3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
3B2GA 1T3QA 3SR6A 2BS4B 3B9JA 4A9AA 2BS2B 3ZYYX 3AE4B 2WLBA 1JQ4A 1NENB 1NVID 1I7HA 1PDXA 3AEGB 1FIQA 1FRDA 1FXAA 2WDQB 4C7ZA 1JALA 3AEAB 1CZPA 3RPFC 1L5PA 1RFKA 3AM9A 3NRZA 3AE9B 2L52A 1N60A 1PFDA 1L6VA 1QOBA 3CIRB 1UWMA 1TKEA 2K22A 1WGKA 1FRRA 2CJNA 3P63A 2WU5B 3SFEB 1WRIA 1AWDA 4N58A 4YXDB 1J7AA 2Y5CA 3AE5B 1KFYB 3AEBB 1L0VB 4JX1C 4KX6B 4N6EB 1QOAA 1IUEA 4YSXB 5MPOA 1DGJA 1XO3A 2WDRB 2OHFA 4ZHOA 2CJOA 1N5XA 5AUKA 2W54A 1YQ3B 4YSYB 3VRBB 3VRAB 1FXIA 2MJ3A 4WQMA 1EWYC 1GPXA 1WWTA 1TKGA 1OFFA 1YJJA 2WQYB 3AE6B 4WWMA 2EKIA 5H92C 2M19A 1SB3C 2DWQA 2JQRB 2L83A 1NYRA 2K5PA 4HRSA 4JWSC 1N5WA 4P6VF 1XLQA 5EE0A 3AN1A 3EUB2 1E10A 1QF6A 2WS3B 2WP9B 3CWIA 2K9XA 4ZOHC 2W55A 1JRPA 1ROEA 5G5HA 3NS1A 5GXGB 1RM6C 4C7YA 3NVWA 1RYJA 5H8YE 2MJDA 2B76B 4LTUA 1XLPA 2PKOA 4YTNB 1ZOYB 4HROA 4FXCA 1SF0A 2BT6A 1XLOA 2PIAA 1JW9D 1JWBD 4ZHPA 1DOYA 1F0ZA 4N59A 1E6EB 1FFUA 1DOIA 1FMAD 1VJKA 1L6UA 1CJEA 3FC4A 3P4SB 1PUTA 3PO0A 2JX5A 1J7CA 2PVOD 3W9CB 3AE7B 3AMZA 3P4PB 2CU3A 1FM0D 1RWSA 3AH7A 3LXFA 1TYGB 2PVGC 3B2FA 1N61A 3DWGC 4JWUC 5G5GA 2ACZB 1A70A 3WCQA 1ZUD2 2G1EA 1OQQA 2LEKA 5AUIA 1E7PB 3LB8C 4YT0B 2W3SA 1JWAD 4C80A 1NYQA 3AEFB 3NVZA 1J7BA 1TKYA 4IDIA 1V97A 4US8A 3AE3B 3VR9B 3AECB 1JROA 5EE1A 3NVYA 1ZP0B 1WYGA 3ETRA 3KWLA 1V8CA 2MH7A 1FFVA 3SFDB 1R7SA 5C3JB 3ABVB 1QOGA 2WU2B 2Q5WD 1NEKB 1TJEA 2HTME 5EE9A 2QIEB 3P1MA 3HUIA 1NI3A 3W5UB 3AEEB 1E0ZA 3AV8A 2WDVB 1AYFA 3P4RB 1E9MA 2DBYA 4YTMB 3HVZA 1YJIA 1FO4A 1QLBB 1QOFA 1OQRA 2H89B 1XLNA 3L4PA 1DOXA 4YTPB 3W5VB 2AX5A 2N0SB 3AE2B 4US9A 1YQ4B 3P4QB 3VR8B 1GAQB 3FAHA 3HRDD 2H88B 2E3TA 1KF6B 1KRHA 2FBWB 3AE1B 2KMMA 5C2TB 2W3RA 1SIJA 3AEDB 3NVVA 2QJLA 1VLBA 1WXQA 2M56B 3AE8B 1N62A 4USAA 2KAJA 2BS3B 4ITKA 5EE3A 1N63A 4YSZB 3DWMA 1B9RA 1ZXIA 2MJEA 3AB5A 1VDVA 1QT9A 3BIID
chains in the Genus database with same CATH superfamily
4DHZB 4F91B 5ALRA 2JWZA 3UIPB 4YFKA 5A0LA 3U30A 2ATLA 2ZIXB 1SE4A 1EU3A 3Q8FA 5ALWA 3MR2A 4O3QA 5J2FA 8ICVA 2WDQB 3I57A 4BKSD 3E9SA 1L5PA 3IP4B 1JX4A 4DHJB 1K51A 3DBLI 1N60A 4ANVA 3P63A 2DF4B 3IG3A 2IHNA 2ZIWA 3IN5A 3QXGA 1TAUA 3BINA 3TKAA 3QZ7A 9ICCA 2MEKA 4BKTA 4EZ9A 1LB2B 5G55A 1OUQA 5AI9A 2INCC 3IBEA 4RNAA 4CE6A 1UCVA 1WWTA 1D3ZA 3QA8A 2DNFA 2DQNB 1XLQA 5AZHA 3AN1A 5ALOA 2M4NA 2LHTA 4I2GA 2BGFA 2D07B 3M95A 4IWOA 2EAOA 3LVWA 1JXEA 3OSPA 1KTKA 3NS1A 5JHAA 1M6YA 1SEBD 1TIFA 3H7PB 8ICSA 1GO3F 3LVVA 5KFCA 1V38A 4I6LB 4XGAB 5FK9C 4OJLA 3JPRA 4MACA 4DCCA 3FILB 3G6YA 2DYOA 5KFZA 4F4ZA 1ZQCA 2BB6A 4G50A 4NNJB 3RYTA 1SZHA 4AOFA 4DQOC 1X6IA 1L3VA 1LVHA 4I27A 1L0YB 1KL9A 1WWUA 2E5SA 2VJ4A 3LXFA 1TZ1A 4GFJA 4IL6U 5G5GA 3SD5A 2KX3A 4KLDA 3RR8A 4RQ5A 4W9GA 1OQQA 2ASQA 5AUIA 4KTQA 1NYQA 2NR2A 1WG8A 2ZNVC 1LKYB 5GTIU 4PHEA 1ZQKA 1XO0A 4BFRA 3MP9A 3T8MA 4B9KA 4K4GA 1UWXA 4E71A 2ASDA 5BMIA 5CHWA 4O5KA 3R66C 5CA7A 4BOSC 4I2HA 2MH7A 3ZI4A 4JK1A 1R4NI 3N1YC 3ABVB 4KN7A 2HTME 5AHXA 3IG8A 3VAWA 3W5UB 2FCQA 2D11A 2HVIA 3MHSD 4XX5A 4K4HA 3H8WA 4WQOB 1ZETA 4ZH4A 4B9NA 4NJ8A 3HVZA 4GLXA 3RT3B 3UMCA 1F0MA 3GB1A 3GV7B 1ZQJA 1K52A 2WXMA 2KDMA 2H3VA 5DB9A 3OWEB 1KN5A 3C2KA 4KMUA 5DBBA 1AW7A 2E3TA 1KRHA 4ICUA 3MBYA 2KMMA 3PV8A 4MFCA 2EDUA 4PS3A 2AGQA 2AEHA 1AROP 4NV0A 2FMSA 4DSEA 4MJSB 5L9XA 4WAAA 2MJEA 1Z1VA 4MT5A 4W9EA 2LFIA 4XWWA 1IM4A 1UPHA 2MP2B 3V72A 2WLBA 2NRZA 2FCSA 3IDWA 4DS4A 2IMWP 2J6TA 1FNVA 1UUPA 3GZNI 1BT0A 3RBEA 2C2RA 2K8HA 1U45A 3TQ1A 3VTWA 4FS2A 4JWMA 7ICPA 5BYSA 2LGYA 1P7EA 2WDTB 4W9IA 1NI2A 1X9MA 5HFYA 2WX1A 7ICMA 4KLSA 3V6KA 2WXJA 1WJNA 5JTIA 1I4XA 2G4SA 5J29A 3SDLC 1PGAA 2OH2A 5DBCA 4PHAA 4CRXA 4JV1A 4OO1J 3VRBB 1EU4A 4RMAA 4WQMA 1M94A 1OFFA 3QAQA 2BKRB 5T8IA 4L2YA 2CPRA 2BWFA 4BWJA 2KG5A 9ICOA 1SXTA 4HRSA 4RQ4A 4W9JA 5KFOA 2FLLA 1S8OA 5J0PA 7ICJA 3ZDEA 1MJDA 3WKBA 2MA9B 2G3QB 4NLNA 9ICIA 3IT6B 1Y56A 1XLPA 2N7JA 3WK4A 3PV1A 5AK4A 1JW9D 4XE0A 1CUKA 2VH2A 5HR6A 4JL9A 3VFKA 1EWCA 3Q3JA 2NPTB 1F0ZA 4JV2A 4NAWA 4HJKA 2X38A 4P1CC 3LYSA 3P4SB 4KZCA 4K3CA 2BPGA 4P7IA 3MC1A 4F4KA 3ED5A 3F53A 4MEYA 2REXA 4LNFA 2F1HA 1TYGB 2CR5A 4B95A 3RB3A 3SQIA 3ZDBA 2WXIA 1ZQEA 2WXFA 1A70A 3DHIC 2XBBC 5D7GA 4HAIA 2W3SA 5DB8A 4HK2A 2ZIWB 2GB1A 1ZE3D 1XQQA 3KKAA 3C21A 4UB8U 5AKZA 5J2CA 1X9SA 8ICBA 2BDUA 3ETRA 4F5PA 1KLNA 1DXSA 2HCFA 1SV4A 2KTRA 4M02A 2UVUA 4TUQA 1TJEA 1JCKB 4BJQA 1RYUA 1VJ5A 4NLBA 5J0XA 2HHUA 2NRVA 4JPSA 5LXIB 1ZQMA 3H0RB 4XDDA 2JH1A 2KWVB 1TS5A 4I29A 4JQWC 5BO4B 4LK0M 3ICXA 4AUQC 1MQ3A 2GRIA 3JPSA 4RQ1A 3TI0A 3P4QB 4Y2SA 2ES6A 3KKAC 4CNQA 3Q8RB 4AWJA 4DXAB 1PZNA 1TTNA 3BZCA 5E6JA 1N62A 4LNNA 2ZPYA 2IOHA 2YLMA 1OGWA 4LJXA 3S2AA 4NJ6A 3M9MB 1I35A 1XS9D 4F2RA 1FNWA 5KFYA 4ED0A 1YMHE 4ED6A 4IW0A 1FIQA 1MC8A 2FUHB 4MEMA 1ZGUB 3MGHA 4ECQA 5C1ZA 3AM9A 5DDMA 2DL0A 3MFHA 1U9LA 3SFEB 2LM1A 1KOTA 3TCAA 3DDCB 3IAM1 3Q69A 1QSSA 1HTOA 3ZDMC 5KAIU 5J2BA 2V9HA 5DPWA 2W43A 8ICHA 1YQ3B 1SGGA 1VCBA 1P98A 2J4XA 2ON8A 2PFQA 3PGEA 3TEWA 3KBBA 5IA7A 2Y0SF 4WWMA 2C7NB 1MQ2A 3BVGA 8ICYA 1SB3C 3X23A 3CSFA 4JWSC 3DVGX 2BQQA 3GIIA 3L5KA 3GILA 2Q4TA 2D3GA 1S3SG 4K7SA 4ZOHC 2K0PA 3H8MA 3B0AA 2B76B 3RJJA 1RQNA 9ICWA 1ZOYB 3J9CA 4FXCA 3TADC 4BBNF 2F8KA 2QARB 4N59A 2N9EB 2EH9A 1FFUA 1FMAD 2CU1A 4EZKA 2NO5A 1QQRA 1PYWD 2X8XX 3CW2C 1YD8U 3ZTDA 2PFOA 3ENEA 3PNCA 3KFUF 1WGHA 1RWSA 2H3QA 9ICNA 5AIBA 5IIJA 1ZD5A 4RQNA 3L08A 3WCQA 5AKIA 4I2CA 1NJWA 3T5KA 2XY7A 4KV2A 3QYPA 4MM3A 4LNKA 5KT6A 1S0NA 2PFNA 4MGYE 5EDSA 1V97A 3VR9B 4P4MA 3O13A 2BCQA 2W03A 4EBEA 1ZP0B 2JXXA 4RNOA 3RNCC 2HTHA 3SFDB 2I1QA 3PS6A 4O3NA 2WNMA 3EHVA 3L17A 2NO4A 4YCXA 5KAFU 4EYHB 5IILA 1NEKB 4Q8EA 2KEYA 5EE9A 1D5XC 2QIEB 4DL5A 3QU9A 1IPGA 2XIDA 2R18A 2W8KA 3EGRA 3AL0B 1L7MA 5AK6A 3C5GA 1U47A 2DYMA 3OG5A 4XA5A 8ICIA 3UINB 1IGDA 2Y3AA 4FULA 5AM5A 5KFTA 9ICKA 4GIVA 2ZW1A 3MGVA 2WYQA 3Q8EA 4M01A 8ICUA 2Z0DB 1GJZA 2XO7A 4YR0A 2NRTA 3VR8B 3KHRA 5DLGA 1Z19A 2DYBA 2YTUA 2AQ0A 4AJYB 4RGNA 4YXMA 1RRBA 4DFPA 4NAWB 1ZQRA 1ESFA 1HUZA 1X66A 4I2IA 3KHLA 5AM1A 1K50A 3D6JA 4E0DA 3A0BU 3RNBC 2OJWA 4GIBA 1WY8A 4Y2YA 1VZ8A 2AYOB 3ZGZA 2F77X 2KHVA 2FCNA 2KN5A 2DUYA 3JPNA 4UDUC 2HBMA 4DWFA 1HUOA 2O6VA 2YMMA 1BMLC 4MSMB 3WAOA 1S9FA 2KZZA 3QU5A 5IIIA 2W8LA 2ZXHA 2CKHB 4EX7A 2Y5CA 2BBCA 2NYVA 2HDEA 2R8GA 4C8LA 2KTRB 2OHFA 2PEAA 2KO3A 4YSYB 3G6XA 1QCKA 4F92B 2V4IB 3TFSA 4Y2RA 2H5XA 2Z7JA 5KFAA 1SE2A 2GI9A 1V1PB 4JGHB 3RR7A 2DGZA 3AU2A 1ZQYA 4O0IA 1Z4NA 1SWWA 4HCPB 2LBOA 4DFJA 5JU5A 2PLPA 1ZQWA 2KIWA 3KVFB 1A6SA 2JEGA 4GOCA 1BPBA 3BQTA 2LJIA 2OJRA 2KYWA 3RJEA 1NNLA 3CNHA 1NDDA 1I42A 1H4RA 5J2IA 2KK8A 1PK3A 1LXDA 2K8CB 5KG6A 1SBBB 2ZUDA 2MHJA 2OEHA 1WXAA 3NS8A 1NK5A 2CRXA 4EENA 4CCHA 3APFA 1N61A 5K4LA 3SYZA 3N20C 4JIOU 3M6KA 1D9FA 1ZDVA 5D3DA 4KVGB 1DGSA 3AU4A 5L1JA 4XQ8A 3PMLA 3RH5A 4A8EA 1J7BA 3RUIB 3N7PD 2QILA 3UXPA 1XXGA 2WF5A 3GIJA 4ACFA 4BGDA 3PR4A 2BYEA 2IO2B 4K7WA 4QWEA 1ENFA 5J2EA 1X6JA 2XY5A 4YR3A 4W9LA 4B6JA 5KT4A 3SHQA 3KHGA 2KZMA 2E1FA 3LWLA 2MA1A 2BYFA 3EFUA 4ELUA 1NI3A 2A1AA 2CXYA 2NTTA 2WXOA 4CYEA 8ICOA 4B9UA 3B0YA 4KZ0A 1JMSA 1PVRA 8ICKA 3IHQB 2ONQA 4AQ7A 2NRWA 1UQVA 4BXOA 4UASA 1Q3VA 4DSIA 7ICVA 4DQSA 1X42A 2KC2A 1PVQA 2L7RA 2L5YA 2QHOA 2BHNA 1WWVA 3RNFC 4YTPB 3M8RA 2AX5A 4RPZA 2I9GA 1JWSD 4MF8A 1JXLA 2I38A 2D3BA 3NUQA 4KGTA 2WXPA 3H4BA 3Q8SB 4UBBA 1ZD4A 4M0AA 2N1VA 4GSWA 2KE7A 4Y2QA 5KFFA 1F2RI 2K3UA 3HWTA 3QU4A 2M56B 5ALTA 2KAJA 2PTLA 4TUPA 2RDGA 1V49A 4NL9A 3AB5A 1V86A 3Q3NC 3SR6A 1A5RA 4RNMA 3N30A 1JQ4A 1L3SA 3EFCA 4F8CB 3PLUA 2BYVE 2KP7A 3WKAA 2K4EA 7ICRA 1IV8A 2V4LA 1CZPA 2AGPA 1N48A 2XVTA 1NK0A 3DBHI 2LJ5A 1ZKHA 1Q8KA 2VANA 3AE9B 3PTFC 1L6VA 4DS5A 4MM3B 1UWMA 4UQGA 5J2JA 5BYQA 5L1IA 4GDLA 1NK6A 1WRIA 3BK2A 3L16A 4PGXA 3QE9Y 3I76A 2HVHA 2KJ8A 2JT4B 3FYHA 1IUEA 4ZYSA 5F3XB 1Z1BA 3A33B 4YVZA 3JSVA 3Q8PB 1EXNA 4W9HA 2WFAA 4DWIA 1F5SA 2KNJA 5H92C 3SV3A 4DSJA 4DEZA 2E8NA 1RG6A 3A1QA 2YB4A 5C23A 1JIHA 4BDPA 1VD2A 4P1BC 1ZJMA 2HD5B 1B4FA 1RM6C 5ALKA 2KQ4X 2DKXA 3QU2A 2PKEA 2IZVB 5AKYA 1KW4A 2YX8A 4BUGA 2DFLA 1MPEA 2HI0A 4PPXA 3DVNU 3DQVA 1C4CA 1CJEA 3AEVA 2E8PA 3VUXA 1C76A 2PVOD 1QQ6A 2LKYA 5D46A 3P4PB 4EEKA 3TSSA 2ICIA 2MSNA 1S1QB 2O6VB 4YQWA 4RGOS 2KZ3A 1XEEA 1JWAD 4WH4A 1TVAA 3IVFA 2YQEA 4J9OA 2M0NA 1RQLA 3UMBA 3WU2U 3MGIA 3AECB 3HVDA 4RPXA 3SZ2A 3RNEC 1X9XA 5EE1A 2YVCA 4C8MA 5ALUA 4NXZA 2JEFA 3SD7A 2KXJA 2P66A 2EAMA 2ZG6A 1PGXA 2JPHA 3N3KB 2ZTEA 2Q5WD 3HP6A 1HZ6A 5EWEA 4NY8A 4XYCA 3VXWA 2KIVA 5HHIA 1SL0A 2E6XA 3RRHA 2OWOA 5JRTA 3P4RB 2IY0B 1J0GA 7ICGA 3U2SC 2W7OA 4ECYA 4M00A 3R7RA 5JUMA 4DSLA 2KQSA 5ALMA 5E6OA 1QSLA 2WAQF 2PE9A 1ZQBA 3PRPB 2C2EA 1D4BA 3IRUA 3RH6A 2XN9C 1WXSA 3QX1A 1B1ZA 2XGPA 5ALGA 4B9VA 4J9RA 1FCLA 5KFGA 2EMTA 5C2TB 3HK0A 5DG7A 2MW5A 3IV6A 2BS3B 4QZIA 4R3DA 4GLSC 1ZD2P 3L54A 5KFXA 3PY8A 2DZIA 4IRDA 3B2GA 2BS4B 3H7SA 5KG7A 1RXVA 1ZQPA 4IR9A 1NENB 3PREA 2JZZA 2L1AA 5L95C 1WSPA 2V3SA 2FPMA 2ZJ8A 1DYQA 1RYSA 2F76X 1K8RB 3I1YA 2LYBA 4NLGA 3G6VA 2HBJA 3U7DA 7ICNA 2D3AA 2H3ZA 1QOBA 2LGXA 3CIRB 3V62A 3BJYA 1TKEA 2N1RA 3V6EB 2KJ9A 2CJNA 3EWAA 3PX4A 4N58A 3DDHA 4OHJA 2HHQA 4A20A 1P7DA 1J7AA 4IWQA 1KFYB 1J97A 4IQVA 4IM2A 4IQTA 3D2SA 4M9LA 3VH4B 4ELVA 1N5XA 2KWUB 3LK9A 4XZ4A 1P9DU 4M8NA 2HDOA 4DL7A 5AZGA 4B9SA 1SV0A 3C23A 7ICUA 2N9KA 1EWYC 4BXOB 4LLGM 4AYBC 2DWQA 5KG4A 4Z6CA 4GU2A 5IINA 3Q8MA 5JZEB 4U6PA 4FHKA 3V7KA 5J0QA 2KJHB 2A1JB 2KHWB 3OJUA 2FMPA 2KANA 3AQFA 3U4EG 2GLSA 5AKEA 3IAS1 3UQAA 3PZ8A 5TR5A 2G0AA 1S97A 3MHZA 4EEYA 3ZUNA 4EBDA 2J6SA 4UATA 4IC9A 3RJHA 4KLFA 2HHWA 4Q8FA 3UXOA 8ICMA 1WJUA 2KT7A 4JLCA 2HSZA 2YN4A 4OZBA 4ECXA 4UBCA 1WCLA 4EX6A 3H8HA 2BCUA 3DCGA 4HWIB 4JWUC 3RFZB 2ACZB 1C4AA 2WF6A 3BQ7A 2R8KA 1XSPA 1Q1OA 3K4GA 4I2JA 4ECVA 1P1AA 5ALXA 3EECA 3NVZA 1TKYA 1GC7A 3ZQ4A 3AE3B 3Q3OC 2V3PA 2B21A 3L10B 1QZEA 1A0PA 3C1YA 5J0YA 3KZIU 4QJFB 3SAFA 2AL3A 1IGCA 2VZKB 3JSVB 2LXAA 3L13A 2BCSA 4LJPB 4PL2A 5DG8A 2J42A 3D2QA 5AI0A 3WKDA 5J2DA 1WYWB 3MC0B 1RZTA 3A1QB 1JN3A 5D6JB 2V0GA 1WXVA 2ZJDA 4FLHA 4EZJA 1YQBA 4DXGA 2KKPA 2QEJC 3DBLB 4KLOA 3OTQA 2EMSA 5KFKA 1L4DB 3HRDD 8ICFA 3AE1B 4G0NB 1CI4A 3W1SA 2QJLA 3W1YA 1GB1A 4USAA 3KQ4A 4DF4A 4ITKA 4YSZB 3PT2B 4J9QA 2O2VA 4F4YA 2HHTA 3BIID 1V5OA 3S6JA 3B9JA 4RQ6A 1WH3A 3ZYYX 4K4IA 1S77D 2J0KA 4NAMA 4GDKA 2K8AA 9ICTA 2NVUI 3TEXA 4J9LA 3OJSA 1I4QA 1I4RA 3RPFC 3N97B 4DHJD 3MJ5A 4PS7A 1WX9A 3PSFA 2ZUBA 3Q6BA 2AWTA 5J8YA 2O6KA 2AQ1B 1UGJA 2KZRA 4E74A 4XWTA 2DZKA 1RLFA 4IKGA 3VTVA 4F72A 3RJIA 1C77A 3UQ2A 3DV9A 3KTQA 2C7MB 5KFRA 2KX0A 1L0VB 2L0FA 3UGBB 7ICHA 1XO3A 4WWOA 3VQIA 5AUKA 4B9TA 1LFDA 2PW9A 4IM3A 9ICGA 1Y88A 4LZDA 1FXIA 9ICUA 1BPYA 4QZBA 2M17A 2WB1F 3ZD8A 3TAQA 3RJFA 4QZDA 5KT3A 5KFDA 4F5QA 9ICPA 5ALJA 1WM3A 3LJ3A 2KC1A 8ICTA 3QWZB 5EE0A 3SMVA 3GZFA 2UVRA 8ICEA 4KX5A 4R8UA 1UF0A 4FE3A 5GXGB 1RYJA 1NKBA 1ET9A 1I4HA 3GFKB 1WCNA 1AQ6A 2G08A 3N28A 4HROA 4NLCA 1JWBD 4FO6A 4KX3A 4A3PA 2G06A 2BPCA 4ZRQA 4OZAA 1KKXA 2JHDA 1R4NB 2FPKA 2LYAA 3FC4A 4GXKA 1PUTA 4WWNA 5L83A 1ZQOA 2KJRA 4F8RA 4OW0A 3F5AA 4MF2A 5DGBA 1ZQLA 4PH5A 3PR5B 3BQ2A 4HDQA 4DQIA 2G4DB 5TSSA 3LB8C 1IYFA 1L6NA 2FUG1 1ZQVA 1SE3A 2LVOA 3M7DA 3VTUA 5LXHA 5KFEA 2DENB 2G45B 1H38A 2GOLA 2JUOA 4NJCA 4M9NA 2F1JA 3QUQA 4RGTA 1S0OA 4F5RA 4Y2UA 3PVXA 5ALIA 3QZ8A 1DRGA 2BQRA 1F52A 4FZMA 1TS3A 2ZUCA 1A77A 4Q43A 1KLGD 2GBRA 3KW5B 1B43A 1ZYQA 4OJPA 1AN8A 4CDGA 5KFQA 4P2HA 3PMNA 1VZ6A 2LMCA 3M6ZA 2MBBB 3GZNB 3X0WA 1F9JA 1ZQUA 4IQWA 3PW4A 1V85A 2Y5BB 1QH9A 1YQ4B 2LGIA 4IC7B 5B5EU 5CX3A 2FBWB 2YMLA 1WX8A 2WXHA 2GBNA 2DZMA 1IIPA 1SIJA 4RQ8A 3RBDA 3NVVA 1O03A 5ALEA 2JZBA 4ECTA 4WJPA 1CMXB 5EE3A 3BQ1A 2YEPF 3M9NB 2LHEA 1MG8A 4NWIA 1L8LA 4OCZA 1VZ7A 2D8CA 3PSPA 3EYZA 2MBHA 3AE4B 3RFAA 2VA8A 3H6NA 2G5HB 3GOEA 2K4IA 2ODGA 3AQEA 3PZ7A 3AEAB 4F7ZA 4WJ3B 4KGSA 3L3FX 2BDPA 1BPZA 2L52A 1LV5A 1V81A 3NHEB 2NMQA 8ICXA 2C28A 1UELA 4C8KA 3I28A 1AWDA 2K8BA 3UI3A 4NY0A 1UT5A 2IA6A 3AE5B 2RDJA 3DHGC 2DHZA 5CRXA 1EO6A 2DZJA 3DVNV 4N6EB 4G11A 3N9YC 3CRXA 4YSXB 4YG2A 5KFMA 2L76A 1DOQA 2DKZA 1ZQSA 1QILA 2NBVB 3KWVA 3QJZA 3MDAA 4RM9A 4C4VA 1D5ZC 3PX0A 3MR3A 1L0XB 4FHJA 1KFTA 3JPQA 3RJGA 5D49A 1S10A 3RAXA 1S5LU 1X40A 2HOQA 1ZOLA 2V9WA 4C8NA 3VDZA 4DSFA 2KFNA 3RI7C 4LZGA 2K5PA 3NTUA 3KH0A 4ECZA 5J17A 1KJTA 4W9CA 1S0VA 5AKKA 4Z6FA 2WP9B 1L7YA 2FJ6A 1YZ6A 4OVVA 4YP3A 3OHBA 2KDEB 1ISNA 1K53A 2LZ6A 3V6CB 1NK4A 2PIAA 1DOYA 4DFDA 4F71A 2IJ0A 3EA6A 3SI8A 2INNE 2WGSA 3VHTC 2O2VB 5HKHA 2MBOA 2C2DA 3RB6A 2F2AB 4IWPA 5AM4A 3QEAZ 4GDKB 2BKFA 1Z4OA 3AU6A 3PHWB 4ED3A 4Z6EA 5KFNA 1ZQQA 2JWUA 4QNLA 1XSNA 2V1YA 2YMPA 3WK7A 5KT5A 1I4GA 2H3FA 1HXYD 4UAZA 3SEBA 2W9CA 7ICQA 1YIWA 3B08A 1XF5L 5L1MA 2MBQA 1ZQHA 4DOCA 3CP8A 1Z5SB 3GQCA 2D6FC 3BK1A 3KHHA 3ETLA 1QLNA 3NOBA 3DBRI 4C00A 1RYRA 2IGGA 3ZTCA 2WU2B 2KLCA 4KLQA 1WZ0A 3RJKA 1Z3EB 2QKQA 2WX0A 4QZEA 4LDTB 3T5JA 3UPQA 4DOBA 3T5HA 3JW0X 5FP0A 1ZQGA 1WMHA 3LDZE 4A6QA 4F4XA 1SKWA 3QHTA 3EC8A 2E8OA 4L1BA 5KG5A 2MUTA 5HR7A 1NJYA 3F2DA 1L3TA 2R8HA 3KYCD 2RDIA 5ALDA 1WGRA 4OVZA 1KF6B 4X57B 2IOFA 2VIXA 1WFYA 1KLUD 3QARA 3KUCB 1VLBA 3QK0A 1F1HA 3KYDD 1LM8B 2ISPA 2Y0SC 3RD2A 3UF8A 1ZXIA 1WR1A 1E8YA 3SAHA 5AI6A 2BS2B 4NLKA 3UIOB 1I7HA 1R4MI 3RAQA 3EPGA 2XGQA 5KG2A 3KUDB 2E1EA 4PHDA 4O9MA 5DB6A 1V6EA 4EEWA 5D4BA 2WXRA 1P0RA 1FXTB 4S0RA 4OJ5A 4BBNC 2WXLA 2N9LA 4JV0A 1JWMD 5J0RA 3CSTA 2V3NA 1BNOA 1WGYA 5J2KA 2D3DA 3AEBB 5J2HA 3QUTA 3HKZF 1C79A 2KMCA 3B1LX 5MPOA 5KFWA 2CJOA 3Q3FA 5LLIA 2Q0ZX 2ZIVA 4DXFA 4OVUA 3K1ZA 2GBKA 4TQSA 1ZW7A 3VH3B 3M3JA 2KACA 3ZJVA 1Q46A 1EM7A 9ICSA 2MJ3A 3C2LA 3BDPA 2W04A 1NZPA 2JZ3B 2KD1A 2VH1A 3E2EA 3QNMA 4XDCA 5GTHU 4HYKA 1OEYA 4F50A 3NJTA 3CWIA 2K4HA 5HG2A 4ACOA 2N9PC 2A5UA 4HXDA 3QX7A 4ZRKA 1X2IA 3MJWA 1L2NA 3LDAA 1U49A 1XLOA 5AM3A 3AU5A 2QB0A 2BVCA 2JZBB 2FAZA 2NS5A 5KT2A 3C29A 1BGXT 2KVZA 4GXJA 2JEIA 2H3IA 4X5VA 1RXWA 1JMLA 1XSLA 1KSPA 1XC9A 1F2RC 1DK3A 2LXCA 3E58A 3M62B 5E6PA 2I1JA 2AQ4A 5H2FU 2NBWB 3ZDDA 5DQIA 4KN4A 4O5CA 3IXSA 1FM0D 3AH7A 1R4MB 4RF1A 5BMHA 3BZKA 4BKGA 3ISCA 4M8MA 4BKSA 2RRDA 4ED1A 3QQ8B 4GC7A 4C80A 2DPJA 2K8BB 1YN3A 2YEPB 3R8BA 4TUUA 8ICRA 2K6DB 4F3OA 1Q3UA 3GV5B 4U7CA 2L8JA 1WYGA 4FZNA 1N2XA 2OCEA 2ASLA 1FFVA 3GS2A 3H8JA 3JPOA 1HQRD 4C4VB 4RU9A 3D32A 9ICHA 5CHGA 3O0FA 3P1MA 3AEEB 3OJ3A 1WGDA 4QIWF 4JWNA 7ICTA 4I6PA 2FMQA 3NRWA 1KRPA 2RDHA 3WKCA 3K9OB 1YJIA 5KFLA 2AJQA 3TMPB 2XC9A 1DOXA 2B3AA 1V1OA 4G3XB 3ISBA 4OJOA 3NZSA 4DBGA 3HILA 4ECSA 1GG3A 5AKJA 1SKSA 3JYUA 4K1RB 4EFOA 2M0XA 1PGBA 4IQUA 8ICWA 4C4TA 2EKEC 4TUSA 2W9AA 5ALSA 1TFRA 5CEHA 2GMIC 1ZD3A 4J9MA 4Y2JA 1N63A 5AI8A 4AP4C 5AM0A 2E8MA 3H7IA 2R2OA 1GNUA 2XICA 2L3ZA 5JHBA 5KFJA 3N32A 1G6JA 1PK1A 3MTNB 4M6WA 4HCNB 4O3RA 4M9HA 3H40A 2ESEA 3ZD9A 4KLEA 2M1MA 3W2DA 4ED8A 4JB3A 2GO7A 2JV3A 2WU5B 4UB1A 4PS8A 3ONNA 1KTQA 1D8LA 3OSNA 8ICJA 2D5GA 1KH0A 1ED1A 1TK0A 4DQRA 4KX6B 3H8SA 2RQ5A 1WR6E 3BVZA 1JI7A 5KFBA 4RUAA 3J81j 2HOFA 1HEZE 2ZEQA 4O3MA 3IHPC 4YMNA 2XI9A 4ELTA 1F44A 4M9GA 2LRUA 3CF6E 2ZTDA 1WMHB 2J52A 4RUCA 4DLGA 1CQVA 2PXIA 1UA0A 1KBUA 2XCPA 4YTMB 1L3UA 4RZRA 1NYRA 4KKIA 2MQJA 5AKGA 4ECUA 1QF6A 1T5XD 2WS3B 5ALNA 4UB2A 4AP9A 1JRPA 1ROEA 4C7YA 1FCCC 2I6XA 5KG1A 4LTUA 4O5EA 1QTMA 4DFMA 3CMMB 5AKLA 2W9NA 4CQNA 1E6EB 3TBLD 4TURA 1WE7A 1L6UA 5D3IB 4NL9C 4IRKA 3APCA 2DPIA 3W9CB 2C5LC 2LUMA 2JRZA 4DL2A 3HM6X 3OPXA 2CU3A 2PE6B 2Z8LA 1HEKA 1MHHE 1NOMA 2NBUA 5E6NA 2MRPA 1HA5A 3ONSA 2EANA 2R8IA 4NLZA 1C1YB 4HJGE 4WJOA 3UXNA 5DG9A 3LYYA 5AM2A 3RRGA 1YX6B 4FFDA 3M8SA 3WA0A 2UVVA 1CEZA 1A76A 3PRZA 2I2YA 2ZIVB 3FILA 5DQGA 4GB9A 5AEKB 3BS5A 1QOGA 1EF1A 1LO5D 1VRAB 4IR1A 1CK1A 2UU7A 2N1WA 1E0ZA 1L7NA 2FDRA 3QUCA 4Q45A 2WDVB 1AYFA 3ZDAA 1H8CA 2BCVA 2HW3A 4PL1A 4FJZA 3WALA 2M8SA 1YT3A 2HJ1A 2DLBA 2N7DA 3L4PA 5DPTA 2OM6A 1T8EA 1SJED 3DBHB 2N0SB 3AE2B 3A9KA 4M0WA 1GAQB 3GDXA 4EOYA 2QB0B 7ICLA 1OEYJ 1SKRA 1V5TA 3KUZA 2PMVA 4M9JA 5IIMA 3RZWC 3D2NA 4URKA 2BQ3A 2ZW0A 2QC8A 5AIAA 3UQ0A 4TQ1A 1N6ZA 4A9AA 2JH7A 4FADA 7ICIA 1UBQA 1KDHA 3R9KA 5HHDG 1PDXA 1SWVA 1FRDA 3QIJA 1JALA 3ISDA 3PZPA 5L1LA 2KVCA 1U4AA 3F2BA 2EELA 1XD3B 2BPFA 4W9FA 3IG5A 1EUVB 2KDFB 1L4ZB 4RT2A 4ED2A 4P0PA 9ICEA 2MRLA 2JRHA 4UARA 5L1KA 3PO5A 5DGAA 4I2FA 2YMQA 2JMGA 1DGJA 4MFAA 1HZ5A 4RQ0A 4B9LA 3OAWA 3OGUA 3I5JC 1TV9A 1TGZB 3UQBA 2VRRB 9ICAA 4FBUA 2ZCCA 1C9FA 1HTQA 4J6IA 1D8YA 1D6EC 2KVRA 4HPLB 2CHZA 1N5WA 1SZPA 2FCMA 5EOZA 4R65A 2Y1IA 2D3CA 2RSUA 3PPAA 4HEA1 5CTRC 5G5HA 9ICMA 5H8YE 2QDFA 2MJDA 2KMAA 5TISU 1QQ5A 5KG0A 4F5NA 1FPYA 2BT6A 5IOIA 2R2QA 4NM2A 1WGGA 2VA3A 4YXJA 2PMZC 3BWUD 1OXJA 5AZFA 3ZDCA 2HHXA 3TACB 2KWCA 3GU3A 2HE7A 9ICLA 3N1ZC 2WWZA 5BYRA 1PK1B 4JUZA 3VCBA 2WAQC 2MCNB 4M6WB 3ZRCA 1SJHD 5KL1B 2BF8B 2D10A 4QW8A 4OZCA 5HI1A 2KN7A 2LRWA 4DO9A 2O6VD 3OHAA 4RQMA 2N4FA 2LEKA 4B0MA 5DKWA 2HBLA 2RPVA 2KJ5A 5AK3A 3K75D 2CN1A 4DL4A 1NBFC 4IDIA 3MABA 2XNAC 3H9DA 4TQ0A 4BZAA 3GE3C 4RT3A 3WAPA 3O65B 4REZA 3B0XA 1XT9B 1C7YA 3HPOA 4MGZE 4RPYA 1R7SA 4IM0A 4KIKA 4ZDVA 1UD7A 4BAXA 4UB3A 1SV0C 2JVCA 2GH1A 1P7FA 3Q8BA 1UT8A 1ZQ1C 2A4ZA 4MSQB 1N56A 2QCZA 3APDA 3V60A 4DL3A 2IPKD 2CHXA 3C19A 3RMKC 4P4OA 4GDLB 1BVSA 1FEZA 5DDYA 2JYEA 4YMOA 3LWMA 3F2CA 1L7OA 3PRMB 4YR2A 2JXTA 1DK2A 2C7HA 5AICA 2G9HD 2WXQA 3AEDB 5KG3A 2K1FA 3AE8B 4IS7A 2KICA 4UAYA 4Y2PA 1E5WA 4HPPA 2J0MA 3U8ZA 1ZXHA 2J0JA 1ET6A 5ALVA 2GOWA 4YWGG 1MA7A 4ICVA 2JF5A 4C4RA 1WX7A 3N7SC 1EF5A 2IGDA 1JWUD 1O08A 5AI5A 1GUAB 4A55A 3N4MB 3HIZA 3QUBA 2JGAA 3NRZA 8ICGA 1PFDA 4I2EA 3N7RC 4Y2VA 2FNJB 2AQ3B 2KJ6A 4KMOB 1BUIC 1JUDA 3K9PB 5J2RA 4ZRIA 4TQRA 1ZDXA 3NASA 2IO3B 3BS5B 4RNNA 5BPCA 2WDRB 4ZHOA 3PZDA 2W54A 4AS1A 3VRAB 4O3SA 2BKEA 3QC8B 5CJ7A 3BYTB 1OQYA 1XWLA 4R63A 4P16A 1FD6A 2G09A 2EKIA 1ACCA 4O3OA 1T94A 2JQRB 9ICRA 2C22A 2M19A 2K89A 1XNSA 4M04A 4O3PA 3VC8A 4GXIA 2BPSA 4QZHA 3A9KB 4M0WB 3IT4B 2EQYA 1OW5A 5JXVA 1RPLA 7ICEA 1Q5WB 2IYDB 2AQ2B 1BPEA 2YY6A 4FZLA 1SF0A 5E79U 3W1SC 4IUMB 1ZQTA 1K1QA 2JSVX 2RLTA 1V2YA 3JPTA 2RPQA 1C78A 2CS4A 4YMMA 3QCAA 3AE7B 1E7UA 3AMZA 2QLTA 4PGQA 3JPPA 3AUOA 2EZZA 1UZXB 4KLGA 2MBEA 3A4SC 3B2FA 4QZ8A 3DWGC 2FE9A 3TUOA 1Q0WB 3ZNHB 2ZTCA 1OTRB 1MN8A 5DCNA 5KHOA 1SXEA 4NQKE 2B6GA 4F2SA 2ZVOA 3P2BA 2QMTA 4BVUC 4P0PB 3PHXB 5J8YC 1VR9A 2F1IA 4OD0A 5TZVA 4J3OD 1SGHA 5IP4D 1E8XA 2MX2A 2WHIA 2QARA 4R64A 4NJ7A 2VZKD 3R2TA 2L0TA 4I6NB 2ZXIA 5C3JB 1QSYA 1V80A 2TSSA 4NZLB 5KFIA 2LD9A 3DOWA 1GB4A 2KD0A 1ECWA 4PZNA 3MFGA 5DPRA 4M2YA 2Y9TA 4FBJB 3GIKA 3URYA 4J9PA 2RHFA 3T3NA 3T3OA 3QU7A 4KLJA 1OQRA 4KKJA 4NM1A 3RNGC 3FKYA 3VUYA 1Z00A 2PFPA 7ICOA 4EUTA 2LHDA 4DFKA 3OJ4B 3N1XC 3C2MA 2KV2A 3WKEA 4M47A 4W9KA 5CB1A 3RB0A 3ALRA 2B0CA 1MVKA 4QWAA 2LMRA 2K6QA 2GBMA 2IGHA 4GXBA 2WB1C 4I2BA 3PW2A 3PSTA 5KNIA 3TEYA 4A90A 4UB6U 3DEEA 2BB5A 1T3QA 1J2MA 4QWBA 3A4RA 2ALZA 4KLUA 2WHEA 3BVMA 2N9XA 5KL8B 3EPIA 1YNTE 1FXAA 1YN4A 2IDYA 4RGMA 2WF8A 4MH0E 4W9DA 1GC6A 2IOFK 1E7VA 4EZLA 2AH5A 3H0MB 2JU6X 3WIMA 2EZXA 1MFWA 2AL6A 3PX6A 4MFFA 2K4PA 1QOAA 2A19A 1ZQDA 2G5IB 3ZDTA 2VKQA 1T3NA 1D9DA 3C0RB 3V05A 2BTEA 2QSDA 2AU0A 1TBEA 4KIKB 1WXMA 2ZJ5A 5KFVA 1M4VA 4N9F4 4DDGD 1WI0A 4F1SA 1GPXA 1PUZA 1YJJA 4H2AA 1E8WA 2L83A 4XRHA 3MFIA 3TIXA 1PVPA 3TANA 3WK6A 5J0UA 2IBKA 5KFHA 5IIKA 1COOA 4KITB 2FLPA 2KOXA 2OXOA 2KFJA 5EWGA 1NK9A 2Y1JA 4ZHPA 4R66A 1T7PA 1XU4A 5KFPA 2IO0B 4CF3A 2WF7A 2WTFA 2Z59B 1VJKA 3BYYB 4DK5A 3V7LA 4K7UA 1WJ6A 1V9PA 5F9LA 1JRUA 3M63B 1C3TA 5FR3A 1ZRNA 4MGKE 1V1PA 8ICLA 4PZOA 4ECWA 5CR0A 4ARCA 4WJNA 3HX0A 2ZNVB 1SL2A 4DSKA 3GP7A 1SXDA 1E7PB 1UH6A 3JVZX 4IG7B 5BOLA 4LJOB 2KTQA 1WM2A 2P35A 4Y2TA 4KLHA 2WXGA 2EZYA 2JR5A 4ANXA 4GMVA 2MLBA 4JE3B 3BZDB 3NUHB 2LGSA 3MR5A 3TJPA 7ICKA 2R61A 4MEXA 1V8CA 4P0QA 4XUSA 2SEBD 4WURA 4XC2A 2ZIUA 1Z2MA 1ZQXA 5ALPA 4YL8A 4IOIE 1HIWA 2K8CA 4J03A 4UAWA 1T6BX 3I9V1 3Q2AC 3ZVVA 5GMVA 2IBIB 2FI1A 3PO4A 1V9JA 3MR6A 2RP5A 2RR9A 4DOAA 2AXTU 1IG6A 3T5LA 4ARIA 3SENA 1KLVA 2ZCBA 2YB1A 1QOFA 2M0AA 2NRXA 2LI5A 2WF9A 4GC6A 1XLNA 3RULA 4HLEA 1WJ4A 3L0WB 2Y9UA 2JY6A 3V7JA 3WANA 3TL5A 4YN4A 3EW9A 3TAPA 2H88B 4YD2A 2JYTA 5ALYA 2KMDA 3TADA 3A9JA 5CHVC 2PPHA 3WK5A 2BGWA 2AHOB 4HKZE 5J0OA 4EZ6A 1ZQAA 3ZNGC 5HMMA 1ZQZA 5D2MB 3BS7A 1SE9A 1SSNA 5IIOA 1HE8A 4DQQA 1VDVA 3ZNZB 2CHWA 3Q8QB 1WIAA 3Q3MC 4RFBA 4WIPA 3WK9A 4II3B 4CO7A 4CF5A 5G2NA 2AGOA 3AEGB 1T0YA 8ICNA 1TT5B 2MWSB 1T0RC 3H4DA 3C5FA 5CP2A 2KFZA 9ICXA 3KOOA 3ORYA 4R8UB 2C60A 4WJQA 1WRDB 4D2KA 2K22A 2L05A 4AJWA 1NJXA 1WGKA 1FRRA 1TS2A 4NPNA 1ZRMA 1LQBA 2KSOA 1T0QC 5FR6A 4YXDB 5T14A 3R3MA 2J6UA 4OJ6A 2PI5A 2OOBB 4E3CA 3E56A 5KT7A 2VA2A 2RMMA 2W82A 3OLMD 4RM8A 4MELA 2P6RA 4MGIE 4ANUA 2NCNA 3I3TB 4WAFA 4PGYA 2UVWA 5IAAC 4HDOA 4A8XC 1TKGA 3TARA 3M9OB 3PW0A 1ZQNA 4P6VF 2W9BA 1NKCA 3ZJTA 1URJA 3HHMA 1Z00B 2F8LA 1SIFA 4QZAA 2I1KA 2K9XA 1NK8A 2KOBA 1TY0A 4MDKE 3CYMA 3PSIA 4BWMA 4PHPA 4GGQA 4CHKA 1IBXA 1MSWD 2PKOA 3T3FA 4YTNB 2INPE 2UYZB 1J19A 3RTVA 2M9NA 3FDSA 3HM3A 2L00B 1DOIA 2K25A 2FPLA 3DBRB 2LPEA 3WK8A 2LWPA 3C28A 1X9WA 3TEZA 3KD3A 1S76D 3PO0A 4LVSA 1J7CA 2JEJA 9ICFA 3C8YA 2W7PA 1NK7A 4TMAB 3Q8LA 3ZLZA 3ZIMA 1MG4A 1NZBA 1UGMA 2I5HA 2JZPA 3THVA 3F5EA 3ZJUA 1BPXA 1UNSA 2JXJA 5ALLA 3H1UA 4YT0B 4DLEA 1J8CA 1HJPA 1BXTA 1TE2A 5EWFA 2KKVA 2A3VA 3PVLA 9ICJA 2XK5A 2C9WB 1KQQA 4J9KA 4PT5A 3SEIA 3ZKJC 1YZ7A 1L5UA 2V4QA 5J0WA 1I4PA 2GLEA 4K3BA 4EYIB 3AV8A 4LDTD 1YJ1A 5J2GA 1Y8RC 2INDC 1E9MA 2F44A 4PYUA 1BPDA 1FO4A 4I28A 2XEWA 4PJ0U 3MC9A 5DB7A 4CGZA 2KN4A 4KSLC 4C56C 4BOZB 2L32A 3P42A 4FA6A 3HKZC 3W5VB 1TKDA 2OYYA 3RH4A 4TV3A 3FAHA 2MU2A 4DF8A 4FN2A 4KGRA 3UMGA 3T79A 1J2NA 3I63C 4ANWA 1FNUA 4QAYA 5J18A 2EAPA 1B22A 1B9RA 3SV4A 4I2DA 5KFUA 5KFSA 1QT9A 3PLVA 2JRIB 4RQ2A 3DVGY 3ZXVA 4ASWC 2FIDA 2WXKA 3ZXRA 3V61A 1NVID 3R7QA 3VVWB 4B0EA 2MSED 4J9SA 2J7QB 5J2AA 2PI4A 3AI5A 2KK0A 1Q10A 1UHUA 4RF0A 3FM9A 4K81A 1YN5A 3C1ZA 3ZO5B 4J9NA 5LNK1 4NQLB 3GE8C 1COKA 3ML9A 1WUDA 5J0SA 4WWPA 2BCRA 3Q8KA 4JX1C 3IM1A 4P0QB 3V3XA 2ZIUB 1NKEA 4I2AA 2MAXA 1TZOA 2V4RA 5CWRA 4Q2JA 4KLIA 3R2IA 2DAJA 4RCOA 4UB5A 3V6HA 1QKZA 4Y2XA 3Q8AA 1KM7A 7ICSA 2ZJAA 2KVSA 2GWSA 2FLNA 2KFKA 3EUB2 3NG0A 5F9NA 2W55A 1FEHA 2W11A 4MH8A 2KDBA 4QZCA 1TY2A 2IO1B 3NVWA 4QZGA 2W9CB 2HJ8A 3A9JB 2KWDA 1WE6A 4DQPA 3ALBA 1MI0A 3H0LB 3Q14C 3K1RB 4HVBA 3BQ0A 2K60A 8ICAA 4QIWC 1XO1A 4F4WA 2KNBA 2BW2A 2LM4A 3RF9A 5IO9A 1K1SA 2JX5A 5KTQA 4EBCA 3KZXA 4QWCA 8ICCA 3UM9A 2KHQA 2HHSA 1XCQL 3IFWB 3RZFA 2PVGC 1TK8A 4A3OA 2ZIXA 3NGDA 5C5JA 2XCAA 5IN7A 2G1EA 2MUTB 4QZ9A 2A1JA 2ISOA 3AEFB 4B9MA 1C20A 2KSOB 2BQUA 5HHHA 2BZFA 4KLMA 5CHFA 2WXNA 5ALQA 1IXRA 2HBKA 2W9MA 4II2B 1F77A 1JROA 3WAMA 4GN1A 4EKUA 1BNPA 4TSSA 3KWLA 2NTSA 5B66U 5DLFA 1RDFA 3RN9C 4F5OA 3ZW3A 1YOVB 3GV8B 4RH6A 1UBIA 4HKQA 1YX5B 3U52E 1D5MC 2KLGA 1SL1A 1GOZA 2W9BB 3PW7A 4FJVB 1RAXA 2H89B 4C4SA 2LUEA 2BR0A 4UAUA 1AARA 2KQ7A 4O1NA 3A0HU 1IBXB 1XCTL 2RD0A 5HP4A 2LYHA 8ICZA 1LGRA 3SAGA 1KFSA 5D94A 2HMXA 4ZYNA 4LNOA 1L7PA 3H7PA 5BOMA 2J53A 2KTFA 2FIFA 3ZNID 2W3RA 4P4PA 5JH5C 1STEA 1WXQA 4F93B 2QB1A 2F3NA 5HMLA 3ZRFA 2IHMA 3DWMA 5FKAC 2GBJA 1TAQA 3E0FA 9ICVA 1KFDA 4FS1A 2OEDA 4RQ7A 1WF9A 4L23A 5ALHA 4EELA 2ZVNA 4Q44A 1NJZA 4C7ZA 2RGFA 1U4BA 2LVQA 5C0YA 1RFKA 4FJYA 4DL6A 2PJHA 1QQ7A 3HW8A 4PK1A 1ZQFA 4S17A 4Z6DA 2KKCA 4ECRA 2IY1B 1LKYA 4IRCA 4RQ3A 1RFAA 2XK5B 4DDID 3RB4A 1KEJA 4UAVA 3BY4B 4PYZA 2XY6A 1UA1A 3NZ3A 5IKCM 3ECIA 1T0SC 3GIMA 3HT3A 4G3IA 5AKHA 4ED7A 4KDLB 4LNIA 3DPDA 3MC8A 5BMGA 5ALFA 5KHQA 4ICAA 4CF4A 1ZQIA 2KDIA 2WQYB 3AE6B 1CRXA 4B6WA 1TAMA 3RNAC 1E10A 2N7EA 1E8ZA 5AKXA 8ICQA 2UWQA 4ZRJA 3MDCA 3RCZA 2G07A 1ZPSA 3NY5A 3NZUA 1B0XA 4KDIC 2P6UA 5AK5A 3Q8CA 4UB4A 2D2QA 4G9BA 4TKNA 4C8OA 4JMUA 4HPMB 2HHVA 4MJSA 4KLTA 2PMZF 4KSKC 5DBAA 2MP2A 2RDBC 2LVPA 4EE2A 4DHZE 1ZUD2 1ZJNA 2LASA 1K5OA 3QEBZ 4AYBF 3EZ5A 1TS4A 2R8JA 1L8OA 3AULA 3KLSX 4US8A 4C0ZA 3U7ZA 1TK5A 3HJEA 5HNKA 4ZRPA 2ZZPB 3PSEB 5ALZA 3NVYA 4LCDE 3VUWA 4QW9A 4BX9C 2BWES 1PQSA 3DBSA 4UW9A 1X1MA 2SAKA 1S0MA 1MHXA 2Y5PA 3HUIA 3M1YA 3PW5A 1P3QU 3V6JA 7ICFA 2HOIA 1U48A 3TFRA 1D8BA 2DBYA 2DX5B 2KFKB 4KLLA 5DPSA 1QLBB 5I4DA 1IP9A 2FE8A 8ICPA 1T4GA 4QZFA 2NV3A 4MHVA 3AXCA 4US9A 2LI6A 2VJ5A 5J0TA 3SU8X 4YD1A 3U26A 2DAFA 5AI4A 1C4PA 3T9LA 9ICQA 4QWDA 2ASJA 1WZ3A 2BYTA 2LGDA 2K39A 9ICBA 2NPTA 1E90A 2ZPNA 3ML8A 5DQHA 3DHHC 4FBTA 2Z0EB
chains in the Genus database with same CATH topology
1T3QA 3SR6A 1JQ4A 2BS2B 3BVMA 1I7HA 1SE4A 1EU3A 1YNTE 3Q8FA 1FXAA 2WDQB 1YN4A 3I57A 2IDYA 1CZPA 3E9SA 4RGMA 1L5PA 2WXRA 1K51A 3AE9B 4MM3B 1N60A 1L6VA 1UWMA 5BYQA 2WXLA 2N9LA 3P63A 1JWMD 1WRIA 2V3NA 3BK2A 2JU6X 3AEBB 1QOAA 1IUEA 1C79A 2MEKA 4ZYSA 5MPOA 2CJOA 3V05A 2BTEA 2QSDA 4DXFA 1M4VA 3ZJVA 2KACA 1EM7A 2MJ3A 4RNAA 1GPXA 1WWTA 1YJJA 4H2AA 5H92C 2L83A 1XLQA 4XDCA 3AN1A 3CWIA 5HG2A 1KTKA 3NS1A 1RM6C 1SEBD 2KQ4X 5FK9C 1XLOA 4MACA 4ZHPA 1MPEA 3FILB 2DYOA 2BB6A 1C4CA 1VJKA 3BYYB 1JMLA 1CJEA 1F2RC 4DQOC 1C76A 2PVOD 5FR3A 1L0YB 3IXSA 3P4PB 3TSSA 1FM0D 3AH7A 1V1PA 3LXFA 4RF1A 5BMHA 2ICIA 5G5GA 4ARCA 3GP7A 1OQQA 4RGOS 5AUIA 1E7PB 1XEEA 1JWAD 1NYQA 4C80A 1YN3A 2YEPB 4WH4A 3R8BA 2WXGA 3MP9A 3BZDB 4JE3B 3HVDA 3AECB 1UWXA 3NUHB 5EE1A 5BMIA 1WYGA 2R61A 1V8CA 2MH7A 1FFVA 2SEBD 4WURA 3GS2A 1HQRD 1PGXA 3ABVB 4IOIE 2Q5WD 1HZ6A 1T6BX 2HTME 3I9V1 3P1MA 3W5UB 3AEEB 2E6XA 4ARIA 3P4RB 2RDHA 3HVZA 3U2SC 1YJIA 1QOFA 2M0AA 3GB1A 1XLNA 1K52A 2WXMA 1DOXA 2KDMA 1V1OA 1D4BA 3OWEB 2XN9C 1B1ZA 1FCLA 1AW7A 2H88B 2E3TA 1KRHA 2JYTA 5C2TB 2KMMA 1PGBA 4HKZE 2BS3B 4R3DA 1N63A 4GLSC 1SSNA 2MJEA 4MT5A 1VDVA 2LFIA 4RFBA 4WIPA 3B2GA 4XWWA 2BS4B 2WLBA 1NENB 3AEGB 1UUPA 2L1AA 1FNVA 1WSPA 1DYQA 4D2KA 3W2DA 1QOBA 3CIRB 1TKEA 2K22A 1WGKA 1FRRA 1TS2A 2CJNA 2WU5B 5BYSA 4N58A 1P7EA 2D5GA 4OHJA 4YXDB 1J7AA 1KH0A 5HFYA 1KFYB 4KX6B 2WXJA 3BVZA 3E56A 2RMMA 1I4XA 1HEZE 2W82A 1N5XA 1PGAA 4WAFA 3VRBB 1EU4A 4A8XC 2N9KA 1EWYC 2J52A 4WQMA 1CQVA 1TKGA 4LLGM 1OFFA 5T8IA 4L2YA 1SXTA 2DWQA 4YTMB 1NYRA 4HRSA 4P6VF 4KKIA 3ZJTA 1QF6A 1T5XD 2WS3B 2K9XA 1JRPA 1ROEA 1TY0A 1IBXA 4C7YA 1FCCC 3IT6B 1Y56A 4LTUA 1XLPA 2N7JA 3U4EG 2PKOA 4YTNB 3IAS1 2INPE 3PZ8A 1JW9D 4XE0A 4CQNA 1F0ZA 3MHZA 1EWCA 1E6EB 1DOIA 2X38A 1L6UA 5D3IB 3TEZA 3P4SB 3PO0A 1J7CA 3W9CB 3C8YA 4TMAB 2LUMA 4OZBA 2CU3A 2Z8LA 1TYGB 1MHHE 2WXIA 3H8HA 4JWUC 3RFZB 2WXFA 2ACZB 1A70A 1C4AA 2JZPA 5D7GA 3ZJUA 1HA5A 1UNSA 4HJGE 4YT0B 2W3SA 3NVZA 1TKYA 3ZQ4A 2GB1A 3LYYA 3AE3B 1BXTA 1ZE3D 2V3PA 2I2YA 3ETRA 3FILA 4PT5A 1IGCA 2VZKB 1QOGA 1TJEA 1JCKB 1LO5D 1VRAB 1CK1A 1I4PA 2J42A 1E0ZA 3MC0B 3AV8A 4JPSA 2WDVB 1AYFA 1E9MA 4XDDA 1FO4A 1TS5A 2V0GA 4LK0M 2DLBA 3L4PA 2KN4A 4C56C 4DXGA 1SJED 2GRIA 2QEJC 2L32A 3P42A 3W5VB 2N0SB 3AE2B 3P4QB 4M0WA 1GAQB 1L4DB 3FAHA 3HRDD 3AE1B 4KGRA 3W1SA 2PMVA 2QJLA 5E6JA 1N62A 1FNUA 1GB1A 4USAA 3KQ4A 4ITKA 4YSZB 1B9RA 1QT9A 2ZW0A 3BIID 1FNWA 4TQ1A 3B9JA 4A9AA 3ZYYX 1YMHE 2WXKA 4NAMA 3TEXA 1NVID 1PDXA 5HHDG 1FIQA 4B0EA 1FRDA 1JALA 1I4QA 1I4RA 1Q10A 3RPFC 4RF0A 3MJ5A 3AM9A 1YN5A 2EELA 5LNK1 2AQ1B 1L4ZB 1UGJA 4XWTA 3SFEB 4IKGA 1C77A 3IAM1 1L0VB 4JX1C 3V3XA 3Q69A 1HZ5A 1DGJA 1XO3A 1TZOA 3VQIA 5AUKA 4Q2JA 1YQ3B 2PW9A 2J4XA 3R2IA 2ON8A 4RCOA 1FXIA 3TEWA 3Q8AA 1QKZA 1C9FA 1D6EC 4WWMA 3BVGA 1SB3C 4JWSC 1N5WA 5EE0A 3EUB2 4ZOHC 2W55A 1FEHA 4HEA1 4MH8A 5G5HA 2K0PA 5GXGB 1TY2A 1RYJA 3NVWA 5H8YE 1ET9A 2MJDA 1I4HA 2B76B 2KWDA 1ZOYB 4HROA 3J9CA 4FXCA 2BT6A 1MI0A 1JWBD 4N59A 1FFUA 3BWUD 1FMAD 4ZRQA 4OZAA 2BW2A 3FC4A 1QQRA 1PUTA 1PYWD 2JX5A 4OW0A 5BYRA 1SJHD 1XCQL 1RWSA 2PVGC 4OZCA 5HI1A 5TSSA 3WCQA 2G1EA 4B0MA 2LEKA 3LB8C 3AEFB 2FUG1 2RPVA 1SE3A 4IDIA 1V97A 2WXNA 3VR9B 2XNAC 4TQ0A 1F77A 1JROA 3O13A 4NJCA 4RGTA 4REZA 1ZP0B 3KWLA 4TSSA 2NTSA 3SFDB 1R7SA 2WNMA 1NEKB 1TS3A 5EE9A 1D5XC 2QIEB 4RH6A 3EGRA 1KLGD 4HKQA 2DYMA 1AN8A 3U52E 1D5MC 1P7FA 3Q8BA 1GOZA 1IGDA 2Y3AA 1VZ6A 2LMCA 2ZW1A 2H89B 2IPKD 3Q8EA 4O1NA 1IBXB 1XCTL 4GDLB 2JYEA 1YQ4B 3VR8B 2LGIA 2FBWB 2JXTA 2J53A 2WXHA 4RGNA 2W3RA 1SIJA 4NAWB 2G9HD 2WXQA 1STEA 3AEDB 3NVVA 1ESFA 1WXQA 3AE8B 5EE3A 2YEPF 3DWMA 5FKAC 2LHEA 1ZXHA 1K50A 1ET6A 4YWGG 1VZ7A 1VZ8A 3AE4B 3ZGZA 2OEDA 2IGDA 1JWUD 4L23A 3PZ7A 3AEAB 4C7ZA 4UDUC 4A55A 1RFKA 3NRZA 4KGSA 2L52A 1PFDA 1BMLC 2AQ3B 1BUIC 2NMQA 1AWDA 3UI3A 2Y5CA 3AE5B 2BBCA 1ZDXA 2HDEA 4N6EB 3N9YC 4YSXB 2WDRB 4ZHOA 2OHFA 3NZ3A 1QILA 2W54A 3KWVA 4YSYB 4AS1A 2V4IB 3VRAB 1D5ZC 1L0XB 3BYTB 5BMGA 1SE2A 2GI9A 1V1PB 2WQYB 4P16A 3AE6B 1FD6A 2EKIA 1ACCA 2JQRB 2M19A 2K5PA 1E10A 2PLPA 2WP9B 3IT4B 5JXVA 2LJIA 2AQ2B 1K53A 1ZPSA 1SF0A 2PIAA 1DOYA 2IJ0A 3EA6A 2INNE 2JSVX 3Q8CA 1SBBB 1C78A 4GDKB 3AE7B 3AMZA 3B2FA 1N61A 3DWGC 4EE2A 3TUOA 1ZUD2 2JWUA 1ZDVA 5D3DA 1TS4A 2QMTA 1J7BA 1I4GA 3KLSX 3SEBA 1HXYD 1VR9A 4US8A 1XXGA 2QILA 4J3OD 3U7ZA 1XF5L 4ZRPA 3NVYA 1ENFA 3BK1A 2SAKA 2VZKD 3R2TA 2IGGA 1MHXA 5C3JB 2WU2B 2Y5PA 2TSSA 4NZLB 3HUIA 1NI3A 2NTTA 2WXOA 1GB4A 3MFGA 2ONQA 4AQ7A 2DBYA 3URYA 4A6QA 3T3NA 1QLBB 5I4DA 3T3OA 1OQRA 4KKJA 2FE8A 4L1BA 4YTPB 2AX5A 4US9A 1JWSD 2I38A 2LHDA 4OVZA 4KGTA 1C4PA 1KF6B 2WXPA 1MVKA 1KLUD 2K3UA 1F2RI 1VLBA 2M56B 2BYTA 2KAJA 2IGHA 2PTLA 2RDGA 3TEYA 1ZXIA 3AB5A 4A90A 2BB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  1T3Q A;  3SR6 A;  2BS4 B;  3B9J A;  4A9A A;  2BS2 B;  3ZYY X;  3AE4 B;  2WLB A;  1JQ4 A;  1NEN B;  1NVI D;  1I7H A;  1PDX A;  3AEG B;  1FIQ A;  1FRD A;  1FXA A;  2WDQ B;  4C7Z A;  1JAL A;  3AEA B;  1CZP A;  3RPF C;  1L5P A;  1RFK A;  3AM9 A;  3NRZ A;  3AE9 B;  2L52 A;  1N60 A;  1PFD A;  1L6V A;  1QOB A;  3CIR B;  1UWM A;  1TKE A;  2K22 A;  1WGK A;  1FRR A;  2CJN A;  3P63 A;  2WU5 B;  3SFE B;  1WRI A;  1AWD A;  4N58 A;  4YXD B;  1J7A A;  2Y5C A;  3AE5 B;  1KFY B;  3AEB B;  1L0V B;  4JX1 C;  4KX6 B;  4N6E B;  1QOA A;  1IUE A;  4YSX B;  5MPO A;  1DGJ A;  1XO3 A;  2WDR B;  2OHF A;  4ZHO A;  2CJO A;  1N5X A;  5AUK A;  2W54 A;  1YQ3 B;  4YSY B;  3VRB B;  3VRA B;  1FXI A;  2MJ3 A;  4WQM A;  1EWY C;  1GPX A;  1WWT A;  1TKG A;  1OFF A;  1YJJ A;  2WQY B;  3AE6 B;  4WWM A;  2EKI A;  5H92 C;  2M19 A;  1SB3 C;  2DWQ A;  2JQR B;  2L83 A;  1NYR A;  2K5P A;  4HRS A;  4JWS C;  1N5W A;  4P6V F;  1XLQ A;  5EE0 A;  3AN1 A;  3EUB 2;  1E10 A;  1QF6 A;  2WS3 B;  2WP9 B;  3CWI A;  2K9X A;  4ZOH C;  2W55 A;  1JRP A;  1ROE A;  5G5H A;  3NS1 A;  5GXG B;  1RM6 C;  4C7Y A;  3NVW A;  1RYJ A;  5H8Y E;  2MJD A;  2B76 B;  4LTU A;  1XLP A;  2PKO A;  4YTN B;  1ZOY B;  4HRO A;  4FXC A;  1SF0 A;  2BT6 A;  1XLO A;  2PIA A;  1JW9 D;  1JWB D;  4ZHP A;  1DOY A;  1F0Z A;  4N59 A;  1E6E B;  1FFU A;  1DOI A;  1FMA D;  1VJK A;  1L6U A;  1CJE A;  3FC4 A;  3P4S B;  1PUT A;  3PO0 A;  2JX5 A;  1J7C A;  2PVO D;  3W9C B;  3AE7 B;  3AMZ A;  3P4P B;  2CU3 A;  1FM0 D;  1RWS A;  3AH7 A;  3LXF A;  1TYG B;  2PVG C;  3B2F A;  1N61 A;  3DWG C;  4JWU C;  5G5G A;  2ACZ B;  1A70 A;  3WCQ A;  1ZUD 2;  2G1E A;  1OQQ A;  2LEK A;  5AUI A;  1E7P B;  3LB8 C;  4YT0 B;  2W3S A;  1JWA D;  4C80 A;  1NYQ A;  3AEF B;  3NVZ A;  1J7B A;  1TKY A;  4IDI A;  1V97 A;  4US8 A;  3AE3 B;  3VR9 B;  3AEC B;  1JRO A;  5EE1 A;  3NVY A;  1ZP0 B;  1WYG A;  3ETR A;  3KWL A;  1V8C A;  2MH7 A;  1FFV A;  3SFD B;  1R7S A;  5C3J B;  3ABV B;  1QOG A;  2WU2 B;  2Q5W D;  1NEK B;  1TJE A;  2HTM E;  5EE9 A;  2QIE B;  3P1M A;  3HUI A;  1NI3 A;  3W5U B;  3AEE B;  1E0Z A;  3AV8 A;  2WDV B;  1AYF A;  3P4R B;  1E9M A;  2DBY A;  4YTM B;  3HVZ A;  1YJI A;  1FO4 A;  1QLB B;  1QOF A;  1OQR A;  2H89 B;  1XLN A;  3L4P A;  1DOX A;  4YTP B;  3W5V B;  2AX5 A;  2N0S B;  3AE2 B;  4US9 A;  1YQ4 B;  3P4Q B;  3VR8 B;  1GAQ B;  3FAH A;  3HRD D;  2H88 B;  2E3T A;  1KF6 B;  1KRH A;  2FBW B;  3AE1 B;  2KMM A;  5C2T B;  2W3R A;  1SIJ A;  3AED B;  3NVV A;  2QJL A;  1VLB A;  1WXQ A;  2M56 B;  3AE8 B;  1N62 A;  4USA A;  2KAJ A;  2BS3 B;  4ITK A;  5EE3 A;  1N63 A;  4YSZ B;  3DWM A;  1B9R A;  1ZXI A;  2MJE A;  3AB5 A;  1VDV A;  1QT9 A;  3BII D; 
#chains in the Genus database with same CATH topology
 4DHZ B;  4F91 B;  5ALR A;  2JWZ A;  3UIP B;  4YFK A;  5A0L A;  3U30 A;  2ATL A;  2ZIX B;  1SE4 A;  1EU3 A;  3Q8F A;  5ALW A;  3MR2 A;  4O3Q A;  5J2F A;  8ICV A;  2WDQ B;  3I57 A;  4BKS D;  3E9S A;  1L5P A;  3IP4 B;  1JX4 A;  4DHJ B;  1K51 A;  3DBL I;  1N60 A;  4ANV A;  3P63 A;  2DF4 B;  3IG3 A;  2IHN A;  2ZIW A;  3IN5 A;  3QXG A;  1TAU A;  3BIN A;  3TKA A;  3QZ7 A;  9ICC A;  2MEK A;  4BKT A;  4EZ9 A;  1LB2 B;  5G55 A;  1OUQ A;  5AI9 A;  2INC C;  3IBE A;  4RNA A;  4CE6 A;  1UCV A;  1WWT A;  1D3Z A;  3QA8 A;  2DNF A;  2DQN B;  1XLQ A;  5AZH A;  3AN1 A;  5ALO A;  2M4N A;  2LHT A;  4I2G A;  2BGF A;  2D07 B;  3M95 A;  4IWO A;  2EAO A;  3LVW A;  1JXE A;  3OSP A;  1KTK A;  3NS1 A;  5JHA A;  1M6Y A;  1SEB D;  1TIF A;  3H7P B;  8ICS A;  1GO3 F;  3LVV A;  5KFC A;  1V38 A;  4I6L B;  4XGA B;  5FK9 C;  4OJL A;  3JPR A;  4MAC A;  4DCC A;  3FIL B;  3G6Y A;  2DYO A;  5KFZ A;  4F4Z A;  1ZQC A;  2BB6 A;  4G50 A;  4NNJ B;  3RYT A;  1SZH A;  4AOF A;  4DQO C;  1X6I A;  1L3V A;  1LVH A;  4I27 A;  1L0Y B;  1KL9 A;  1WWU A;  2E5S A;  2VJ4 A;  3LXF A;  1TZ1 A;  4GFJ A;  4IL6 U;  5G5G A;  3SD5 A;  2KX3 A;  4KLD A;  3RR8 A;  4RQ5 A;  4W9G A;  1OQQ A;  2ASQ A;  5AUI A;  4KTQ A;  1NYQ A;  2NR2 A;  1WG8 A;  2ZNV C;  1LKY B;  5GTI U;  4PHE A;  1ZQK A;  1XO0 A;  4BFR A;  3MP9 A;  3T8M A;  4B9K A;  4K4G A;  1UWX A;  4E71 A;  2ASD A;  5BMI A;  5CHW A;  4O5K A;  3R66 C;  5CA7 A;  4BOS C;  4I2H A;  2MH7 A;  3ZI4 A;  4JK1 A;  1R4N I;  3N1Y C;  3ABV B;  4KN7 A;  2HTM E;  5AHX A;  3IG8 A;  3VAW A;  3W5U B;  2FCQ A;  2D11 A;  2HVI A;  3MHS D;  4XX5 A;  4K4H A;  3H8W A;  4WQO B;  1ZET A;  4ZH4 A;  4B9N A;  4NJ8 A;  3HVZ A;  4GLX A;  3RT3 B;  3UMC A;  1F0M A;  3GB1 A;  3GV7 B;  1ZQJ A;  1K52 A;  2WXM A;  2KDM A;  2H3V A;  5DB9 A;  3OWE B;  1KN5 A;  3C2K A;  4KMU A;  5DBB A;  1AW7 A;  2E3T A;  1KRH A;  4ICU A;  3MBY A;  2KMM A;  3PV8 A;  4MFC A;  2EDU A;  4PS3 A;  2AGQ A;  2AEH A;  1ARO P;  4NV0 A;  2FMS A;  4DSE A;  4MJS B;  5L9X A;  4WAA A;  2MJE A;  1Z1V A;  4MT5 A;  4W9E A;  2LFI A;  4XWW A;  1IM4 A;  1UPH A;  2MP2 B;  3V72 A;  2WLB A;  2NRZ A;  2FCS A;  3IDW A;  4DS4 A;  2IMW P;  2J6T A;  1FNV A;  1UUP A;  3GZN I;  1BT0 A;  3RBE A;  2C2R A;  2K8H A;  1U45 A;  3TQ1 A;  3VTW A;  4FS2 A;  4JWM A;  7ICP A;  5BYS A;  2LGY A;  1P7E A;  2WDT B;  4W9I A;  1NI2 A;  1X9M A;  5HFY A;  2WX1 A;  7ICM A;  4KLS A;  3V6K A;  2WXJ A;  1WJN A;  5JTI A;  1I4X A;  2G4S A;  5J29 A;  3SDL C;  1PGA A;  2OH2 A;  5DBC A;  4PHA A;  4CRX A;  4JV1 A;  4OO1 J;  3VRB B;  1EU4 A;  4RMA A;  4WQM A;  1M94 A;  1OFF A;  3QAQ A;  2BKR B;  5T8I A;  4L2Y A;  2CPR A;  2BWF A;  4BWJ A;  2KG5 A;  9ICO A;  1SXT A;  4HRS A;  4RQ4 A;  4W9J A;  5KFO A;  2FLL A;  1S8O A;  5J0P A;  7ICJ A;  3ZDE A;  1MJD A;  3WKB A;  2MA9 B;  2G3Q B;  4NLN A;  9ICI A;  3IT6 B;  1Y56 A;  1XLP A;  2N7J A;  3WK4 A;  3PV1 A;  5AK4 A;  1JW9 D;  4XE0 A;  1CUK A;  2VH2 A;  5HR6 A;  4JL9 A;  3VFK A;  1EWC A;  3Q3J A;  2NPT B;  1F0Z A;  4JV2 A;  4NAW A;  4HJK A;  2X38 A;  4P1C C;  3LYS A;  3P4S B;  4KZC A;  4K3C A;  2BPG A;  4P7I A;  3MC1 A;  4F4K A;  3ED5 A;  3F53 A;  4MEY A;  2REX A;  4LNF A;  2F1H A;  1TYG B;  2CR5 A;  4B95 A;  3RB3 A;  3SQI A;  3ZDB A;  2WXI A;  1ZQE A;  2WXF A;  1A70 A;  3DHI C;  2XBB C;  5D7G A;  4HAI A;  2W3S A;  5DB8 A;  4HK2 A;  2ZIW B;  2GB1 A;  1ZE3 D;  1XQQ A;  3KKA A;  3C21 A;  4UB8 U;  5AKZ A;  5J2C A;  1X9S A;  8ICB A;  2BDU A;  3ETR A;  4F5P A;  1KLN A;  1DXS A;  2HCF A;  1SV4 A;  2KTR A;  4M02 A;  2UVU A;  4TUQ A;  1TJE A;  1JCK B;  4BJQ A;  1RYU A;  1VJ5 A;  4NLB A;  5J0X A;  2HHU A;  2NRV A;  4JPS A;  5LXI B;  1ZQM A;  3H0R B;  4XDD A;  2JH1 A;  2KWV B;  1TS5 A;  4I29 A;  4JQW C;  5BO4 B;  4LK0 M;  3ICX A;  4AUQ C;  1MQ3 A;  2GRI A;  3JPS A;  4RQ1 A;  3TI0 A;  3P4Q B;  4Y2S A;  2ES6 A;  3KKA C;  4CNQ A;  3Q8R B;  4AWJ A;  4DXA B;  1PZN A;  1TTN A;  3BZC A;  5E6J A;  1N62 A;  4LNN A;  2ZPY A;  2IOH A;  2YLM A;  1OGW A;  4LJX A;  3S2A A;  4NJ6 A;  3M9M B;  1I35 A;  1XS9 D;  4F2R A;  1FNW A;  5KFY A;  4ED0 A;  1YMH E;  4ED6 A;  4IW0 A;  1FIQ A;  1MC8 A;  2FUH B;  4MEM A;  1ZGU B;  3MGH A;  4ECQ A;  5C1Z A;  3AM9 A;  5DDM A;  2DL0 A;  3MFH A;  1U9L A;  3SFE B;  2LM1 A;  1KOT A;  3TCA A;  3DDC B;  3IAM 1;  3Q69 A;  1QSS A;  1HTO A;  3ZDM C;  5KAI U;  5J2B A;  2V9H A;  5DPW A;  2W43 A;  8ICH A;  1YQ3 B;  1SGG A;  1VCB A;  1P98 A;  2J4X A;  2ON8 A;  2PFQ A;  3PGE A;  3TEW A;  3KBB A;  5IA7 A;  2Y0S F;  4WWM A;  2C7N B;  1MQ2 A;  3BVG A;  8ICY A;  1SB3 C;  3X23 A;  3CSF A;  4JWS C;  3DVG X;  2BQQ A;  3GII A;  3L5K A;  3GIL A;  2Q4T A;  2D3G A;  1S3S G;  4K7S A;  4ZOH C;  2K0P A;  3H8M A;  3B0A A;  2B76 B;  3RJJ A;  1RQN A;  9ICW A;  1ZOY B;  3J9C A;  4FXC A;  3TAD C;  4BBN F;  2F8K A;  2QAR B;  4N59 A;  2N9E B;  2EH9 A;  1FFU A;  1FMA D;  2CU1 A;  4EZK A;  2NO5 A;  1QQR A;  1PYW D;  2X8X X;  3CW2 C;  1YD8 U;  3ZTD A;  2PFO A;  3ENE A;  3PNC A;  3KFU F;  1WGH A;  1RWS A;  2H3Q A;  9ICN A;  5AIB A;  5IIJ A;  1ZD5 A;  4RQN A;  3L08 A;  3WCQ A;  5AKI A;  4I2C A;  1NJW A;  3T5K A;  2XY7 A;  4KV2 A;  3QYP A;  4MM3 A;  4LNK A;  5KT6 A;  1S0N A;  2PFN A;  4MGY E;  5EDS A;  1V97 A;  3VR9 B;  4P4M A;  3O13 A;  2BCQ A;  2W03 A;  4EBE A;  1ZP0 B;  2JXX A;  4RNO A;  3RNC C;  2HTH A;  3SFD B;  2I1Q A;  3PS6 A;  4O3N A;  2WNM A;  3EHV A;  3L17 A;  2NO4 A;  4YCX A;  5KAF U;  4EYH B;  5IIL A;  1NEK B;  4Q8E A;  2KEY A;  5EE9 A;  1D5X C;  2QIE B;  4DL5 A;  3QU9 A;  1IPG A;  2XID A;  2R18 A;  2W8K A;  3EGR A;  3AL0 B;  1L7M A;  5AK6 A;  3C5G A;  1U47 A;  2DYM A;  3OG5 A;  4XA5 A;  8ICI A;  3UIN B;  1IGD A;  2Y3A A;  4FUL A;  5AM5 A;  5KFT A;  9ICK A;  4GIV A;  2ZW1 A;  3MGV A;  2WYQ A;  3Q8E A;  4M01 A;  8ICU A;  2Z0D B;  1GJZ A;  2XO7 A;  4YR0 A;  2NRT A;  3VR8 B;  3KHR A;  5DLG A;  1Z19 A;  2DYB A;  2YTU A;  2AQ0 A;  4AJY B;  4RGN A;  4YXM A;  1RRB A;  4DFP A;  4NAW B;  1ZQR A;  1ESF A;  1HUZ A;  1X66 A;  4I2I A;  3KHL A;  5AM1 A;  1K50 A;  3D6J A;  4E0D A;  3A0B U;  3RNB C;  2OJW A;  4GIB A;  1WY8 A;  4Y2Y A;  1VZ8 A;  2AYO B;  3ZGZ A;  2F77 X;  2KHV A;  2FCN A;  2KN5 A;  2DUY A;  3JPN A;  4UDU C;  2HBM A;  4DWF A;  1HUO A;  2O6V A;  2YMM A;  1BML C;  4MSM B;  3WAO A;  1S9F A;  2KZZ A;  3QU5 A;  5III A;  2W8L A;  2ZXH A;  2CKH B;  4EX7 A;  2Y5C A;  2BBC A;  2NYV A;  2HDE A;  2R8G A;  4C8L A;  2KTR B;  2OHF A;  2PEA A;  2KO3 A;  4YSY B;  3G6X A;  1QCK A;  4F92 B;  2V4I B;  3TFS A;  4Y2R A;  2H5X A;  2Z7J A;  5KFA A;  1SE2 A;  2GI9 A;  1V1P B;  4JGH B;  3RR7 A;  2DGZ A;  3AU2 A;  1ZQY A;  4O0I A;  1Z4N A;  1SWW A;  4HCP B;  2LBO A;  4DFJ A;  5JU5 A;  2PLP A;  1ZQW A;  2KIW A;  3KVF B;  1A6S A;  2JEG A;  4GOC A;  1BPB A;  3BQT A;  2LJI A;  2OJR A;  2KYW A;  3RJE A;  1NNL A;  3CNH A;  1NDD A;  1I42 A;  1H4R A;  5J2I A;  2KK8 A;  1PK3 A;  1LXD A;  2K8C B;  5KG6 A;  1SBB B;  2ZUD A;  2MHJ A;  2OEH A;  1WXA A;  3NS8 A;  1NK5 A;  2CRX A;  4EEN A;  4CCH A;  3APF A;  1N61 A;  5K4L A;  3SYZ A;  3N20 C;  4JIO U;  3M6K A;  1D9F A;  1ZDV A;  5D3D A;  4KVG B;  1DGS A;  3AU4 A;  5L1J A;  4XQ8 A;  3PML A;  3RH5 A;  4A8E A;  1J7B A;  3RUI B;  3N7P D;  2QIL A;  3UXP A;  1XXG A;  2WF5 A;  3GIJ A;  4ACF A;  4BGD A;  3PR4 A;  2BYE A;  2IO2 B;  4K7W A;  4QWE A;  1ENF A;  5J2E A;  1X6J A;  2XY5 A;  4YR3 A;  4W9L A;  4B6J A;  5KT4 A;  3SHQ A;  3KHG A;  2KZM A;  2E1F A;  3LWL A;  2MA1 A;  2BYF A;  3EFU A;  4ELU A;  1NI3 A;  2A1A A;  2CXY A;  2NTT A;  2WXO A;  4CYE A;  8ICO A;  4B9U A;  3B0Y A;  4KZ0 A;  1JMS A;  1PVR A;  8ICK A;  3IHQ B;  2ONQ A;  4AQ7 A;  2NRW A;  1UQV A;  4BXO A;  4UAS A;  1Q3V A;  4DSI A;  7ICV A;  4DQS A;  1X42 A;  2KC2 A;  1PVQ A;  2L7R A;  2L5Y A;  2QHO A;  2BHN A;  1WWV A;  3RNF C;  4YTP B;  3M8R A;  2AX5 A;  4RPZ A;  2I9G A;  1JWS D;  4MF8 A;  1JXL A;  2I38 A;  2D3B A;  3NUQ A;  4KGT A;  2WXP A;  3H4B A;  3Q8S B;  4UBB A;  1ZD4 A;  4M0A A;  2N1V A;  4GSW A;  2KE7 A;  4Y2Q A;  5KFF A;  1F2R I;  2K3U A;  3HWT A;  3QU4 A;  2M56 B;  5ALT A;  2KAJ A;  2PTL A;  4TUP A;  2RDG A;  1V49 A;  4NL9 A;  3AB5 A;  1V86 A;  3Q3N C;  3SR6 A;  1A5R A;  4RNM A;  3N30 A;  1JQ4 A;  1L3S A;  3EFC A;  4F8C B;  3PLU A;  2BYV E;  2KP7 A;  3WKA A;  2K4E A;  7ICR A;  1IV8 A;  2V4L A;  1CZP A;  2AGP A;  1N48 A;  2XVT A;  1NK0 A;  3DBH I;  2LJ5 A;  1ZKH A;  1Q8K A;  2VAN A;  3AE9 B;  3PTF C;  1L6V A;  4DS5 A;  4MM3 B;  1UWM A;  4UQG A;  5J2J A;  5BYQ A;  5L1I A;  4GDL A;  1NK6 A;  1WRI A;  3BK2 A;  3L16 A;  4PGX A;  3QE9 Y;  3I76 A;  2HVH A;  2KJ8 A;  2JT4 B;  3FYH A;  1IUE A;  4ZYS A;  5F3X B;  1Z1B A;  3A33 B;  4YVZ A;  3JSV A;  3Q8P B;  1EXN A;  4W9H A;  2WFA A;  4DWI A;  1F5S A;  2KNJ A;  5H92 C;  3SV3 A;  4DSJ A;  4DEZ A;  2E8N A;  1RG6 A;  3A1Q A;  2YB4 A;  5C23 A;  1JIH A;  4BDP A;  1VD2 A;  4P1B C;  1ZJM A;  2HD5 B;  1B4F A;  1RM6 C;  5ALK A;  2KQ4 X;  2DKX A;  3QU2 A;  2PKE A;  2IZV B;  5AKY A;  1KW4 A;  2YX8 A;  4BUG A;  2DFL A;  1MPE A;  2HI0 A;  4PPX A;  3DVN U;  3DQV A;  1C4C A;  1CJE A;  3AEV A;  2E8P A;  3VUX A;  1C76 A;  2PVO D;  1QQ6 A;  2LKY A;  5D46 A;  3P4P B;  4EEK A;  3TSS A;  2ICI A;  2MSN A;  1S1Q B;  2O6V B;  4YQW A;  4RGO S;  2KZ3 A;  1XEE A;  1JWA D;  4WH4 A;  1TVA A;  3IVF A;  2YQE A;  4J9O A;  2M0N A;  1RQL A;  3UMB A;  3WU2 U;  3MGI A;  3AEC B;  3HVD A;  4RPX A;  3SZ2 A;  3RNE C;  1X9X A;  5EE1 A;  2YVC A;  4C8M A;  5ALU A;  4NXZ A;  2JEF A;  3SD7 A;  2KXJ A;  2P66 A;  2EAM A;  2ZG6 A;  1PGX A;  2JPH A;  3N3K B;  2ZTE A;  2Q5W D;  3HP6 A;  1HZ6 A;  5EWE A;  4NY8 A;  4XYC A;  3VXW A;  2KIV A;  5HHI A;  1SL0 A;  2E6X A;  3RRH A;  2OWO A;  5JRT A;  3P4R B;  2IY0 B;  1J0G A;  7ICG A;  3U2S C;  2W7O A;  4ECY A;  4M00 A;  3R7R A;  5JUM A;  4DSL A;  2KQS A;  5ALM A;  5E6O A;  1QSL A;  2WAQ F;  2PE9 A;  1ZQB A;  3PRP B;  2C2E A;  1D4B A;  3IRU A;  3RH6 A;  2XN9 C;  1WXS A;  3QX1 A;  1B1Z A;  2XGP A;  5ALG A;  4B9V A;  4J9R A;  1FCL A;  5KFG A;  2EMT A;  5C2T B;  3HK0 A;  5DG7 A;  2MW5 A;  3IV6 A;  2BS3 B;  4QZI A;  4R3D A;  4GLS C;  1ZD2 P;  3L54 A;  5KFX A;  3PY8 A;  2DZI A;  4IRD A;  3B2G A;  2BS4 B;  3H7S A;  5KG7 A;  1RXV A;  1ZQP A;  4IR9 A;  1NEN B;  3PRE A;  2JZZ A;  2L1A A;  5L95 C;  1WSP A;  2V3S A;  2FPM A;  2ZJ8 A;  1DYQ A;  1RYS A;  2F76 X;  1K8R B;  3I1Y A;  2LYB A;  4NLG A;  3G6V A;  2HBJ A;  3U7D A;  7ICN A;  2D3A A;  2H3Z A;  1QOB A;  2LGX A;  3CIR B;  3V62 A;  3BJY A;  1TKE A;  2N1R A;  3V6E B;  2KJ9 A;  2CJN A;  3EWA A;  3PX4 A;  4N58 A;  3DDH A;  4OHJ A;  2HHQ A;  4A20 A;  1P7D A;  1J7A A;  4IWQ A;  1KFY B;  1J97 A;  4IQV A;  4IM2 A;  4IQT A;  3D2S A;  4M9L A;  3VH4 B;  4ELV A;  1N5X A;  2KWU B;  3LK9 A;  4XZ4 A;  1P9D U;  4M8N A;  2HDO A;  4DL7 A;  5AZG A;  4B9S A;  1SV0 A;  3C23 A;  7ICU A;  2N9K A;  1EWY C;  4BXO B;  4LLG M;  4AYB C;  2DWQ A;  5KG4 A;  4Z6C A;  4GU2 A;  5IIN A;  3Q8M A;  5JZE B;  4U6P A;  4FHK A;  3V7K A;  5J0Q A;  2KJH B;  2A1J B;  2KHW B;  3OJU A;  2FMP A;  2KAN A;  3AQF A;  3U4E G;  2GLS A;  5AKE A;  3IAS 1;  3UQA A;  3PZ8 A;  5TR5 A;  2G0A A;  1S97 A;  3MHZ A;  4EEY A;  3ZUN A;  4EBD A;  2J6S A;  4UAT A;  4IC9 A;  3RJH A;  4KLF A;  2HHW A;  4Q8F A;  3UXO A;  8ICM A;  1WJU A;  2KT7 A;  4JLC A;  2HSZ A;  2YN4 A;  4OZB A;  4ECX A;  4UBC A;  1WCL A;  4EX6 A;  3H8H A;  2BCU A;  3DCG A;  4HWI B;  4JWU C;  3RFZ B;  2ACZ B;  1C4A A;  2WF6 A;  3BQ7 A;  2R8K A;  1XSP A;  1Q1O A;  3K4G A;  4I2J A;  4ECV A;  1P1A A;  5ALX A;  3EEC A;  3NVZ A;  1TKY A;  1GC7 A;  3ZQ4 A;  3AE3 B;  3Q3O C;  2V3P A;  2B21 A;  3L10 B;  1QZE A;  1A0P A;  3C1Y A;  5J0Y A;  3KZI U;  4QJF B;  3SAF A;  2AL3 A;  1IGC A;  2VZK B;  3JSV B;  2LXA A;  3L13 A;  2BCS A;  4LJP B;  4PL2 A;  5DG8 A;  2J42 A;  3D2Q A;  5AI0 A;  3WKD A;  5J2D A;  1WYW B;  3MC0 B;  1RZT A;  3A1Q B;  1JN3 A;  5D6J B;  2V0G A;  1WXV A;  2ZJD A;  4FLH A;  4EZJ A;  1YQB A;  4DXG A;  2KKP A;  2QEJ C;  3DBL B;  4KLO A;  3OTQ A;  2EMS A;  5KFK A;  1L4D B;  3HRD D;  8ICF A;  3AE1 B;  4G0N B;  1CI4 A;  3W1S A;  2QJL A;  3W1Y A;  1GB1 A;  4USA A;  3KQ4 A;  4DF4 A;  4ITK A;  4YSZ B;  3PT2 B;  4J9Q A;  2O2V A;  4F4Y A;  2HHT A;  3BII D;  1V5O A;  3S6J A;  3B9J A;  4RQ6 A;  1WH3 A;  3ZYY X;  4K4I A;  1S77 D;  2J0K A;  4NAM A;  4GDK A;  2K8A A;  9ICT A;  2NVU I;  3TEX A;  4J9L A;  3OJS A;  1I4Q A;  1I4R A;  3RPF C;  3N97 B;  4DHJ D;  3MJ5 A;  4PS7 A;  1WX9 A;  3PSF A;  2ZUB A;  3Q6B A;  2AWT A;  5J8Y A;  2O6K A;  2AQ1 B;  1UGJ A;  2KZR A;  4E74 A;  4XWT A;  2DZK A;  1RLF A;  4IKG A;  3VTV A;  4F72 A;  3RJI A;  1C77 A;  3UQ2 A;  3DV9 A;  3KTQ A;  2C7M B;  5KFR A;  2KX0 A;  1L0V B;  2L0F A;  3UGB B;  7ICH A;  1XO3 A;  4WWO A;  3VQI A;  5AUK A;  4B9T A;  1LFD A;  2PW9 A;  4IM3 A;  9ICG A;  1Y88 A;  4LZD A;  1FXI A;  9ICU A;  1BPY A;  4QZB A;  2M17 A;  2WB1 F;  3ZD8 A;  3TAQ A;  3RJF A;  4QZD A;  5KT3 A;  5KFD A;  4F5Q A;  9ICP A;  5ALJ A;  1WM3 A;  3LJ3 A;  2KC1 A;  8ICT A;  3QWZ B;  5EE0 A;  3SMV A;  3GZF A;  2UVR A;  8ICE A;  4KX5 A;  4R8U A;  1UF0 A;  4FE3 A;  5GXG B;  1RYJ A;  1NKB A;  1ET9 A;  1I4H A;  3GFK B;  1WCN A;  1AQ6 A;  2G08 A;  3N28 A;  4HRO A;  4NLC A;  1JWB D;  4FO6 A;  4KX3 A;  4A3P A;  2G06 A;  2BPC A;  4ZRQ A;  4OZA A;  1KKX A;  2JHD A;  1R4N B;  2FPK A;  2LYA A;  3FC4 A;  4GXK A;  1PUT A;  4WWN A;  5L83 A;  1ZQO A;  2KJR A;  4F8R A;  4OW0 A;  3F5A A;  4MF2 A;  5DGB A;  1ZQL A;  4PH5 A;  3PR5 B;  3BQ2 A;  4HDQ A;  4DQI A;  2G4D B;  5TSS A;  3LB8 C;  1IYF A;  1L6N A;  2FUG 1;  1ZQV A;  1SE3 A;  2LVO A;  3M7D A;  3VTU A;  5LXH A;  5KFE A;  2DEN B;  2G45 B;  1H38 A;  2GOL A;  2JUO A;  4NJC A;  4M9N A;  2F1J A;  3QUQ A;  4RGT A;  1S0O A;  4F5R A;  4Y2U A;  3PVX A;  5ALI A;  3QZ8 A;  1DRG A;  2BQR A;  1F52 A;  4FZM A;  1TS3 A;  2ZUC A;  1A77 A;  4Q43 A;  1KLG D;  2GBR A;  3KW5 B;  1B43 A;  1ZYQ A;  4OJP A;  1AN8 A;  4CDG A;  5KFQ A;  4P2H A;  3PMN A;  1VZ6 A;  2LMC A;  3M6Z A;  2MBB B;  3GZN B;  3X0W A;  1F9J A;  1ZQU A;  4IQW A;  3PW4 A;  1V85 A;  2Y5B B;  1QH9 A;  1YQ4 B;  2LGI A;  4IC7 B;  5B5E U;  5CX3 A;  2FBW B;  2YML A;  1WX8 A;  2WXH A;  2GBN A;  2DZM A;  1IIP A;  1SIJ A;  4RQ8 A;  3RBD A;  3NVV A;  1O03 A;  5ALE A;  2JZB A;  4ECT A;  4WJP A;  1CMX B;  5EE3 A;  3BQ1 A;  2YEP F;  3M9N B;  2LHE A;  1MG8 A;  4NWI A;  1L8L A;  4OCZ A;  1VZ7 A;  2D8C A;  3PSP A;  3EYZ A;  2MBH A;  3AE4 B;  3RFA A;  2VA8 A;  3H6N A;  2G5H B;  3GOE A;  2K4I A;  2ODG A;  3AQE A;  3PZ7 A;  3AEA B;  4F7Z A;  4WJ3 B;  4KGS A;  3L3F X;  2BDP A;  1BPZ A;  2L52 A;  1LV5 A;  1V81 A;  3NHE B;  2NMQ A;  8ICX A;  2C28 A;  1UEL A;  4C8K A;  3I28 A;  1AWD A;  2K8B A;  3UI3 A;  4NY0 A;  1UT5 A;  2IA6 A;  3AE5 B;  2RDJ A;  3DHG C;  2DHZ A;  5CRX A;  1EO6 A;  2DZJ A;  3DVN V;  4N6E B;  4G11 A;  3N9Y C;  3CRX A;  4YSX B;  4YG2 A;  5KFM A;  2L76 A;  1DOQ A;  2DKZ A;  1ZQS A;  1QIL A;  2NBV B;  3KWV A;  3QJZ A;  3MDA A;  4RM9 A;  4C4V A;  1D5Z C;  3PX0 A;  3MR3 A;  1L0X B;  4FHJ A;  1KFT A;  3JPQ A;  3RJG A;  5D49 A;  1S10 A;  3RAX A;  1S5L U;  1X40 A;  2HOQ A;  1ZOL A;  2V9W A;  4C8N A;  3VDZ A;  4DSF A;  2KFN A;  3RI7 C;  4LZG A;  2K5P A;  3NTU A;  3KH0 A;  4ECZ A;  5J17 A;  1KJT A;  4W9C A;  1S0V A;  5AKK A;  4Z6F A;  2WP9 B;  1L7Y A;  2FJ6 A;  1YZ6 A;  4OVV A;  4YP3 A;  3OHB A;  2KDE B;  1ISN A;  1K53 A;  2LZ6 A;  3V6C B;  1NK4 A;  2PIA A;  1DOY A;  4DFD A;  4F71 A;  2IJ0 A;  3EA6 A;  3SI8 A;  2INN E;  2WGS A;  3VHT C;  2O2V B;  5HKH A;  2MBO A;  2C2D A;  3RB6 A;  2F2A B;  4IWP A;  5AM4 A;  3QEA Z;  4GDK B;  2BKF A;  1Z4O A;  3AU6 A;  3PHW B;  4ED3 A;  4Z6E A;  5KFN A;  1ZQQ A;  2JWU A;  4QNL A;  1XSN A;  2V1Y A;  2YMP A;  3WK7 A;  5KT5 A;  1I4G A;  2H3F A;  1HXY D;  4UAZ A;  3SEB A;  2W9C A;  7ICQ A;  1YIW A;  3B08 A;  1XF5 L;  5L1M A;  2MBQ A;  1ZQH A;  4DOC A;  3CP8 A;  1Z5S B;  3GQC A;  2D6F C;  3BK1 A;  3KHH A;  3ETL A;  1QLN A;  3NOB A;  3DBR I;  4C00 A;  1RYR A;  2IGG A;  3ZTC A;  2WU2 B;  2KLC A;  4KLQ A;  1WZ0 A;  3RJK A;  1Z3E B;  2QKQ A;  2WX0 A;  4QZE A;  4LDT B;  3T5J A;  3UPQ A;  4DOB A;  3T5H A;  3JW0 X;  5FP0 A;  1ZQG A;  1WMH A;  3LDZ E;  4A6Q A;  4F4X A;  1SKW A;  3QHT A;  3EC8 A;  2E8O A;  4L1B A;  5KG5 A;  2MUT A;  5HR7 A;  1NJY A;  3F2D A;  1L3T A;  2R8H A;  3KYC D;  2RDI A;  5ALD A;  1WGR A;  4OVZ A;  1KF6 B;  4X57 B;  2IOF A;  2VIX A;  1WFY A;  1KLU D;  3QAR A;  3KUC B;  1VLB A;  3QK0 A;  1F1H A;  3KYD D;  1LM8 B;  2ISP A;  2Y0S C;  3RD2 A;  3UF8 A;  1ZXI A;  1WR1 A;  1E8Y A;  3SAH A;  5AI6 A;  2BS2 B;  4NLK A;  3UIO B;  1I7H A;  1R4M I;  3RAQ A;  3EPG A;  2XGQ A;  5KG2 A;  3KUD B;  2E1E A;  4PHD A;  4O9M A;  5DB6 A;  1V6E A;  4EEW A;  5D4B A;  2WXR A;  1P0R A;  1FXT B;  4S0R A;  4OJ5 A;  4BBN C;  2WXL A;  2N9L A;  4JV0 A;  1JWM D;  5J0R A;  3CST A;  2V3N A;  1BNO A;  1WGY A;  5J2K A;  2D3D A;  3AEB B;  5J2H A;  3QUT A;  3HKZ F;  1C79 A;  2KMC A;  3B1L X;  5MPO A;  5KFW A;  2CJO A;  3Q3F A;  5LLI A;  2Q0Z X;  2ZIV A;  4DXF A;  4OVU A;  3K1Z A;  2GBK A;  4TQS A;  1ZW7 A;  3VH3 B;  3M3J A;  2KAC A;  3ZJV A;  1Q46 A;  1EM7 A;  9ICS A;  2MJ3 A;  3C2L A;  3BDP A;  2W04 A;  1NZP A;  2JZ3 B;  2KD1 A;  2VH1 A;  3E2E A;  3QNM A;  4XDC A;  5GTH U;  4HYK A;  1OEY A;  4F50 A;  3NJT A;  3CWI A;  2K4H A;  5HG2 A;  4ACO A;  2N9P C;  2A5U A;  4HXD A;  3QX7 A;  4ZRK A;  1X2I A;  3MJW A;  1L2N A;  3LDA A;  1U49 A;  1XLO A;  5AM3 A;  3AU5 A;  2QB0 A;  2BVC A;  2JZB B;  2FAZ A;  2NS5 A;  5KT2 A;  3C29 A;  1BGX T;  2KVZ A;  4GXJ A;  2JEI A;  2H3I A;  4X5V A;  1RXW A;  1JML A;  1XSL A;  1KSP A;  1XC9 A;  1F2R C;  1DK3 A;  2LXC A;  3E58 A;  3M62 B;  5E6P A;  2I1J A;  2AQ4 A;  5H2F U;  2NBW B;  3ZDD A;  5DQI A;  4KN4 A;  4O5C A;  3IXS A;  1FM0 D;  3AH7 A;  1R4M B;  4RF1 A;  5BMH A;  3BZK A;  4BKG A;  3ISC A;  4M8M A;  4BKS A;  2RRD A;  4ED1 A;  3QQ8 B;  4GC7 A;  4C80 A;  2DPJ A;  2K8B B;  1YN3 A;  2YEP B;  3R8B A;  4TUU A;  8ICR A;  2K6D B;  4F3O A;  1Q3U A;  3GV5 B;  4U7C A;  2L8J A;  1WYG A;  4FZN A;  1N2X A;  2OCE A;  2ASL A;  1FFV A;  3GS2 A;  3H8J A;  3JPO A;  1HQR D;  4C4V B;  4RU9 A;  3D32 A;  9ICH A;  5CHG A;  3O0F A;  3P1M A;  3AEE B;  3OJ3 A;  1WGD A;  4QIW F;  4JWN A;  7ICT A;  4I6P A;  2FMQ A;  3NRW A;  1KRP A;  2RDH A;  3WKC A;  3K9O B;  1YJI A;  5KFL A;  2AJQ A;  3TMP B;  2XC9 A;  1DOX A;  2B3A A;  1V1O A;  4G3X B;  3ISB A;  4OJO A;  3NZS A;  4DBG A;  3HIL A;  4ECS A;  1GG3 A;  5AKJ A;  1SKS A;  3JYU A;  4K1R B;  4EFO A;  2M0X A;  1PGB A;  4IQU A;  8ICW A;  4C4T A;  2EKE C;  4TUS A;  2W9A A;  5ALS A;  1TFR A;  5CEH A;  2GMI C;  1ZD3 A;  4J9M A;  4Y2J A;  1N63 A;  5AI8 A;  4AP4 C;  5AM0 A;  2E8M A;  3H7I A;  2R2O A;  1GNU A;  2XIC A;  2L3Z A;  5JHB A;  5KFJ A;  3N32 A;  1G6J A;  1PK1 A;  3MTN B;  4M6W A;  4HCN B;  4O3R A;  4M9H A;  3H40 A;  2ESE A;  3ZD9 A;  4KLE A;  2M1M A;  3W2D A;  4ED8 A;  4JB3 A;  2GO7 A;  2JV3 A;  2WU5 B;  4UB1 A;  4PS8 A;  3ONN A;  1KTQ A;  1D8L A;  3OSN A;  8ICJ A;  2D5G A;  1KH0 A;  1ED1 A;  1TK0 A;  4DQR A;  4KX6 B;  3H8S A;  2RQ5 A;  1WR6 E;  3BVZ A;  1JI7 A;  5KFB A;  4RUA A;  3J81 j;  2HOF A;  1HEZ E;  2ZEQ A;  4O3M A;  3IHP C;  4YMN A;  2XI9 A;  4ELT A;  1F44 A;  4M9G A;  2LRU A;  3CF6 E;  2ZTD A;  1WMH B;  2J52 A;  4RUC A;  4DLG A;  1CQV A;  2PXI A;  1UA0 A;  1KBU A;  2XCP A;  4YTM B;  1L3U A;  4RZR A;  1NYR A;  4KKI A;  2MQJ A;  5AKG A;  4ECU A;  1QF6 A;  1T5X D;  2WS3 B;  5ALN A;  4UB2 A;  4AP9 A;  1JRP A;  1ROE A;  4C7Y A;  1FCC C;  2I6X A;  5KG1 A;  4LTU A;  4O5E A;  1QTM A;  4DFM A;  3CMM B;  5AKL A;  2W9N A;  4CQN A;  1E6E B;  3TBL D;  4TUR A;  1WE7 A;  1L6U A;  5D3I B;  4NL9 C;  4IRK A;  3APC A;  2DPI A;  3W9C B;  2C5L C;  2LUM A;  2JRZ A;  4DL2 A;  3HM6 X;  3OPX A;  2CU3 A;  2PE6 B;  2Z8L A;  1HEK A;  1MHH E;  1NOM A;  2NBU A;  5E6N A;  2MRP A;  1HA5 A;  3ONS A;  2EAN A;  2R8I A;  4NLZ A;  1C1Y B;  4HJG E;  4WJO A;  3UXN A;  5DG9 A;  3LYY A;  5AM2 A;  3RRG A;  1YX6 B;  4FFD A;  3M8S A;  3WA0 A;  2UVV A;  1CEZ A;  1A76 A;  3PRZ A;  2I2Y A;  2ZIV B;  3FIL A;  5DQG A;  4GB9 A;  5AEK B;  3BS5 A;  1QOG A;  1EF1 A;  1LO5 D;  1VRA B;  4IR1 A;  1CK1 A;  2UU7 A;  2N1W A;  1E0Z A;  1L7N A;  2FDR A;  3QUC A;  4Q45 A;  2WDV B;  1AYF A;  3ZDA A;  1H8C A;  2BCV A;  2HW3 A;  4PL1 A;  4FJZ A;  3WAL A;  2M8S A;  1YT3 A;  2HJ1 A;  2DLB A;  2N7D A;  3L4P A;  5DPT A;  2OM6 A;  1T8E A;  1SJE D;  3DBH B;  2N0S B;  3AE2 B;  3A9K A;  4M0W A;  1GAQ B;  3GDX A;  4EOY A;  2QB0 B;  7ICL A;  1OEY J;  1SKR A;  1V5T A;  3KUZ A;  2PMV A;  4M9J A;  5IIM A;  3RZW C;  3D2N A;  4URK A;  2BQ3 A;  2ZW0 A;  2QC8 A;  5AIA A;  3UQ0 A;  4TQ1 A;  1N6Z A;  4A9A A;  2JH7 A;  4FAD A;  7ICI A;  1UBQ A;  1KDH A;  3R9K A;  5HHD G;  1PDX A;  1SWV A;  1FRD A;  3QIJ A;  1JAL A;  3ISD A;  3PZP A;  5L1L A;  2KVC A;  1U4A A;  3F2B A;  2EEL A;  1XD3 B;  2BPF A;  4W9F A;  3IG5 A;  1EUV B;  2KDF B;  1L4Z B;  4RT2 A;  4ED2 A;  4P0P A;  9ICE A;  2MRL A;  2JRH A;  4UAR A;  5L1K A;  3PO5 A;  5DGA A;  4I2F A;  2YMQ A;  2JMG A;  1DGJ A;  4MFA A;  1HZ5 A;  4RQ0 A;  4B9L A;  3OAW A;  3OGU A;  3I5J C;  1TV9 A;  1TGZ B;  3UQB A;  2VRR B;  9ICA A;  4FBU A;  2ZCC A;  1C9F A;  1HTQ A;  4J6I A;  1D8Y A;  1D6E C;  2KVR A;  4HPL B;  2CHZ A;  1N5W A;  1SZP A;  2FCM A;  5EOZ A;  4R65 A;  2Y1I A;  2D3C A;  2RSU A;  3PPA A;  4HEA 1;  5CTR C;  5G5H A;  9ICM A;  5H8Y E;  2QDF A;  2MJD A;  2KMA A;  5TIS U;  1QQ5 A;  5KG0 A;  4F5N A;  1FPY A;  2BT6 A;  5IOI A;  2R2Q A;  4NM2 A;  1WGG A;  2VA3 A;  4YXJ A;  2PMZ C;  3BWU D;  1OXJ A;  5AZF A;  3ZDC A;  2HHX A;  3TAC B;  2KWC A;  3GU3 A;  2HE7 A;  9ICL A;  3N1Z C;  2WWZ A;  5BYR A;  1PK1 B;  4JUZ A;  3VCB A;  2WAQ C;  2MCN B;  4M6W B;  3ZRC A;  1SJH D;  5KL1 B;  2BF8 B;  2D10 A;  4QW8 A;  4OZC A;  5HI1 A;  2KN7 A;  2LRW A;  4DO9 A;  2O6V D;  3OHA A;  4RQM A;  2N4F A;  2LEK A;  4B0M A;  5DKW A;  2HBL A;  2RPV A;  2KJ5 A;  5AK3 A;  3K75 D;  2CN1 A;  4DL4 A;  1NBF C;  4IDI A;  3MAB A;  2XNA C;  3H9D A;  4TQ0 A;  4BZA A;  3GE3 C;  4RT3 A;  3WAP A;  3O65 B;  4REZ A;  3B0X A;  1XT9 B;  1C7Y A;  3HPO A;  4MGZ E;  4RPY A;  1R7S A;  4IM0 A;  4KIK A;  4ZDV A;  1UD7 A;  4BAX A;  4UB3 A;  1SV0 C;  2JVC A;  2GH1 A;  1P7F A;  3Q8B A;  1UT8 A;  1ZQ1 C;  2A4Z A;  4MSQ B;  1N56 A;  2QCZ A;  3APD A;  3V60 A;  4DL3 A;  2IPK D;  2CHX A;  3C19 A;  3RMK C;  4P4O A;  4GDL B;  1BVS A;  1FEZ A;  5DDY A;  2JYE A;  4YMO A;  3LWM A;  3F2C A;  1L7O A;  3PRM B;  4YR2 A;  2JXT A;  1DK2 A;  2C7H A;  5AIC A;  2G9H D;  2WXQ A;  3AED B;  5KG3 A;  2K1F A;  3AE8 B;  4IS7 A;  2KIC A;  4UAY A;  4Y2P A;  1E5W A;  4HPP A;  2J0M A;  3U8Z A;  1ZXH A;  2J0J A;  1ET6 A;  5ALV A;  2GOW A;  4YWG G;  1MA7 A;  4ICV A;  2JF5 A;  4C4R A;  1WX7 A;  3N7S C;  1EF5 A;  2IGD A;  1JWU D;  1O08 A;  5AI5 A;  1GUA B;  4A55 A;  3N4M B;  3HIZ A;  3QUB A;  2JGA A;  3NRZ A;  8ICG A;  1PFD A;  4I2E A;  3N7R C;  4Y2V A;  2FNJ B;  2AQ3 B;  2KJ6 A;  4KMO B;  1BUI C;  1JUD A;  3K9P B;  5J2R A;  4ZRI A;  4TQR A;  1ZDX A;  3NAS A;  2IO3 B;  3BS5 B;  4RNN A;  5BPC A;  2WDR B;  4ZHO A;  3PZD A;  2W54 A;  4AS1 A;  3VRA B;  4O3S A;  2BKE A;  3QC8 B;  5CJ7 A;  3BYT B;  1OQY A;  1XWL A;  4R63 A;  4P16 A;  1FD6 A;  2G09 A;  2EKI A;  1ACC A;  4O3O A;  1T94 A;  2JQR B;  9ICR A;  2C22 A;  2M19 A;  2K89 A;  1XNS A;  4M04 A;  4O3P A;  3VC8 A;  4GXI A;  2BPS A;  4QZH A;  3A9K B;  4M0W B;  3IT4 B;  2EQY A;  1OW5 A;  5JXV A;  1RPL A;  7ICE A;  1Q5W B;  2IYD B;  2AQ2 B;  1BPE A;  2YY6 A;  4FZL A;  1SF0 A;  5E79 U;  3W1S C;  4IUM B;  1ZQT A;  1K1Q A;  2JSV X;  2RLT A;  1V2Y A;  3JPT A;  2RPQ A;  1C78 A;  2CS4 A;  4YMM A;  3QCA A;  3AE7 B;  1E7U A;  3AMZ A;  2QLT A;  4PGQ A;  3JPP A;  3AUO A;  2EZZ A;  1UZX B;  4KLG A;  2MBE A;  3A4S C;  3B2F A;  4QZ8 A;  3DWG C;  2FE9 A;  3TUO A;  1Q0W B;  3ZNH B;  2ZTC A;  1OTR B;  1MN8 A;  5DCN A;  5KHO A;  1SXE A;  4NQK E;  2B6G A;  4F2S A;  2ZVO A;  3P2B A;  2QMT A;  4BVU C;  4P0P B;  3PHX B;  5J8Y C;  1VR9 A;  2F1I A;  4OD0 A;  5TZV A;  4J3O D;  1SGH A;  5IP4 D;  1E8X A;  2MX2 A;  2WHI A;  2QAR A;  4R64 A;  4NJ7 A;  2VZK D;  3R2T A;  2L0T A;  4I6N B;  2ZXI A;  5C3J B;  1QSY A;  1V80 A;  2TSS A;  4NZL B;  5KFI A;  2LD9 A;  3DOW A;  1GB4 A;  2KD0 A;  1ECW A;  4PZN A;  3MFG A;  5DPR A;  4M2Y A;  2Y9T A;  4FBJ B;  3GIK A;  3URY A;  4J9P A;  2RHF A;  3T3N A;  3T3O A;  3QU7 A;  4KLJ A;  1OQR A;  4KKJ A;  4NM1 A;  3RNG C;  3FKY A;  3VUY A;  1Z00 A;  2PFP A;  7ICO A;  4EUT A;  2LHD A;  4DFK A;  3OJ4 B;  3N1X C;  3C2M A;  2KV2 A;  3WKE A;  4M47 A;  4W9K A;  5CB1 A;  3RB0 A;  3ALR A;  2B0C A;  1MVK A;  4QWA A;  2LMR A;  2K6Q A;  2GBM A;  2IGH A;  4GXB A;  2WB1 C;  4I2B A;  3PW2 A;  3PST A;  5KNI A;  3TEY A;  4A90 A;  4UB6 U;  3DEE A;  2BB5 A;  1T3Q A;  1J2M A;  4QWB A;  3A4R A;  2ALZ A;  4KLU A;  2WHE A;  3BVM A;  2N9X A;  5KL8 B;  3EPI A;  1YNT E;  1FXA A;  1YN4 A;  2IDY A;  4RGM A;  2WF8 A;  4MH0 E;  4W9D A;  1GC6 A;  2IOF K;  1E7V A;  4EZL A;  2AH5 A;  3H0M B;  2JU6 X;  3WIM A;  2EZX A;  1MFW A;  2AL6 A;  3PX6 A;  4MFF A;  2K4P A;  1QOA A;  2A19 A;  1ZQD A;  2G5I B;  3ZDT A;  2VKQ A;  1T3N A;  1D9D A;  3C0R B;  3V05 A;  2BTE A;  2QSD A;  2AU0 A;  1TBE A;  4KIK B;  1WXM A;  2ZJ5 A;  5KFV A;  1M4V A;  4N9F 4;  4DDG D;  1WI0 A;  4F1S A;  1GPX A;  1PUZ A;  1YJJ A;  4H2A A;  1E8W A;  2L83 A;  4XRH A;  3MFI A;  3TIX A;  1PVP A;  3TAN A;  3WK6 A;  5J0U A;  2IBK A;  5KFH A;  5IIK A;  1COO A;  4KIT B;  2FLP A;  2KOX A;  2OXO A;  2KFJ A;  5EWG A;  1NK9 A;  2Y1J A;  4ZHP A;  4R66 A;  1T7P A;  1XU4 A;  5KFP A;  2IO0 B;  4CF3 A;  2WF7 A;  2WTF A;  2Z59 B;  1VJK A;  3BYY B;  4DK5 A;  3V7L A;  4K7U A;  1WJ6 A;  1V9P A;  5F9L A;  1JRU A;  3M63 B;  1C3T A;  5FR3 A;  1ZRN A;  4MGK E;  1V1P A;  8ICL A;  4PZO A;  4ECW A;  5CR0 A;  4ARC A;  4WJN A;  3HX0 A;  2ZNV B;  1SL2 A;  4DSK A;  3GP7 A;  1SXD A;  1E7P B;  1UH6 A;  3JVZ X;  4IG7 B;  5BOL A;  4LJO B;  2KTQ A;  1WM2 A;  2P35 A;  4Y2T A;  4KLH A;  2WXG A;  2EZY A;  2JR5 A;  4ANX A;  4GMV A;  2MLB A;  4JE3 B;  3BZD B;  3NUH B;  2LGS A;  3MR5 A;  3TJP A;  7ICK A;  2R61 A;  4MEX A;  1V8C A;  4P0Q A;  4XUS A;  2SEB D;  4WUR A;  4XC2 A;  2ZIU A;  1Z2M A;  1ZQX A;  5ALP A;  4YL8 A;  4IOI E;  1HIW A;  2K8C A;  4J03 A;  4UAW A;  1T6B X;  3I9V 1;  3Q2A C;  3ZVV A;  5GMV A;  2IBI B;  2FI1 A;  3PO4 A;  1V9J A;  3MR6 A;  2RP5 A;  2RR9 A;  4DOA A;  2AXT U;  1IG6 A;  3T5L A;  4ARI A;  3SEN A;  1KLV A;  2ZCB A;  2YB1 A;  1QOF A;  2M0A A;  2NRX A;  2LI5 A;  2WF9 A;  4GC6 A;  1XLN A;  3RUL A;  4HLE A;  1WJ4 A;  3L0W B;  2Y9U A;  2JY6 A;  3V7J A;  3WAN A;  3TL5 A;  4YN4 A;  3EW9 A;  3TAP A;  2H88 B;  4YD2 A;  2JYT A;  5ALY A;  2KMD A;  3TAD A;  3A9J A;  5CHV C;  2PPH A;  3WK5 A;  2BGW A;  2AHO B;  4HKZ E;  5J0O A;  4EZ6 A;  1ZQA A;  3ZNG C;  5HMM A;  1ZQZ A;  5D2M B;  3BS7 A;  1SE9 A;  1SSN A;  5IIO A;  1HE8 A;  4DQQ A;  1VDV A;  3ZNZ B;  2CHW A;  3Q8Q B;  1WIA A;  3Q3M C;  4RFB A;  4WIP A;  3WK9 A;  4II3 B;  4CO7 A;  4CF5 A;  5G2N A;  2AGO A;  3AEG B;  1T0Y A;  8ICN A;  1TT5 B;  2MWS B;  1T0R C;  3H4D A;  3C5F A;  5CP2 A;  2KFZ A;  9ICX A;  3KOO A;  3ORY A;  4R8U B;  2C60 A;  4WJQ A;  1WRD B;  4D2K A;  2K22 A;  2L05 A;  4AJW A;  1NJX A;  1WGK A;  1FRR A;  1TS2 A;  4NPN A;  1ZRM A;  1LQB A;  2KSO A;  1T0Q C;  5FR6 A;  4YXD B;  5T14 A;  3R3M A;  2J6U A;  4OJ6 A;  2PI5 A;  2OOB B;  4E3C A;  3E56 A;  5KT7 A;  2VA2 A;  2RMM A;  2W82 A;  3OLM D;  4RM8 A;  4MEL A;  2P6R A;  4MGI E;  4ANU A;  2NCN A;  3I3T B;  4WAF A;  4PGY A;  2UVW A;  5IAA C;  4HDO A;  4A8X C;  1TKG A;  3TAR A;  3M9O B;  3PW0 A;  1ZQN A;  4P6V F;  2W9B A;  1NKC A;  3ZJT A;  1URJ A;  3HHM A;  1Z00 B;  2F8L A;  1SIF A;  4QZA A;  2I1K A;  2K9X A;  1NK8 A;  2KOB A;  1TY0 A;  4MDK E;  3CYM A;  3PSI A;  4BWM A;  4PHP A;  4GGQ A;  4CHK A;  1IBX A;  1MSW D;  2PKO A;  3T3F A;  4YTN B;  2INP E;  2UYZ B;  1J19 A;  3RTV A;  2M9N A;  3FDS A;  3HM3 A;  2L00 B;  1DOI A;  2K25 A;  2FPL A;  3DBR B;  2LPE A;  3WK8 A;  2LWP A;  3C28 A;  1X9W A;  3TEZ A;  3KD3 A;  1S76 D;  3PO0 A;  4LVS A;  1J7C A;  2JEJ A;  9ICF A;  3C8Y A;  2W7P A;  1NK7 A;  4TMA B;  3Q8L A;  3ZLZ A;  3ZIM A;  1MG4 A;  1NZB A;  1UGM A;  2I5H A;  2JZP A;  3THV A;  3F5E A;  3ZJU A;  1BPX A;  1UNS A;  2JXJ A;  5ALL A;  3H1U A;  4YT0 B;  4DLE A;  1J8C A;  1HJP A;  1BXT A;  1TE2 A;  5EWF A;  2KKV A;  2A3V A;  3PVL A;  9ICJ A;  2XK5 A;  2C9W B;  1KQQ A;  4J9K A;  4PT5 A;  3SEI A;  3ZKJ C;  1YZ7 A;  1L5U A;  2V4Q A;  5J0W A;  1I4P A;  2GLE A;  4K3B A;  4EYI B;  3AV8 A;  4LDT D;  1YJ1 A;  5J2G A;  1Y8R C;  2IND C;  1E9M A;  2F44 A;  4PYU A;  1BPD A;  1FO4 A;  4I28 A;  2XEW A;  4PJ0 U;  3MC9 A;  5DB7 A;  4CGZ A;  2KN4 A;  4KSL C;  4C56 C;  4BOZ B;  2L32 A;  3P42 A;  4FA6 A;  3HKZ C;  3W5V B;  1TKD A;  2OYY A;  3RH4 A;  4TV3 A;  3FAH A;  2MU2 A;  4DF8 A;  4FN2 A;  4KGR A;  3UMG A;  3T79 A;  1J2N A;  3I63 C;  4ANW A;  1FNU A;  4QAY A;  5J18 A;  2EAP A;  1B22 A;  1B9R A;  3SV4 A;  4I2D A;  5KFU A;  5KFS A;  1QT9 A;  3PLV A;  2JRI B;  4RQ2 A;  3DVG Y;  3ZXV A;  4ASW C;  2FID A;  2WXK A;  3ZXR A;  3V61 A;  1NVI D;  3R7Q A;  3VVW B;  4B0E A;  2MSE D;  4J9S A;  2J7Q B;  5J2A A;  2PI4 A;  3AI5 A;  2KK0 A;  1Q10 A;  1UHU A;  4RF0 A;  3FM9 A;  4K81 A;  1YN5 A;  3C1Z A;  3ZO5 B;  4J9N A;  5LNK 1;  4NQL B;  3GE8 C;  1COK A;  3ML9 A;  1WUD A;  5J0S A;  4WWP A;  2BCR A;  3Q8K A;  4JX1 C;  3IM1 A;  4P0Q B;  3V3X A;  2ZIU B;  1NKE A;  4I2A A;  2MAX A;  1TZO A;  2V4R A;  5CWR A;  4Q2J A;  4KLI A;  3R2I A;  2DAJ A;  4RCO A;  4UB5 A;  3V6H A;  1QKZ A;  4Y2X A;  3Q8A A;  1KM7 A;  7ICS A;  2ZJA A;  2KVS A;  2GWS A;  2FLN A;  2KFK A;  3EUB 2;  3NG0 A;  5F9N A;  2W55 A;  1FEH A;  2W11 A;  4MH8 A;  2KDB A;  4QZC A;  1TY2 A;  2IO1 B;  3NVW A;  4QZG A;  2W9C B;  2HJ8 A;  3A9J B;  2KWD A;  1WE6 A;  4DQP A;  3ALB A;  1MI0 A;  3H0L B;  3Q14 C;  3K1R B;  4HVB A;  3BQ0 A;  2K60 A;  8ICA A;  4QIW C;  1XO1 A;  4F4W A;  2KNB A;  2BW2 A;  2LM4 A;  3RF9 A;  5IO9 A;  1K1S A;  2JX5 A;  5KTQ A;  4EBC A;  3KZX A;  4QWC A;  8ICC A;  3UM9 A;  2KHQ A;  2HHS A;  1XCQ L;  3IFW B;  3RZF A;  2PVG C;  1TK8 A;  4A3O A;  2ZIX A;  3NGD A;  5C5J A;  2XCA A;  5IN7 A;  2G1E A;  2MUT B;  4QZ9 A;  2A1J A;  2ISO A;  3AEF B;  4B9M A;  1C20 A;  2KSO B;  2BQU A;  5HHH A;  2BZF A;  4KLM A;  5CHF A;  2WXN A;  5ALQ A;  1IXR A;  2HBK A;  2W9M A;  4II2 B;  1F77 A;  1JRO A;  3WAM A;  4GN1 A;  4EKU A;  1BNP A;  4TSS A;  3KWL A;  2NTS A;  5B66 U;  5DLF A;  1RDF A;  3RN9 C;  4F5O A;  3ZW3 A;  1YOV B;  3GV8 B;  4RH6 A;  1UBI A;  4HKQ A;  1YX5 B;  3U52 E;  1D5M C;  2KLG A;  1SL1 A;  1GOZ A;  2W9B B;  3PW7 A;  4FJV B;  1RAX A;  2H89 B;  4C4S A;  2LUE A;  2BR0 A;  4UAU A;  1AAR A;  2KQ7 A;  4O1N A;  3A0H U;  1IBX B;  1XCT L;  2RD0 A;  5HP4 A;  2LYH A;  8ICZ A;  1LGR A;  3SAG A;  1KFS A;  5D94 A;  2HMX A;  4ZYN A;  4LNO A;  1L7P A;  3H7P A;  5BOM A;  2J53 A;  2KTF A;  2FIF A;  3ZNI D;  2W3R A;  4P4P A;  5JH5 C;  1STE A;  1WXQ A;  4F93 B;  2QB1 A;  2F3N A;  5HML A;  3ZRF A;  2IHM A;  3DWM A;  5FKA C;  2GBJ A;  1TAQ A;  3E0F A;  9ICV A;  1KFD A;  4FS1 A;  2OED A;  4RQ7 A;  1WF9 A;  4L23 A;  5ALH A;  4EEL A;  2ZVN A;  4Q44 A;  1NJZ A;  4C7Z A;  2RGF A;  1U4B A;  2LVQ A;  5C0Y A;  1RFK A;  4FJY A;  4DL6 A;  2PJH A;  1QQ7 A;  3HW8 A;  4PK1 A;  1ZQF A;  4S17 A;  4Z6D A;  2KKC A;  4ECR A;  2IY1 B;  1LKY A;  4IRC A;  4RQ3 A;  1RFA A;  2XK5 B;  4DDI D;  3RB4 A;  1KEJ A;  4UAV A;  3BY4 B;  4PYZ A;  2XY6 A;  1UA1 A;  3NZ3 A;  5IKC M;  3ECI A;  1T0S C;  3GIM A;  3HT3 A;  4G3I A;  5AKH A;  4ED7 A;  4KDL B;  4LNI A;  3DPD A;  3MC8 A;  5BMG A;  5ALF A;  5KHQ A;  4ICA A;  4CF4 A;  1ZQI A;  2KDI A;  2WQY B;  3AE6 B;  1CRX A;  4B6W A;  1TAM A;  3RNA C;  1E10 A;  2N7E A;  1E8Z A;  5AKX A;  8ICQ A;  2UWQ A;  4ZRJ A;  3MDC A;  3RCZ A;  2G07 A;  1ZPS A;  3NY5 A;  3NZU A;  1B0X A;  4KDI C;  2P6U A;  5AK5 A;  3Q8C A;  4UB4 A;  2D2Q A;  4G9B A;  4TKN A;  4C8O A;  4JMU A;  4HPM B;  2HHV A;  4MJS A;  4KLT A;  2PMZ F;  4KSK C;  5DBA A;  2MP2 A;  2RDB C;  2LVP A;  4EE2 A;  4DHZ E;  1ZUD 2;  1ZJN A;  2LAS A;  1K5O A;  3QEB Z;  4AYB F;  3EZ5 A;  1TS4 A;  2R8J A;  1L8O A;  3AUL A;  3KLS X;  4US8 A;  4C0Z A;  3U7Z A;  1TK5 A;  3HJE A;  5HNK A;  4ZRP A;  2ZZP B;  3PSE B;  5ALZ A;  3NVY A;  4LCD E;  3VUW A;  4QW9 A;  4BX9 C;  2BWE S;  1PQS A;  3DBS A;  4UW9 A;  1X1M A;  2SAK A;  1S0M A;  1MHX A;  2Y5P A;  3HUI A;  3M1Y A;  3PW5 A;  1P3Q U;  3V6J A;  7ICF A;  2HOI A;  1U48 A;  3TFR A;  1D8B A;  2DBY A;  2DX5 B;  2KFK B;  4KLL A;  5DPS A;  1QLB B;  5I4D A;  1IP9 A;  2FE8 A;  8ICP A;  1T4G A;  4QZF A;  2NV3 A;  4MHV A;  3AXC A;  4US9 A;  2LI6 A;  2VJ5 A;  5J0T A;  3SU8 X;  4YD1 A;  3U26 A;  2DAF A;  5AI4 A;  1C4P A;  3T9L A;  9ICQ A;  4QWD A;  2ASJ A;  1WZ3 A;  2BYT A;  2LGD A;  2K39 A;  9ICB A;  2NPT A;  1E90 A;  2ZPN A;  3ML8 A;  5DQH A;  3DHH C;  4FBT A;  2Z0E B; 
#chains in the Genus database with same CATH homology
 1T3Q A;  3SR6 A;  1JQ4 A;  2BS2 B;  3BVM A;  1I7H A;  1SE4 A;  1EU3 A;  1YNT E;  3Q8F A;  1FXA A;  2WDQ B;  1YN4 A;  3I57 A;  2IDY A;  1CZP A;  3E9S A;  4RGM A;  1L5P A;  2WXR A;  1K51 A;  3AE9 B;  4MM3 B;  1N60 A;  1L6V A;  1UWM A;  5BYQ A;  2WXL A;  2N9L A;  3P63 A;  1JWM D;  1WRI A;  2V3N A;  3BK2 A;  2JU6 X;  3AEB B;  1QOA A;  1IUE A;  1C79 A;  2MEK A;  4ZYS A;  5MPO A;  2CJO A;  3V05 A;  2BTE A;  2QSD A;  4DXF A;  1M4V A;  3ZJV A;  2KAC A;  1EM7 A;  2MJ3 A;  4RNA A;  1GPX A;  1WWT A;  1YJJ A;  4H2A A;  5H92 C;  2L83 A;  1XLQ A;  4XDC A;  3AN1 A;  3CWI A;  5HG2 A;  1KTK A;  3NS1 A;  1RM6 C;  1SEB D;  2KQ4 X;  5FK9 C;  1XLO A;  4MAC A;  4ZHP A;  1MPE A;  3FIL B;  2DYO A;  2BB6 A;  1C4C A;  1VJK A;  3BYY B;  1JML A;  1CJE A;  1F2R C;  4DQO C;  1C76 A;  2PVO D;  5FR3 A;  1L0Y B;  3IXS A;  3P4P B;  3TSS A;  1FM0 D;  3AH7 A;  1V1P A;  3LXF A;  4RF1 A;  5BMH A;  2ICI A;  5G5G A;  4ARC A;  3GP7 A;  1OQQ A;  4RGO S;  5AUI A;  1E7P B;  1XEE A;  1JWA D;  1NYQ A;  4C80 A;  1YN3 A;  2YEP B;  4WH4 A;  3R8B A;  2WXG A;  3MP9 A;  3BZD B;  4JE3 B;  3HVD A;  3AEC B;  1UWX A;  3NUH B;  5EE1 A;  5BMI A;  1WYG A;  2R61 A;  1V8C A;  2MH7 A;  1FFV A;  2SEB D;  4WUR A;  3GS2 A;  1HQR D;  1PGX A;  3ABV B;  4IOI E;  2Q5W D;  1HZ6 A;  1T6B X;  2HTM E;  3I9V 1;  3P1M A;  3W5U B;  3AEE B;  2E6X A;  4ARI A;  3P4R B;  2RDH A;  3HVZ A;  3U2S C;  1YJI A;  1QOF A;  2M0A A;  3GB1 A;  1XLN A;  1K52 A;  2WXM A;  1DOX A;  2KDM A;  1V1O A;  1D4B A;  3OWE B;  2XN9 C;  1B1Z A;  1FCL A;  1AW7 A;  2H88 B;  2E3T A;  1KRH A;  2JYT A;  5C2T B;  2KMM A;  1PGB A;  4HKZ E;  2BS3 B;  4R3D A;  1N63 A;  4GLS C;  1SSN A;  2MJE A;  4MT5 A;  1VDV A;  2LFI A;  4RFB A;  4WIP A;  3B2G A;  4XWW A;  2BS4 B;  2WLB A;  1NEN B;  3AEG B;  1UUP A;  2L1A A;  1FNV A;  1WSP A;  1DYQ A;  4D2K A;  3W2D A;  1QOB A;  3CIR B;  1TKE A;  2K22 A;  1WGK A;  1FRR A;  1TS2 A;  2CJN A;  2WU5 B;  5BYS A;  4N58 A;  1P7E A;  2D5G A;  4OHJ A;  4YXD B;  1J7A A;  1KH0 A;  5HFY A;  1KFY B;  4KX6 B;  2WXJ A;  3BVZ A;  3E56 A;  2RMM A;  1I4X A;  1HEZ E;  2W82 A;  1N5X A;  1PGA A;  4WAF A;  3VRB B;  1EU4 A;  4A8X C;  2N9K A;  1EWY C;  2J52 A;  4WQM A;  1CQV A;  1TKG A;  4LLG M;  1OFF A;  5T8I A;  4L2Y A;  1SXT A;  2DWQ A;  4YTM B;  1NYR A;  4HRS A;  4P6V F;  4KKI A;  3ZJT A;  1QF6 A;  1T5X D;  2WS3 B;  2K9X A;  1JRP A;  1ROE A;  1TY0 A;  1IBX A;  4C7Y A;  1FCC C;  3IT6 B;  1Y56 A;  4LTU A;  1XLP A;  2N7J A;  3U4E G;  2PKO A;  4YTN B;  3IAS 1;  2INP E;  3PZ8 A;  1JW9 D;  4XE0 A;  4CQN A;  1F0Z A;  3MHZ A;  1EWC A;  1E6E B;  1DOI A;  2X38 A;  1L6U A;  5D3I B;  3TEZ A;  3P4S B;  3PO0 A;  1J7C A;  3W9C B;  3C8Y A;  4TMA B;  2LUM A;  4OZB A;  2CU3 A;  2Z8L A;  1TYG B;  1MHH E;  2WXI A;  3H8H A;  4JWU C;  3RFZ B;  2WXF A;  2ACZ B;  1A70 A;  1C4A A;  2JZP A;  5D7G A;  3ZJU A;  1HA5 A;  1UNS A;  4HJG E;  4YT0 B;  2W3S A;  3NVZ A;  1TKY A;  3ZQ4 A;  2GB1 A;  3LYY A;  3AE3 B;  1BXT A;  1ZE3 D;  2V3P A;  2I2Y A;  3ETR A;  3FIL A;  4PT5 A;  1IGC A;  2VZK B;  1QOG A;  1TJE A;  1JCK B;  1LO5 D;  1VRA B;  1CK1 A;  1I4P A;  2J42 A;  1E0Z A;  3MC0 B;  3AV8 A;  4JPS A;  2WDV B;  1AYF A;  1E9M A;  4XDD A;  1FO4 A;  1TS5 A;  2V0G A;  4LK0 M;  2DLB A;  3L4P A;  2KN4 A;  4C56 C;  4DXG A;  1SJE D;  2GRI A;  2QEJ C;  2L32 A;  3P42 A;  3W5V B;  2N0S B;  3AE2 B;  3P4Q B;  4M0W A;  1GAQ B;  1L4D B;  3FAH A;  3HRD D;  3AE1 B;  4KGR A;  3W1S A;  2PMV A;  2QJL A;  5E6J A;  1N62 A;  1FNU A;  1GB1 A;  4USA A;  3KQ4 A;  4ITK A;  4YSZ B;  1B9R A;  1QT9 A;  2ZW0 A;  3BII D;  1FNW A;  4TQ1 A;  3B9J A;  4A9A A;  3ZYY X;  1YMH E;  2WXK A;  4NAM A;  3TEX A;  1NVI D;  1PDX A;  5HHD G;  1FIQ A;  4B0E A;  1FRD A;  1JAL A;  1I4Q A;  1I4R A;  1Q10 A;  3RPF C;  4RF0 A;  3MJ5 A;  3AM9 A;  1YN5 A;  2EEL A;  5LNK 1;  2AQ1 B;  1L4Z B;  1UGJ A;  4XWT A;  3SFE B;  4IKG A;  1C77 A;  3IAM 1;  1L0V B;  4JX1 C;  3V3X A;  3Q69 A;  1HZ5 A;  1DGJ A;  1XO3 A;  1TZO A;  3VQI A;  5AUK A;  4Q2J A;  1YQ3 B;  2PW9 A;  2J4X A;  3R2I A;  2ON8 A;  4RCO A;  1FXI A;  3TEW A;  3Q8A A;  1QKZ A;  1C9F A;  1D6E C;  4WWM A;  3BVG A;  1SB3 C;  4JWS C;  1N5W A;  5EE0 A;  3EUB 2;  4ZOH C;  2W55 A;  1FEH A;  4HEA 1;  4MH8 A;  5G5H A;  2K0P A;  5GXG B;  1TY2 A;  1RYJ A;  3NVW A;  5H8Y E;  1ET9 A;  2MJD A;  1I4H A;  2B76 B;  2KWD A;  1ZOY B;  4HRO A;  3J9C A;  4FXC A;  2BT6 A;  1MI0 A;  1JWB D;  4N59 A;  1FFU A;  3BWU D;  1FMA D;  4ZRQ A;  4OZA A;  2BW2 A;  3FC4 A;  1QQR A;  1PUT A;  1PYW D;  2JX5 A;  4OW0 A;  5BYR A;  1SJH D;  1XCQ L;  1RWS A;  2PVG C;  4OZC A;  5HI1 A;  5TSS A;  3WCQ A;  2G1E A;  4B0M A;  2LEK A;  3LB8 C;  3AEF B;  2FUG 1;  2RPV A;  1SE3 A;  4IDI A;  1V97 A;  2WXN A;  3VR9 B;  2XNA C;  4TQ0 A;  1F77 A;  1JRO A;  3O13 A;  4NJC A;  4RGT A;  4REZ A;  1ZP0 B;  3KWL A;  4TSS A;  2NTS A;  3SFD B;  1R7S A;  2WNM A;  1NEK B;  1TS3 A;  5EE9 A;  1D5X C;  2QIE B;  4RH6 A;  3EGR A;  1KLG D;  4HKQ A;  2DYM A;  1AN8 A;  3U52 E;  1D5M C;  1P7F A;  3Q8B A;  1GOZ A;  1IGD A;  2Y3A A;  1VZ6 A;  2LMC A;  2ZW1 A;  2H89 B;  2IPK D;  3Q8E A;  4O1N A;  1IBX B;  1XCT L;  4GDL B;  2JYE A;  1YQ4 B;  3VR8 B;  2LGI A;  2FBW B;  2JXT A;  2J53 A;  2WXH A;  4RGN A;  2W3R A;  1SIJ A;  4NAW B;  2G9H D;  2WXQ A;  1STE A;  3AED B;  3NVV A;  1ESF A;  1WXQ A;  3AE8 B;  5EE3 A;  2YEP F;  3DWM A;  5FKA C;  2LHE A;  1ZXH A;  1K50 A;  1ET6 A;  4YWG G;  1VZ7 A;  1VZ8 A;  3AE4 B;  3ZGZ A;  2OED A;  2IGD A;  1JWU D;  4L23 A;  3PZ7 A;  3AEA B;  4C7Z A;  4UDU C;  4A55 A;  1RFK A;  3NRZ A;  4KGS A;  2L52 A;  1PFD A;  1BML C;  2AQ3 B;  1BUI C;  2NMQ A;  1AWD A;  3UI3 A;  2Y5C A;  3AE5 B;  2BBC A;  1ZDX A;  2HDE A;  4N6E B;  3N9Y C;  4YSX B;  2WDR B;  4ZHO A;  2OHF A;  3NZ3 A;  1QIL A;  2W54 A;  3KWV A;  4YSY B;  4AS1 A;  2V4I B;  3VRA B;  1D5Z C;  1L0X B;  3BYT B;  5BMG A;  1SE2 A;  2GI9 A;  1V1P B;  2WQY B;  4P16 A;  3AE6 B;  1FD6 A;  2EKI A;  1ACC A;  2JQR B;  2M19 A;  2K5P A;  1E10 A;  2PLP A;  2WP9 B;  3IT4 B;  5JXV A;  2LJI A;  2AQ2 B;  1K53 A;  1ZPS A;  1SF0 A;  2PIA A;  1DOY A;  2IJ0 A;  3EA6 A;  2INN E;  2JSV X;  3Q8C A;  1SBB B;  1C78 A;  4GDK B;  3AE7 B;  3AMZ A;  3B2F A;  1N61 A;  3DWG C;  4EE2 A;  3TUO A;  1ZUD 2;  2JWU A;  1ZDV A;  5D3D A;  1TS4 A;  2QMT A;  1J7B A;  1I4G A;  3KLS X;  3SEB A;  1HXY D;  1VR9 A;  4US8 A;  1XXG A;  2QIL A;  4J3O D;  3U7Z A;  1XF5 L;  4ZRP A;  3NVY A;  1ENF A;  3BK1 A;  2SAK A;  2VZK D;  3R2T A;  2IGG A;  1MHX A;  5C3J B;  2WU2 B;  2Y5P A;  2TSS A;  4NZL B;  3HUI A;  1NI3 A;  2NTT A;  2WXO A;  1GB4 A;  3MFG A;  2ONQ A;  4AQ7 A;  2DBY A;  3URY A;  4A6Q A;  3T3N A;  1QLB B;  5I4D A;  3T3O A;  1OQR A;  4KKJ A;  2FE8 A;  4L1B A;  4YTP B;  2AX5 A;  4US9 A;  1JWS D;  2I38 A;  2LHD A;  4OVZ A;  4KGT A;  1C4P A;  1KF6 B;  2WXP A;  1MVK A;  1KLU D;  2K3U A;  1F2R I;  1VLB A;  2M56 B;  2BYT A;  2KAJ A;  2IGH A;  2PTL A;  2RDG A;  3TEY A;  1ZXI A;  3AB5 A;  4A90 A;  2BB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...