEZA 5KG6A 1N48A 1T0QC 2HJ8A 2W7PA 5IILA 3JPNA 2HHXA 4ICAA 5DGAA 2PW9A 3M3JA 4A6QA 2CN1A 4G11A 4WQMA 2GBJA 5CWRA 1NZPA 2DGZA 3ZGZA 1WF9A 1SSNA 5DG8A 4K7WA 4TSSA 4YP3A 1CRXA 4GIVA 5AI6A 4K3CA 3FDSA 2FMPA 2PFQA 2KICA 7ICJA 1DOIA 1TK5A 4PHDA 3TQ1A 2FUG1 2J53A 3EFCA 1WWVA 1TJEA 2KMMA 4YMOA 4BJQA 5HKHA 2LGXA 4UAZA 4O3QA 2NTTA 3CRXA 4KLMA 2Y5BB 3BS7A 1E8XA 5DDYA 4Q43A 3TSSA 2Y1IA 3LVVA 4EX6A 2BKRB 4LNOA 3CP8A 1TKEA 1D8YA 3MBYA 2IO2B 4F4WA 1LO5D 3BINA 5KFJA 3TEXA 2KHQA 4OD0A 4CDGA 1NNLA 3M6KA 1XS9D 1SKRA 2BCRA 2L7RA 2WXHA 1FM0D 8ICOA 2NYVA 2L76A 1QF6A 3ONSA 3AEBB 3HM6X 1ROEA 2KTFA 1HEZE 3C23A 2WXRA 3JYUA 1EU4A 3ZRCA 2ZUCA 2NS5A 4DWFA 3TFRA 3R3MA 2I6XA 3O65B 9ICMA 1KTQA 4XYCA 4MFCA 5LLIA 3KWLA 1WGHA 3GE3C 4CF3A 1WJNA 3WKEA 3Q8AA 2OH2A 3AE1B 4KLUA 4FZLA 3GP7A 4BKGA 2KLCA 2GH1A 5EE0A 1FIQA 3KHGA 2DZKA 4ARIA 1J8CA 1WE7A 3PR4A 4B9NA 4AYBC 4KLEA 2DZMA 4PGXA 4AJWA 2DX5B 4DQPA 1P7FA 2OHFA 1F2RC 5L95C 2JXJA 3WK5A 2LYBA 1BPYA 1Y8RC 3RJGA 1KEJA 4FXCA 4GLSC 4JL9A 4KLIA 3HWTA 3W9CB 1MJDA 3PHWB 4UBBA 2BT6A 2J6SA 3SAFA 2MCNB 4FBJB 4DXFA 4EEKA 1VRAB 2RQ5A 1WYGA 3C21A 3ZNGC 5KFXA 4RT2A 2GWSA 1E7VA 3S2AA 4D2KA 1X40A 1LGRA 3QEAZ 3NVZA 1EUVB 3A1QA 3VAWA 2JH1A 5KFVA 4W9EA 3WK7A 7ICVA 1Z5SB 4ED8A 3BS5B 5B5EU 2FLNA 3DHHC 3AH7A 4QZIA 1S76D 3V3XA 3R2TA 1XLNA 4A55A 3PZDA 4IR9A 4DQQA 2H5XA 2DKZA 3OJ4B 4XRHA 3HVDA 2PE6B 5DLGA 2WAQF 1SE4A 4GXBA 4CHKA 3H8MA 1C4CA 1I4GA 1E9MA 1JRUA 2DUYA 4LNFA 2MSNA 4B9LA 2HOIA 4ECSA 2L05A 1T0SC 4WJOA 5KG2A 1E8YA 2DENB 3DEEA 5AKJA 3D32A 3V60A 1DK3A 4I6LB 3A9KA 4Z6EA 2ZPNA 1LKYB 1X9XA 3TCAA 1UA1A 4ECXA 2V4IB 2L0TA 2E1FA 1KQQA 1RFAA 1TS2A 2LHDA 1I35A 2PIAA 3KZXA 4TQRA 2N0SB 4B6WA 4RGNA 4GDLA 5BOMA 4XDCA 2NPTB 1URJA 2MRLA 4QW9A 2DZJA 2WXMA 1BPEA 2W9BB 4ECYA 5C23A 2K8BA 2K8BB 3NVWA 3WKBA 2GBNA 3H7SA 2JEGA 4GN1A 5L1IA 4ZRJA 2HMXA 3U7DA 3OSPA 2W54A 2BTEA 2A1JB 3NUQA 4HPPA 2QCZA 4KGSA 2H3IA 2JGAA 2WTFA 1UGJA 3OPXA 1PVQA 2ZW1A 4E74A 1UELA 4NLCA 3A9JA 3CWIA 2HOFA 4MGIE 1ECWA 4F7ZA 4R8UA 3MJ5A 3GZNI 3F5EA 1B22A 1E90A 4XE0A 2MJEA 4NAWA 2KKCA 5J2AA 3MGVA 4R63A 3UMGA 4GFJA 2XVTA 3KWVA 1KLVA 5TSSA 2FNJB 3ZNHB 3W5UB 1K1QA 1S8OA 5KFZA 3QK0A 4PT5A 4ACFA 4PH5A 2CU3A 1NBFC 1UT8A 2AYOB 3BZCA 3LK9A 2W9CB 4NLGA 7ICSA 5KG1A 4C8OA 3GE8C 2V1YA 1D6EC 4A20A 3M63B 2FCNA 3FAHA 1I4QA 4AJYB 5KFSA 1L7NA 3BS5A 4BKTA 1BGXT 1WM2A 1ACCA 1YX6B 3RI7C 2QIEB 3TL5A 4QZHA 1I7HA 2J0JA 2PTLA 2WHIA 2HJ1A 3H7PA 4WWPA 5F9LA 2KDIA 5KG5A 3QC8B 2JHDA 4M2YA 1ZDXA 8ICYA 3K1ZA 5J0SA 4DFKA 3ML9A 4JV0A 4IQWA 1JMLA 2I2YA 5DB7A 4PK1A 3TANA 5ALWA 3RJEA 3H8JA 4EBEA 1JWUD 4JV2A 2E8NA 2BQRA 4REZA 5FR6A 4TKNA 3RB6A 4DLGA 1NJYA 2L0FA 4WIPA 2HCFA 3PX6A 1X9WA 4J9RA 1X42A 3MGHA 2PMZC 3RAQA 3RB3A 1L3UA 5E6NA 1QILA 1Q5WB 1RYUA 3P2BA 3GS2A 1LQBA 2OWOA 1RYRA 3A4RA 5BYQA 4PYZA 1QOFA 1L7MA 4ELTA 2O2VB 5C3JB 3PS6A 4BDPA 1OTRB 2DFLA 4RU9A 3T5HA 5E6OA 1AQ6A 3DBRB 2IPKD 2KK0A 7ICHA 1HEKA 1FNWA 3PZ7A 2V3PA 2QMTA 2B76B 1FPYA 4XGAB 2W11A 4RUCA 1V5OA 1K53A 3C2LA 2K3UA 5CJ7A 1JCKB 1V1PA 3DDCB 2FBWB 2UWQA 1XWLA 3ZDAA 1H8CA 2INNE 4NJCA 1HTOA 2D8CA 1J0GA 1L6NA 3DDHA 4J9QA 3KUZA 4UB1A 4MEYA 3EECA 4C7ZA 2JZBA 3B0YA 1PQSA 1QLNA 1GO3F 2QLTA 4ZRKA 5D2MB 4DSFA 5IIJA 3K9PB 3KYCD 3ZXVA 4S0RA 1PVRA 4KMOB 1VDVA 4DO9A 4TV3A 2ASJA 5IP4D 1CI4A 1SWWA 2EAMA 5JU5A 3FYHA 3HT3A 1IG6A 2ODGA 3JPQA 4GXJA 2PFOA 1B0XA 4CNQA 2N9PC 3MHSD 2MUTA 1KFYB 3PVLA 3UIPB 1J7BA 4GXKA 2QB1A 2L32A 4IW0A 3HM3A 5CHGA 5ALVA 1N62A 2YTUA 3AQFA 2JRIB 2K25A 3SMVA 4PL2A 5KT5A 1YN4A 4OJ6A 2IOHA 4C0ZA 4PL1A 1NK0A 5AKEA 4DSKA 3V05A 8ICEA 3SD5A 4YTPB 3AEVA 2BCVA 1XLPA 3ZQ4A 4B95A 3QU9A 1AW7A 5FK9C 4M9HA 2G0AA 5DBAA 4GC7A 2HHSA 2WDVB 3V7KA 4IRCA 1Z4NA 4ECVA 1PYWD 4A8XC 2KDEB 2VJ4A 3HW8A 3B0AA 4Q2JA 2JX5A 4E0DA 5KFOA 5DGBA 2IGHA 2KMCA 1KLGD 3NY5A 4C56C 4QZ9A 4M8MA 2FMSA 4ECUA 5CTRC 3QUTA 2KSOB 2IBIB 4AP4C 3Q69A 4P0PA 5EDSA 3QYPA 4KITB 1X66A 3R8BA 4UAUA 2JEJA 5J17A 4J9SA 2F1JA 3L4PA 4DL7A 2XNAC 3IRUA 3JPPA 2CJOA 3E58A 4PGYA 4UBCA 1XEEA 4KKIA 4NQKE 2ZJAA 4LNIA 1U49A 3KOOA 3W1SA 1SB3C 4FJVB 2YEPF 2PKOA 1S10A 8ICCA 2HTHA 1S0VA 2L8JA 5J2JA 3E2EA 5KFGA 1N63A 4W9DA 2M0NA 1KRHA 5KT6A 4F2SA 1SE3A 1CJEA 2D6FC 3M95A 4RQ5A 4I6PA 1QSLA 2F1HA 2FCMA 5ALIA 4FS2A 1S77D 3Q8FA 2IHNA 2RDGA 2XY6A 1ZQAA 1UA0A 4ZRPA 4F72A 2J0KA 4RQ0A 2N1VA 3C8YA 2GLSA 2VKQA 1P0RA 1EWYC 3AN1A 3HKZF 3VH4B 2H3QA 4F5NA 5HNKA 3E56A 4DXGA 3JVZX 5IIOA 4OJ5A 1XD3B 4US8A 2K9XA 3OAWA 4F50A 2BWES 3LVWA 3KVFB 3V61A 3LWLA 4Y2TA 2M19A 5L83A 2DAFA 3T3NA 1C7YA 7ICQA 2LPEA 2RDHA 1NDDA 3CW2C 2WDTB 1TBEA 3FILB 3K9OB 2F3NA 3SU8X 5KL1B 2JY6A 3QU5A 4KGTA 4ECQA 1LM8B 1JRPA 3HP6A 3IM1A 4HJGE 2H3ZA 2ATLA 8ICBA 2HOQA 1NK7A 4ED2A 5GTIU 3U4EG 1N5WA 3RJKA 1HZ6A 5ALDA 7ICPA 1T7PA 3U8ZA 2L3ZA 4NJ6A 2AJQA 4QIWC 4C8MA 4J3OD 9ICWA 3CSTA 4GB9A 5TR5A 2QJLA 4DSIA 3ZJTA 1CZPA 4BWMA 2KJHB 4XZ4A 4FADA 4FFDA 5LXHA 1ZGUB 2J4XA 1FO4A 5MPOA 3UM9A 1MSWD 1WY8A 8ICGA 3JSVB 3AM9A 5AI0A 5JXVA 2G07A 3SI8A 2C7MB 5J2DA 1C4AA 4ECZA 5EWFA 4HPLB 2XCAA 5J2KA 3AUOA 3BQ2A 4PS7A 3IG3A 3ZUNA 4IS7A 4RQNA 3IN5A 1V6EA 4XA5A 4GOCA 3U52E 2HTME 2KJ6A 4YXDB 1WIAA 5KFYA 3RB0A 3VR9B 4KSKC 2KZ3A 4NQLB 2MW5A 1ZRMA 2E5SA 1ZJMA 2PI4A 4CE6A 2M0XA 2DYBA 2LZ6A 4TQ1A 4F1SA 4WWOA 1V85A 3RBEA 7ICTA 1KFDA 2B0CA 5J0QA 4O3RA 1V9PA 2BPFA 2XY5A 1QQ7A 2JZPA 3B2GA 2FJ6A 3L16A 4U6PA 5J2GA 1OFFA 2ZCCA 1SGHA 3AV8A 1VJ5A 2LFIA 3WALA 1E8WA 4HROA 2MWSB 3W2DA 3C29A 4GGQA 3RMKC 2GRIA 2HE7A 3IFWB 3JPOA 4Q8EA 3AE7B 5AK3A 1ZQZA 4RNNA 3AEGB 4DSLA 1JQ4A 1UNSA 2LYAA 1FMAD 2HBKA 4NZLB 3NJTA 1YQBA 1SKSA 4G3IA 5J8YA 2WF7A 1SEBD 1D8LA 2ZVOA 3EZ5A 3URYA 1N5XA 2AH5A 5DPWA 4F2RA 4K3BA 1QCKA 2BQUA 2K89A 5KG7A 2M56B 2O2VA 2WF5A 1KJTA 3OLMD 4ICVA 3C1YA 3QHTA 4KMUA 1D5ZC 2DWQA 5IOIA 1D3ZA 2D5GA 2MEKA 2W55A 4O3SA 1ZXIA 1IGDA 1TTNA 5KT4A 2KWUB 3M7DA 4QZEA 2K1FA 1XO3A 2TSSA 3FKYA 9ICVA 1E7UA 2WNMA 2CHWA 3BIID 2BDUA 4J9KA 5IINA 3QXGA 2ESEA 9ICXA 2IY0B 1T6BX 2LGDA 2V9HA 2NBWB 1GAQB 3Q3JA 3HILA 1X9SA 4W9LA 3RULA 5KAFU 3DPDA 4EELA 1DOQA 3MTNB 3UQBA 3RB4A 1JWBD 1LV5A 1TK8A 5ALFA 2KKVA 7ICNA 1TS4A 1VJKA 3CSFA 3IHPC 5D3DA 4J9LA 3PLVA 3O0FA 1X6JA 3DQVA 2LHTA 2JWZA 2AQ4A 4I2EA 1YMHE 2OJRA 2ZTDA 2KV2A 1XSLA 2LI5A 1K1SA 2F8KA 5ALRA 4JWSC 1TY0A 2Q5WD 4EOYA 3D2NA 1BXTA 2K4PA 2MBOA 4YT0B 1NK9A 4FULA 5L9XA 5IO9A 1YQ4B 4IUMB 2NO5A 1YJJA 2VJ5A 3KHHA 3RRHA 3K75D 3L08A 3PW7A 5KFRA 5DB6A 1C9FA 4L23A 1WZ0A 4RPZA 1N6ZA 4PZOA 2EMTA 4DHZE 1XQQA 2YQEA 5HMLA 5CA7A 2LHEA 1RYSA 2WF8A 5EOZA 1HUZA 1SJED 2INCC 2DHZA 5E79U 3ZDBA 3JPRA 3DBRI 1Y56A 1MQ2A 3TAQA 3U26A 4RCOA 2V0GA 1OW5A 1OQYA 3BQ0A 2F44A 1PVPA 4HDQA 3V72A 1T0YA 2WB1F 4QWEA 2NBUA 4CYEA 2BQ3A 2ZIXA 2KVRA 3VTVA 1MA7A 4EE2A 3MDCA 3BDPA 5AHXA 2NV3A 2W9AA 2KHVA 2K8AA 1U47A 1P7DA 2Y5PA 4O3NA 2BZFA 2JQRB 4MDKE 5IIKA 2WS3B 1ZUD2 2F77X 1H38A 4RQ3A 2LEKA 1QOGA 2B21A 4NLNA 5DKWA 2BR0A 1C20A 2M0AA 2YB1A 3RNFC 3GZNB 4C4RA 1V8CA 3QQ8B 4HWIB 1XXGA 2XCPA 2W04A 4YR3A 4K7UA 3VQIA 4M6WB 3A4SC 4BVUC 4ZOHC 1F52A 2NTSA 5IIMA 2MBQA 2MJDA 3HHMA 2BWFA 3DVGX 1F44A 1XO1A 3UMBA 1BNOA 5D46A 3WK4A 4JGHB 4DXAB 2F76X 3NVYA 4UQGA 5EE9A 2BYEA 2W9NA 2CS4A 4KKJA 2G09A 1BT0A 2A5UA 2LMRA 4QWAA 3B9JA 1D5XC 1U45A 5DQGA 3AE8B 1A70A 3BVMA 3LDAA 2C7NB 3IBEA 3MR5A 1D4BA 3K4GA 3M6ZA 1J2NA 4QWCA 4JQWC 4UDUC 2M17A 1ZQWA 3Q8SB 3Q8LA 5I4DA 5BMGA 1FFVA 2NO4A 4FN2A 1PK3A 5AKYA 4KGRA 2PEAA 1V97A 3DBHI 3V6JA 1TK0A 4MT5A 2KMDA 5L1KA 1OEYJ 4YN4A 4AP9A 1RQLA 1ZYQA 1WR1A 1OQRA 4PS3A 1GOZA 3IAM1 4ANXA 3TIXA 7ICIA 4P2HA 3Q8KA 2I5HA 4F91B 4FJZA 3IXSA 3V7JA 4YSYB 1QH9A 4F5QA 2RHFA 2W7OA 5AKIA 4RQ7A 2WXOA 2J42A 3JPSA 2BCQA 2FMQA 2JWUA 2WXPA 1U48A 3Q3MC 3RRGA 2K0PA 3NUHB 1YIWA 4GIBA 3MP9A 4GLXA 5AKXA 4NM1A 3AU5A 4J9MA 3QCAA 1Z1VA 5ALZA 5L1LA 2L5YA 3MC9A 4O1NA 2EKEC 1ZP0B 3ZIMA 5AK4A 2LWPA 4JK1A 4Y2UA 3E9SA 2MU2A 1ZQLA 3KUDB 1N2XA 4P4OA 1RFKA 1FEZA 3A0HU 3V62A 3GILA 1ZQRA 2UVUA 4B9KA 4BX9C 3Q3OC 2IO1B 1L0XB 4KLQA 4GDKB 1D9FA 2HDOA 4F4XA 2P6RA 4N9F4 3DBHB 5E6PA 2C7HA 3KUCB 3NZSA 2BF8B 2BGFA 9ICFA 2AL6A 2WU5B 4WWNA 1J7AA 1R4MB 1RAXA 3TEZA 3L17A 3VUXA 8ICZA 1WJ4A 1BPZA 1N61A 3H0MB 2DF4B 3PO0A 1TFRA 2D3DA 3OHAA 1V86A 3QEBZ 4MEMA 2OOBB 2UYZB 5AKZA 2NRWA 4DL5A 3WA0A 5LXIB 4I27A 2AQ2B 3SV3A 3T3FA 3KLSX 3LJ3A 3SV4A 2WXQA 3QUBA 1F1HA 1IIPA 2EMSA 1IPGA 3PW0A 3DBSA 2N1RA 3PW4A 3ETRA 2IBKA 1ZOYB 2MX2A 2LVQA 2XC9A 4TQSA 9ICOA 4M0WB 2KWVB 1NKBA 4AS1A 3R2IA 1DK2A 2K22A 4B9VA 4LDTD 4QZ8A 4EBCA 5HR7A 1ET6A 2JUOA 1KW4A 2XGPA 1I4HA 1DYQA 1L7YA 2C60A 5AM5A 2KO3A 3Q8EA 2Y0SF 5HR6A 2KN5A 1FNUA 2JPHA 1F77A 3AB5A 2J0MA 3SENA 3KH0A 2G4SA 1UH6A 4EZLA 5ALOA 4RQ8A 2IMWP 3WKDA 3X0WA 4YMMA 1L3SA 8ICNA 5IA7A 4KX6B 9ICTA 3ZVVA 1KRPA 2JZ3B 2WDRB 4K81A 2ZEQA 4GXIA 3NGDA 4G50A 5IN7A 4QZDA 3PVXA 2ICIA 4HKQA 3PR5B 2DKXA 4NY8A 4Y2JA 4F5RA 4P0QB 2HVHA 3R7QA 5HP4A 4C7YA 4OVVA 2IHMA 3UXOA 4DBGA 4NJ8A 1YX5B 3UMCA 1DRGA 4KLDA 3ETLA 2KHWB 1UQVA 3HK0A 5ALXA 1UHUA 3EUB2 2NVUI 4YFKA 1WWTA 4PHAA 2ZIUB 1RLFA 5DQIA 1SGGA 5AZFA 3X23A 4KX5A 3JPTA 1JMSA 2QKQA 2LBOA 2BS4B 4MH8A 1S5LU 1UF0A 1HZ5A 1QSYA 4DWIA 3Q2AC 2FPLA 2LMCA 4PJ0U 3ISBA 2A1AA 1GC6A 4NJ7A 4R3DA 5A0LA 3TARA 4Y2YA 3SZ2A 1QQRA 2XI9A 2HD5B 1EXNA 4XWTA 1S0MA 3KZIU 4O5KA 1NENB 1SJHD 4J9OA 4MH0E 3GV8B 3AMZA 4CF4A 2F1IA 2QARB 2MBEA 2O6VB 3V7LA 5D6JB 4ECTA 5DB8A 2ZPYA 5KFWA 4MM3A 4XUSA 1KM7A 1M4VA 3RNCC 2KEYA 4RQ6A 1CMXB 4IM0A 3A0BU 5CR0A 1FEHA 2L83A 3PRMB 1G6JA 2WQYB 2Z59B 2W43A 3B2FA 4IDIA 4P6VF 2O6VA 2PXIA 4A90A 2JRZA 3AECB 5JHBA 9ICJA 1EU3A 2K39A 5J0XA 2MJ3A 3RF9A 3JSVA 3TACB 3MR3A 5ALHA 1L0VB 4ANWA 4DQOC 2YMQA 5J29A 1PK1A 1D9DA 3PTFC 4DS4A 1T8EA 3WAOA 1GPXA 3AU4A 3GOEA 1QOBA 1Q1OA 2CXYA 1FCCC 5KFNA 2XY7A 3H6NA 3NZ3A 1VLBA 4O3PA 5G5GA 4ED3A 4MFFA 2KQ4X 4BWJA 2VZKD 1MG8A 1ZKHA 1C3TA 2WP9B 4DHJB 1NJXA 2KN4A 4TQ0A 3V6CB 3NS1A 5JRTA 5J0RA 1DGJA 4X5VA 1SV4A 4C4TA 5AM0A 5AKLA 1YD8U 3ALBA 8ICMA 4RF0A 4RT3A 3RR8A 4L2YA 4I2FA 3NS8A 4O5CA 2JYTA 2AXTU 4EYIB 4Y2XA 4RUAA 3ZDEA 5DG9A 2FAZA 2MSED 4BBNC 2K8CB 1SV0C 9ICGA 2CHZA 3Q8BA 4DFPA 8ICRA 1PGAA 2KMAA 1JXEA 4MJSA 4KLTA 4PS8A 2KTRA 2AWTA 2WU2B 1PUZA 1NK8A 4W9GA 1T94A 2KD0A 4OVZA 3T3OA 4IG7B 5C0YA 3ZDCA 3IAS1 3AE6B 4HCNB 4MSQB 1F0ZA 4CGZA 1L5PA 5AIAA 8ICIA 4USAA 5DPSA 2VA2A 4IWPA 4YG2A 5J0OA 4MGYE 5H92C 2DBYA 1JX4A 4IOIE 2OEDA 2QARA 1XC9A 3IV6A 2DQNB 8ICWA 1UWXA 3VUYA 1RYJA 3RJFA 1SF0A 2QILA 3BJYA 4LNKA 4UAYA 2WWZA 2PFPA 9ICCA 1XCTL 2E8OA 2VRRB 4KDLB 4YWGG 4FZNA 1CQVA 1KTKA 1J2MA 4RF1A 4I2AA 2VH1A 1COOA 1JW9D 2WXFA 2RDJA 3PX0A 1WSPA 1O08A 4CCHA 3RPFC 3KD3A 3QAQA 4E71A 3PW5A 4ARCA 3C28A 2SEBD 1X1MA 4BKSA 1SXDA 3RZFA 3BWUD 1UUPA 3GZFA 3VC8A 1XO0A 3B08A 2Q0ZX 2DNFA 2HI0A 2PLPA 2GBKA 2WXJA 4JUZA 4J9PA 3BZKA 4O9MA 1D5MC 4MFAA 1XLQA 4IM2A 5KFUA 1FNVA 4MF2A 2Y9TA 3PLUA 4MACA 2IOFA 3RJJA 1ZQEA 4B9UA 2V4QA 2JEFA 1EWCA 2ASQA 4GDKA 1FXAA 3P4SB 1ENFA 3N9YC 1KFTA 1LXDA 5BPCA 3LWMA 1K8RB 1L6VA 4RM8A 4EX7A 1JWSD 2E1EA 2X8XX 2BB5A 3N7PD 1WRDB 2D11A 3OJUA 3GV7B 5DBCA 1KFSA 2DL0A 2IZVB 1PZNA 1UPHA 4CRXA 1STEA 3KKAC 1WI0A 4KZ0A 2WXLA 4I29A 1C78A 5J2IA 2BCSA 1ZQQA 2CPRA 2Z8LA 3MABA 2CU1A 2E6XA 4NLZA 1N56A 9ICIA 3DHGC 1GB4A 2RSUA 2BPGA 2JH7A 5DB9A 3M8RA 2I9GA 2PJHA 1UBQA 4W9CA 4TURA 4JWMA 8ICQA 2X38A 3IG5A 4I28A 2JMGA 2OEHA 2KVSA 1C77A 2FIFA 2XO7A 8ICJA 4EZ9A 2KTRB 2ON8A 4MJSB 4DDGD 4MF8A 3AEDB 1FXIA 1V9JA 4RNOA 2NRTA 3SR6A 2NRXA 2JZZA 2KX3A 4OJLA 3QWZB 5ALSA 1XF5L 4AUQC 3GIIA 1KDHA 3QA8A 4FE3A 4EFOA 4WAFA 2Y3AA 1Z00A 3Q8CA 1RZTA 3H9DA 2W9MA 2AQ1B 5AI8A 4HCPB 3PSPA 8ICUA 3MFGA 3P42A 1YZ7A 4BXOA 2XEWA 1ZD3A 5AI5A 1R4NB 4A3OA 3M8SA 4HRSA 1VR9A 2MA9B 4S17A 1HE8A 1JWMD 2KVZA 4LTUA 3ALRA 2QB0B 3UIOB 3QZ8A 3WKAA 2VH2A 4G9BA 1WR6E 1MHXA 2MAXA 7ICGA 2HBJA 3RJHA 3ZKJC 5AKGA 2HHUA 1Z2MA 4LJPB 3ZJUA 2UVWA 2YX8A 4YD2A 3BY4B 3MJWA 3Q14C 2JRHA 3SDLC 3M62B 1WYWB 1ZW7A 4PHEA 3KHLA 2JF5A 5AEKB 4KLHA 2XK5A 4AWJA 1E8ZA 2ZTEA 3Q8RB 5KFFA 3EYZA 2ISOA 1AYFA 2ZIWB 4P7IA 3ZTCA 2BPCA 2BGWA 2W8KA 2D07B 4OZCA 2M1MA 3H0LB 1MVKA 2LVPA 3VR8B 4YMNA 1VCBA 2EQYA 1ZOLA 1ZQTA 2E8MA 2W8LA 2YLMA 1L4ZB 1OGWA 3BZDB 4OZBA 3UINB 3I9V1 2KC1A 2V3SA 3VRBB 1ZQBA 2LGYA 2Y1JA 5CHWA 4DL4A 2KDFB 3PSEB 4NLBA 3NZUA 4YR0A 2VA3A 2JT4B 4JWUC 1S0NA 1L4DB 4EZJA 1ZQGA 3H7PB 4DFJA 4LVSA 2HDEA 3ECIA 3UQAA 5ALJA 5DQHA 3RJIA 3EWAA 4PPXA 1KLUD 1S9FA 3MFIA 1GG3A 2QC8A 5KT2A 1E7PB 2UU7A 4Q45A 4KIKB 4LDTB 1NK5A 2DYOA 3WAMA 1WRIA 3WANA 4O0IA 5CRXA 1WCLA 4B9SA 3ZJVA 3TUOA 1Z00B 2ZIUA 3ISCA 5EWEA 2EKIA 1T3QA 3A33B 3DHIC 3BYTB 1U4BA 4A9AA 3N1YC 5GTHU 5BMHA 4RMAA 4LJXA 2CR5A 1ZQHA 3TI0A 3FC4A 2QEJC 4R64A 1WG8A 2A3VA 3KQ4A 3L10B 4O3MA 2ZJ8A 3HVZA 4YSXB 1X2IA 4FHJA 4GC6A 4IRKA 4N58A 3I63C 4F3OA 9ICSA 3N7RC 5DCNA 1GNUA 1OQQA 2KQSA 2A19A 5J2CA 4BBNF 1L3VA 1E10A 2ZJDA 2ZNVB 2D3CA 1U9LA 2AGQA 7ICLA 2ZUBA 2G5IB 3N28A 1QLBB 1RWSA 4EEYA 2UVVA 2KZRA 2H88B 3P1MA 3A9JB 4CO7A 4Y2RA 4RPXA 4XQ8A 3BQ1A 2LGSA 3VTUA 1VZ8A 4DOAA 1YNTE 1K5OA 2KWCA 2KZMA 2IO3B 2H3FA 4DOCA 3V6EB 4I2CA 1FRDA 1IXRA 3BQTA 4UASA 1Z19A 2G4DB 3N30A 5JZEB 4ZYNA 2GO7A 2JVCA 8ICAA 3H8HA 4QNLA 2BHNA 1KBUA 1K52A 1A77A 3ENEA 5KG3A 7ICRA 1YJIA 3N32A 5J8YC 2W9BA 1XNSA 3N4MB 4DDID 4M0WA 1FXTB 4Y2PA 4JV1A 4IRDA 1R4MI 4I2DA 1ET9A 3PZ8A 4AQ7A 2V9WA 3J81j 3C2MA 2KN7A 3CF6E 1J97A 3TEWA 4M8NA 2ZIXB 2NR2A 3I1YA 2KOXA 4RFBA 2CJNA 1ZQNA 3HUIA 1X6IA 2RP5A 3K1RB 4M00A 2HHWA 2LJ5A 3L0WB 2INPE 3SFDB 4TMAB 5ALPA 4MGZE 3ZDMC 2BKEA 4HAIA 1AN8A 8ICSA 2XN9C 3WAPA 2ZVNA 2XICA 1V2YA 4NWIA 2A4ZA 2BB6A 2J7QB 4I2JA 3WK9A 1ZETA 1WGGA 2F8LA 2R8IA 4XC2A 1RXWA 4UB5A 5H8YE 1R7SA 1PGXA 2INDC 1QSSA 4M01A 2GLEA 1QKZA 2G45B 3WK6A 3IT4B 2J6TA 1KOTA 2K6QA 2BYTA 1SL2A 1L8OA 1ZQFA 4AYBF 3T9LA 8ICFA 2OJWA 3GV5B 9ICQA 3HRDD 3RNAC 4EENA 4M9NA 2KFNA 2QHOA 4P4MA 5AKHA 3N20C 1ZQXA 4M47A 3OG5A 4QZBA 4F8RA 1T4GA 3E0FA 2AEHA 3TAPA 4ELUA 3CIRB 3H0RB 3H7IA 4M04A 2LVOA 1TE2A 3V6KA 2FE8A 4KX3A 3OGUA 2BCUA 2ES6A 2KLGA 2RMMA 1GJZA 1ZD2P 2ZIWA 2HHTA 2KVCA 3W1SC 4HLEA 2KIWA 4QW8A 4DL3A 1NK4A 4E3CA 2XK5B 2D2QA 4MEXA 2LRUA 2R8JA 1KKXA 4KDIC 1XSPA 3DOWA 4NXZA 3ORYA 3RFZB 1TKGA 3LXFA 2DPJA 2CKHB 1NVID 2RD0A 3Q3NC 4JMUA 4M9JA 1E5WA 2V3NA 1V49A 2I1QA 1TIFA 1YN5A 2CHXA 4IQVA 2PKEA 5J2RA 5K4LA 1SE9A 1AWDA 1HTQA 5JHAA 4OZAA 4ZHPA 9ICBA 5KFMA 5AI9A 2ASLA 2KANA 3ZNZB 4A3PA 2WXIA 3APFA 2P35A 3ED5A 4LNNA 4K7SA 2KWDA 1UWMA 1L8LA 2BS3B 3F2BA 4BXOB 2K60A 3TADC 3SEBA 4KIKA 3PO5A 4C8NA 3MC1A 2EZYA 2Y0SC 2YMMA 3RAXA 7ICUA 1QT9A 1Y88A 1XU4A 1V38A 2KP7A 3ICXA 1CK1A 2WX0A 3NRWA 4YXMA 3P4QB 1JWAD 2ZG6A 5D94A 5C2TB 5FKAC 3WCQA 4ANVA 1RM6C 1ZQKA 1SE2A 4RGTA 5AI4A 1SL0A 3RH5A 5KFDA 2MLBA 4W9JA 4GMVA 5C1ZA 2G9HD 3OJSA 1AARA 4Y2QA 2HHVA 1R4NI 2ACZB 4F5PA 4WJ3B 1YOVB 3AULA 5AK6A 1I4XA 3L13A 1TAMA 2KTQA 1Q8KA 9ICEA 5J2HA 2KZZA 3OTQA 2RGFA 2RPQA 3AEEB 2KE7A 2WFAA 3JW0X 3C5FA 1JALA 3G6YA 1V81A 2KKPA 2BS2B 5JH5C 5HFYA 4KLGA 3PSFA 4UW9A 3AE4B 4IWOA 2RRDA 1CUKA 3KBBA 1VD2A 2FE9A 3HPOA 1FRRA 1P9DU 2I38A 2VANA 3PV8A 1UCVA 4DSJA 4ED1A 2UVRA 5EWGA 1CEZA 5CB1A 4BOSC 3L5KA 3AE2B 3AL0B 3ONNA 2XIDA 2R18A 1UD7A 1SXTA 1JUDA 3QX1A 2FCSA 1Q10A 3DWMA 1DGSA 1ZQSA 1ZE3D 2R2OA 3TADA 4Z6DA 1F9JA 2EZZA 2GOLA 4Z6CA 4KLFA 5ALLA 2Z0EB 3MFHA 1J19A 3RNGC 1ZD4A 5AIBA 1RDFA 2MA1A 2KYWA 4TUQA 4RQ1A 3EPIA 3IP4B 4RM9A 2Y9UA 3UXPA 3VDZA 1WZ3A 3QU7A 2E8PA 2P6UA 1OUQA 3G6VA 1BPBA 3N1ZC 3B0XA 1P7EA 1B4FA 1ZQIA 7ICFA 2K4HA 4IQUA 1ZQOA 3V6HA 2IY1B 5G2NA 1WCNA 2LM4A 2BPSA 5BYSA 2EELA 4QWBA 3FILA 5L1MA 3FM9A 1Q3VA 2HVIA 4G0NB 4LK0M 3PNCA 3U2SC 2ALZA 1K50A 5CX3A 3S6JA 2XBBC 2NRVA 5IKCM 3U30A 4KLJA 5G55A 3MR2A 2JXTA 1Q0WB 3I76A 1ZQ1C 3MDAA 3TMPB 5ALQA 2OXOA 1N60A 2IO0B 1OEYA 4BUGA 2PVGC 5J0TA 3O13A 3GIMA 4N59A 4LZDA 3N3KB 2W3RA 1J7CA 2N7EA 5T14A 9ICRA 1B9RA 3D2SA 5KG0A 4KLLA 5KFAA 2MQJA 4DF4A 4RQMA 2L1AA 1JXLA 3MR6A 1S0OA 3PMLA 5KG4A 1TGZB 2RR9A 3PV1A 2W3SA 4DHZB 2VIXA 1WUDA 2KFZA 3KKAA 1E0ZA 5AM3A 2VA8A 5HMMA 5AM2A 4TUPA 3C5GA 1YQ3B 1WX8A 1LVHA 1IBXB 1BMLC 5L1JA 2WF9A 1WJ6A 1S97A 4I2GA 3BVGA 5J0YA 4W9KA 3AQEA 3G6XA 2JZBB 3EPGA 3NOBA 4DHJD 5AM1A 2NCNA 4ICUA 5KHQA 2VZKB 4OVUA 3UPQA 5F3XB 3ZD8A 4FJYA 3M9OB 3AEFB 5ALEA 4BOZB 2YN4A 9ICUA 3LYYA 3T5KA 4OW0A 3MC8A 1IM4A 1XCQL 3WIMA 2ZXHA 1NYRA 2K5PA 3ML8A 2LUMA 3SHQA 4YVZA 1YT3A 1WM3A 1WH3A 1ZQVA 5DLFA 1B43A 5CHVC 2FLLA 4QZGA 2FCQA 5HHIA 4K4GA 9ICPA 5ALNA 1NK6A 1GC7A 1PGBA 3OHBA 3RUIB 4ASWC 4YL8A 4II2B 3ZD9A 5J0PA 1YJ1A 2KFKA 2JEIA 3Q8QB 2V4LA 4LCDE 4NL9A 1TV9A 4JIOU 4PYUA 1EO6A 2MH7A 3EGRA 5FR3A 1ED1A 5DPTA 1XSNA 3T8MA 4RH6A 4U7CA 2K4EA 2WB1C 2K6DB 4QWDA 1IV8A 3I28A 3SQIA 1HA5A 3DVGY 2WXGA 4XX5A 4UAWA 5BYRA 4P16A 2N9EB 2JR5A 3M9MB 2FUHB 1IGCA 5J18A 2N9KA 2P66A 2FIDA 2MUTB 2FDRA 2C9WB 5KFBA 1TS5A 4NPNA 1NYQA 2HW3A 2KJ9A 7ICMA 2M9NA 3KTQA 2K4IA 4AOFA 5D49A 2WLBA 3Q3FA 2D3GA 3F5AA 8ICTA 1D8BA 4M9GA 3DV9A 3UF8A 1MQ3A 5AK5A 2LUEA 1NKEA 2REXA 3TKAA 4UAVA 3PRPB 4OCZA 4G3XB 9ICAA 2EZXA 4ZDVA 1FD6A 3NVVA 3QU4A 2EH9A 4KSLC 1TZOA 4HK2A 1RPLA 3BYYB 4MGKE 1NEKB 5KNIA 4EYHB 1S1QB 2AX5A 4I2IA 3PT2B 4P4PA 1SKWA 1ZDVA 2KAJA 3M1YA 3H1UA 1L2NA 3ZI4A 2K8HA 4FZMA 1O03A 3GDXA 4ECRA 1ZQMA 2WHEA 2KT7A 2WXNA 1MN8A 3P4PB 1WXSA 3QZ7A 1PK1B 1V1OA 1MFWA 3C0RB 5AM4A 5D7GA 3CMMB 4R8UB 2LD9A 3DVNU 1ZRNA 5ALYA 5KFQA 3PSIA 2R8KA 3ZNID 2LRWA 2AHOB 3VFKA 4Y2VA 3TEYA 2KJ5A 5GXGB 1H4RA 1HXYD 4W9FA 1C4PA 2PMVA 1QZEA 1HJPA 1PDXA 4I2HA 3R9KA 4TUSA 2N1WA 3IT6B 1TY2A 1XLOA 2L00B 4FBUA 2LXAA 3GIKA 4DOBA 1K51A 3Q6BA 4B9TA 3GU3A 5BMIA 4I6NB 3VRAB 2ZIVB 5J2BA 1I4PA 1DOXA 5ALMA 4KN4A 4B9MA 3P63A 1NI3A 2GB1A 4NLKA 2N9XA 4J9NA 2ZXIA 2LM1A 4Q44A 4HXDA 1WWUA 4F93B 3B1LX 4OO1J 1S3SG 4FA6A 5AZGA 3PRZA 2IJ0A 4HPMB 2BYFA 2O6VD 1SZPA 2H3VA 2KDBA 3C1ZA 2BQQA 1SV0A 1Z3EB 4QAYA 1T3NA 1MI0A 3AE3B 2YB4A 3KYDD 2MHJA 4DQRA 5E6JA 1EM7A 4RNMA 1C76A 2LXCA 5JUMA 8ICVA 2GMIC 2IA6A 4PGQA 2AGOA 4DSEA 4NM2A 3VH3B 5AICA 4UATA 4FBTA 1NI2A 1ZQPA 4F92B 4P0PB 2Y5CA 2AU0A 5AUKA 3QIJA 2ASDA 2PVOD 5KFKA 3LYSA 4DQSA 3WK8A 5DBBA 3PMNA 3ISDA 4P0QA 1RXVA 1ZQJA 2R8HA 1I4RA 1HIWA 4RQ2A 4NAWB 9ICLA 1KSPA 2H89B 3A1QB 4YTMB 4M0AA 2E3TA 1P98A 2KK8A 1B1ZA 5AKKA 3SEIA 2FI1A 2F2AB 2ONQA 4LLGM 4C4SA 1JIHA 1LB2B 4O3OA 1Z4OA 1L3TA 2HBLA 1UZXB 2RDIA 4P1BC 3OWEB 3TFSA 4QIWF 4RQ4A 1TKYA 3P4RB 4GSWA 2FPMA 2EAOA 8ICHA 5T8IA 3EC8A 2M8SA 4I2BA 4NV0A 2XGQA 4DK5A 1NJZA 4ZHOA 3N7SC 2GI9A 2AQ0A 1ZJNA 3HKZC 1NOMA 4C80A 1M94A 4Z6FA 1Z1BA 1LKYA 4M9LA 2BBCA 5KFLA 3VXWA 3A9KB 3RR7A 3I3TB 2DAJA 3NHEB 4NL9C 3H8WA 4EBDA 1SIFA 1XT9B 3SAGA 3BVZA 4ED7A 2YMPA 3AU6A 3QARA 1UGMA 2KJRA 1P1AA 2M4NA 3PZPA 2BYVE 2OM6A 4HVBA 3H8SA 3GQCA 2N4FA 4R66A 5KT7A 3RBDA 1KF6B 4YD1A 2R8GA 3DWGC 3GB1A 4JWNA 2LASA 3NASA 2Z7JA 3ZXRA 4W9HA 3F53A 1TVAA 3C2KA 3UGBB 5ALTA 2G08A 2C2RA 2JXXA 4YXJA 4ELVA 2G06A 3R66C 3RTVA 1WGKA 2NMQA 4GU2A 4KV2A 3VTWA 3ZDTA 2D3BA 4HEA1 4RGOS 1KH0A 1ZD5A 4WQOB 2W03A 3R7RA 4JB3A 1SL1A 2WX1A 3ZTDA 5C5JA 4ZH4A 3PW2A 3EHVA 1KLNA 4XWWA 2HSZA 4YR2A 4K4IA 1ESFA 2AL3A 3RNEC 2RLTA 2RDBC 1BUIC 4US9A 4YTNB 3EFUA 2HHQA 4CF5A 1WXQA 3ZRFA 1GB1A 3C19A 3RD2A 4K4HA 2B3AA 5KFPA 1ZQUA 3IHQB 4KN7A 3CNHA 2FPKA 3RT3B 3AU2A 4HKZE 2IGDA 3ZLZA 5KTQA 5F9NA 3EA6A 3W1YA 4DFDA 3OJ3A 4IM3A 2JYEA 4OJOA 5HI1A 2LGIA 3BQ7A 2AQ3B 1ZQCA 1Q46A 4DL2A 1JI7A 1WGYA 4ACOA 5ALGA 3W5VB 3OSNA 1SWVA 5JTIA 1QOAA 4WURA 4FLHA 2QB0A 3ZW3A 1AROP 3UQ0A 5KHOA 4F71A 2KACA 3EW9A 1Q3UA 3GIJA 1L0YB 5ALUA 3VVWB 5KL8B 4WJQA 3PX4A 1WE6A 2SAKA 5KFTA 2J6UA 3VHTC 2ZUDA 4QZCA 3DVNV 1F2RI 2D3AA 5DG7A 1TT5B 1WXAA 1ISNA 2W9CA 4WJNA 4O5EA 2EDUA 3Q8PB 3N97B 5ALKA 4QZFA 2JU6X 3PGEA 4IC7B 4TUUA 3NTUA 3HX0A 1L7OA 1X9MA 3VCBA 4BAXA 4ITKA 3I57A 1TYGB 2R2QA 2RPVA 4WAAA 2LKYA 3TBLD 1L5UA 3KFUF 3D2QA 4PHPA 4RZRA 4KTQA 2D10A 2ZTCA 2IYDB 4X57B 4EZ6A 4F4KA 2WXKA 4NAMA 2EAPA 4EUTA 1YZ6A 4M6WA 1FFUA 5J2EA 2G1EA 2N9LA 5HHHA 4UB2A 3THVA 4BKSD 3H4BA 1IP9A 2JSVX 1M6YA 3IDWA 2ZIVA 2A1JA 5CP2A 1COKA 2W82A 1GUAB 3APCA 3DCGA 3D6JA 4UB3A 4F8CB 2C2EA 1WFYA 5B66U 1NKCA 5BOLA 3SYZA 5G5HA 2J52A 3QNMA 2NPTA 1A5RA 2PPHA 3AE9B 3KW5B 4GDLB 1T0RC 1MC8A 3PY8A 2KC2A 3DBLI 4MHVA 1WXMA 4DL6A 1I42A 3AEAB 2QSDA 2IOFK 2PMZF 4HYKA 2MBBB 3NRZA 3RH6A 1VZ7A 3RCZA 4H2AA 2KXJA 1SBBB 1BPXA 2PFNA 2KIVA 1QQ5A 1IUEA 3T5JA 5GMVA 5LNK1 2HBMA 2BKFA 3GFKB 4QZAA 8ICPA 8ICXA 2DLBA 4FO6A 1PFDA 2BVCA 1P3QU 2GBRA 3MC0B 4YQWA 2LI6A 5KFCA 4IC9A 4RNAA 2JV3A 4C8LA 4B0MA 3HJEA 4Y2SA 4ED6A 1E6EB 2ZNVC 4URKA 2KDMA 1SXEA 3RYTA 2YVCA 5J2FA 2WGSA 4HJKA 4HDOA 3RNBC 2Z0DB 3RN9C 3QE9Y 2ZCBA 2WF6A 3PREA 1RRBA 2I1KA 4EEWA 2ISPA 1WX7A 3MHZA 3ZO5B 7ICOA 4QJFB 2DZIA 4ZRIA 4J6IA 3QUCA 2YEPB 2EANA 1F5SA 2MP2B 1C79A 3L3FX 1ZPSA 2KFJA 4FS1A 3H40A 2C28A 2OCEA 3PSTA 2KOBA 4UB6U 3CYMA 1BPDA 2LYHA 3RH4A 2G5HB 1LFDA 3DBLB 3SFEB 2IDYA 3TJPA 1IYFA 4KZCA 4MSMB 3WU2U 5IAAC 4L1BA 5J0UA 1RQNA 4IL6U 1WMHB 1HQRD 3AI5A 2K8CA
chains in the Genus database with same CATH topology
3B2FA 4IDIA 4P6VF 3R8BA 4A90A 5BYSA 3L4PA 2EELA 2XNAC 3FILA 3AECB 1EU3A 1FCLA 2CJOA 2MJ3A 1JROA 4LK0M 1XEEA 4KKIA 1L0VB 3U2SC 4DQOC 4JE3B 1K50A 3W1SA 1SB3C 2IGGA 2YEPF 1DOYA 2PKOA 4N6EB 1GPXA 4IKGA 2JXTA 1QOBA 1TS3A 1N60A 1N63A 1FCCC 1V1PB 1KRHA 2PVGC 3O13A 1SE3A 3ZYYX 3NZ3A 1YN3A 1CJEA 1VLBA 1VZ6A 4N59A 5G5GA 1ZXHA 2KQ4X 2VZKD 4JPSA 2W3RA 1J7CA 2WP9B 1B9RA 3Q8FA 3J9CA 2KN4A 4TQ0A 2RDGA 3ABVB 3NS1A 2N7JA 4CQNA 1DGJA 3C8YA 2L52A 4B0EA 4WH4A 2L1AA 1L6UA 4OHJA 1EWYC 3AN1A 4RF0A 4DXGA 3E56A 4L2YA 2K9XA 4US8A 2W3SA 4ZYSA 5EE1A 2JYTA 4XDDA 1PUTA 2R61A 2M19A 1E0ZA 3T3NA 1YQ3B 4WWMA 3Q8BA 1IBXA 2RDHA 1IBXB 1BMLC 1PGAA 3FILB 1SIJA 3BVGA 2ZW0A 2WU2B 4MM3B 4KGTA 4OVZA 3T3OA 2WDQB 1JRPA 2VZKB 3IAS1 3AE6B 4HJGE 1F0ZA 1L5PA 5AUIA 3AEFB 4USAA 5HG2A 3LYYA 3U4EG 1N5WA 1HZ6A 4OW0A 2LJIA 1XCQL 5H92C 1NYRA 2DBYA 4IOIE 2K5PA 2OEDA 2LUMA 1UWXA 1MPEA 1RYJA 1SF0A 2QILA 4J3OD 1XCTL 2QJLA 3U7ZA 1PGBA 4YWGG 3ZJTA 1CZPA 1CQVA 1KTKA 4RGMA 4RF1A 4YSZB 1JW9D 2WXFA 1WSPA 1MHHE 3RPFC 2BW2A 2J4XA 3LB8C 1FO4A 5MPOA 2MH7A 3EGRA 5FR3A 4ARCA 2SEBD 4RH6A 3AM9A 5JXVA 3BWUD 1UUPA 1C4AA 1HA5A 3BK1A 2WXGA 5BYRA 2PLPA 4P16A 2DYMA 2WXJA 1IGCA 1D5MC 1XLQA 2N9KA 4ZRQA 2HTME 5EE3A 3U52E 4YXDB 1FNVA 4MACA 1TS5A 3VR9B 1EWCA 1NYQA 1T5XD 1FXAA 3P4SB 5HHDG 1ENFA 3N9YC 4TQ1A 1L6VA 2WLBA 1JWSD 3UI3A 2JZPA 3B2GA 1OFFA 2BB5A 5D3IB 3AV8A 2LFIA 3AE5B 4HROA 3BK2A 4JX1C 3W2DA 1STEA 1FD6A 2WXLA 2GRIA 3NVVA 1C78A 1TZOA 3AE7B 3BYYB 2Z8LA 1NEKB 3AEGB 2E6XA 2PW9A 4A6QA 2AX5A 1JQ4A 1UNSA 1FMAD 4WQMA 1GB4A 1ZDVA 2KAJA 4NZLB 3ZGZA 1SSNA 1SEBD 4TSSA 2WXNA 2X38A 3URYA 1N5XA 2M56B 1DOIA 1C77A 3P4PB 2ON8A 2FUG1 2J53A 1D5ZC 1V1OA 1TJEA 2KMMA 2D5GA 2DWQA 3AEDB 1FXIA 2MEKA 2W55A 5D7GA 1ZXIA 3SR6A 1IGDA 2NTTA 1XF5L 1XO3A 3TSSA 2TSSA 4WAFA 2Y3AA 3Q8CA 3TEYA 5GXGB 1TKEA 2WNMA 3BIID 1HXYD 2AQ1B 1C4PA 2PMVA 1T6BX 1GAQB 1PDXA 1LO5D 3MFGA 3IT6B 3P42A 3TEXA 1TY2A 1XLOA 3WCQA 2WXHA 1QF6A 1FM0D 4HRSA 1K51A 1VR9A 3AEBB 1JWMD 1JWBD 1ROEA 4LTUA 1HEZE 5BMIA 3VRAB 1TS4A 5D3DA 1VJKA 1I4PA 2WXRA 1EU4A 1DOXA 1MHXA 1YMHE 3P63A 1NI3A 2GB1A 4JWSC 3KWLA 3ZJUA 1TY0A 2Q5WD 1BXTA 3Q8AA 3AE1B 3GP7A 4ARIA 5EE0A 1FIQA 2IJ0A 4YT0B 1YQ4B 1YJJA 1MI0A 3AE3B 1P7FA 2OHFA 1F2RC 5E6JA 1EM7A 1C9FA 4L23A 1C76A 1AYFA 2LHEA 4FXCA 4GLSC 3W9CB 1SJED 4OZCA 2BT6A 1MVKA 2Y5CA 3VR8B 4DXFA 1Y56A 5AUKA 1VRAB 3BZDB 1WYGA 1L4ZB 4OZBA 3I9V1 4RCOA 2PVOD 2V0GA 3VRBB 4D2KA 3NVZA 4EE2A 1I4RA 4JWUC 4NAWB 2H89B 1L4DB 4YTMB 2Y5PA 2E3TA 2HDEA 2JQRB 3AH7A 1B1ZA 2WS3B 1KLUD 1ZUD2 3V3XA 2ONQA 3R2TA 4LLGM 1E7PB 2LEKA 1XLNA 1QOGA 4A55A 2DYOA 2M0AA 1WRIA 3OWEB 1V8CA 3HVDA 1TKYA 1SE4A 1XXGA 3TUOA 3ZJVA 1I4GA 1C4CA 1E9MA 2EKIA 5T8IA 1T3QA 3VQIA 3BYTB 4ZOHC 4ZHOA 2NTSA 4A9AA 2MJDA 5BMHA 2GI9A 4C80A 3FC4A 2QEJC 3KQ4A 3HVZA 4YSXB 3NVYA 2BBCA 5EE9A 4N58A 4KKJA 2V4IB 1OQQA 3B9JA 1D5XC 1TS2A 2LHDA 3BVZA 2PIAA 2N0SB 3AE8B 1A70A 3BVMA 4RGNA 1E10A 4XDCA 1D4BA 1RWSA 2WXMA 1QLBB 2H88B 3P1MA 4UDUC 3NVWA 1VZ8A 1YNTE 1KF6B 2W54A 3GB1A 3DWGC 2BTEA 5I4DA 5BMGA 1FFVA 1FRDA 4KGRA 4KGSA 1V97A 1UGJA 4MT5A 2ZW1A 3H8HA 1K52A 3CWIA 1WGKA 2NMQA 1YJIA 4RGOS 4HEA1 4M0WA 1OQRA 1KH0A 1GOZA 3IAM1 3MJ5A 1ET9A 3PZ8A 4AQ7A 4XE0A 2MJEA 4XWWA 3TEWA 4RFBA 2CJNA 1ESFA 3IXSA 3HUIA 3KWVA 4YSYB 2INPE 3SFDB 4TMAB 5TSSA 1BUIC 2WXOA 4US9A 2J42A 4YTNB 3W5UB 1AN8A 1WXQA 2JWUA 2WXPA 2XN9C 1GB1A 4PT5A 2CU3A 2K0PA 3NUHB 2BB6A 3MP9A 4HKZE 2IGDA 1D6EC 5H8YE 1R7SA 1PGXA 3EA6A 3FAHA 2JYEA 4O1NA 1QKZA 5HI1A 1ZP0B 2LGIA 1I4QA 3IT4B 2AQ3B 3E9SA 2BYTA 1RFKA 1ACCA 3W5VB 2QIEB 4WURA 1QOAA 1I7HA 3HRDD 2PTLA 2KACA 1L0XB 4GDKB 1L0YB 1ZDXA 3CIRB 1JMLA 2I2YA 2SAKA 4REZA 1JWUD 2WU5B 1J7AA 2FE8A 3TEZA 2RMMA 4WIPA 1F2RI 1N61A 3PO0A 1QILA 3GS2A 5BYQA 2JU6X 1QOFA 5C3JB 3RFZB 1TKGA 2AQ2B 3LXFA 3KLSX 1NVID 4ITKA 2WXQA 2V3NA 3I57A 1YN5A 1TYGB 2IPKD 2RPVA 1FNWA 3PZ7A 2V3PA 2QMTA 2B76B 3ETRA 2WXKA 1AWDA 1ZOYB 4NAMA 4OZAA 4ZHPA 2G1EA 1FFUA 2WXIA 2N9LA 1K53A 4AS1A 2K3UA 1JCKB 3R2IA 2K22A 2KWDA 4ZRPA 1UWMA 1V1PA 1ET6A 2FBWB 1I4HA 1DYQA 2BS3B 2JSVX 2INNE 3Q8EA 4NJCA 2W82A 3SEBA 3P4RB 1FNUA 1F77A 3AB5A 4C7ZA 1QT9A 4KX6B 1CK1A 5G5HA 2J52A 2WDRB 3P4QB 3AE9B 1JWAD 4GDLB 1VDVA 5C2TB 5FKAC 1RM6C 1SE2A 2ICIA 4RGTA 4HKQA 3AEAB 2QSDA 2G9HD 3NRZA 1VZ7A 4C7YA 2ACZB 4H2AA 1SBBB 1I4XA 1KFYB 3AEEB 1IUEA 1J7BA 5LNK1 2L32A 1JALA 3EUB2 2BS2B 1N62A 2DLBA 5HFYA 1PFDA 3AE4B 1WWTA 1YN4A 3MC0B 1FRRA 2I38A 4RNAA 3V05A 4B0MA 3AE2B 2BS4B 4MH8A 1E6EB 4YTPB 1SXTA 1HZ5A 1XLPA 2KDMA 3ZQ4A 1AW7A 2LMCA 5FK9C 1Q10A 3DWMA 4R3DA 1ZE3D 1QQRA 2WDVB 3MHZA 1PYWD 4XWTA 1NENB 4A8XC 1SJHD 2YEPB 3AMZA 4Q2JA 2JX5A 1C79A 1ZPSA 2IGHA 1KLGD 4C56C 1M4VA 3SFEB 2IDYA 1FEHA 2L83A 3Q69A 4L1BA 2WQYB 1HQRD 1P7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J7A A;  3B2F A;  1L6V A;  2JQR B;  4IDI A;  4P6V F;  3AH7 A;  2WS3 B;  2WLB A;  3L4P A;  1ZUD 2;  1N61 A;  1E7P B;  2LEK A;  3AEC B;  1XLN A;  1QOG A;  3PO0 A;  3B2G A;  2CJO A;  1OFF A;  2MJ3 A;  1JRO A;  3AV8 A;  1WRI A;  3AE5 B;  1L0V B;  1V8C A;  1TKY A;  4HRO A;  4JX1 C;  1QOF A;  1E9M A;  5C3J B;  1SB3 C;  2EKI A;  1DOY A;  1T3Q A;  3NVV A;  1TKG A;  2PKO A;  3LXF A;  4N6E B;  1GPX A;  4ZOH C;  1NVI D;  4ITK A;  3AE7 B;  4A9A A;  4ZHO A;  2MJD A;  1NEK B;  3AEG B;  1QOB A;  1TYG B;  1N60 A;  1N63 A;  3P4S B;  2AX5 A;  1KRH A;  4C80 A;  1FMA D;  2PVG C;  4WQM A;  1JQ4 A;  3ZYY X;  3FC4 A;  2B76 B;  1CJE A;  1VLB A;  3ETR A;  2KAJ A;  4N59 A;  5G5G A;  1AWD A;  1ZOY B;  3HVZ A;  3NVY A;  4YSX B;  4ZHP A;  5EE9 A;  2W3R A;  1J7C A;  2G1E A;  1FFU A;  1N5X A;  2WP9 B;  4N58 A;  1B9R A;  2M56 B;  1DOI A;  3ABV B;  2K22 A;  3NS1 A;  1OQQ A;  3B9J A;  3P4P B;  1UWM A;  2FBW B;  1DGJ A;  2DWQ A;  1TJE A;  2BS3 B;  2KMM A;  2L52 A;  1A70 A;  2N0S B;  1FXI A;  2PIA A;  2W55 A;  3AE8 B;  1ZXI A;  3SR6 A;  1L6U A;  1E10 A;  1EWY C;  3AN1 A;  1RWS A;  3P4R B;  1QLB B;  3AB5 A;  1XO3 A;  2H88 B;  4C7Z A;  3P1M A;  2K9X A;  4US8 A;  2W3S A;  3NVW A;  5EE1 A;  5GXG B;  1PUT A;  1TKE A;  2M19 A;  1QT9 A;  3BII D;  1KF6 B;  4KX6 B;  1E0Z A;  2W54 A;  3DWG C;  5G5H A;  2WDR B;  1YQ3 B;  3P4Q B;  1GAQ B;  1PDX A;  1JWA D;  3AE9 B;  4WWM A;  1VDV A;  5C2T B;  1FFV A;  1FRD A;  1RM6 C;  1XLO A;  3WCQ A;  1V97 A;  1SIJ A;  1QF6 A;  1FM0 D;  4HRS A;  3AEA B;  1WGK A;  2WU2 B;  1YJI A;  3AEB B;  3CWI A;  3NRZ A;  1JWB D;  4C7Y A;  1OQR A;  1ROE A;  2ACZ B;  2WDQ B;  4LTU A;  1JRP A;  3VRA B;  1VJK A;  3AE6 B;  1F0Z A;  1L5P A;  5AUI A;  1DOX A;  2MJE A;  3AEF B;  4USA A;  1KFY B;  3AEE B;  1N5W A;  1IUE A;  1J7B A;  3P63 A;  2CJN A;  1NI3 A;  5H92 C;  1JAL A;  1NYR A;  3EUB 2;  2DBY A;  2K5P A;  2BS2 B;  3HUI A;  3KWL A;  4JWS C;  1N62 A;  2Q5W D;  4YSY B;  1PFD A;  3AE4 B;  1RYJ A;  1WWT A;  3AE1 B;  3SFD B;  4US9 A;  4YTN B;  1SF0 A;  5EE0 A;  1FIQ A;  3W5U B;  1WXQ A;  1FRR A;  4YT0 B;  2QJL A;  2CU3 A;  1YQ4 B;  1YJJ A;  1CZP A;  3AE2 B;  2BS4 B;  3AE3 B;  1E6E B;  2OHF A;  4YTP B;  4YSZ B;  1XLP A;  1JW9 D;  1AYF A;  3DWM A;  1R7S A;  5H8Y E;  3RPF C;  3FAH A;  4FXC A;  3LB8 C;  1FO4 A;  1ZP0 B;  2MH7 A;  2WDV B;  5MPO A;  3W9C B;  3AM9 A;  2BT6 A;  2Y5C A;  3VR8 B;  1NEN B;  1RFK A;  5AUK A;  3W5V B;  2QIE B;  1WYG A;  3AMZ A;  1QOA A;  1I7H A;  2JX5 A;  3HRD D;  2PVO D;  3VRB B;  1XLQ A;  3NVZ A;  2HTM E;  5EE3 A;  4YXD B;  4JWU C;  3SFE B;  2H89 B;  3CIR B;  3VR9 B;  2L83 A;  1NYQ A;  3AED B;  4YTM B;  1FXA A;  2WQY B;  2E3T A;  2WU5 B; 
#chains in the Genus database with same CATH topology
 4PZN A;  5AZH A;  4LZG A;  2KD1 A;  4IQT A;  3SAH A;  2V4R A;  3QUQ A;  1FCL A;  1A0P A;  1JRO A;  2C2D A;  4WJP A;  4R65 A;  4NNJ B;  4JE3 B;  1SZH A;  2B6G A;  2KFK B;  5KT3 A;  5DDM A;  2IGG A;  1DOY A;  4N6E B;  2N7D A;  3MGI A;  4IKG A;  5DPR A;  1WGD A;  1TS3 A;  1TAU A;  3PHX B;  1EF1 A;  1V1P B;  3L54 A;  2YY6 A;  3IG8 A;  1V80 A;  3ZYY X;  4BFR A;  4OJP A;  7ICK A;  1YN3 A;  1VZ6 A;  1ZXH A;  1UBI A;  2OYY A;  8ICK A;  3T79 A;  4JPS A;  1EF5 A;  1U4A A;  2I1J A;  4BGD A;  1QTM A;  3J9C A;  1KL9 A;  3ABV B;  4DCC A;  2N7J A;  4KLO A;  2CRX A;  4CQN A;  2L52 A;  4B0E A;  4MEL A;  4WH4 A;  1L6U A;  3SD7 A;  4OHJ A;  4EZK A;  2PE9 A;  2PI5 A;  4KVG B;  1ZQY A;  4NY0 A;  3T5L A;  4ANU A;  4C00 A;  4ZYS A;  3PO4 A;  4DQI A;  4IR1 A;  5EE1 A;  2GOW A;  4XDD A;  1KN5 A;  1TKD A;  1OXJ A;  1PUT A;  2R61 A;  3F2D A;  1DXS A;  3QU2 A;  2QDF A;  4DFM A;  1WX9 A;  3HIZ A;  9ICH A;  4WWM A;  2C5L C;  1IBX A;  2WAQ C;  9ICN A;  1V5T A;  3AXC A;  9ICK A;  3LDZ E;  4K1R B;  1SIJ A;  3RZW C;  3WKC A;  5KFH A;  2ZW0 A;  1BNP A;  4MM3 B;  2ZZP B;  3N1X C;  5FP0 A;  2WDQ B;  4JLC A;  1WMH A;  4ED0 A;  1WXV A;  5KAI U;  1BVS A;  5AUI A;  2DPI A;  4FHK A;  2ZJ5 A;  5HG2 A;  3UQ2 A;  1NJW A;  3VUW A;  2LJI A;  2WYQ A;  4EKU A;  2MP2 A;  2NBV B;  1MPE A;  5BO4 B;  4DLE A;  1HUO A;  1TZ1 A;  3APD A;  5H2F U;  1F0M A;  3M9N B;  3I5J C;  5KFI A;  3U7Z A;  3PPA A;  4UB8 U;  2NRZ A;  3Q8M A;  3F2C A;  4UB4 A;  1JN3 A;  1A6S A;  4IWQ A;  4RGM A;  4YSZ B;  1UT5 A;  4W9I A;  1TAQ A;  1MG4 A;  5TZV A;  2KNJ A;  2Q4T A;  4DF8 A;  4B6J A;  1MHH E;  2BW2 A;  2MBH A;  3NG0 A;  3UXN A;  5J0W A;  3LB8 C;  4BZA A;  2KG5 A;  3RFA A;  7ICE A;  4C4V B;  2YML A;  4YCX A;  2KSO A;  4F5O A;  2KX0 A;  5KFE A;  8ICL A;  1NZB A;  3BK1 A;  4II3 B;  4J03 A;  2G3Q B;  4LJO B;  4P1C C;  2O6K A;  2DYM A;  1WJU A;  2BDP A;  1C1Y B;  4ZRQ A;  5CEH A;  5EE3 A;  2AGP A;  4KLS A;  3IVF A;  2KJ8 A;  1RG6 A;  3QX7 A;  4A8E A;  2FLP A;  2GBM A;  2KQ7 A;  2C22 A;  4M02 A;  1T5X D;  5HHD G;  4C4V A;  4F4Y A;  5III A;  1A76 A;  4F4Z A;  1ZQD A;  3ZDD A;  4UAR A;  4ECW A;  1WGR A;  3QJZ A;  3UI3 A;  4C8K A;  2KNB A;  4DS5 A;  1QQ6 A;  5D3I B;  5D4B A;  3AE5 B;  2MRP A;  4Q8F A;  3H4D A;  3KHR A;  3BK2 A;  4JX1 C;  4RPY A;  5CHF A;  1L7P A;  5TIS U;  4DEZ A;  5KG6 A;  1N48 A;  1T0Q C;  2HJ8 A;  2W7P A;  5IIL A;  3JPN A;  2HHX A;  4ICA A;  5DGA A;  2PW9 A;  3M3J A;  4A6Q A;  2CN1 A;  4G11 A;  4WQM A;  2GBJ A;  5CWR A;  1NZP A;  2DGZ A;  3ZGZ A;  1WF9 A;  1SSN A;  5DG8 A;  4K7W A;  4TSS A;  4YP3 A;  1CRX A;  4GIV A;  5AI6 A;  4K3C A;  3FDS A;  2FMP A;  2PFQ A;  2KIC A;  7ICJ A;  1DOI A;  1TK5 A;  4PHD A;  3TQ1 A;  2FUG 1;  2J53 A;  3EFC A;  1WWV A;  1TJE A;  2KMM A;  4YMO A;  4BJQ A;  5HKH A;  2LGX A;  4UAZ A;  4O3Q A;  2NTT A;  3CRX A;  4KLM A;  2Y5B B;  3BS7 A;  1E8X A;  5DDY A;  4Q43 A;  3TSS A;  2Y1I A;  3LVV A;  4EX6 A;  2BKR B;  4LNO A;  3CP8 A;  1TKE A;  1D8Y A;  3MBY A;  2IO2 B;  4F4W A;  1LO5 D;  3BIN A;  5KFJ A;  3TEX A;  2KHQ A;  4OD0 A;  4CDG A;  1NNL A;  3M6K A;  1XS9 D;  1SKR A;  2BCR A;  2L7R A;  2WXH A;  1FM0 D;  8ICO A;  2NYV A;  2L76 A;  1QF6 A;  3ONS A;  3AEB B;  3HM6 X;  1ROE A;  2KTF A;  1HEZ E;  3C23 A;  2WXR A;  3JYU A;  1EU4 A;  3ZRC A;  2ZUC A;  2NS5 A;  4DWF A;  3TFR A;  3R3M A;  2I6X A;  3O65 B;  9ICM A;  1KTQ A;  4XYC A;  4MFC A;  5LLI A;  3KWL A;  1WGH A;  3GE3 C;  4CF3 A;  1WJN A;  3WKE A;  3Q8A A;  2OH2 A;  3AE1 B;  4KLU A;  4FZL A;  3GP7 A;  4BKG A;  2KLC A;  2GH1 A;  5EE0 A;  1FIQ A;  3KHG A;  2DZK A;  4ARI A;  1J8C A;  1WE7 A;  3PR4 A;  4B9N A;  4AYB C;  4KLE A;  2DZM A;  4PGX A;  4AJW A;  2DX5 B;  4DQP A;  1P7F A;  2OHF A;  1F2R C;  5L95 C;  2JXJ A;  3WK5 A;  2LYB A;  1BPY A;  1Y8R C;  3RJG A;  1KEJ A;  4FXC A;  4GLS C;  4JL9 A;  4KLI A;  3HWT A;  3W9C B;  1MJD A;  3PHW B;  4UBB A;  2BT6 A;  2J6S A;  3SAF A;  2MCN B;  4FBJ B;  4DXF A;  4EEK A;  1VRA B;  2RQ5 A;  1WYG A;  3C21 A;  3ZNG C;  5KFX A;  4RT2 A;  2GWS A;  1E7V A;  3S2A A;  4D2K A;  1X40 A;  1LGR A;  3QEA Z;  3NVZ A;  1EUV B;  3A1Q A;  3VAW A;  2JH1 A;  5KFV A;  4W9E A;  3WK7 A;  7ICV A;  1Z5S B;  4ED8 A;  3BS5 B;  5B5E U;  2FLN A;  3DHH C;  3AH7 A;  4QZI A;  1S76 D;  3V3X A;  3R2T A;  1XLN A;  4A55 A;  3PZD A;  4IR9 A;  4DQQ A;  2H5X A;  2DKZ A;  3OJ4 B;  4XRH A;  3HVD A;  2PE6 B;  5DLG A;  2WAQ F;  1SE4 A;  4GXB A;  4CHK A;  3H8M A;  1C4C A;  1I4G A;  1E9M A;  1JRU A;  2DUY A;  4LNF A;  2MSN A;  4B9L A;  2HOI A;  4ECS A;  2L05 A;  1T0S C;  4WJO A;  5KG2 A;  1E8Y A;  2DEN B;  3DEE A;  5AKJ A;  3D32 A;  3V60 A;  1DK3 A;  4I6L B;  3A9K A;  4Z6E A;  2ZPN A;  1LKY B;  1X9X A;  3TCA A;  1UA1 A;  4ECX A;  2V4I B;  2L0T A;  2E1F A;  1KQQ A;  1RFA A;  1TS2 A;  2LHD A;  1I35 A;  2PIA A;  3KZX A;  4TQR A;  2N0S B;  4B6W A;  4RGN A;  4GDL A;  5BOM A;  4XDC A;  2NPT B;  1URJ A;  2MRL A;  4QW9 A;  2DZJ A;  2WXM A;  1BPE A;  2W9B B;  4ECY A;  5C23 A;  2K8B A;  2K8B B;  3NVW A;  3WKB A;  2GBN A;  3H7S A;  2JEG A;  4GN1 A;  5L1I A;  4ZRJ A;  2HMX A;  3U7D A;  3OSP A;  2W54 A;  2BTE A;  2A1J B;  3NUQ A;  4HPP A;  2QCZ A;  4KGS A;  2H3I A;  2JGA A;  2WTF A;  1UGJ A;  3OPX A;  1PVQ A;  2ZW1 A;  4E74 A;  1UEL A;  4NLC A;  3A9J A;  3CWI A;  2HOF A;  4MGI E;  1ECW A;  4F7Z A;  4R8U A;  3MJ5 A;  3GZN I;  3F5E A;  1B22 A;  1E90 A;  4XE0 A;  2MJE A;  4NAW A;  2KKC A;  5J2A A;  3MGV A;  4R63 A;  3UMG A;  4GFJ A;  2XVT A;  3KWV A;  1KLV A;  5TSS A;  2FNJ B;  3ZNH B;  3W5U B;  1K1Q A;  1S8O A;  5KFZ A;  3QK0 A;  4PT5 A;  4ACF A;  4PH5 A;  2CU3 A;  1NBF C;  1UT8 A;  2AYO B;  3BZC A;  3LK9 A;  2W9C B;  4NLG A;  7ICS A;  5KG1 A;  4C8O A;  3GE8 C;  2V1Y A;  1D6E C;  4A20 A;  3M63 B;  2FCN A;  3FAH A;  1I4Q A;  4AJY B;  5KFS A;  1L7N A;  3BS5 A;  4BKT A;  1BGX T;  1WM2 A;  1ACC A;  1YX6 B;  3RI7 C;  2QIE B;  3TL5 A;  4QZH A;  1I7H A;  2J0J A;  2PTL A;  2WHI A;  2HJ1 A;  3H7P A;  4WWP A;  5F9L A;  2KDI A;  5KG5 A;  3QC8 B;  2JHD A;  4M2Y A;  1ZDX A;  8ICY A;  3K1Z A;  5J0S A;  4DFK A;  3ML9 A;  4JV0 A;  4IQW A;  1JML A;  2I2Y A;  5DB7 A;  4PK1 A;  3TAN A;  5ALW A;  3RJE A;  3H8J A;  4EBE A;  1JWU D;  4JV2 A;  2E8N A;  2BQR A;  4REZ A;  5FR6 A;  4TKN A;  3RB6 A;  4DLG A;  1NJY A;  2L0F A;  4WIP A;  2HCF A;  3PX6 A;  1X9W A;  4J9R A;  1X42 A;  3MGH A;  2PMZ C;  3RAQ A;  3RB3 A;  1L3U A;  5E6N A;  1QIL A;  1Q5W B;  1RYU A;  3P2B A;  3GS2 A;  1LQB A;  2OWO A;  1RYR A;  3A4R A;  5BYQ A;  4PYZ A;  1QOF A;  1L7M A;  4ELT A;  2O2V B;  5C3J B;  3PS6 A;  4BDP A;  1OTR B;  2DFL A;  4RU9 A;  3T5H A;  5E6O A;  1AQ6 A;  3DBR B;  2IPK D;  2KK0 A;  7ICH A;  1HEK A;  1FNW A;  3PZ7 A;  2V3P A;  2QMT A;  2B76 B;  1FPY A;  4XGA B;  2W11 A;  4RUC A;  1V5O A;  1K53 A;  3C2L A;  2K3U A;  5CJ7 A;  1JCK B;  1V1P A;  3DDC B;  2FBW B;  2UWQ A;  1XWL A;  3ZDA A;  1H8C A;  2INN E;  4NJC A;  1HTO A;  2D8C A;  1J0G A;  1L6N A;  3DDH A;  4J9Q A;  3KUZ A;  4UB1 A;  4MEY A;  3EEC A;  4C7Z A;  2JZB A;  3B0Y A;  1PQS A;  1QLN A;  1GO3 F;  2QLT A;  4ZRK A;  5D2M B;  4DSF A;  5IIJ A;  3K9P B;  3KYC D;  3ZXV A;  4S0R A;  1PVR A;  4KMO B;  1VDV A;  4DO9 A;  4TV3 A;  2ASJ A;  5IP4 D;  1CI4 A;  1SWW A;  2EAM A;  5JU5 A;  3FYH A;  3HT3 A;  1IG6 A;  2ODG A;  3JPQ A;  4GXJ A;  2PFO A;  1B0X A;  4CNQ A;  2N9P C;  3MHS D;  2MUT A;  1KFY B;  3PVL A;  3UIP B;  1J7B A;  4GXK A;  2QB1 A;  2L32 A;  4IW0 A;  3HM3 A;  5CHG A;  5ALV A;  1N62 A;  2YTU A;  3AQF A;  2JRI B;  2K25 A;  3SMV A;  4PL2 A;  5KT5 A;  1YN4 A;  4OJ6 A;  2IOH A;  4C0Z A;  4PL1 A;  1NK0 A;  5AKE A;  4DSK A;  3V05 A;  8ICE A;  3SD5 A;  4YTP B;  3AEV A;  2BCV A;  1XLP A;  3ZQ4 A;  4B95 A;  3QU9 A;  1AW7 A;  5FK9 C;  4M9H A;  2G0A A;  5DBA A;  4GC7 A;  2HHS A;  2WDV B;  3V7K A;  4IRC A;  1Z4N A;  4ECV A;  1PYW D;  4A8X C;  2KDE B;  2VJ4 A;  3HW8 A;  3B0A A;  4Q2J A;  2JX5 A;  4E0D A;  5KFO A;  5DGB A;  2IGH A;  2KMC A;  1KLG D;  3NY5 A;  4C56 C;  4QZ9 A;  4M8M A;  2FMS A;  4ECU A;  5CTR C;  3QUT A;  2KSO B;  2IBI B;  4AP4 C;  3Q69 A;  4P0P A;  5EDS A;  3QYP A;  4KIT B;  1X66 A;  3R8B A;  4UAU A;  2JEJ A;  5J17 A;  4J9S A;  2F1J A;  3L4P A;  4DL7 A;  2XNA C;  3IRU A;  3JPP A;  2CJO A;  3E58 A;  4PGY A;  4UBC A;  1XEE A;  4KKI A;  4NQK E;  2ZJA A;  4LNI A;  1U49 A;  3KOO A;  3W1S A;  1SB3 C;  4FJV B;  2YEP F;  2PKO A;  1S10 A;  8ICC A;  2HTH A;  1S0V A;  2L8J A;  5J2J A;  3E2E A;  5KFG A;  1N63 A;  4W9D A;  2M0N A;  1KRH A;  5KT6 A;  4F2S A;  1SE3 A;  1CJE A;  2D6F C;  3M95 A;  4RQ5 A;  4I6P A;  1QSL A;  2F1H A;  2FCM A;  5ALI A;  4FS2 A;  1S77 D;  3Q8F A;  2IHN A;  2RDG A;  2XY6 A;  1ZQA A;  1UA0 A;  4ZRP A;  4F72 A;  2J0K A;  4RQ0 A;  2N1V A;  3C8Y A;  2GLS A;  2VKQ A;  1P0R A;  1EWY C;  3AN1 A;  3HKZ F;  3VH4 B;  2H3Q A;  4F5N A;  5HNK A;  3E56 A;  4DXG A;  3JVZ X;  5IIO A;  4OJ5 A;  1XD3 B;  4US8 A;  2K9X A;  3OAW A;  4F50 A;  2BWE S;  3LVW A;  3KVF B;  3V61 A;  3LWL A;  4Y2T A;  2M19 A;  5L83 A;  2DAF A;  3T3N A;  1C7Y A;  7ICQ A;  2LPE A;  2RDH A;  1NDD A;  3CW2 C;  2WDT B;  1TBE A;  3FIL B;  3K9O B;  2F3N A;  3SU8 X;  5KL1 B;  2JY6 A;  3QU5 A;  4KGT A;  4ECQ A;  1LM8 B;  1JRP A;  3HP6 A;  3IM1 A;  4HJG E;  2H3Z A;  2ATL A;  8ICB A;  2HOQ A;  1NK7 A;  4ED2 A;  5GTI U;  3U4E G;  1N5W A;  3RJK A;  1HZ6 A;  5ALD A;  7ICP A;  1T7P A;  3U8Z A;  2L3Z A;  4NJ6 A;  2AJQ A;  4QIW C;  4C8M A;  4J3O D;  9ICW A;  3CST A;  4GB9 A;  5TR5 A;  2QJL A;  4DSI A;  3ZJT A;  1CZP A;  4BWM A;  2KJH B;  4XZ4 A;  4FAD A;  4FFD A;  5LXH A;  1ZGU B;  2J4X A;  1FO4 A;  5MPO A;  3UM9 A;  1MSW D;  1WY8 A;  8ICG A;  3JSV B;  3AM9 A;  5AI0 A;  5JXV A;  2G07 A;  3SI8 A;  2C7M B;  5J2D A;  1C4A A;  4ECZ A;  5EWF A;  4HPL B;  2XCA A;  5J2K A;  3AUO A;  3BQ2 A;  4PS7 A;  3IG3 A;  3ZUN A;  4IS7 A;  4RQN A;  3IN5 A;  1V6E A;  4XA5 A;  4GOC A;  3U52 E;  2HTM E;  2KJ6 A;  4YXD B;  1WIA A;  5KFY A;  3RB0 A;  3VR9 B;  4KSK C;  2KZ3 A;  4NQL B;  2MW5 A;  1ZRM A;  2E5S A;  1ZJM A;  2PI4 A;  4CE6 A;  2M0X A;  2DYB A;  2LZ6 A;  4TQ1 A;  4F1S A;  4WWO A;  1V85 A;  3RBE A;  7ICT A;  1KFD A;  2B0C A;  5J0Q A;  4O3R A;  1V9P A;  2BPF A;  2XY5 A;  1QQ7 A;  2JZP A;  3B2G A;  2FJ6 A;  3L16 A;  4U6P A;  5J2G A;  1OFF A;  2ZCC A;  1SGH A;  3AV8 A;  1VJ5 A;  2LFI A;  3WAL A;  1E8W A;  4HRO A;  2MWS B;  3W2D A;  3C29 A;  4GGQ A;  3RMK C;  2GRI A;  2HE7 A;  3IFW B;  3JPO A;  4Q8E A;  3AE7 B;  5AK3 A;  1ZQZ A;  4RNN A;  3AEG B;  4DSL A;  1JQ4 A;  1UNS A;  2LYA A;  1FMA D;  2HBK A;  4NZL B;  3NJT A;  1YQB A;  1SKS A;  4G3I A;  5J8Y A;  2WF7 A;  1SEB D;  1D8L A;  2ZVO A;  3EZ5 A;  3URY A;  1N5X A;  2AH5 A;  5DPW A;  4F2R A;  4K3B A;  1QCK A;  2BQU A;  2K89 A;  5KG7 A;  2M56 B;  2O2V A;  2WF5 A;  1KJT A;  3OLM D;  4ICV A;  3C1Y A;  3QHT A;  4KMU A;  1D5Z C;  2DWQ A;  5IOI A;  1D3Z A;  2D5G A;  2MEK A;  2W55 A;  4O3S A;  1ZXI A;  1IGD A;  1TTN A;  5KT4 A;  2KWU B;  3M7D A;  4QZE A;  2K1F A;  1XO3 A;  2TSS A;  3FKY A;  9ICV A;  1E7U A;  2WNM A;  2CHW A;  3BII D;  2BDU A;  4J9K A;  5IIN A;  3QXG A;  2ESE A;  9ICX A;  2IY0 B;  1T6B X;  2LGD A;  2V9H A;  2NBW B;  1GAQ B;  3Q3J A;  3HIL A;  1X9S A;  4W9L A;  3RUL A;  5KAF U;  3DPD A;  4EEL A;  1DOQ A;  3MTN B;  3UQB A;  3RB4 A;  1JWB D;  1LV5 A;  1TK8 A;  5ALF A;  2KKV A;  7ICN A;  1TS4 A;  1VJK A;  3CSF A;  3IHP C;  5D3D A;  4J9L A;  3PLV A;  3O0F A;  1X6J A;  3DQV A;  2LHT A;  2JWZ A;  2AQ4 A;  4I2E A;  1YMH E;  2OJR A;  2ZTD A;  2KV2 A;  1XSL A;  2LI5 A;  1K1S A;  2F8K A;  5ALR A;  4JWS C;  1TY0 A;  2Q5W D;  4EOY A;  3D2N A;  1BXT A;  2K4P A;  2MBO A;  4YT0 B;  1NK9 A;  4FUL A;  5L9X A;  5IO9 A;  1YQ4 B;  4IUM B;  2NO5 A;  1YJJ A;  2VJ5 A;  3KHH A;  3RRH A;  3K75 D;  3L08 A;  3PW7 A;  5KFR A;  5DB6 A;  1C9F A;  4L23 A;  1WZ0 A;  4RPZ A;  1N6Z A;  4PZO A;  2EMT A;  4DHZ E;  1XQQ A;  2YQE A;  5HML A;  5CA7 A;  2LHE A;  1RYS A;  2WF8 A;  5EOZ A;  1HUZ A;  1SJE D;  2INC C;  2DHZ A;  5E79 U;  3ZDB A;  3JPR A;  3DBR I;  1Y56 A;  1MQ2 A;  3TAQ A;  3U26 A;  4RCO A;  2V0G A;  1OW5 A;  1OQY A;  3BQ0 A;  2F44 A;  1PVP A;  4HDQ A;  3V72 A;  1T0Y A;  2WB1 F;  4QWE A;  2NBU A;  4CYE A;  2BQ3 A;  2ZIX A;  2KVR A;  3VTV A;  1MA7 A;  4EE2 A;  3MDC A;  3BDP A;  5AHX A;  2NV3 A;  2W9A A;  2KHV A;  2K8A A;  1U47 A;  1P7D A;  2Y5P A;  4O3N A;  2BZF A;  2JQR B;  4MDK E;  5IIK A;  2WS3 B;  1ZUD 2;  2F77 X;  1H38 A;  4RQ3 A;  2LEK A;  1QOG A;  2B21 A;  4NLN A;  5DKW A;  2BR0 A;  1C20 A;  2M0A A;  2YB1 A;  3RNF C;  3GZN B;  4C4R A;  1V8C A;  3QQ8 B;  4HWI B;  1XXG A;  2XCP A;  2W04 A;  4YR3 A;  4K7U A;  3VQI A;  4M6W B;  3A4S C;  4BVU C;  4ZOH C;  1F52 A;  2NTS A;  5IIM A;  2MBQ A;  2MJD A;  3HHM A;  2BWF A;  3DVG X;  1F44 A;  1XO1 A;  3UMB A;  1BNO A;  5D46 A;  3WK4 A;  4JGH B;  4DXA B;  2F76 X;  3NVY A;  4UQG A;  5EE9 A;  2BYE A;  2W9N A;  2CS4 A;  4KKJ A;  2G09 A;  1BT0 A;  2A5U A;  2LMR A;  4QWA A;  3B9J A;  1D5X C;  1U45 A;  5DQG A;  3AE8 B;  1A70 A;  3BVM A;  3LDA A;  2C7N B;  3IBE A;  3MR5 A;  1D4B A;  3K4G A;  3M6Z A;  1J2N A;  4QWC A;  4JQW C;  4UDU C;  2M17 A;  1ZQW A;  3Q8S B;  3Q8L A;  5I4D A;  5BMG A;  1FFV A;  2NO4 A;  4FN2 A;  1PK3 A;  5AKY A;  4KGR A;  2PEA A;  1V97 A;  3DBH I;  3V6J A;  1TK0 A;  4MT5 A;  2KMD A;  5L1K A;  1OEY J;  4YN4 A;  4AP9 A;  1RQL A;  1ZYQ A;  1WR1 A;  1OQR A;  4PS3 A;  1GOZ A;  3IAM 1;  4ANX A;  3TIX A;  7ICI A;  4P2H A;  3Q8K A;  2I5H A;  4F91 B;  4FJZ A;  3IXS A;  3V7J A;  4YSY B;  1QH9 A;  4F5Q A;  2RHF A;  2W7O A;  5AKI A;  4RQ7 A;  2WXO A;  2J42 A;  3JPS A;  2BCQ A;  2FMQ A;  2JWU A;  2WXP A;  1U48 A;  3Q3M C;  3RRG A;  2K0P A;  3NUH B;  1YIW A;  4GIB A;  3MP9 A;  4GLX A;  5AKX A;  4NM1 A;  3AU5 A;  4J9M A;  3QCA A;  1Z1V A;  5ALZ A;  5L1L A;  2L5Y A;  3MC9 A;  4O1N A;  2EKE C;  1ZP0 B;  3ZIM A;  5AK4 A;  2LWP A;  4JK1 A;  4Y2U A;  3E9S A;  2MU2 A;  1ZQL A;  3KUD B;  1N2X A;  4P4O A;  1RFK A;  1FEZ A;  3A0H U;  3V62 A;  3GIL A;  1ZQR A;  2UVU A;  4B9K A;  4BX9 C;  3Q3O C;  2IO1 B;  1L0X B;  4KLQ A;  4GDK B;  1D9F A;  2HDO A;  4F4X A;  2P6R A;  4N9F 4;  3DBH B;  5E6P A;  2C7H A;  3KUC B;  3NZS A;  2BF8 B;  2BGF A;  9ICF A;  2AL6 A;  2WU5 B;  4WWN A;  1J7A A;  1R4M B;  1RAX A;  3TEZ A;  3L17 A;  3VUX A;  8ICZ A;  1WJ4 A;  1BPZ A;  1N61 A;  3H0M B;  2DF4 B;  3PO0 A;  1TFR A;  2D3D A;  3OHA A;  1V86 A;  3QEB Z;  4MEM A;  2OOB B;  2UYZ B;  5AKZ A;  2NRW A;  4DL5 A;  3WA0 A;  5LXI B;  4I27 A;  2AQ2 B;  3SV3 A;  3T3F A;  3KLS X;  3LJ3 A;  3SV4 A;  2WXQ A;  3QUB A;  1F1H A;  1IIP A;  2EMS A;  1IPG A;  3PW0 A;  3DBS A;  2N1R A;  3PW4 A;  3ETR A;  2IBK A;  1ZOY B;  2MX2 A;  2LVQ A;  2XC9 A;  4TQS A;  9ICO A;  4M0W B;  2KWV B;  1NKB A;  4AS1 A;  3R2I A;  1DK2 A;  2K22 A;  4B9V A;  4LDT D;  4QZ8 A;  4EBC A;  5HR7 A;  1ET6 A;  2JUO A;  1KW4 A;  2XGP A;  1I4H A;  1DYQ A;  1L7Y A;  2C60 A;  5AM5 A;  2KO3 A;  3Q8E A;  2Y0S F;  5HR6 A;  2KN5 A;  1FNU A;  2JPH A;  1F77 A;  3AB5 A;  2J0M A;  3SEN A;  3KH0 A;  2G4S A;  1UH6 A;  4EZL A;  5ALO A;  4RQ8 A;  2IMW P;  3WKD A;  3X0W A;  4YMM A;  1L3S A;  8ICN A;  5IA7 A;  4KX6 B;  9ICT A;  3ZVV A;  1KRP A;  2JZ3 B;  2WDR B;  4K81 A;  2ZEQ A;  4GXI A;  3NGD A;  4G50 A;  5IN7 A;  4QZD A;  3PVX A;  2ICI A;  4HKQ A;  3PR5 B;  2DKX A;  4NY8 A;  4Y2J A;  4F5R A;  4P0Q B;  2HVH A;  3R7Q A;  5HP4 A;  4C7Y A;  4OVV A;  2IHM A;  3UXO A;  4DBG A;  4NJ8 A;  1YX5 B;  3UMC A;  1DRG A;  4KLD A;  3ETL A;  2KHW B;  1UQV A;  3HK0 A;  5ALX A;  1UHU A;  3EUB 2;  2NVU I;  4YFK A;  1WWT A;  4PHA A;  2ZIU B;  1RLF A;  5DQI A;  1SGG A;  5AZF A;  3X23 A;  4KX5 A;  3JPT A;  1JMS A;  2QKQ A;  2LBO A;  2BS4 B;  4MH8 A;  1S5L U;  1UF0 A;  1HZ5 A;  1QSY A;  4DWI A;  3Q2A C;  2FPL A;  2LMC A;  4PJ0 U;  3ISB A;  2A1A A;  1GC6 A;  4NJ7 A;  4R3D A;  5A0L A;  3TAR A;  4Y2Y A;  3SZ2 A;  1QQR A;  2XI9 A;  2HD5 B;  1EXN A;  4XWT A;  1S0M A;  3KZI U;  4O5K A;  1NEN B;  1SJH D;  4J9O A;  4MH0 E;  3GV8 B;  3AMZ A;  4CF4 A;  2F1I A;  2QAR B;  2MBE A;  2O6V B;  3V7L A;  5D6J B;  4ECT A;  5DB8 A;  2ZPY A;  5KFW A;  4MM3 A;  4XUS A;  1KM7 A;  1M4V A;  3RNC C;  2KEY A;  4RQ6 A;  1CMX B;  4IM0 A;  3A0B U;  5CR0 A;  1FEH A;  2L83 A;  3PRM B;  1G6J A;  2WQY B;  2Z59 B;  2W43 A;  3B2F A;  4IDI A;  4P6V F;  2O6V A;  2PXI A;  4A90 A;  2JRZ A;  3AEC B;  5JHB A;  9ICJ A;  1EU3 A;  2K39 A;  5J0X A;  2MJ3 A;  3RF9 A;  3JSV A;  3TAC B;  3MR3 A;  5ALH A;  1L0V B;  4ANW A;  4DQO C;  2YMQ A;  5J29 A;  1PK1 A;  1D9D A;  3PTF C;  4DS4 A;  1T8E A;  3WAO A;  1GPX A;  3AU4 A;  3GOE A;  1QOB A;  1Q1O A;  2CXY A;  1FCC C;  5KFN A;  2XY7 A;  3H6N A;  3NZ3 A;  1VLB A;  4O3P A;  5G5G A;  4ED3 A;  4MFF A;  2KQ4 X;  4BWJ A;  2VZK D;  1MG8 A;  1ZKH A;  1C3T A;  2WP9 B;  4DHJ B;  1NJX A;  2KN4 A;  4TQ0 A;  3V6C B;  3NS1 A;  5JRT A;  5J0R A;  1DGJ A;  4X5V A;  1SV4 A;  4C4T A;  5AM0 A;  5AKL A;  1YD8 U;  3ALB A;  8ICM A;  4RF0 A;  4RT3 A;  3RR8 A;  4L2Y A;  4I2F A;  3NS8 A;  4O5C A;  2JYT A;  2AXT U;  4EYI B;  4Y2X A;  4RUA A;  3ZDE A;  5DG9 A;  2FAZ A;  2MSE D;  4BBN C;  2K8C B;  1SV0 C;  9ICG A;  2CHZ A;  3Q8B A;  4DFP A;  8ICR A;  1PGA A;  2KMA A;  1JXE A;  4MJS A;  4KLT A;  4PS8 A;  2KTR A;  2AWT A;  2WU2 B;  1PUZ A;  1NK8 A;  4W9G A;  1T94 A;  2KD0 A;  4OVZ A;  3T3O A;  4IG7 B;  5C0Y A;  3ZDC A;  3IAS 1;  3AE6 B;  4HCN B;  4MSQ B;  1F0Z A;  4CGZ A;  1L5P A;  5AIA A;  8ICI A;  4USA A;  5DPS A;  2VA2 A;  4IWP A;  4YG2 A;  5J0O A;  4MGY E;  5H92 C;  2DBY A;  1JX4 A;  4IOI E;  2OED A;  2QAR A;  1XC9 A;  3IV6 A;  2DQN B;  8ICW A;  1UWX A;  3VUY A;  1RYJ A;  3RJF A;  1SF0 A;  2QIL A;  3BJY A;  4LNK A;  4UAY A;  2WWZ A;  2PFP A;  9ICC A;  1XCT L;  2E8O A;  2VRR B;  4KDL B;  4YWG G;  4FZN A;  1CQV A;  1KTK A;  1J2M A;  4RF1 A;  4I2A A;  2VH1 A;  1COO A;  1JW9 D;  2WXF A;  2RDJ A;  3PX0 A;  1WSP A;  1O08 A;  4CCH A;  3RPF C;  3KD3 A;  3QAQ A;  4E71 A;  3PW5 A;  4ARC A;  3C28 A;  2SEB D;  1X1M A;  4BKS A;  1SXD A;  3RZF A;  3BWU D;  1UUP A;  3GZF A;  3VC8 A;  1XO0 A;  3B08 A;  2Q0Z X;  2DNF A;  2HI0 A;  2PLP A;  2GBK A;  2WXJ A;  4JUZ A;  4J9P A;  3BZK A;  4O9M A;  1D5M C;  4MFA A;  1XLQ A;  4IM2 A;  5KFU A;  1FNV A;  4MF2 A;  2Y9T A;  3PLU A;  4MAC A;  2IOF A;  3RJJ A;  1ZQE A;  4B9U A;  2V4Q A;  2JEF A;  1EWC A;  2ASQ A;  4GDK A;  1FXA A;  3P4S B;  1ENF A;  3N9Y C;  1KFT A;  1LXD A;  5BPC A;  3LWM A;  1K8R B;  1L6V A;  4RM8 A;  4EX7 A;  1JWS D;  2E1E A;  2X8X X;  2BB5 A;  3N7P D;  1WRD B;  2D11 A;  3OJU A;  3GV7 B;  5DBC A;  1KFS A;  2DL0 A;  2IZV B;  1PZN A;  1UPH A;  4CRX A;  1STE A;  3KKA C;  1WI0 A;  4KZ0 A;  2WXL A;  4I29 A;  1C78 A;  5J2I A;  2BCS A;  1ZQQ A;  2CPR A;  2Z8L A;  3MAB A;  2CU1 A;  2E6X A;  4NLZ A;  1N56 A;  9ICI A;  3DHG C;  1GB4 A;  2RSU A;  2BPG A;  2JH7 A;  5DB9 A;  3M8R A;  2I9G A;  2PJH A;  1UBQ A;  4W9C A;  4TUR A;  4JWM A;  8ICQ A;  2X38 A;  3IG5 A;  4I28 A;  2JMG A;  2OEH A;  2KVS A;  1C77 A;  2FIF A;  2XO7 A;  8ICJ A;  4EZ9 A;  2KTR B;  2ON8 A;  4MJS B;  4DDG D;  4MF8 A;  3AED B;  1FXI A;  1V9J A;  4RNO A;  2NRT A;  3SR6 A;  2NRX A;  2JZZ A;  2KX3 A;  4OJL A;  3QWZ B;  5ALS A;  1XF5 L;  4AUQ C;  3GII A;  1KDH A;  3QA8 A;  4FE3 A;  4EFO A;  4WAF A;  2Y3A A;  1Z00 A;  3Q8C A;  1RZT A;  3H9D A;  2W9M A;  2AQ1 B;  5AI8 A;  4HCP B;  3PSP A;  8ICU A;  3MFG A;  3P42 A;  1YZ7 A;  4BXO A;  2XEW A;  1ZD3 A;  5AI5 A;  1R4N B;  4A3O A;  3M8S A;  4HRS A;  1VR9 A;  2MA9 B;  4S17 A;  1HE8 A;  1JWM D;  2KVZ A;  4LTU A;  3ALR A;  2QB0 B;  3UIO B;  3QZ8 A;  3WKA A;  2VH2 A;  4G9B A;  1WR6 E;  1MHX A;  2MAX A;  7ICG A;  2HBJ A;  3RJH A;  3ZKJ C;  5AKG A;  2HHU A;  1Z2M A;  4LJP B;  3ZJU A;  2UVW A;  2YX8 A;  4YD2 A;  3BY4 B;  3MJW A;  3Q14 C;  2JRH A;  3SDL C;  3M62 B;  1WYW B;  1ZW7 A;  4PHE A;  3KHL A;  2JF5 A;  5AEK B;  4KLH A;  2XK5 A;  4AWJ A;  1E8Z A;  2ZTE A;  3Q8R B;  5KFF A;  3EYZ A;  2ISO A;  1AYF A;  2ZIW B;  4P7I A;  3ZTC A;  2BPC A;  2BGW A;  2W8K A;  2D07 B;  4OZC A;  2M1M A;  3H0L B;  1MVK A;  2LVP A;  3VR8 B;  4YMN A;  1VCB A;  2EQY A;  1ZOL A;  1ZQT A;  2E8M A;  2W8L A;  2YLM A;  1L4Z B;  1OGW A;  3BZD B;  4OZB A;  3UIN B;  3I9V 1;  2KC1 A;  2V3S A;  3VRB B;  1ZQB A;  2LGY A;  2Y1J A;  5CHW A;  4DL4 A;  2KDF B;  3PSE B;  4NLB A;  3NZU A;  4YR0 A;  2VA3 A;  2JT4 B;  4JWU C;  1S0N A;  1L4D B;  4EZJ A;  1ZQG A;  3H7P B;  4DFJ A;  4LVS A;  2HDE A;  3ECI A;  3UQA A;  5ALJ A;  5DQH A;  3RJI A;  3EWA A;  4PPX A;  1KLU D;  1S9F A;  3MFI A;  1GG3 A;  2QC8 A;  5KT2 A;  1E7P B;  2UU7 A;  4Q45 A;  4KIK B;  4LDT B;  1NK5 A;  2DYO A;  3WAM A;  1WRI A;  3WAN A;  4O0I A;  5CRX A;  1WCL A;  4B9S A;  3ZJV A;  3TUO A;  1Z00 B;  2ZIU A;  3ISC A;  5EWE A;  2EKI A;  1T3Q A;  3A33 B;  3DHI C;  3BYT B;  1U4B A;  4A9A A;  3N1Y C;  5GTH U;  5BMH A;  4RMA A;  4LJX A;  2CR5 A;  1ZQH A;  3TI0 A;  3FC4 A;  2QEJ C;  4R64 A;  1WG8 A;  2A3V A;  3KQ4 A;  3L10 B;  4O3M A;  2ZJ8 A;  3HVZ A;  4YSX B;  1X2I A;  4FHJ A;  4GC6 A;  4IRK A;  4N58 A;  3I63 C;  4F3O A;  9ICS A;  3N7R C;  5DCN A;  1GNU A;  1OQQ A;  2KQS A;  2A19 A;  5J2C A;  4BBN F;  1L3V A;  1E10 A;  2ZJD A;  2ZNV B;  2D3C A;  1U9L A;  2AGQ A;  7ICL A;  2ZUB A;  2G5I B;  3N28 A;  1QLB B;  1RWS A;  4EEY A;  2UVV A;  2KZR A;  2H88 B;  3P1M A;  3A9J B;  4CO7 A;  4Y2R A;  4RPX A;  4XQ8 A;  3BQ1 A;  2LGS A;  3VTU A;  1VZ8 A;  4DOA A;  1YNT E;  1K5O A;  2KWC A;  2KZM A;  2IO3 B;  2H3F A;  4DOC A;  3V6E B;  4I2C A;  1FRD A;  1IXR A;  3BQT A;  4UAS A;  1Z19 A;  2G4D B;  3N30 A;  5JZE B;  4ZYN A;  2GO7 A;  2JVC A;  8ICA A;  3H8H A;  4QNL A;  2BHN A;  1KBU A;  1K52 A;  1A77 A;  3ENE A;  5KG3 A;  7ICR A;  1YJI A;  3N32 A;  5J8Y C;  2W9B A;  1XNS A;  3N4M B;  4DDI D;  4M0W A;  1FXT B;  4Y2P A;  4JV1 A;  4IRD A;  1R4M I;  4I2D A;  1ET9 A;  3PZ8 A;  4AQ7 A;  2V9W A;  3J81 j;  3C2M A;  2KN7 A;  3CF6 E;  1J97 A;  3TEW A;  4M8N A;  2ZIX B;  2NR2 A;  3I1Y A;  2KOX A;  4RFB A;  2CJN A;  1ZQN A;  3HUI A;  1X6I A;  2RP5 A;  3K1R B;  4M00 A;  2HHW A;  2LJ5 A;  3L0W B;  2INP E;  3SFD B;  4TMA B;  5ALP A;  4MGZ E;  3ZDM C;  2BKE A;  4HAI A;  1AN8 A;  8ICS A;  2XN9 C;  3WAP A;  2ZVN A;  2XIC A;  1V2Y A;  4NWI A;  2A4Z A;  2BB6 A;  2J7Q B;  4I2J A;  3WK9 A;  1ZET A;  1WGG A;  2F8L A;  2R8I A;  4XC2 A;  1RXW A;  4UB5 A;  5H8Y E;  1R7S A;  1PGX A;  2IND C;  1QSS A;  4M01 A;  2GLE A;  1QKZ A;  2G45 B;  3WK6 A;  3IT4 B;  2J6T A;  1KOT A;  2K6Q A;  2BYT A;  1SL2 A;  1L8O A;  1ZQF A;  4AYB F;  3T9L A;  8ICF A;  2OJW A;  3GV5 B;  9ICQ A;  3HRD D;  3RNA C;  4EEN A;  4M9N A;  2KFN A;  2QHO A;  4P4M A;  5AKH A;  3N20 C;  1ZQX A;  4M47 A;  3OG5 A;  4QZB A;  4F8R A;  1T4G A;  3E0F A;  2AEH A;  3TAP A;  4ELU A;  3CIR B;  3H0R B;  3H7I A;  4M04 A;  2LVO A;  1TE2 A;  3V6K A;  2FE8 A;  4KX3 A;  3OGU A;  2BCU A;  2ES6 A;  2KLG A;  2RMM A;  1GJZ A;  1ZD2 P;  2ZIW A;  2HHT A;  2KVC A;  3W1S C;  4HLE A;  2KIW A;  4QW8 A;  4DL3 A;  1NK4 A;  4E3C A;  2XK5 B;  2D2Q A;  4MEX A;  2LRU A;  2R8J A;  1KKX A;  4KDI C;  1XSP A;  3DOW A;  4NXZ A;  3ORY A;  3RFZ B;  1TKG A;  3LXF A;  2DPJ A;  2CKH B;  1NVI D;  2RD0 A;  3Q3N C;  4JMU A;  4M9J A;  1E5W A;  2V3N A;  1V49 A;  2I1Q A;  1TIF A;  1YN5 A;  2CHX A;  4IQV A;  2PKE A;  5J2R A;  5K4L A;  1SE9 A;  1AWD A;  1HTQ A;  5JHA A;  4OZA A;  4ZHP A;  9ICB A;  5KFM A;  5AI9 A;  2ASL A;  2KAN A;  3ZNZ B;  4A3P A;  2WXI A;  3APF A;  2P35 A;  3ED5 A;  4LNN A;  4K7S A;  2KWD A;  1UWM A;  1L8L A;  2BS3 B;  3F2B A;  4BXO B;  2K60 A;  3TAD C;  3SEB A;  4KIK A;  3PO5 A;  4C8N A;  3MC1 A;  2EZY A;  2Y0S C;  2YMM A;  3RAX A;  7ICU A;  1QT9 A;  1Y88 A;  1XU4 A;  1V38 A;  2KP7 A;  3ICX A;  1CK1 A;  2WX0 A;  3NRW A;  4YXM A;  3P4Q B;  1JWA D;  2ZG6 A;  5D94 A;  5C2T B;  5FKA C;  3WCQ A;  4ANV A;  1RM6 C;  1ZQK A;  1SE2 A;  4RGT A;  5AI4 A;  1SL0 A;  3RH5 A;  5KFD A;  2MLB A;  4W9J A;  4GMV A;  5C1Z A;  2G9H D;  3OJS A;  1AAR A;  4Y2Q A;  2HHV A;  1R4N I;  2ACZ B;  4F5P A;  4WJ3 B;  1YOV B;  3AUL A;  5AK6 A;  1I4X A;  3L13 A;  1TAM A;  2KTQ A;  1Q8K A;  9ICE A;  5J2H A;  2KZZ A;  3OTQ A;  2RGF A;  2RPQ A;  3AEE B;  2KE7 A;  2WFA A;  3JW0 X;  3C5F A;  1JAL A;  3G6Y A;  1V81 A;  2KKP A;  2BS2 B;  5JH5 C;  5HFY A;  4KLG A;  3PSF A;  4UW9 A;  3AE4 B;  4IWO A;  2RRD A;  1CUK A;  3KBB A;  1VD2 A;  2FE9 A;  3HPO A;  1FRR A;  1P9D U;  2I38 A;  2VAN A;  3PV8 A;  1UCV A;  4DSJ A;  4ED1 A;  2UVR A;  5EWG A;  1CEZ A;  5CB1 A;  4BOS C;  3L5K A;  3AE2 B;  3AL0 B;  3ONN A;  2XID A;  2R18 A;  1UD7 A;  1SXT A;  1JUD A;  3QX1 A;  2FCS A;  1Q10 A;  3DWM A;  1DGS A;  1ZQS A;  1ZE3 D;  2R2O A;  3TAD A;  4Z6D A;  1F9J A;  2EZZ A;  2GOL A;  4Z6C A;  4KLF A;  5ALL A;  2Z0E B;  3MFH A;  1J19 A;  3RNG C;  1ZD4 A;  5AIB A;  1RDF A;  2MA1 A;  2KYW A;  4TUQ A;  4RQ1 A;  3EPI A;  3IP4 B;  4RM9 A;  2Y9U A;  3UXP A;  3VDZ A;  1WZ3 A;  3QU7 A;  2E8P A;  2P6U A;  1OUQ A;  3G6V A;  1BPB A;  3N1Z C;  3B0X A;  1P7E A;  1B4F A;  1ZQI A;  7ICF A;  2K4H A;  4IQU A;  1ZQO A;  3V6H A;  2IY1 B;  5G2N A;  1WCN A;  2LM4 A;  2BPS A;  5BYS A;  2EEL A;  4QWB A;  3FIL A;  5L1M A;  3FM9 A;  1Q3V A;  2HVI A;  4G0N B;  4LK0 M;  3PNC A;  3U2S C;  2ALZ A;  1K50 A;  5CX3 A;  3S6J A;  2XBB C;  2NRV A;  5IKC M;  3U30 A;  4KLJ A;  5G55 A;  3MR2 A;  2JXT A;  1Q0W B;  3I76 A;  1ZQ1 C;  3MDA A;  3TMP B;  5ALQ A;  2OXO A;  1N60 A;  2IO0 B;  1OEY A;  4BUG A;  2PVG C;  5J0T A;  3O13 A;  3GIM A;  4N59 A;  4LZD A;  3N3K B;  2W3R A;  1J7C A;  2N7E A;  5T14 A;  9ICR A;  1B9R A;  3D2S A;  5KG0 A;  4KLL A;  5KFA A;  2MQJ A;  4DF4 A;  4RQM A;  2L1A A;  1JXL A;  3MR6 A;  1S0O A;  3PML A;  5KG4 A;  1TGZ B;  2RR9 A;  3PV1 A;  2W3S A;  4DHZ B;  2VIX A;  1WUD A;  2KFZ A;  3KKA A;  1E0Z A;  5AM3 A;  2VA8 A;  5HMM A;  5AM2 A;  4TUP A;  3C5G A;  1YQ3 B;  1WX8 A;  1LVH A;  1IBX B;  1BML C;  5L1J A;  2WF9 A;  1WJ6 A;  1S97 A;  4I2G A;  3BVG A;  5J0Y A;  4W9K A;  3AQE A;  3G6X A;  2JZB B;  3EPG A;  3NOB A;  4DHJ D;  5AM1 A;  2NCN A;  4ICU A;  5KHQ A;  2VZK B;  4OVU A;  3UPQ A;  5F3X B;  3ZD8 A;  4FJY A;  3M9O B;  3AEF B;  5ALE A;  4BOZ B;  2YN4 A;  9ICU A;  3LYY A;  3T5K A;  4OW0 A;  3MC8 A;  1IM4 A;  1XCQ L;  3WIM A;  2ZXH A;  1NYR A;  2K5P A;  3ML8 A;  2LUM A;  3SHQ A;  4YVZ A;  1YT3 A;  1WM3 A;  1WH3 A;  1ZQV A;  5DLF A;  1B43 A;  5CHV C;  2FLL A;  4QZG A;  2FCQ A;  5HHI A;  4K4G A;  9ICP A;  5ALN A;  1NK6 A;  1GC7 A;  1PGB A;  3OHB A;  3RUI B;  4ASW C;  4YL8 A;  4II2 B;  3ZD9 A;  5J0P A;  1YJ1 A;  2KFK A;  2JEI A;  3Q8Q B;  2V4L A;  4LCD E;  4NL9 A;  1TV9 A;  4JIO U;  4PYU A;  1EO6 A;  2MH7 A;  3EGR A;  5FR3 A;  1ED1 A;  5DPT A;  1XSN A;  3T8M A;  4RH6 A;  4U7C A;  2K4E A;  2WB1 C;  2K6D B;  4QWD A;  1IV8 A;  3I28 A;  3SQI A;  1HA5 A;  3DVG Y;  2WXG A;  4XX5 A;  4UAW A;  5BYR A;  4P16 A;  2N9E B;  2JR5 A;  3M9M B;  2FUH B;  1IGC A;  5J18 A;  2N9K A;  2P66 A;  2FID A;  2MUT B;  2FDR A;  2C9W B;  5KFB A;  1TS5 A;  4NPN A;  1NYQ A;  2HW3 A;  2KJ9 A;  7ICM A;  2M9N A;  3KTQ A;  2K4I A;  4AOF A;  5D49 A;  2WLB A;  3Q3F A;  2D3G A;  3F5A A;  8ICT A;  1D8B A;  4M9G A;  3DV9 A;  3UF8 A;  1MQ3 A;  5AK5 A;  2LUE A;  1NKE A;  2REX A;  3TKA A;  4UAV A;  3PRP B;  4OCZ A;  4G3X B;  9ICA A;  2EZX A;  4ZDV A;  1FD6 A;  3NVV A;  3QU4 A;  2EH9 A;  4KSL C;  1TZO A;  4HK2 A;  1RPL A;  3BYY B;  4MGK E;  1NEK B;  5KNI A;  4EYH B;  1S1Q B;  2AX5 A;  4I2I A;  3PT2 B;  4P4P A;  1SKW A;  1ZDV A;  2KAJ A;  3M1Y A;  3H1U A;  1L2N A;  3ZI4 A;  2K8H A;  4FZM A;  1O03 A;  3GDX A;  4ECR A;  1ZQM A;  2WHE A;  2KT7 A;  2WXN A;  1MN8 A;  3P4P B;  1WXS A;  3QZ7 A;  1PK1 B;  1V1O A;  1MFW A;  3C0R B;  5AM4 A;  5D7G A;  3CMM B;  4R8U B;  2LD9 A;  3DVN U;  1ZRN A;  5ALY A;  5KFQ A;  3PSI A;  2R8K A;  3ZNI D;  2LRW A;  2AHO B;  3VFK A;  4Y2V A;  3TEY A;  2KJ5 A;  5GXG B;  1H4R A;  1HXY D;  4W9F A;  1C4P A;  2PMV A;  1QZE A;  1HJP A;  1PDX A;  4I2H A;  3R9K A;  4TUS A;  2N1W A;  3IT6 B;  1TY2 A;  1XLO A;  2L00 B;  4FBU A;  2LXA A;  3GIK A;  4DOB A;  1K51 A;  3Q6B A;  4B9T A;  3GU3 A;  5BMI A;  4I6N B;  3VRA B;  2ZIV B;  5J2B A;  1I4P A;  1DOX A;  5ALM A;  4KN4 A;  4B9M A;  3P63 A;  1NI3 A;  2GB1 A;  4NLK A;  2N9X A;  4J9N A;  2ZXI A;  2LM1 A;  4Q44 A;  4HXD A;  1WWU A;  4F93 B;  3B1L X;  4OO1 J;  1S3S G;  4FA6 A;  5AZG A;  3PRZ A;  2IJ0 A;  4HPM B;  2BYF A;  2O6V D;  1SZP A;  2H3V A;  2KDB A;  3C1Z A;  2BQQ A;  1SV0 A;  1Z3E B;  4QAY A;  1T3N A;  1MI0 A;  3AE3 B;  2YB4 A;  3KYD D;  2MHJ A;  4DQR A;  5E6J A;  1EM7 A;  4RNM A;  1C76 A;  2LXC A;  5JUM A;  8ICV A;  2GMI C;  2IA6 A;  4PGQ A;  2AGO A;  4DSE A;  4NM2 A;  3VH3 B;  5AIC A;  4UAT A;  4FBT A;  1NI2 A;  1ZQP A;  4F92 B;  4P0P B;  2Y5C A;  2AU0 A;  5AUK A;  3QIJ A;  2ASD A;  2PVO D;  5KFK A;  3LYS A;  4DQS A;  3WK8 A;  5DBB A;  3PMN A;  3ISD A;  4P0Q A;  1RXV A;  1ZQJ A;  2R8H A;  1I4R A;  1HIW A;  4RQ2 A;  4NAW B;  9ICL A;  1KSP A;  2H89 B;  3A1Q B;  4YTM B;  4M0A A;  2E3T A;  1P98 A;  2KK8 A;  1B1Z A;  5AKK A;  3SEI A;  2FI1 A;  2F2A B;  2ONQ A;  4LLG M;  4C4S A;  1JIH A;  1LB2 B;  4O3O A;  1Z4O A;  1L3T A;  2HBL A;  1UZX B;  2RDI A;  4P1B C;  3OWE B;  3TFS A;  4QIW F;  4RQ4 A;  1TKY A;  3P4R B;  4GSW A;  2FPM A;  2EAO A;  8ICH A;  5T8I A;  3EC8 A;  2M8S A;  4I2B A;  4NV0 A;  2XGQ A;  4DK5 A;  1NJZ A;  4ZHO A;  3N7S C;  2GI9 A;  2AQ0 A;  1ZJN A;  3HKZ C;  1NOM A;  4C80 A;  1M94 A;  4Z6F A;  1Z1B A;  1LKY A;  4M9L A;  2BBC A;  5KFL A;  3VXW A;  3A9K B;  3RR7 A;  3I3T B;  2DAJ A;  3NHE B;  4NL9 C;  3H8W A;  4EBD A;  1SIF A;  1XT9 B;  3SAG A;  3BVZ A;  4ED7 A;  2YMP A;  3AU6 A;  3QAR A;  1UGM A;  2KJR A;  1P1A A;  2M4N A;  3PZP A;  2BYV E;  2OM6 A;  4HVB A;  3H8S A;  3GQC A;  2N4F A;  4R66 A;  5KT7 A;  3RBD A;  1KF6 B;  4YD1 A;  2R8G A;  3DWG C;  3GB1 A;  4JWN A;  2LAS A;  3NAS A;  2Z7J A;  3ZXR A;  4W9H A;  3F53 A;  1TVA A;  3C2K A;  3UGB B;  5ALT A;  2G08 A;  2C2R A;  2JXX A;  4YXJ A;  4ELV A;  2G06 A;  3R66 C;  3RTV A;  1WGK A;  2NMQ A;  4GU2 A;  4KV2 A;  3VTW A;  3ZDT A;  2D3B A;  4HEA 1;  4RGO S;  1KH0 A;  1ZD5 A;  4WQO B;  2W03 A;  3R7R A;  4JB3 A;  1SL1 A;  2WX1 A;  3ZTD A;  5C5J A;  4ZH4 A;  3PW2 A;  3EHV A;  1KLN A;  4XWW A;  2HSZ A;  4YR2 A;  4K4I A;  1ESF A;  2AL3 A;  3RNE C;  2RLT A;  2RDB C;  1BUI C;  4US9 A;  4YTN B;  3EFU A;  2HHQ A;  4CF5 A;  1WXQ A;  3ZRF A;  1GB1 A;  3C19 A;  3RD2 A;  4K4H A;  2B3A A;  5KFP A;  1ZQU A;  3IHQ B;  4KN7 A;  3CNH A;  2FPK A;  3RT3 B;  3AU2 A;  4HKZ E;  2IGD A;  3ZLZ A;  5KTQ A;  5F9N A;  3EA6 A;  3W1Y A;  4DFD A;  3OJ3 A;  4IM3 A;  2JYE A;  4OJO A;  5HI1 A;  2LGI A;  3BQ7 A;  2AQ3 B;  1ZQC A;  1Q46 A;  4DL2 A;  1JI7 A;  1WGY A;  4ACO A;  5ALG A;  3W5V B;  3OSN A;  1SWV A;  5JTI A;  1QOA A;  4WUR A;  4FLH A;  2QB0 A;  3ZW3 A;  1ARO P;  3UQ0 A;  5KHO A;  4F71 A;  2KAC A;  3EW9 A;  1Q3U A;  3GIJ A;  1L0Y B;  5ALU A;  3VVW B;  5KL8 B;  4WJQ A;  3PX4 A;  1WE6 A;  2SAK A;  5KFT A;  2J6U A;  3VHT C;  2ZUD A;  4QZC A;  3DVN V;  1F2R I;  2D3A A;  5DG7 A;  1TT5 B;  1WXA A;  1ISN A;  2W9C A;  4WJN A;  4O5E A;  2EDU A;  3Q8P B;  3N97 B;  5ALK A;  4QZF A;  2JU6 X;  3PGE A;  4IC7 B;  4TUU A;  3NTU A;  3HX0 A;  1L7O A;  1X9M A;  3VCB A;  4BAX A;  4ITK A;  3I57 A;  1TYG B;  2R2Q A;  2RPV A;  4WAA A;  2LKY A;  3TBL D;  1L5U A;  3KFU F;  3D2Q A;  4PHP A;  4RZR A;  4KTQ A;  2D10 A;  2ZTC A;  2IYD B;  4X57 B;  4EZ6 A;  4F4K A;  2WXK A;  4NAM A;  2EAP A;  4EUT A;  1YZ6 A;  4M6W A;  1FFU A;  5J2E A;  2G1E A;  2N9L A;  5HHH A;  4UB2 A;  3THV A;  4BKS D;  3H4B A;  1IP9 A;  2JSV X;  1M6Y A;  3IDW A;  2ZIV A;  2A1J A;  5CP2 A;  1COK A;  2W82 A;  1GUA B;  3APC A;  3DCG A;  3D6J A;  4UB3 A;  4F8C B;  2C2E A;  1WFY A;  5B66 U;  1NKC A;  5BOL A;  3SYZ A;  5G5H A;  2J52 A;  3QNM A;  2NPT A;  1A5R A;  2PPH A;  3AE9 B;  3KW5 B;  4GDL B;  1T0R C;  1MC8 A;  3PY8 A;  2KC2 A;  3DBL I;  4MHV A;  1WXM A;  4DL6 A;  1I42 A;  3AEA B;  2QSD A;  2IOF K;  2PMZ F;  4HYK A;  2MBB B;  3NRZ A;  3RH6 A;  1VZ7 A;  3RCZ A;  4H2A A;  2KXJ A;  1SBB B;  1BPX A;  2PFN A;  2KIV A;  1QQ5 A;  1IUE A;  3T5J A;  5GMV A;  5LNK 1;  2HBM A;  2BKF A;  3GFK B;  4QZA A;  8ICP A;  8ICX A;  2DLB A;  4FO6 A;  1PFD A;  2BVC A;  1P3Q U;  2GBR A;  3MC0 B;  4YQW A;  2LI6 A;  5KFC A;  4IC9 A;  4RNA A;  2JV3 A;  4C8L A;  4B0M A;  3HJE A;  4Y2S A;  4ED6 A;  1E6E B;  2ZNV C;  4URK A;  2KDM A;  1SXE A;  3RYT A;  2YVC A;  5J2F A;  2WGS A;  4HJK A;  4HDO A;  3RNB C;  2Z0D B;  3RN9 C;  3QE9 Y;  2ZCB A;  2WF6 A;  3PRE A;  1RRB A;  2I1K A;  4EEW A;  2ISP A;  1WX7 A;  3MHZ A;  3ZO5 B;  7ICO A;  4QJF B;  2DZI A;  4ZRI A;  4J6I A;  3QUC A;  2YEP B;  2EAN A;  1F5S A;  2MP2 B;  1C79 A;  3L3F X;  1ZPS A;  2KFJ A;  4FS1 A;  3H40 A;  2C28 A;  2OCE A;  3PST A;  2KOB A;  4UB6 U;  3CYM A;  1BPD A;  2LYH A;  3RH4 A;  2G5H B;  1LFD A;  3DBL B;  3SFE B;  2IDY A;  3TJP A;  1IYF A;  4KZC A;  4MSM B;  3WU2 U;  5IAA C;  4L1B A;  5J0U A;  1RQN A;  4IL6 U;  1WMH B;  1HQR D;  3AI5 A;  2K8C A; 
#chains in the Genus database with same CATH homology
 3B2F A;  4IDI A;  4P6V F;  3R8B A;  4A90 A;  5BYS A;  3L4P A;  2EEL A;  2XNA C;  3FIL A;  3AEC B;  1EU3 A;  1FCL A;  2CJO A;  2MJ3 A;  1JRO A;  4LK0 M;  1XEE A;  4KKI A;  1L0V B;  3U2S C;  4DQO C;  4JE3 B;  1K50 A;  3W1S A;  1SB3 C;  2IGG A;  2YEP F;  1DOY A;  2PKO A;  4N6E B;  1GPX A;  4IKG A;  2JXT A;  1QOB A;  1TS3 A;  1N60 A;  1N63 A;  1FCC C;  1V1P B;  1KRH A;  2PVG C;  3O13 A;  1SE3 A;  3ZYY X;  3NZ3 A;  1YN3 A;  1CJE A;  1VLB A;  1VZ6 A;  4N59 A;  5G5G A;  1ZXH A;  2KQ4 X;  2VZK D;  4JPS A;  2W3R A;  1J7C A;  2WP9 B;  1B9R A;  3Q8F A;  3J9C A;  2KN4 A;  4TQ0 A;  2RDG A;  3ABV B;  3NS1 A;  2N7J A;  4CQN A;  1DGJ A;  3C8Y A;  2L52 A;  4B0E A;  4WH4 A;  2L1A A;  1L6U A;  4OHJ A;  1EWY C;  3AN1 A;  4RF0 A;  4DXG A;  3E56 A;  4L2Y A;  2K9X A;  4US8 A;  2W3S A;  4ZYS A;  5EE1 A;  2JYT A;  4XDD A;  1PUT A;  2R61 A;  2M19 A;  1E0Z A;  3T3N A;  1YQ3 B;  4WWM A;  3Q8B A;  1IBX A;  2RDH A;  1IBX B;  1BML C;  1PGA A;  3FIL B;  1SIJ A;  3BVG A;  2ZW0 A;  2WU2 B;  4MM3 B;  4KGT A;  4OVZ A;  3T3O A;  2WDQ B;  1JRP A;  2VZK B;  3IAS 1;  3AE6 B;  4HJG E;  1F0Z A;  1L5P A;  5AUI A;  3AEF B;  4USA A;  5HG2 A;  3LYY A;  3U4E G;  1N5W A;  1HZ6 A;  4OW0 A;  2LJI A;  1XCQ L;  5H92 C;  1NYR A;  2DBY A;  4IOI E;  2K5P A;  2OED A;  2LUM A;  1UWX A;  1MPE A;  1RYJ A;  1SF0 A;  2QIL A;  4J3O D;  1XCT L;  2QJL A;  3U7Z A;  1PGB A;  4YWG G;  3ZJT A;  1CZP A;  1CQV A;  1KTK A;  4RGM A;  4RF1 A;  4YSZ B;  1JW9 D;  2WXF A;  1WSP A;  1MHH E;  3RPF C;  2BW2 A;  2J4X A;  3LB8 C;  1FO4 A;  5MPO A;  2MH7 A;  3EGR A;  5FR3 A;  4ARC A;  2SEB D;  4RH6 A;  3AM9 A;  5JXV A;  3BWU D;  1UUP A;  1C4A A;  1HA5 A;  3BK1 A;  2WXG A;  5BYR A;  2PLP A;  4P16 A;  2DYM A;  2WXJ A;  1IGC A;  1D5M C;  1XLQ A;  2N9K A;  4ZRQ A;  2HTM E;  5EE3 A;  3U52 E;  4YXD B;  1FNV A;  4MAC A;  1TS5 A;  3VR9 B;  1EWC A;  1NYQ A;  1T5X D;  1FXA A;  3P4S B;  5HHD G;  1ENF A;  3N9Y C;  4TQ1 A;  1L6V A;  2WLB A;  1JWS D;  3UI3 A;  2JZP A;  3B2G A;  1OFF A;  2BB5 A;  5D3I B;  3AV8 A;  2LFI A;  3AE5 B;  4HRO A;  3BK2 A;  4JX1 C;  3W2D A;  1STE A;  1FD6 A;  2WXL A;  2GRI A;  3NVV A;  1C78 A;  1TZO A;  3AE7 B;  3BYY B;  2Z8L A;  1NEK B;  3AEG B;  2E6X A;  2PW9 A;  4A6Q A;  2AX5 A;  1JQ4 A;  1UNS A;  1FMA D;  4WQM A;  1GB4 A;  1ZDV A;  2KAJ A;  4NZL B;  3ZGZ A;  1SSN A;  1SEB D;  4TSS A;  2WXN A;  2X38 A;  3URY A;  1N5X A;  2M56 B;  1DOI A;  1C77 A;  3P4P B;  2ON8 A;  2FUG 1;  2J53 A;  1D5Z C;  1V1O A;  1TJE A;  2KMM A;  2D5G A;  2DWQ A;  3AED B;  1FXI A;  2MEK A;  2W55 A;  5D7G A;  1ZXI A;  3SR6 A;  1IGD A;  2NTT A;  1XF5 L;  1XO3 A;  3TSS A;  2TSS A;  4WAF A;  2Y3A A;  3Q8C A;  3TEY A;  5GXG B;  1TKE A;  2WNM A;  3BII D;  1HXY D;  2AQ1 B;  1C4P A;  2PMV A;  1T6B X;  1GAQ B;  1PDX A;  1LO5 D;  3MFG A;  3IT6 B;  3P42 A;  3TEX A;  1TY2 A;  1XLO A;  3WCQ A;  2WXH A;  1QF6 A;  1FM0 D;  4HRS A;  1K51 A;  1VR9 A;  3AEB B;  1JWM D;  1JWB D;  1ROE A;  4LTU A;  1HEZ E;  5BMI A;  3VRA B;  1TS4 A;  5D3D A;  1VJK A;  1I4P A;  2WXR A;  1EU4 A;  1DOX A;  1MHX A;  1YMH E;  3P63 A;  1NI3 A;  2GB1 A;  4JWS C;  3KWL A;  3ZJU A;  1TY0 A;  2Q5W D;  1BXT A;  3Q8A A;  3AE1 B;  3GP7 A;  4ARI A;  5EE0 A;  1FIQ A;  2IJ0 A;  4YT0 B;  1YQ4 B;  1YJJ A;  1MI0 A;  3AE3 B;  1P7F A;  2OHF A;  1F2R C;  5E6J A;  1EM7 A;  1C9F A;  4L23 A;  1C76 A;  1AYF A;  2LHE A;  4FXC A;  4GLS C;  3W9C B;  1SJE D;  4OZC A;  2BT6 A;  1MVK A;  2Y5C A;  3VR8 B;  4DXF A;  1Y56 A;  5AUK A;  1VRA B;  3BZD B;  1WYG A;  1L4Z B;  4OZB A;  3I9V 1;  4RCO A;  2PVO D;  2V0G A;  3VRB B;  4D2K A;  3NVZ A;  4EE2 A;  1I4R A;  4JWU C;  4NAW B;  2H89 B;  1L4D B;  4YTM B;  2Y5P A;  2E3T A;  2HDE A;  2JQR B;  3AH7 A;  1B1Z A;  2WS3 B;  1KLU D;  1ZUD 2;  3V3X A;  2ONQ A;  3R2T A;  4LLG M;  1E7P B;  2LEK A;  1XLN A;  1QOG A;  4A55 A;  2DYO A;  2M0A A;  1WRI A;  3OWE B;  1V8C A;  3HVD A;  1TKY A;  1SE4 A;  1XXG A;  3TUO A;  3ZJV A;  1I4G A;  1C4C A;  1E9M A;  2EKI A;  5T8I A;  1T3Q A;  3VQI A;  3BYT B;  4ZOH C;  4ZHO A;  2NTS A;  4A9A A;  2MJD A;  5BMH A;  2GI9 A;  4C80 A;  3FC4 A;  2QEJ C;  3KQ4 A;  3HVZ A;  4YSX B;  3NVY A;  2BBC A;  5EE9 A;  4N58 A;  4KKJ A;  2V4I B;  1OQQ A;  3B9J A;  1D5X C;  1TS2 A;  2LHD A;  3BVZ A;  2PIA A;  2N0S B;  3AE8 B;  1A70 A;  3BVM A;  4RGN A;  1E10 A;  4XDC A;  1D4B A;  1RWS A;  2WXM A;  1QLB B;  2H88 B;  3P1M A;  4UDU C;  3NVW A;  1VZ8 A;  1YNT E;  1KF6 B;  2W54 A;  3GB1 A;  3DWG C;  2BTE A;  5I4D A;  5BMG A;  1FFV A;  1FRD A;  4KGR A;  4KGS A;  1V97 A;  1UGJ A;  4MT5 A;  2ZW1 A;  3H8H A;  1K52 A;  3CWI A;  1WGK A;  2NMQ A;  1YJI A;  4RGO S;  4HEA 1;  4M0W A;  1OQR A;  1KH0 A;  1GOZ A;  3IAM 1;  3MJ5 A;  1ET9 A;  3PZ8 A;  4AQ7 A;  4XE0 A;  2MJE A;  4XWW A;  3TEW A;  4RFB A;  2CJN A;  1ESF A;  3IXS A;  3HUI A;  3KWV A;  4YSY B;  2INP E;  3SFD B;  4TMA B;  5TSS A;  1BUI C;  2WXO A;  4US9 A;  2J42 A;  4YTN B;  3W5U B;  1AN8 A;  1WXQ A;  2JWU A;  2WXP A;  2XN9 C;  1GB1 A;  4PT5 A;  2CU3 A;  2K0P A;  3NUH B;  2BB6 A;  3MP9 A;  4HKZ E;  2IGD A;  1D6E C;  5H8Y E;  1R7S A;  1PGX A;  3EA6 A;  3FAH A;  2JYE A;  4O1N A;  1QKZ A;  5HI1 A;  1ZP0 B;  2LGI A;  1I4Q A;  3IT4 B;  2AQ3 B;  3E9S A;  2BYT A;  1RFK A;  1ACC A;  3W5V B;  2QIE B;  4WUR A;  1QOA A;  1I7H A;  3HRD D;  2PTL A;  2KAC A;  1L0X B;  4GDK B;  1L0Y B;  1ZDX A;  3CIR B;  1JML A;  2I2Y A;  2SAK A;  4REZ A;  1JWU D;  2WU5 B;  1J7A A;  2FE8 A;  3TEZ A;  2RMM A;  4WIP A;  1F2R I;  1N61 A;  3PO0 A;  1QIL A;  3GS2 A;  5BYQ A;  2JU6 X;  1QOF A;  5C3J B;  3RFZ B;  1TKG A;  2AQ2 B;  3LXF A;  3KLS X;  1NVI D;  4ITK A;  2WXQ A;  2V3N A;  3I57 A;  1YN5 A;  1TYG B;  2IPK D;  2RPV A;  1FNW A;  3PZ7 A;  2V3P A;  2QMT A;  2B76 B;  3ETR A;  2WXK A;  1AWD A;  1ZOY B;  4NAM A;  4OZA A;  4ZHP A;  2G1E A;  1FFU A;  2WXI A;  2N9L A;  1K53 A;  4AS1 A;  2K3U A;  1JCK B;  3R2I A;  2K22 A;  2KWD A;  4ZRP A;  1UWM A;  1V1P A;  1ET6 A;  2FBW B;  1I4H A;  1DYQ A;  2BS3 B;  2JSV X;  2INN E;  3Q8E A;  4NJC A;  2W82 A;  3SEB A;  3P4R B;  1FNU A;  1F77 A;  3AB5 A;  4C7Z A;  1QT9 A;  4KX6 B;  1CK1 A;  5G5H A;  2J52 A;  2WDR B;  3P4Q B;  3AE9 B;  1JWA D;  4GDL B;  1VDV A;  5C2T B;  5FKA C;  1RM6 C;  1SE2 A;  2ICI A;  4RGT A;  4HKQ A;  3AEA B;  2QSD A;  2G9H D;  3NRZ A;  1VZ7 A;  4C7Y A;  2ACZ B;  4H2A A;  1SBB B;  1I4X A;  1KFY B;  3AEE B;  1IUE A;  1J7B A;  5LNK 1;  2L32 A;  1JAL A;  3EUB 2;  2BS2 B;  1N62 A;  2DLB A;  5HFY A;  1PFD A;  3AE4 B;  1WWT A;  1YN4 A;  3MC0 B;  1FRR A;  2I38 A;  4RNA A;  3V05 A;  4B0M A;  3AE2 B;  2BS4 B;  4MH8 A;  1E6E B;  4YTP B;  1SXT A;  1HZ5 A;  1XLP A;  2KDM A;  3ZQ4 A;  1AW7 A;  2LMC A;  5FK9 C;  1Q10 A;  3DWM A;  4R3D A;  1ZE3 D;  1QQR A;  2WDV B;  3MHZ A;  1PYW D;  4XWT A;  1NEN B;  4A8X C;  1SJH D;  2YEP B;  3AMZ A;  4Q2J A;  2JX5 A;  1C79 A;  1ZPS A;  2IGH A;  1KLG D;  4C56 C;  1M4V A;  3SFE B;  2IDY A;  1FEH A;  2L83 A;  3Q69 A;  4L1B A;  2WQY B;  1HQR D;  1P7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...