3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
3W5UB 2PVGC 1QOAA 1TKGA 2W3SA 1V8CA 4YTPB 2WP9B 2WS3B 3AE9B 2JX5A 2QJLA 1E0ZA 1VLBA 1PUTA 3P1MA 2WDVB 3B9JA 2N0SB 3AE3B 1VJKA 2PVOD 4C80A 1TJEA 2H88B 2BS2B 1ROEA 4FXCA 1R7SA 2FBWB 1RYJA 1KRHA 1FRDA 1AYFA 2M56B 3NVVA 2WU2B 3LB8C 5EE1A 3AE7B 4C7ZA 2LEKA 1WRIA 3FAHA 4YXDB 2MH7A 5AUIA 3HUIA 1WXQA 4US8A 3CWIA 3P4QB 1FIQA 1RM6C 1NYRA 2WQYB 3AEBB 3NRZA 1TYGB 1XO3A 1ZUD2 3L4PA 3AMZA 1DOXA 4US9A 1TKEA 1YQ4B 1ZOYB 2AX5A 1N5WA 1L0VB 1OFFA 1E6EB 2BT6A 1OQQA 2KMMA 2WLBA 2KAJA 1N61A 1CZPA 1FRRA 1E7PB 1RWSA 3P4RB 1N63A 1ZP0B 2QIEB 2WDQB 3HVZA 4YTMB 1KF6B 4C7YA 1GAQB 3W9CB 3HRDD 3VR9B 4ZHOA 1JALA 1FO4A 1PFDA 3SFDB 1JROA 5G5HA 1T3QA 1FXIA 1FM0D 2B76B 2CJOA 1DGJA 2K5PA 3AE5B 3AEGB 1N60A 2WU5B 1QLBB 2MJEA 2MJDA 1YJJA 2BS4B 3AEDB 1L6UA 4IDIA 1CJEA 1DOYA 5C2TB 1NVID 1XLOA 1FMAD 5EE3A 5H92C 3DWGC 4HRSA 5EE9A 1FFUA 1N5XA 1YQ3B 3AE6B 4N59A 1JWAD 1XLPA 1B9RA 2W55A 1J7CA 3P4PB 2BS3B 3ABVB 3VRBB 2WDRB 1QOGA 2JQRB 1OQRA 3P4SB 2DBYA 3AE1B 2DWQA 4JX1C 4LTUA 1SB3C 3EUB2 1QT9A 3AECB 3AB5A 3B2FA 3AE2B 2H89B 1GPXA 3AE8B 4YSYB 1TKYA 2MJ3A 4JWSC 3P63A 3AM9A 1WGKA 2M19A 3DWMA 3NVYA 1WWTA 2Y5CA 1JWBD 3NS1A 5MPOA 2K22A 3KWLA 1EWYC 1L6VA 1SF0A 1ZXIA 1XLNA 1A70A 4YTNB 3W5VB 4HROA 4ZHPA 1QOFA 1QF6A 3SR6A 2K9XA 4YSZB 1E9MA 1KFYB 2L83A 3LXFA 2EKIA 3RPFC 3AE4B 3BIID 1DOIA 1N62A 3VRAB 3FC4A 1J7BA 3PO0A 4A9AA 3NVZA 1PDXA 1SIJA 1QOBA 3SFEB 1E10A 2CJNA 1WYGA 5G5GA 3B2GA 4ITKA 1IUEA 1XLQA 1YJIA 1VDVA 1V97A 1L5PA 4WQMA 1FFVA 2ACZB 4N58A 5H8YE 2L52A 3VR8B 2W54A 4JWUC 3AN1A 4WWMA 3ETRA 4USAA 1I7HA 1JW9D 2E3TA 2OHFA 3AEFB 4KX6B 5GXGB 5C3JB 2PKOA 2HTME 4N6EB 1F0ZA 1JRPA 2CU3A 3ZYYX 1JQ4A 4ZOHC 1RFKA 4YSXB 1AWDA 1NEKB 1NI3A 1J7AA 2PIAA 2W3RA 3CIRB 3AEEB 3AEAB 2G1EA 3AH7A 3NVWA 1FXAA 3AV8A 5AUKA 1NYQA 4YT0B 3WCQA 1NENB 1UWMA 5EE0A 2Q5WD 4P6VF
chains in the Genus database with same CATH superfamily
3W5UB 2AQ0A 2Z0EB 2MW5A 3PSFA 1ESFA 2L00B 2J52A 3AE9B 3RH6A 1NZBA 1VZ7A 2Y9TA 3ZD9A 1FEHA 3A9KB 3AE3B 1MHHE 1VJKA 2KMDA 3RNAC 2NS5A 2N9KA 2WU2B 4RGMA 2ONQA 1U45A 1XEEA 3VQIA 1C4PA 1NNLA 3I63C 1SIFA 3SHQA 1BPBA 3UXOA 4MSQB 5J2FA 3IHPC 4A3OA 2Y9UA 3WK4A 1PUZA 1WUDA 1P7DA 4F1SA 1XSNA 1MQ3A 3RMKC 2BQ3A 1DYQA 3EECA 1KW4A 1RPLA 3QZ7A 2RDIA 4BGDA 3PO5A 2D3BA 2NMQA 2BBCA 2BB5A 3R2TA 4XE0A 2Z7JA 3KHLA 2JH1A 1Z3EB 3VR9B 3WK6A 1JALA 4KSLC 1D3ZA 4R64A 4I2HA 3DBHB 2KVZA 3PZ7A 2MJDA 1ZRNA 1YJJA 3AEDB 3ETLA 1IBXB 1ZQEA 1FMAD 2IOFA 3QE9Y 3I1YA 3AUOA 1L4ZB 2PE9A 3GIKA 1BPYA 3PR4A 3JPNA 3OG5A 3R3MA 3VRBB 5HHDG 1OXJA 3EUB2 3URYA 4F50A 5B5EU 2M0NA 4BOZB 3AB5A 3Q8BA 2WXJA 5E6NA 1V6EA 1HEKA 3DBSA 2IHNA 1AW7A 2LXAA 2NTSA 2XNAC 4G3XB 3RN9C 5IIJA 5KAIU 5DB8A 2ZIUA 2I2YA 4KIKA 2ZIWB 4IQTA 1MI0A 4DOAA 4FE3A 3F5EA 4R3DA 1E9MA 5J0TA 3MC1A 1ZQGA 2SAKA 5KG0A 4JV0A 4EBEA 1TZ1A 4BWJA 3SV4A 2JRZA 4NJ8A 3IG5A 2M9NA 4I28A 3NVZA 2GOLA 1D5ZC 8ICCA 1E10A 2YY6A 1WYGA 7ICSA 1SV4A 2IO0B 3R9KA 4NLGA 3K4GA 3QXGA 1YJIA 2ZNVC 1RG6A 2DAJA 2K3UA 3WAOA 1S1QB 2IOHA 4RQ4A 2E8OA 3ONSA 1NBFC 1QZEA 5J29A 2QB1A 2OHFA 1TZOA 1B1ZA 1C1YB 3DVGY 2GMIC 2WX1A 5CHVC 2Y1IA 2LM1A 5HKHA 4ED2A 3CIRB 3KZXA 3MDAA 3B0AA 2GBKA 3N7PD 3NVWA 1GB4A 2GLSA 1LM8B 1KFSA 3RB6A 1N56A 3PR5B 1YMHE 2QHOA 1S3SG 5J0YA 3RJJA 1UBQA 2DGZA 1M6YA 2GO7A 2QKQA 2LYBA 3MR3A 2QCZA 5D3IB 5BYQA 2WXRA 4DF8A 1E8ZA 4UDUC 2JSVX 2LD9A 3Q3OC 4HJKA 4FA6A 1TK0A 3QZ8A 2CHXA 4RGNA 4QZCA 4C80A 2LVQA 4NAMA 3RT3B 4MFCA 4KGSA 4RQNA 1C79A 2J0KA 2M56B 4CGZA 4DFMA 3H0RB 4DL5A 2ATLA 4IR1A 1ZQDA 4BOSC 2KDBA 3F2BA 2ZJDA 3OJ4B 4LNIA 2K39A 1IGCA 3OGUA 7ICUA 4RNAA 2DFLA 3APFA 3ZJTA 2I1KA 1QQ6A 1V9PA 7ICMA 3PREA 4M0WB 5C1ZA 3ML8A 4TUPA 4IM0A 2KD0A 4OW0A 3PX4A 1M4VA 4JWMA 2KAJA 4FS1A 3QWZB 5KG3A 4FN2A 2XGPA 1IBXA 2AEHA 3ZI4A 2YVCA 2EDUA 2RLTA 3IFWB 5KFXA 2C2DA 4KLGA 3W9CB 1UD7A 1XU4A 2JHDA 3GZNB 4GDKA 1JROA 1FXIA 1JIHA 5DGBA 1EWCA 2YB1A 1XQQA 3SYZA 1CJEA 2AGQA 3DVGX 1SE4A 4DQOC 1SKWA 5EE9A 3VC8A 1SXTA 1KDHA 2YX8A 4WJOA 4X57B 4ZH4A 2AQ4A 4GOCA 1L7PA 2HOQA 1ENFA 1LVHA 2WXGA 2JR5A 1ZJNA 1X6IA 2XVTA 5ALSA 5ALXA 3Q14C 4IWPA 2N9EB 3ZIMA 2QB0A 3AM9A 3KYCD 5DBAA 3T9LA 1TTNA 2CU1A 2WWZA 3IRUA 1Z19A 1V80A 4UW9A 1ZXIA 2LWPA 1RYRA 4MH0E 2IY0B 4WAAA 1ZQJA 1ZGUB 3N7SC 2LZ6A 3MR6A 3JSVA 4URKA 2HHTA 1KFYB 1KJTA 3PZ8A 3NASA 2EKIA 4WH4A 3P2BA 2HI0A 4BKSD 5IO9A 3K1ZA 2IYDB 3C23A 2W82A 5BMIA 3AQEA 1BPEA 3I57A 1OUQA 2KNJA 3H9DA 3ZDEA 2G08A 4F71A 3IG3A 1V97A 3LWLA 4KLHA 3A0BU 2ACZB 4C4VB 4MFAA 2IBIB 3PGEA 4DDGD 2HJ1A 4MGIE 4EEKA 9ICGA 2KK8A 2E3TA 3GQCA 3AEFB 4QZ8A 4A20A 1P0RA 2PFQA 2WXNA 4PS8A 3R2IA 5AEKB 1A6SA 2CHWA 2JZ3B 1H8CA 4KLQA 3PNCA 2JH7A 4NLBA 3UIOB 1E7VA 3A1QB 4JQWC 4YTPB 2RDHA 2GH1A 4YMOA 5J8YC 1BUIC 3MGIA 2PW9A 1K53A 4K81A 2ESEA 4I2DA 2KYWA 4J6IA 2KVCA 4W9HA 4J9NA 2ZPNA 4PS7A 2Y0SF 4KLLA 4XGAB 2LYHA 2LGYA 5L1MA 1NOMA 1GC6A 2LRWA 3RH5A 5CP2A 3Q69A 3OJ3A 3WU2U 7ICGA 4DFJA 1FIQA 4C8LA 2JPHA 3SD5A 3ZW3A 1WMHB 1E8YA 1AARA 2CXYA 5GTIU 3UGBB 4Y2UA 7ICNA 3TEWA 4NZLB 2RP5A 1ZQUA 4US9A 2AX5A 2C7NB 3VR8B 1KTQA 4RQMA 1NK5A 2FLPA 4KDLB 1K8RB 4I29A 3B1LX 1ZE3D 4GXKA 1U47A 2YEPF 1BPDA 2K8AA 5AHXA 2D3CA 3H7SA 4Y2TA 4DWIA 2BWFA 2PFPA 2QILA 3AEGB 3LDAA 4XDCA 2FIFA 2K8BB 2JVCA 2L76A 1PK3A 1JMSA 4LNFA 1PVQA 4CYEA 1ZPSA 4LJPB 3DVNV 2NYVA 4O3OA 5JRTA 3ICXA 3DVNU 3KUZA 1KM7A 1RXVA 4LTUA 4MHVA 2BYVE 8ICVA 5L95C 3B2FA 1LB2B 2FMQA 2ASDA 1SE2A 3A0HU 1QLNA 1SEBD 2KD1A 3F2CA 4M2YA 3A4RA 5JTIA 4IG7B 3TQ1A 2ZUCA 1O03A 5D46A 2WB1C 2BDPA 2AL6A 3IAS1 4N9F4 4RGOS 5KFGA 1T0SC 4FBJB 9ICUA 1ZYQA 1MVKA 1ZD2P 4NQLB 3N28A 9ICOA 1EWYC 1GUAB 2KT7A 5LLIA 1JXLA 5BOLA 1HTOA 4DOCA 2XIDA 2L8JA 2M4NA 3ZKJC 2HTHA 2WF6A 2BKRB 2K9XA 3PTFC 3AXCA 5FR3A 1CRXA 2QSDA 4P4PA 3TKAA 3FC4A 1K1QA 9ICVA 1WXVA 2JWZA 3GIIA 1M94A 1T0RC 4F72A 2LPEA 1SIJA 3SFEB 2FUG1 3GU3A 1TV9A 1S77D 2BPFA 3ML9A 5KG6A 9ICEA 3MC8A 2N4FA 1HA5A 1SXEA 1ZQOA 2B0CA 4EZJA 1KLUD 4HPMB 5GXGB 4EOYA 4ARCA 4OVZA 1GJZA 2VRRB 5BPCA 3VAWA 4G9BA 2I5HA 4IRDA 2QC8A 5KG5A 4MEMA 4HPLB 2UWQA 4Y2SA 4QWCA 4NNJB 3GE3C 5HI1A 1ZDXA 1TKDA 2G1EA 4JWNA 3EFUA 4Y2YA 2ZIWA 1E8WA 5EE0A 4ELUA 2AL3A 3NGDA 4RQ0A 3IXSA 4M9HA 2I1JA 4QZ9A 2MEKA 2HBLA 4MELA 2AWTA 1VLBA 2FLNA 4PGXA 2WDVB 5JHBA 5IIIA 4YP3A 4OD0A 2E6XA 3UQBA 1D4BA 2KDMA 4Z6CA 3N3KB 7ICKA 1XCQL 1WRIA 3FAHA 2GWSA 2C2RA 3PO4A 4ECRA 4FBUA 5IKCM 4IW0A 2LHEA 3SV3A 3NRZA 2V3NA 3DBRB 2K6QA 2PPHA 1F9JA 3N9YC 1RQNA 1FCLA 3V72A 3KFUF 2PJHA 8ICYA 3ISCA 2EZYA 1XNSA 4HAIA 1TVAA 3TFSA 3EPGA 1L7MA 4DFDA 4GXBA 3NUQA 3IVFA 2QIEB 4XYCA 2LVOA 3HRDD 2DHZA 5AM2A 2MA9B 2KDEB 1WY8A 1L2NA 3V7LA 4A55A 5AKHA 4MF8A 4HVBA 4LJXA 3H8SA 4PHEA 5E6JA 1EO6A 3LYSA 4CHKA 2O6VB 7ICIA 1PGAA 5H92C 4BXOA 4KLIA 1YN3A 3JVZX 4RPYA 1VR9A 3LYYA 2HBMA 1J7CA 2EZZA 4I2JA 2GLEA 2BS3B 4EZKA 4Y2QA 3M6ZA 1J2MA 8ICZA 4RFBA 4G3IA 4Q2JA 5A0LA 3VXWA 4DLGA 2UVUA 5KG2A 2WGSA 3BINA 4DQQA 3P63A 2HSZA 2ZPYA 2ZIVB 4K4IA 4MDKE 2DYBA 4DO9A 3CSFA 4P4MA 5L1KA 3QUQA 5DLGA 4KZCA 8ICPA 4ZHPA 1T8EA 3R7QA 4F5NA 2P6RA 2XY6A 3V6CB 4NL9A 3BIID 4PS3A 4A3PA 5DPSA 9ICQA 2MBBB 1GO3F 4ZYNA 3M1YA 2M1MA 1UF0A 1ZQVA 2WXKA 3M3JA 4Y2VA 4O3PA 3PSTA 5EWEA 1KLGD 3KHHA 4M02A 3S6JA 4CRXA 1PQSA 4XZ4A 5H8YE 3ZVVA 4TQ0A 3H1UA 1HUZA 5ALDA 2BGFA 4K7SA 2XBBC 2W9MA 2CN1A 3H4DA 1B4FA 2V4RA 4J9LA 1TAMA 5G55A 2HTME 2IO3B 1JRPA 4YFKA 4EBDA 1JQ4A 2JYTA 3N1YC 3JPPA 5B66U 4A8XC 1NI3A 1ZQFA 2KHQA 3AEEB 8ICNA 3RYTA 2HHWA 1IPGA 1FXAA 2Z0DB 3IT6B 4PYUA 4IRKA 4Y2XA 2V1YA 1UWMA 2MRPA 2R8HA 5KFMA 3U30A 3ZUNA 4HDOA 1BVSA 2W3SA 1TGZB 3ZNZB 2XK5A 4MF2A 1U9LA 4ZRKA 2O6VD 3I76A 4II3B 3U52E 5FKAC 5HP4A 4BFRA 3D2QA 5L83A 2JWUA 2KIWA 4IQUA 4DXGA 2A1JA 1ZJMA 4ECZA 3KQ4A 3ZGZA 3AE7B 2K8CB 4KN4A 4NAWB 2H5XA 4R8UB 4IM3A 4RQ3A 3TUOA 3PSEB 3BQ7A 2NRXA 4YMNA 3UM9A 3A9JA 5AM0A 2KFJA 4OZAA 5IN7A 7ICFA 2KMMA 4LZGA 5KFHA 2GRIA 4K1RB 1FRRA 2C22A 4M9GA 1X42A 3N1ZC 4P0PB 1WGGA 1IM4A 3M9NB 3A9JB 4ARIA 3B0XA 2RGFA 4FZLA 4J03A 4C0ZA 4P7IA 3DCGA 1ZW7A 3VTUA 1X40A 3MR2A 5CX3A 3V61A 1KLNA 9ICKA 2K5PA 3QIJA 8ICTA 2MJEA 4II2B 4ECQA 5ALQA 1SJHD 3RJFA 1B9RA 4DL2A 1WFYA 5ALEA 3RH4A 5AICA 3HW8A 4JUZA 2D3AA 2BYEA 3HM3A 4RUAA 1F1HA 2UVVA 3BS5A 2MUTB 3VHTC 5J2HA 4LNKA 2NRWA 4B9NA 2E8NA 2KLGA 5DB6A 4F4KA 3MFGA 2JT4B 4GDLB 2UYZB 3AU6A 3BZKA 2VKQA 4UAWA 3NVYA 2C5LC 1NK8A 4ECYA 2K22A 4KITB 4CF3A 1F5SA 3T3OA 5KFOA 2JY6A 2JEFA 1XLNA 2P35A 2CKHB 4MM3A 1HUOA 1QOFA 3RNBC 4QIWF 3T5KA 1BNPA 2RD0A 4I2CA 1KBUA 1STEA 2BHNA 1SGHA 4BBNF 2KVRA 2L5YA 4JMUA 2IGGA 2QLTA 4FS2A 4IWQA 1UT5A 1YNTE 4S17A 5BMGA 2GBNA 1T3NA 1MA7A 4F4XA 4ED7A 2KANA 3I9V1 4DQPA 4GU2A 3UXPA 4DBGA 3MFIA 4C4VA 2OEDA 1L5PA 3W1SC 1SE9A 5KFTA 3TAPA 5E6PA 2DPIA 8ICGA 4I2GA 3C21A 4W9JA 4I27A 3OJSA 4QZBA 1Z2MA 4IQWA 1BPXA 4QWBA 4CCHA 3C2MA 1TS4A 2MLBA 1JCKB 5HR6A 2CPRA 1V2YA 4CE6A 3K1RB 5KFFA 4OJLA 2HDEA 2LI5A 4L23A 4BWMA 4B9VA 2LHDA 1IXRA 9ICFA 4OJ5A 3RJGA 3QUTA 1SV0C 2BPCA 5J0RA 2WP9B 8ICRA 4G0NB 2IDYA 2FMSA 3TEXA 4BXOB 5HNKA 5KG7A 3VH4B 4G11A 5EE1A 1S0NA 2PFOA 4LLGM 2JMGA 4PHDA 1ZKHA 3N4MB 2MH7A 4BKGA 2F1JA 3H4BA 4QIWC 3P4QB 2WQYB 4XX5A 5HHHA 9ICCA 4FO6A 2ZZPB 4DHJB 2PKEA 4WJNA 4YN4A 3TADA 4DSIA 2C9WB 1L0VB 2W7PA 4IR9A 1ZQXA 2V4IB 3EFCA 2R8IA 1I4QA 1XSLA 2VA8A 4QZGA 4JV1A 5BYSA 4XA5A 2LUMA 2YMLA 2HBKA 3GZNI 2G5IB 3WALA 1GNUA 5J2BA 1QQRA 4GN1A 1DGJA 5DG8A 1E90A 4UARA 2NPTB 1L6UA 1NK9A 2R61A 5AI4A 5KFCA 1WGHA 4GSWA 2IMWP 1FFUA 1YQ3B 3QU4A 5J2AA 2KSOB 2WDRB 1QOGA 4HCPB 4AJYB 4PH5A 2B6GA 4P4OA 5DDYA 4DL7A 3RAQA 2KDIA 1Z4NA 3IN5A 3WIMA 4G50A 3ISDA 3I28A 1VRAB 2G5HB 3DEEA 3Q3NC 5MPOA 3O0FA 4B95A 3ONNA 5ALRA 2JXTA 1X9WA 1AROP 2NO5A 1DOQA 5EWFA 2WXPA 1QTMA 3Q6BA 4EX6A 5IAAC 4DSFA 4CO7A 4B9MA 3CSTA 2ZCCA 1JMLA 3Q3MC 3RF9A 2BKEA 1PK1A 3FILB 5ALNA 4MJSB 1SL2A 2ASLA 4NQKE 1NZPA 2DKXA 3PW5A 3TJPA 3RNFC 1QSYA 4B9UA 3D6JA 2KJ5A 4RNMA 3RJHA 4QNLA 1EUVB 4EYIB 2OJRA 2HJ8A 1L6NA 2W9NA 3QUCA 4X5VA 4C56C 4XC2A 3V6KA 5I4DA 2K4PA 4HCNB 1J0GA 3PV8A 1RXWA 2BYFA 1OEYA 2LUEA 4RQ8A 3ZJUA 1S5LU 3HP6A 5KFSA 4J3OD 3WAPA 4UATA 1K5OA 1Z1VA 3TMPB 1NYQA 9ICMA 2Q5WD 2W04A 4KIKB 2KIVA 3LWMA 5ALYA 1ZQSA 1D6EC 3ZXVA 4P0QB 2LJIA 4HKQA 3PMLA 1YQBA 4WJQA 3B0YA 1NJZA 1ET9A 1WIAA 4XRHA 2JX5A 3KLSX 1PUTA 4MGZE 4HYKA 2IBKA 2INDC 4ZRPA 2L1AA 3GP7A 4HPPA 1TS5A 1ZQWA 2ZIXB 2MU2A 2KNBA 3EHVA 3KOOA 5ALLA 1Z1BA 1XO1A 3PX6A 1FNVA 2Y1JA 5H2FU 4F93B 3N7RC 3KWVA 1V9JA 4OJPA 4C8NA 2N1WA 5AKEA 5KFAA 1X2IA 1NK0A 4RQ2A 3CRXA 2NO4A 4RPZA 4JGHB 3EW9A 1V49A 4XDDA 2ZIVA 1XO3A 2PTLA 1HJPA 4GIBA 3SEBA 4IC9A 3V05A 1Q8KA 1WWUA 3IG8A 2BT6A 4P1CC 7ICPA 5AKYA 2VANA 5F9NA 3OHBA 1L0YB 3SDLC 3WANA 2LGDA 3RB3A 5KT3A 2RMMA 3P4RB 1E7UA 5DDMA 4I6PA 4YQWA 5JZEB 1NI2A 2C7HA 3AE5B 4JLCA 2LKYA 4ZDVA 1TE2A 5ALZA 2O6VA 3IV6A 4GGQA 4O3MA 2NVUI 2N9XA 1TY0A 3ZDBA 2X38A 3RBEA 1U49A 4UAVA 1TK8A 2GB1A 3B08A 5KT4A 4EFOA 4DSEA 3AL0B 3M9MB 2ICIA 4JX1C 4WWPA 1QT9A 3RBDA 5CTRC 2ZVNA 2O6KA 2I38A 4EE2A 1I42A 3RNEC 3IM1A 2OWOA 5J2IA 2K89A 2KZ3A 1GPXA 2YMMA 4NM2A 3RTVA 3TSSA 1KRPA 3EGRA 4NLCA 2HVHA 2MRLA 1RZTA 2PXIA 1ACCA 2M8SA 2W9BA 1L3SA 2RDJA 2K25A 5CB1A 2Y5BB 1X9MA 2ODGA 1S8OA 4M0AA 2MCNB 4EX7A 2WHIA 3H7PA 3GV8B 2X8XX 1XD3B 2QARA 2N9PC 5DQIA 4IM2A 1DOIA 4RQ1A 4ECXA 3N30A 3OAWA 4EUTA 9ICIA 2W8LA 3KYDD 3QCAA 3H8HA 5J2CA 1C78A 4EZ9A 2BYTA 4P0QA 1U4AA 1P9DU 4TUSA 1J2NA 5ALIA 3ZRFA 4WWMA 3AN1A 8ICUA 5TZVA 2HCFA 4N6EB 2BB6A 3OLMD 2B21A 2KDFB 4F7ZA 5AI5A 3RB0A 4Y2RA 2J4XA 3PW7A 2FPKA 3MTNB 2KK0A 1KL9A 2Q4TA 1NK7A 2ZXHA 1FD6A 3AH7A 2ZW0A 4FHJA 2MX2A 4K7WA 4M9LA 3TBLD 1N2XA 2HHXA 1XWLA 3H0MB 3PZPA 3LDZE 2KQ4X 2FUHB 1WI0A 3GS2A 1LFDA 4EZLA 2KOXA 3V3XA 4QWDA 3QEAZ 3LVWA 5CRXA 3BVGA 4DQIA 3P1MA 3D32A 3QX1A 4O3RA 5ALUA 2WXMA 4QAYA 4J9MA 2DX5B 2LVPA 2BCUA 2D8CA 1V86A 2EELA 3DBLI 5AKGA 3QU7A 5J0XA 4QWEA 2LEKA 3APCA 3W1YA 2MSNA 4QZAA 3HUIA 4US8A 1NYRA 1RM6C 4NLNA 3KD3A 3OSNA 1JI7A 1I4PA 5DCNA 1PVPA 5IOIA 1YQ4B 1L7NA 1N5WA 3HIZA 2H3ZA 2WB1F 4XWWA 1J8CA 4I2FA 3EPIA 1SV0A 4CDGA 5TISU 5J8YA 2HMXA 3PSIA 3EZ5A 2L0TA 4M0WA 4ED8A 3SZ2A 3Q8MA 2KFKB 3T3NA 3UPQA 1V5TA 3DOWA 4ZHOA 4KTQA 3H40A 3HPOA 2D2QA 1GOZA 1WYWB 5KHOA 5C5JA 3PS6A 2OXOA 2FNJB 4F5QA 4B6JA 4IQVA 4RF0A 5AKIA 3PMNA 1XLOA 3BYYB 4KGRA 3C2LA 1MSWD 4MGKE 1N5XA 2KKPA 3QK0A 4H2AA 5DLFA 2REXA 1NK4A 1P3QU 2H3IA 2MSED 3VUWA 2ALZA 4B9KA 3SQIA 2ASQA 4U6PA 3RAXA 3AE2B 4FBTA 4ED0A 1Z00A 2KJ8A 1F2RI 1JWMD 2IPKD 1MPEA 3U8ZA 3HK0A 1Q10A 2HHSA 1T6BX 2PMVA 2VZKB 1WGKA 8ICQA 1WMHA 2INCC 1X9SA 2FJ6A 2DZJA 4F4YA 2ZTEA 3ORYA 4TQRA 5KFQA 3A33B 4JL9A 4AOFA 8ICSA 2FCSA 2Y3AA 2ZJ5A 7ICLA 4IS7A 2XCPA 2CHZA 3E56A 1VD2A 2IZVB 2YEPB 2YB4A 4GLXA 1SJED 1N62A 1MG4A 4BZAA 3VTWA 1YZ7A 1WR6E 4UB8U 1ZQNA 5G5GA 1VZ8A 1DK3A 3C8YA 2R8JA 1UQVA 2PFNA 3NZUA 4N58A 3BQ2A 4UB6U 1ZQTA 3ETRA 4EEYA 3V6JA 2C28A 3PSPA 2CU3A 2ZIUB 4KLMA 1AWDA 1NEKB 1I4XA 3T5LA 3MABA 4NJ7A 4ZYSA 3Q8KA 2KWUB 4LDTB 2A3VA 5KG4A 4Q45A 3WCQA 2HHUA 4C8KA 4FULA 1B0XA 3MC9A 2W11A 3IP4B 1UNSA 2K4IA 2E8MA 4Y2PA 3V6EB 1CK1A 3SAGA 3H7PB 4ED1A 1QQ5A 2NTTA 1F0MA 1LKYA 2EANA 5AK4A 4YVZA 2ZNVB 3NOBA 3QU5A 2BCQA 2MQJA 3NG0A 4EEWA 3HHMA 3B9JA 7ICQA 5G2NA 5HFYA 3PW4A 3G6XA 2W9BB 3KW5B 3TFRA 4PPXA 5DGAA 1HXYD 4LJOB 4ACFA 3JSVB 3C5GA 2FCNA 3PVXA 4EBCA 2PMZC 5ALTA 4JPSA 2WHEA 2MA1A 3HILA 1WGDA 1V38A 2E8PA 2LHTA 3F2DA 2DYOA 3JYUA 2VZKD 1ZQHA 4I6LB 4LK0M 2H3FA 4NPNA 1YN5A 5EOZA 3MGHA 1A76A 5DG7A 4QZFA 4ZRQA 1CZPA 1D8LA 4DEZA 4ECVA 2ISPA 3ZRCA 4MEXA 4BKTA 3UMCA 4WIPA 3DHHC 1YN4A 1TBEA 1WGRA 3BS5B 4ANVA 4FFDA 4PZNA 1EF5A 4W9CA 1BXTA 2Z8LA 3SFDB 2J6UA 1WX8A 2IOFK 1ECWA 4NJ6A 4F5RA 3PRZA 1Q0WB 1UZXB 2B3AA 3RUIB 4JE3B 1WX9A 5J17A 1IGDA 4OZBA 3U2SC 3RJKA 3C19A 2JQRB 2DBYA 2LXCA 4ED3A 3EA6A 4ANXA 2F8LA 4P0PA 3QAQA 3OSPA 4KZ0A 4MEYA 4W9EA 3Q8CA 2BVCA 1ZQAA 2JZPA 4L2YA 4O3SA 4OVUA 2DYMA 4XQ8A 3NS1A 5KFEA 2ZIXA 2XY7A 1T7PA 5KFPA 4I2AA 5E6OA 4YTNB 4TURA 2K8CA 3R7RA 1NDDA 1YIWA 2KN5A 3VUYA 2F1HA 3RJIA 1ZQBA 2GBRA 3GB1A 1QSSA 1OGWA 1WJ4A 5J0QA 2EAOA 4UAYA 3VRAB 5J0OA 1T5XD 1WF9A 2FAZA 2KQSA 2R8KA 7ICHA 5KFIA 2J0JA 4BBNC 2HBJA 2DL0A 3N97B 5D4BA 2JEJA 2OEHA 9ICHA 1XF5L 3RR8A 1GC7A 3GILA 2KWVB 4NJCA 5HR7A 1COOA 3Q8RB 1LXDA 1SGGA 1I4GA 1KFDA 2UVRA 4MACA 1I7HA 2INNE 4FZMA 4C8OA 4ANUA 2XICA 3ZYYX 4ZOHC 8ICBA 1SWWA 4GLSC 3AI5A 3AEAB 1D8YA 4M6WB 2KFZA 2N7JA 1YOVB 3CF6E 1WM2A 2PVGC 4M47A 3FDSA 4KVGB 3EC8A 3VTVA 3UMGA 2WS3B 4O1NA 2MP2B 1WXSA 5KFZA 2XGQA 2KLCA 1R7SA 9ICSA 4RM9A 1KRHA 2DF4B 5J2GA 3NVVA 5L1JA 1D9FA 2JGAA 2BQUA 1WJUA 2F76X 1NKBA 4HK2A 3MP9A 5KL8B 2QMTA 4GMVA 2L32A 3PLVA 3SAFA 4DHJD 3QQ8B 1T0QC 2JXXA 1WJ6A 3A4SC 2JXJA 1OFFA 3E2EA 3VFKA 3V7KA 3KKAA 3RFZB 2P66A 4C8MA 7ICJA 3GOEA 1N63A 2YQEA 1ZP0B 2NPTA 3IBEA 4C7YA 1A77A 1JUDA 1UA1A 1C77A 5J0SA 7ICRA 1R4NB 1FO4A 2ZTCA 5G5HA 1XSPA 2J6TA 3PRMB 8ICEA 2WU5B 3APDA 4ELVA 1IP9A 2MAXA 4XWTA 2F44A 4F4WA 4IKGA 5JHAA 2WAQC 4WURA 1CQVA 3Q8EA 5IA7A 3DHIC 2FDRA 1QQ7A 3P4PB 1QKZA 4M00A 5AZHA 1OQRA 3P4SB 4KLFA 2KC1A 1SB3C 4LCDE 4MH8A 2W9CA 7ICTA 1F77A 3O13A 1ZOLA 2G06A 3AE8B 1VJ5A 1S0MA 4J9RA 3X23A 4QZIA 2O2VA 5ALFA 4C4TA 1TAUA 4I2EA 2V3PA 3ZDMC 2XC9A 5CA7A 2ZUBA 1ZQPA 1D9DA 3SU8X 2EZXA 3BZDB 1SWVA 2BDUA 4HROA 3NJTA 1X9XA 3PHXB 2FIDA 3RPFC 2KO3A 4RMAA 5F9LA 4Q43A 2VA3A 3PO0A 3L17A 2WF8A 2LGSA 5DB7A 1YX6B 1PDXA 2RPVA 3M8RA 2K8HA 3UQ0A 4KN7A 4ACOA 1VDVA 5CEHA 2WDTB 5HHIA 3E0FA 2I6XA 8ICHA 2L52A 3NRWA 4JWUC 1H4RA 4USAA 5K4LA 4UB2A 1JW9D 1P1AA 1VCBA 1FPYA 2IA6A 1P7FA 3GDXA 2PKOA 3KHGA 4LNNA 4PGYA 2RDBC 3BVMA 1FXTB 1T94A 3MC0B 5L9XA 4U7CA 1J7AA 3QEBZ 4BKSA 5CR0A 2BWES 3DBHI 3BY4B 2A5UA 5AKJA 4NY0A 1K51A 3AV8A 1FNUA 5J2KA 4QW8A 3MBYA 4IWOA 2MBOA 4RM8A 4NWIA 2JUOA 5AIAA 1KLVA 3Q8LA 3KKAC 1E5WA 3WK8A 2BCSA 1UHUA 1EM7A 4B0MA 4RF1A 1CI4A 5AKZA 4UB1A 1TY2A 2WXOA 1OW5A 2W9CB 1LO5D 5AI8A 1ROEA 4FXCA 1AQ6A 4DSKA 4MSMB 3FKYA 2W7OA 5HG2A 3Q8PB 4MFFA 2ZUDA 4NLZA 4EKUA 4YXDB 1D5MC 2K60A 5CHWA 4ECTA 2K1FA 4RH6A 1TYGB 5IILA 1ZUD2 2J53A 2KJHB 3ALBA 4A6QA 1KEJA 3UQAA 4CF4A 3BQ1A 5KFRA 3AMZA 1J97A 2N7EA 4KMUA 2WF9A 2Y5PA 4EYHB 4FJVB 8ICFA 3MFHA 1OQYA 3KTQA 5KT7A 2VIXA 1RWSA 2AXTU 4AS1A 2FPMA 2KJ9A 2KC2A 3VCBA 1GAQB 2KZMA 2IO2B 1IYFA 1PFDA 8ICAA 3SD7A 4F92B 2J7QB 1T3QA 2H3QA 2CJOA 3J9CA 4O9MA 1UGJA 3DPDA 5J18A 3P42A 1XO0A 2KFKA 1JXEA 4IDIA 3W2DA 4FZNA 1J19A 2DAFA 1UA0A 1L3TA 5JU5A 2KFNA 4HRSA 3GV5B 4YD1A 4ECUA 2TSSA 4LNOA 1XLPA 3L08A 2JZBA 1MFWA 4K7UA 5T8IA 1CEZA 4YMMA 4UB5A 2MBEA 5AK5A 1C3TA 5D6JB 2FMPA 2DWQA 1GG3A 3ZNHB 2D3GA 2KXJA 2KMAA 1UCVA 5LXIB 2HD5B 3DHGC 1HEZE 3BQ0A 4DL4A 2PI5A 1HZ6A 5KTQA 3ZO5B 5KFBA 4O0IA 2IO1B 4NAWA 2MJ3A 4JWSC 1ZQZA 3TEYA 4YR2A 1WWTA 1HTQA 1JWBD 3TACB 1V5OA 4LZDA 2KP7A 2ZJAA 5J0PA 3WKAA 2KJ6A 1JRUA 2LASA 4F8RA 3KZIU 4JK1A 9ICLA 3Q8AA 4PJ0U 2KZZA 1ZRMA 3SR6A 1NJXA 3MR5A 2XK5B 3H8JA 3RCZA 5JXVA 1J7BA 1AN8A 4AQ7A 2NCNA 2N7DA 4DXAB 5AIBA 4PHPA 1N6ZA 2ISOA 1PZNA 2LGXA 2E1FA 2M0XA 1KFTA 2AQ1B 4MGYE 4BUGA 3RB4A 3Q8SB 3FYHA 4P1BC 3C1ZA 5KFVA 4ELTA 1Y56A 2Q0ZX 2V9WA 4Q8FA 9ICPA 1SL1A 1ZQMA 2ZTDA 1S97A 3NS8A 1WXMA 3GIMA 4EENA 1L8OA 2IY1B 3D2NA 4KLDA 3TIXA 1C4AA 2JZZA 2JRHA 3UQ2A 2W43A 5FK9C 5L1IA 1PVRA 4KLSA 2D07B 1QOAA 3L13A 1ZD3A 3O65B 4WWNA 1X1MA 2NBUA 2FPLA 5BMHA 3ZXRA 4GXJA 2HDOA 1COKA 2XY5A 2INPE 4W9LA 2EH9A 3ZNID 2XCAA 4TUUA 5D49A 4PK1A 2F8KA 5AM4A 1OTRB 4UQGA 3TARA 5KNIA 4AWJA 1RYJA 3ZDTA 4FADA 3UI3A 3I5JC 1SBBB 2BQRA 3R66C 5AZFA 3HVDA 1FNWA 5KFKA 1WXAA 4K3BA 1UWXA 4F5PA 2C7MB 1WCNA 2GBMA 1RRBA 4C4RA 3TEZA 1YX5B 1C7YA 3SMVA 1S0OA 2XEWA 2QB0B 5AI0A 2G45B 3S2AA 1TKEA 5KAFU 3PW2A 3MHSD 1ZQIA 3QJZA 2WXFA 1MG8A 1N61A 5EWGA 2P6UA 3BYTB 3HVZA 1ET6A 5DPTA 3X0WA 2EMTA 5KT2A 1QH9A 2DLBA 3HM6X 3NTUA 3ED5A 4A8EA 1N60A 5CWRA 2PI4A 2L0FA 4HEA1 5ALJA 4IRCA 4DOBA 4RQ5A 2DKZA 2FE9A 3AE6B 4R66A 4N59A 5DKWA 2VH2A 3A9KA 4DDID 4W9KA 1ZQRA 2UU7A 2KV2A 3CNHA 2F3NA 2F77X 2LI6A 1SL0A 1ZQCA 1KQQA 3ISBA 3T3FA 2G4SA 1P7EA 1Q3VA 1TKYA 1LKYB 3F5AA 4J9PA 3MHZA 2FE8A 3PHWB 7ICOA 2HHQA 2DQNB 3UMBA 2IGHA 2Y5CA 2VJ5A 4PGQA 3KWLA 3NUHB 2BTEA 1SF0A 1K52A 1UELA 1A70A 1X6JA 3QYPA 3PLUA 1MN8A 2PEAA 4C4SA 3ZTDA 2L83A 2N9LA 3AULA 2MBHA 3LXFA 3ZJVA 1B22A 5AI9A 4AYBC 5DBBA 3AQFA 4UBCA 1ZD5A 5KT5A 4A9AA 2GBJA 1NJYA 2KWCA 3Q3FA 1TS3A 3HJEA 5ALWA 2CJNA 8ICKA 2KZRA 4O3QA 3T5JA 1O08A 3C5FA 3ZDCA 1FEZA 4RNNA 4UBBA 1VZ6A 1UGMA 4DF4A 1QCKA 3ZDDA 1DK2A 5GMVA 1MHXA 4DHZE 3GV7B 3IDWA 5DQGA 2OM6A 1NKEA 4KV2A 2HHVA 2ZVOA 1V1PB 4C00A 2W3RA 4B0EA 2AU0A 2AQ3B 3OWEB 1Y88A 5F3XB 1NENB 2SEBD 4Q8EA 2LJ5A 2G3QB 2KWDA 4WJ3B 3ENEA 2HE7A 1V8CA 3NY5A 2WAQF 3MDCA 4BJQA 4DCCA 1E0ZA 1ZD4A 3NZ3A 2N0SB 2BW2A 1Q3UA 3M7DA 4UB3A 4KLUA 2NBVB 1LQBA 4F2RA 2LRUA 5KHQA 4O5CA 2BPGA 1Z4OA 2R2QA 3HWTA 2MHJA 3T8MA 4AYBF 5DPWA 3JW0X 2V0GA 2JZBB 3V7JA 4KLTA 4OVVA 5AUIA 2DUYA 1WCLA 3CWIA 1QILA 2V4LA 2KOBA 3N1XC 3DBRI 1TFRA 2FI1A 4F4ZA 3SI8A 2IHMA 5CHGA 2AGOA 1I4HA 1DOXA 2G09A 3K75D 3M8SA 3WKCA 1E6EB 4ZRIA 2WLBA 4PT5A 2I1QA 3M9OB 2CRXA 4F3OA 9ICXA 5ALKA 5ALMA 4QW9A 5DG9A 1HE8A 2EAMA 4NLKA 1U48A 1NK6A 2LMRA 4YG2A 3PV1A 2WNMA 5D3DA 4KKJA 2BKFA 7ICVA 1ZQLA 2ZXIA 4RUCA 3NHEB 5E79U 2OH2A 3G6VA 2WTFA 9ICJA 3Q8QB 4M01A 4PL1A 3AECB 2AGPA 2A4ZA 1RLFA 2GI9A 3HT3A 3MGVA 5FR6A 3BVZA 4D2KA 2LBOA 5AKXA 2OJWA 2K4HA 1V1PA 3AU5A 1U4BA 3ZLZA 2FCMA 1DRGA 4O5EA 4B9TA 5D7GA 1BNOA 1V1OA 3JPQA 4JB3A 4YSZB 1IIPA 3A1QA 2M0AA 2KTQA 4K4HA 1EU3A 2OCEA 1Q46A 3PRPB 5GTHU 4YL8A 3BZCA 1ZQKA 5TSSA 1QOBA 2KTRB 4ITKA 1UBIA 4KDIC 2BPSA 1UUPA 3U26A 4WQMA 3F53A 5IIKA 4B9LA 2FCQA 5J2DA 4DL6A 4R63A 9ICAA 2OOBB 2F2AB 2PLPA 5HMMA 5IINA 4KX6B 5J0UA 4RGTA 1YZ6A 3PX0A 3LJ3A 4ZRJA 1F0ZA 1GB1A 4WQOB 2HVIA 2KJRA 2QARB 8ICOA 2BGWA 2KQ7A 2EQYA 4AP9A 3Q2AC 3DBLB 1WZ0A 4DQRA 1RQLA 2ON8A 4ED6A 2D5GA 3THVA 2C2EA 2EMSA 2DZMA 4P6VF 3WK7A 1F2RC 3PZDA 3QARA 4M8MA 2JV3A 2AH5A 3GIJA 3ZTCA 3V6HA 2KTRA 4DFKA 3BK1A 3U7ZA 4DHZB 2PE6B 2QJLA 4MM3B 1B43A 2E5SA 1FCCC 1S76D 2RPQA 4DSJA 2A1AA 3SENA 1WH3A 1S0VA 2RQ5A 3PW0A 2FBWB 2NR2A 3TCAA 1JWSD 8ICJA 1FRDA 3IAM1 2G0AA 2KE7A 2UVWA 4WWOA 3VUXA 2JEIA 1WM3A 4GDLA 4ASWC 2KG5A 3DDCB 2G9HD 2V3SA 2K0PA 2LFIA 3TANA 4UAUA 3AEBB 1SZPA 5KL1B 1S10A 1E8XA 2MUTA 4RU9A 5T14A 9ICTA 1F52A 3UIPB 5KFJA 2RRDA 3H8WA 2W9AA 1LGRA 1SSNA 2WXQA 1WR1A 2ZEQA 3GFKB 5TR5A 4B9SA 1OQQA 4A90A 3SEIA 5IP4D 4B6WA 4R65A 2ZCBA 4HLEA 2PMZF 2DPJA 3L54A 4BDPA 1L3UA 1SE3A 3Q8FA 4YTMB 5DBCA 4QZDA 1MQ2A 3BJYA 1X66A 4NY8A 1WRDB 2BF8B 1URJA 4P2HA 5HMLA 4PL2A 2KEYA 1FM0D 2Z59B 2N1VA 4GDKB 1L0XB 4J9KA 4TMAB 5AI6A 5CJ7A 1ISNA 4HWIB 7ICEA 1I35A 1DOYA 2ES6A 3RZWC 3PT2B 5EE3A 4HJGE 1BT0A 4OHJA 4IUMB 5CHFA 1IG6A 2K4EA 3QX7A 4QZHA 1LV5A 4OO1J 5AM3A 3U4EG 2NV3A 3RRHA 5J0WA 4PHAA 4KLOA 3TI0A 1DXSA 4FHKA 2DZIA 3QC8B 5J2EA 8ICXA 3SAHA 4R8UA 2I9GA 3AEVA 2VJ4A 1XT9B 3CMMB 5BO4B 4DK5A 1H38A 2KMCA 2MP2A 4BVUC 1L7OA 5KT6A 5IIOA 2M17A 1KTKA 2KHVA 2EKEC 3DWMA 4NV0A 3GE8C 1KOTA 1L8LA 4Z6EA 2KN7A 2RHFA 1L5UA 2QEJC 5DPRA 3H7IA 2K6DB 4DQSA 3ZNGC 4BX9C 1HIWA 3G6YA 3AE4B 5KFWA 4ECWA 1T0YA 1EU4A 2XO7A 4ICUA 4WAFA 2Y0SC 3ECIA 4ICVA 5AM1A 1ED1A 3RI7C 2LM4A 4TQSA 1UPHA 9ICWA 2CS4A 2WX0A 4OJ6A 2JRIB 1KSPA 2YLMA 9ICRA 4CQNA 4S0RA 4E3CA 4YXMA 3LK9A 2KN4A 9ICNA 1WX7A 5KFDA 2H3VA 3WKDA 1TK5A 2AQ2B 3OJUA 3ZD8A 4NXZA 5J2RA 1PK1B 1RFAA 3FILA 4MJSA 1UT8A 3C28A 3RZFA 3GZFA 5KFLA 2DENB 4E71A 1XS9D 1Y8RC 4I2IA 3RULA 4GIVA 1S9FA 1RAXA 2HOIA 4K3CA 4L1BA 4O5KA 1BPZA 1K1SA 1YT3A 1BGXT 4NM1A 1N48A 4YT0B 3QUBA 1PGBA 3K9PB 3R8BA 2KVSA 4O3NA 4J9OA 5ALVA 1TKGA 5BOMA 3KVFB 2KHWB 3QNMA 5BYRA 2D3DA 3L5KA 4YCXA 2W03A 4F2SA 4EZ6A 1Z5SB 2DNFA 3QA8A 4TV3A 2JEGA 3DDHA 3V62A 5ALHA 2H88B 3KHRA 1RDFA 2BS2B 5D94A 4YWGG 1G6JA 1V81A 1AYFA 3I3TB 3N20C 2KSOA 4TQ1A 4C7ZA 3C1YA 3AU2A 3BS7A 5AK3A 2LMCA 1XC9A 3UF8A 3HKZF 4UAZA 2R8GA 2V9HA 3VVWB 1EXNA 3ZDAA 4TKNA 4BAXA 4F91B 1SXDA 1BMLC 1ZOYB 2MBQA 3ZQ4A 3QHTA 1D5XC 2F1IA 3C0RB 4DLEA 3N32A 1E7PB 4Z6FA 1YD8U 2WFAA 1L3VA 3QU2A 1A0PA 2QDFA 3WKEA 4LDTD 2BR0A 4W9DA 3KBBA 3RD2A 2B76B 4RQ6A 3RNGC 4W9FA 5KFUA 4GC6A 1HQRD 3L3FX 1QLBB 3TL5A 1KKXA 5IIMA 3ALRA 3KUDB 4DXFA 4KMOB 3FM9A 3DWGC 5FP0A 1SZHA 4NL9C 3WKBA 3WK9A 1JWAD 2W55A 2RR9A 3M62B 3VH3B 2HOFA 3H8MA 5JH5C 4Y2JA 2AHOB 4W9IA 4GB9A 1DGSA 4ICAA 2V4QA 2KX3A 2L3ZA 2R18A 2H89B 1C4CA 3JPOA 3MJ5A 5AKKA 3M6KA 2KTFA 4F5OA 1OEYJ 5DQHA 5J2JA 2JYEA 1TS2A 1XXGA 2KICA 3Q3JA 4GFJA 4M9JA 3OTQA 1C76A 1KN5A 1SKSA 1TT5B 2WXIA 1CMXB 3CP8A 1QF6A 3T79A 3J81j 3DQVA 4GC7A 4TUQA 3RR7A 1MJDA 4YR3A 4Z6DA 3KUCB 1MC8A 4P16A 4ECSA 3TAQA 1D8BA 4UASA 4DS5A 4PYZA 4RZRA 2VA2A 4TSSA 5LNK1 3IT4B 3B2GA 1ZQ1C 2OYYA 3C29A 1IUEA 3OPXA 4K4GA 4LVSA 2WYQA 4RT2A 2WXHA 1FFVA 2EAPA 3MJWA 1ZXHA 3PVLA 1V85A 4YD2A 2W54A 1WJNA 2L7RA 1ZDVA 4HKZE 2ZG6A 3CW2C 3CYMA 4J9QA 4PZOA 5C0YA 4KX3A 1HZ5A 1A5RA 1RFKA 2AJQA 4HDQA 4YSXB 4RT3A 4FJYA 2PIAA 2O2VB 4RCOA 3L10B 2JU6X 4AP4C 2WF5A 4Q44A 5AUKA 1EF1A 2BQQA 2XN9C 5AZGA 2KACA 4AUQC 1WG8A 2ASJA 1RYUA 2LYAA 2BCRA 2KX0A 1P98A 4DS4A 3RJEA 1Z00B 3WK5A 2GOWA 3PY8A 4IC7B 2PVOD 3AU4A 1C9FA 2AYOB 1TJEA 2E1EA 4YXJA 3OHAA 1C20A 1JWUD 1ZQQA 1CUKA 8ICWA 2D6FC 4KSKC 3U7DA 3V60A 1R4MB 5ALGA 4QWAA 3LB8C 1NKCA 2IJ0A 3K9OB 1JN3A 1Q1OA 5DB9A 3JPSA 4REZA 1WXQA 1IV8A 2CR5A 4OCZA 5ALPA 2HW3A 3H0LB 2A19A 3RFAA 1PYWD 2KKVA 3L4PA 4RQ7A 2WF7A 4FLHA 4UB4A 2W8KA 2D11A 1SKRA 2NBWB 2R2OA 1ZETA 1T4GA 4RNOA 2G07A 1YJ1A 2D10A 3HKZC 4YR0A 1WZ3A 3BQTA 1XCTL 2WDQB 4DWFA 1ZQYA 1KF6B 1Q5WB 2K8BA 4I6NB 4QJFB 4DSLA 2YMPA 1WE6A 2N1RA 3VDZA 4RPXA 3DV9A 4ANWA 4DL3A 3E9SA 2BS4B 1KH0A 5C2TB 1NVID 2LGIA 1TAQA 3JPRA 4OJOA 2IGDA 4JV2A 2C60A 4J9SA 2FLLA 1RYSA 3M63B 4XUSA 3UINB 4DFPA 4E74A 2J6SA 5JUMA 3ABVB 5EDSA 3C2KA 2J0MA 3AE1B 4F8CB 2KKCA 2WXLA 2A1JB 4M9NA 1R4MI 5AM5A 4KGTA 3IHQB 4KKIA 3QU9A 5ALOA 1JX4A 3UXNA 4YSYB 2NRTA 1F44A 5AK6A 4HXDA 1WWVA 3W1SA 4M6WA 3EWAA 1UH6A 2YTUA 8ICIA 2M19A 2VH1A 4E0DA 4IOIE 2G4DB 2YN4A 1L6VA 2MWSB 1L4DB 3BK2A 4OZCA 5C23A 2RSUA 3KH0A 5KG1A 1NJWA 3W5VB 4CNQA 4KX5A 5L1LA 3PPAA 2L05A 1I4RA 5KFNA 4KLJA 1TIFA 3T5HA 4IL6U 3LVVA 8ICMA 2YMQA 4I2BA 4WJPA 2NRZA 3BDPA 2ZW1A 2ZJ8A 2XI9A 1K50A 1WSPA 5KFYA 4EELA 2BCVA 4FJZA 4AJWA 1R4NI 2BZFA 1PGXA 1XLQA 3H6NA 4KLEA 2RDGA 4MT5A 4M8NA 3L16A 2DZKA 2JF5A 3L0WB 4M04A 4CF5A 1WGYA 4GXIA 3M95A 2J42A 5D2MB 3HX0A 9ICBA 3NZSA 1L7YA 5C3JB 2NRVA 3WA0A 1WE7A 3D2SA 5AKLA 5LXHA 3RRGA 8ICLA 3BWUD 4W9GA 3E58A 3WAMA 3RNCC 4QZEA 4JIOU 3EYZA 1QSLA 3TADC 3JPTA
chains in the Genus database with same CATH topology
3W5UB 2KWDA 1UNSA 2W3SA 1V8CA 1CK1A 1ESFA 3AE9B 2J52A 2NTTA 1VZ7A 1E0ZA 1FEHA 3NZ3A 3U52E 3B9JA 2BW2A 2N0SB 3AE3B 5FKAC 1MHHE 1VJKA 5HFYA 2JWUA 4DXGA 3KQ4A 2N9KA 2WU2B 4RGMA 3ZGZA 3AE7B 1HXYD 4NAWB 2V0GA 2ONQA 1XEEA 5AUIA 3VQIA 1C4PA 4JPSA 3TUOA 3CWIA 1QILA 2DYOA 2VZKD 4LK0M 4OZAA 1DOXA 1I4HA 1YN5A 1E6EB 1DYQA 2KMMA 2WLBA 4PT5A 2GRIA 4ZRQA 1CZPA 1FRRA 2NMQA 4ARIA 2BBCA 2BB5A 4WIPA 1YN4A 3R2TA 4XE0A 3VR9B 1JALA 1BXTA 2Z8LA 3SFDB 2K5PA 3PZ7A 2MJEA 2MJDA 1YJJA 2WNMA 3AEDB 5D3DA 1IBXB 4KKJA 1FMAD 4JE3B 1SJHD 1L4ZB 1B9RA 1IGDA 4OZBA 3U2SC 3VRBB 2JQRB 5HHDG 2DBYA 3EA6A 3EUB2 3AECB 3URYA 3AB5A 3Q8BA 2GI9A 2WXJA 3Q8CA 3MFGA 4GDLB 2JZPA 4L2YA 3BVZA 4D2KA 1AW7A 2DYMA 3NVYA 2NTSA 2XNAC 1V1PA 3NS1A 2K22A 2I2YA 3T3OA 1MI0A 5D7GA 1XLNA 4YTNB 1V1OA 4R3DA 1QOFA 4YSZB 1E9MA 1STEA 3GB1A 2M0AA 2SAKA 1EU3A 3VRAB 2IGGA 1T5XD 5TSSA 1YNTE 5BMGA 3NVZA 1E10A 1D5ZC 1QOBA 3I9V1 1WYGA 4ITKA 1YJIA 1XF5L 1L5PA 1UUPA 2OEDA 4WQMA 2K3UA 4NJCA 2PLPA 1I4GA 4MACA 1I7HA 1TZOA 2INNE 2OHFA 4KX6B 4RGTA 1F0ZA 1GB1A 1B1ZA 3ZYYX 4ZOHC 4GLSC 3CIRB 1TS4A 3AEAB 1JCKB 1GB4A 3NVWA 2ON8A 2N7JA 2D5GA 2HDEA 4L23A 4P6VF 2LHDA 1F2RC 1YMHE 2PVGC 2WP9B 2WS3B 3BK1A 4O1NA 5D3IB 5BYQA 2WXRA 3U7ZA 2QJLA 4MM3B 4UDUC 2IDYA 2JSVX 1FCCC 3TEXA 4RGNA 4C80A 4NAMA 1R7SA 2FBWB 4KGSA 1C79A 1JWSD 5EE1A 1KRHA 1FRDA 2M56B 3IAM1 3NVVA 4LLGM 2MH7A 3MP9A 3P4QB 2G9HD 1IGCA 2K0PA 2L32A 2LFIA 2QMTA 2WQYB 3AEBB 4RNAA 3ZJTA 2WXQA 1SSNA 4OW0A 4A90A 1L0VB 1OFFA 1M4VA 1OQQA 3RFZB 2KAJA 2V4IB 1I4QA 1SE3A 3Q8FA 1N63A 5BYSA 1IBXA 1ZP0B 2LUMA 4YTMB 4C7YA 3W9CB 1C77A 1FO4A 1JROA 5G5HA 1FXIA 1FM0D 1QQRA 4GDKB 1DGJA 4TMAB 1L0XB 1EWCA 2WU5B 1L6UA 1CJEA 4XWTA 2R61A 4IKGA 1DOYA 4OHJA 4HJGE 1SE4A 5EE3A 4DQOC 5EE9A 1FFUA 1SXTA 1YQ3B 4WURA 1CQVA 3Q8EA 3P4PB 1QKZA 2WDRB 1QOGA 1OQRA 3P4SB 1ENFA 2WXGA 1SB3C 3U4EG 4MH8A 1F77A 3O13A 3AE8B 3AM9A 3DWMA 1KTKA 1VRAB 2V3PA 2JXTA 1ZXIA 3BZDB 2WXPA 4HROA 2QEJC 1KFYB 3PZ8A 2EKIA 4WH4A 1JMLA 3AE4B 3RPFC 1EU4A 3FILB 3PO0A 4WAFA 2W82A 5BMIA 1PDXA 3I57A 2RPVA 1VDVA 1V97A 4CQNA 2ACZB 2L52A 2KN4A 4JWUC 2AQ2B 4USAA 4C56C 1JW9D 2E3TA 5I4DA 3AEFB 1P7FA 3FILA 2PKOA 3BVMA 2WXNA 3MC0B 3ZJUA 1J7AA 3R2IA 4L1BA 4J3OD 1K51A 3AV8A 1FNUA 1NYQA 4YT0B 1PGBA 3R8BA 2Q5WD 1D6EC 1TKGA 2LJIA 4HKQA 4YTPB 2RDHA 5BYRA 1ET9A 2JX5A 1BUIC 2PW9A 1K53A 3KLSX 1PUTA 1EM7A 4B0MA 4ZRPA 4RF1A 2L1AA 1TY2A 2WXOA 3GP7A 1TS5A 1LO5D 2H88B 2BS2B 1ROEA 4FXCA 4YWGG 1AYFA 5HG2A 1FNVA 3Q69A 4TQ1A 4C7ZA 3KWVA 4YXDB 1D5MC 2LMCA 1FIQA 4RH6A 4XDDA 1TYGB 2J53A 1XO3A 1ZUD2 2PTLA 4A6QA 3SEBA 3V05A 3TEWA 1BMLC 3AMZA 4NZLB 4US9A 2AX5A 2BT6A 1ZOYB 2Y5PA 3VR8B 3ZQ4A 1L0YB 1ZE3D 1D5XC 2RMMA 1E7PB 1RWSA 3P4RB 2YEPF 4AS1A 1GAQB 1PFDA 2QILA 3J9CA 3AEGB 1T3QA 2B76B 2CJOA 3AE5B 4XDCA 1UGJA 1HQRD 1QLBB 3P42A 4IDIA 3W2DA 4DXFA 1TY0A 2X38A 1ZPSA 3DWGC 4HRSA 2GB1A 2TSSA 1JWAD 1XLPA 5T8IA 2W55A 2ICIA 4JX1C 2DWQA 4LTUA 1QT9A 4EE2A 2I38A 1HEZE 3B2FA 1HZ6A 1SE2A 2H89B 1C4CA 1SEBD 3MJ5A 1GPXA 2MJ3A 4JWSC 3TSSA 3EGRA 3TEYA 2JYEA 1ACCA 1TS2A 3IAS1 1WWTA 1JWBD 4RGOS 1XXGA 5MPOA 1MVKA 1EWYC 1C76A 2WXIA 3Q8AA 1QF6A 3SR6A 2K9XA 4P16A 5FR3A 2QSDA 1DOIA 3FC4A 5JXVA 1J7BA 1AN8A 4AQ7A 4TSSA 5LNK1 1SIJA 1C78A 3H8HA 3SFEB 2BYTA 2FUG1 3IT4B 3B2GA 1IUEA 2WXHA 1FFVA 2AQ1B 1ZXHA 1HA5A 2W54A 1Y56A 3AN1A 4WWMA 1ZDVA 1KLUD 5GXGB 4HKZE 4ARCA 4OVZA 4N6EB 2BB6A 1HZ5A 1RFKA 2J4XA 4YSXB 2PIAA 5HI1A 1C4AA 4RCOA 1ZDXA 2JU6X 2G1EA 2ZW0A 3AH7A 1FD6A 5AUKA 2XN9C 5EE0A 5FK9C 1QOAA 3IXSA 2KACA 2KQ4X 3GS2A 5BMHA 2MEKA 3V3XA 2INPE 3BVGA 1VLBA 3P1MA 2WDVB 2PVOD 1C9FA 1TJEA 2WXMA 2E6XA 1JWUD 1RYJA 2EELA 2KDMA 1D4BA 3LB8C 3UI3A 1SBBB 2IJ0A 1XCQL 2LEKA 1FNWA 3FAHA 1WRIA 3HVDA 1UWXA 4REZA 3HUIA 1WXQA 4US8A 1NYRA 1RM6C 2LHEA 3TEZA 3NRZA 2V3NA 1PYWD 3L4PA 1I4PA 3N9YC 1FCLA 1TKEA 1YQ4B 1N5WA 4XWWA 2WXFA 1N61A 4M0WA 3T3NA 2SEBD 1XCTL 2QIEB 2WDQB 3BYTB 1ET6A 1KF6B 3HVZA 4ZHOA 3HRDD 2DLBA 1GOZA 1N60A 4A55A 3E9SA 2BS4B 4HEA1 1KH0A 4RF0A 5E6JA 5C2TB 1NVID 2LGIA 1XLOA 5H92C 1PGAA 3BYYB 4KGRA 1YN3A 1N5XA 3AE6B 4N59A 2IGDA 1VR9A 4H2AA 3LYYA 1J7CA 2BS3B 3ABVB 3AE1B 2WXLA 4RFBA 4KGTA 4Q2JA 3AE2B 4KKIA 1F2RI 1JWMD 2IPKD 4YSYB 1MPEA 1P7EA 1TKYA 3P63A 3MHZA 3W1SA 1Q10A 2FE8A 1T6BX 2PMVA 1WGKA 2M19A 2IGHA 2VZKB 2Y5CA 4IOIE 3KWLA 3NUHB 1L6VA 2BTEA 1L4DB 3BK2A 4OZCA 1SF0A 1K52A 1A70A 3W5VB 2Y3AA 4ZHPA 1I4RA 3E56A 2L83A 2N9LA 3LXFA 3ZJVA 2YEPB 1SJED 3BIID 1N62A 2ZW1A 4A9AA 1K50A 1TS3A 1WSPA 2CJNA 5G5GA 2WXKA 1VZ8A 3C8YA 1PGXA 1XLQA 1KLGD 2RDGA 1VZ6A 4MT5A 4N58A 5H8YE 4TQ0A 2J42A 1MHXA 3ETRA 5C3JB 2HTME 1JRPA 2CU3A 1JQ4A 2JYTA 3BWUD 4A8XC 1AWDA 1NEKB 1NI3A 1V1PB 2W3RA 1I4XA 4ZYSA 3AEEB 4B0EA 2AQ3B 3OWEB 1FXAA 3IT6B 3WCQA 1NENB 1UWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U B;  2PVG C;  1QOA A;  1TKG A;  2W3S A;  1V8C A;  4YTP B;  2WP9 B;  2WS3 B;  3AE9 B;  2JX5 A;  2QJL A;  1E0Z A;  1VLB A;  1PUT A;  3P1M A;  2WDV B;  3B9J A;  2N0S B;  3AE3 B;  1VJK A;  2PVO D;  4C80 A;  1TJE A;  2H88 B;  2BS2 B;  1ROE A;  4FXC A;  1R7S A;  2FBW B;  1RYJ A;  1KRH A;  1FRD A;  1AYF A;  2M56 B;  3NVV A;  2WU2 B;  3LB8 C;  5EE1 A;  3AE7 B;  4C7Z A;  2LEK A;  1WRI A;  3FAH A;  4YXD B;  2MH7 A;  5AUI A;  3HUI A;  1WXQ A;  4US8 A;  3CWI A;  3P4Q B;  1FIQ A;  1RM6 C;  1NYR A;  2WQY B;  3AEB B;  3NRZ A;  1TYG B;  1XO3 A;  1ZUD 2;  3L4P A;  3AMZ A;  1DOX A;  4US9 A;  1TKE A;  1YQ4 B;  1ZOY B;  2AX5 A;  1N5W A;  1L0V B;  1OFF A;  1E6E B;  2BT6 A;  1OQQ A;  2KMM A;  2WLB A;  2KAJ A;  1N61 A;  1CZP A;  1FRR A;  1E7P B;  1RWS A;  3P4R B;  1N63 A;  1ZP0 B;  2QIE B;  2WDQ B;  3HVZ A;  4YTM B;  1KF6 B;  4C7Y A;  1GAQ B;  3W9C B;  3HRD D;  3VR9 B;  4ZHO A;  1JAL A;  1FO4 A;  1PFD A;  3SFD B;  1JRO A;  5G5H A;  1T3Q A;  1FXI A;  1FM0 D;  2B76 B;  2CJO A;  1DGJ A;  2K5P A;  3AE5 B;  3AEG B;  1N60 A;  2WU5 B;  1QLB B;  2MJE A;  2MJD A;  1YJJ A;  2BS4 B;  3AED B;  1L6U A;  4IDI A;  1CJE A;  1DOY A;  5C2T B;  1NVI D;  1XLO A;  1FMA D;  5EE3 A;  5H92 C;  3DWG C;  4HRS A;  5EE9 A;  1FFU A;  1N5X A;  1YQ3 B;  3AE6 B;  4N59 A;  1JWA D;  1XLP A;  1B9R A;  2W55 A;  1J7C A;  3P4P B;  2BS3 B;  3ABV B;  3VRB B;  2WDR B;  1QOG A;  2JQR B;  1OQR A;  3P4S B;  2DBY A;  3AE1 B;  2DWQ A;  4JX1 C;  4LTU A;  1SB3 C;  3EUB 2;  1QT9 A;  3AEC B;  3AB5 A;  3B2F A;  3AE2 B;  2H89 B;  1GPX A;  3AE8 B;  4YSY B;  1TKY A;  2MJ3 A;  4JWS C;  3P63 A;  3AM9 A;  1WGK A;  2M19 A;  3DWM A;  3NVY A;  1WWT A;  2Y5C A;  1JWB D;  3NS1 A;  5MPO A;  2K22 A;  3KWL A;  1EWY C;  1L6V A;  1SF0 A;  1ZXI A;  1XLN A;  1A70 A;  4YTN B;  3W5V B;  4HRO A;  4ZHP A;  1QOF A;  1QF6 A;  3SR6 A;  2K9X A;  4YSZ B;  1E9M A;  1KFY B;  2L83 A;  3LXF A;  2EKI A;  3RPF C;  3AE4 B;  3BII D;  1DOI A;  1N62 A;  3VRA B;  3FC4 A;  1J7B A;  3PO0 A;  4A9A A;  3NVZ A;  1PDX A;  1SIJ A;  1QOB A;  3SFE B;  1E10 A;  2CJN A;  1WYG A;  5G5G A;  3B2G A;  4ITK A;  1IUE A;  1XLQ A;  1YJI A;  1VDV A;  1V97 A;  1L5P A;  4WQM A;  1FFV A;  2ACZ B;  4N58 A;  5H8Y E;  2L52 A;  3VR8 B;  2W54 A;  4JWU C;  3AN1 A;  4WWM A;  3ETR A;  4USA A;  1I7H A;  1JW9 D;  2E3T A;  2OHF A;  3AEF B;  4KX6 B;  5GXG B;  5C3J B;  2PKO A;  2HTM E;  4N6E B;  1F0Z A;  1JRP A;  2CU3 A;  3ZYY X;  1JQ4 A;  4ZOH C;  1RFK A;  4YSX B;  1AWD A;  1NEK B;  1NI3 A;  1J7A A;  2PIA A;  2W3R A;  3CIR B;  3AEE B;  3AEA B;  2G1E A;  3AH7 A;  3NVW A;  1FXA A;  3AV8 A;  5AUK A;  1NYQ A;  4YT0 B;  3WCQ A;  1NEN B;  1UWM A;  5EE0 A;  2Q5W D;  4P6V F; 
#chains in the Genus database with same CATH topology
 3W5U B;  2AQ0 A;  2Z0E B;  2MW5 A;  3PSF A;  1ESF A;  2L00 B;  2J52 A;  3AE9 B;  3RH6 A;  1NZB A;  1VZ7 A;  2Y9T A;  3ZD9 A;  1FEH A;  3A9K B;  3AE3 B;  1MHH E;  1VJK A;  2KMD A;  3RNA C;  2NS5 A;  2N9K A;  2WU2 B;  4RGM A;  2ONQ A;  1U45 A;  1XEE A;  3VQI A;  1C4P A;  1NNL A;  3I63 C;  1SIF A;  3SHQ A;  1BPB A;  3UXO A;  4MSQ B;  5J2F A;  3IHP C;  4A3O A;  2Y9U A;  3WK4 A;  1PUZ A;  1WUD A;  1P7D A;  4F1S A;  1XSN A;  1MQ3 A;  3RMK C;  2BQ3 A;  1DYQ A;  3EEC A;  1KW4 A;  1RPL A;  3QZ7 A;  2RDI A;  4BGD A;  3PO5 A;  2D3B A;  2NMQ A;  2BBC A;  2BB5 A;  3R2T A;  4XE0 A;  2Z7J A;  3KHL A;  2JH1 A;  1Z3E B;  3VR9 B;  3WK6 A;  1JAL A;  4KSL C;  1D3Z A;  4R64 A;  4I2H A;  3DBH B;  2KVZ A;  3PZ7 A;  2MJD A;  1ZRN A;  1YJJ A;  3AED B;  3ETL A;  1IBX B;  1ZQE A;  1FMA D;  2IOF A;  3QE9 Y;  3I1Y A;  3AUO A;  1L4Z B;  2PE9 A;  3GIK A;  1BPY A;  3PR4 A;  3JPN A;  3OG5 A;  3R3M A;  3VRB B;  5HHD G;  1OXJ A;  3EUB 2;  3URY A;  4F50 A;  5B5E U;  2M0N A;  4BOZ B;  3AB5 A;  3Q8B A;  2WXJ A;  5E6N A;  1V6E A;  1HEK A;  3DBS A;  2IHN A;  1AW7 A;  2LXA A;  2NTS A;  2XNA C;  4G3X B;  3RN9 C;  5IIJ A;  5KAI U;  5DB8 A;  2ZIU A;  2I2Y A;  4KIK A;  2ZIW B;  4IQT A;  1MI0 A;  4DOA A;  4FE3 A;  3F5E A;  4R3D A;  1E9M A;  5J0T A;  3MC1 A;  1ZQG A;  2SAK A;  5KG0 A;  4JV0 A;  4EBE A;  1TZ1 A;  4BWJ A;  3SV4 A;  2JRZ A;  4NJ8 A;  3IG5 A;  2M9N A;  4I28 A;  3NVZ A;  2GOL A;  1D5Z C;  8ICC A;  1E10 A;  2YY6 A;  1WYG A;  7ICS A;  1SV4 A;  2IO0 B;  3R9K A;  4NLG A;  3K4G A;  3QXG A;  1YJI A;  2ZNV C;  1RG6 A;  2DAJ A;  2K3U A;  3WAO A;  1S1Q B;  2IOH A;  4RQ4 A;  2E8O A;  3ONS A;  1NBF C;  1QZE A;  5J29 A;  2QB1 A;  2OHF A;  1TZO A;  1B1Z A;  1C1Y B;  3DVG Y;  2GMI C;  2WX1 A;  5CHV C;  2Y1I A;  2LM1 A;  5HKH A;  4ED2 A;  3CIR B;  3KZX A;  3MDA A;  3B0A A;  2GBK A;  3N7P D;  3NVW A;  1GB4 A;  2GLS A;  1LM8 B;  1KFS A;  3RB6 A;  1N56 A;  3PR5 B;  1YMH E;  2QHO A;  1S3S G;  5J0Y A;  3RJJ A;  1UBQ A;  2DGZ A;  1M6Y A;  2GO7 A;  2QKQ A;  2LYB A;  3MR3 A;  2QCZ A;  5D3I B;  5BYQ A;  2WXR A;  4DF8 A;  1E8Z A;  4UDU C;  2JSV X;  2LD9 A;  3Q3O C;  4HJK A;  4FA6 A;  1TK0 A;  3QZ8 A;  2CHX A;  4RGN A;  4QZC A;  4C80 A;  2LVQ A;  4NAM A;  3RT3 B;  4MFC A;  4KGS A;  4RQN A;  1C79 A;  2J0K A;  2M56 B;  4CGZ A;  4DFM A;  3H0R B;  4DL5 A;  2ATL A;  4IR1 A;  1ZQD A;  4BOS C;  2KDB A;  3F2B A;  2ZJD A;  3OJ4 B;  4LNI A;  2K39 A;  1IGC A;  3OGU A;  7ICU A;  4RNA A;  2DFL A;  3APF A;  3ZJT A;  2I1K A;  1QQ6 A;  1V9P A;  7ICM A;  3PRE A;  4M0W B;  5C1Z A;  3ML8 A;  4TUP A;  4IM0 A;  2KD0 A;  4OW0 A;  3PX4 A;  1M4V A;  4JWM A;  2KAJ A;  4FS1 A;  3QWZ B;  5KG3 A;  4FN2 A;  2XGP A;  1IBX A;  2AEH A;  3ZI4 A;  2YVC A;  2EDU A;  2RLT A;  3IFW B;  5KFX A;  2C2D A;  4KLG A;  3W9C B;  1UD7 A;  1XU4 A;  2JHD A;  3GZN B;  4GDK A;  1JRO A;  1FXI A;  1JIH A;  5DGB A;  1EWC A;  2YB1 A;  1XQQ A;  3SYZ A;  1CJE A;  2AGQ A;  3DVG X;  1SE4 A;  4DQO C;  1SKW A;  5EE9 A;  3VC8 A;  1SXT A;  1KDH A;  2YX8 A;  4WJO A;  4X57 B;  4ZH4 A;  2AQ4 A;  4GOC A;  1L7P A;  2HOQ A;  1ENF A;  1LVH A;  2WXG A;  2JR5 A;  1ZJN A;  1X6I A;  2XVT A;  5ALS A;  5ALX A;  3Q14 C;  4IWP A;  2N9E B;  3ZIM A;  2QB0 A;  3AM9 A;  3KYC D;  5DBA A;  3T9L A;  1TTN A;  2CU1 A;  2WWZ A;  3IRU A;  1Z19 A;  1V80 A;  4UW9 A;  1ZXI A;  2LWP A;  1RYR A;  4MH0 E;  2IY0 B;  4WAA A;  1ZQJ A;  1ZGU B;  3N7S C;  2LZ6 A;  3MR6 A;  3JSV A;  4URK A;  2HHT A;  1KFY B;  1KJT A;  3PZ8 A;  3NAS A;  2EKI A;  4WH4 A;  3P2B A;  2HI0 A;  4BKS D;  5IO9 A;  3K1Z A;  2IYD B;  3C23 A;  2W82 A;  5BMI A;  3AQE A;  1BPE A;  3I57 A;  1OUQ A;  2KNJ A;  3H9D A;  3ZDE A;  2G08 A;  4F71 A;  3IG3 A;  1V97 A;  3LWL A;  4KLH A;  3A0B U;  2ACZ B;  4C4V B;  4MFA A;  2IBI B;  3PGE A;  4DDG D;  2HJ1 A;  4MGI E;  4EEK A;  9ICG A;  2KK8 A;  2E3T A;  3GQC A;  3AEF B;  4QZ8 A;  4A20 A;  1P0R A;  2PFQ A;  2WXN A;  4PS8 A;  3R2I A;  5AEK B;  1A6S A;  2CHW A;  2JZ3 B;  1H8C A;  4KLQ A;  3PNC A;  2JH7 A;  4NLB A;  3UIO B;  1E7V A;  3A1Q B;  4JQW C;  4YTP B;  2RDH A;  2GH1 A;  4YMO A;  5J8Y C;  1BUI C;  3MGI A;  2PW9 A;  1K53 A;  4K81 A;  2ESE A;  4I2D A;  2KYW A;  4J6I A;  2KVC A;  4W9H A;  4J9N A;  2ZPN A;  4PS7 A;  2Y0S F;  4KLL A;  4XGA B;  2LYH A;  2LGY A;  5L1M A;  1NOM A;  1GC6 A;  2LRW A;  3RH5 A;  5CP2 A;  3Q69 A;  3OJ3 A;  3WU2 U;  7ICG A;  4DFJ A;  1FIQ A;  4C8L A;  2JPH A;  3SD5 A;  3ZW3 A;  1WMH B;  1E8Y A;  1AAR A;  2CXY A;  5GTI U;  3UGB B;  4Y2U A;  7ICN A;  3TEW A;  4NZL B;  2RP5 A;  1ZQU A;  4US9 A;  2AX5 A;  2C7N B;  3VR8 B;  1KTQ A;  4RQM A;  1NK5 A;  2FLP A;  4KDL B;  1K8R B;  4I29 A;  3B1L X;  1ZE3 D;  4GXK A;  1U47 A;  2YEP F;  1BPD A;  2K8A A;  5AHX A;  2D3C A;  3H7S A;  4Y2T A;  4DWI A;  2BWF A;  2PFP A;  2QIL A;  3AEG B;  3LDA A;  4XDC A;  2FIF A;  2K8B B;  2JVC A;  2L76 A;  1PK3 A;  1JMS A;  4LNF A;  1PVQ A;  4CYE A;  1ZPS A;  4LJP B;  3DVN V;  2NYV A;  4O3O A;  5JRT A;  3ICX A;  3DVN U;  3KUZ A;  1KM7 A;  1RXV A;  4LTU A;  4MHV A;  2BYV E;  8ICV A;  5L95 C;  3B2F A;  1LB2 B;  2FMQ A;  2ASD A;  1SE2 A;  3A0H U;  1QLN A;  1SEB D;  2KD1 A;  3F2C A;  4M2Y A;  3A4R A;  5JTI A;  4IG7 B;  3TQ1 A;  2ZUC A;  1O03 A;  5D46 A;  2WB1 C;  2BDP A;  2AL6 A;  3IAS 1;  4N9F 4;  4RGO S;  5KFG A;  1T0S C;  4FBJ B;  9ICU A;  1ZYQ A;  1MVK A;  1ZD2 P;  4NQL B;  3N28 A;  9ICO A;  1EWY C;  1GUA B;  2KT7 A;  5LLI A;  1JXL A;  5BOL A;  1HTO A;  4DOC A;  2XID A;  2L8J A;  2M4N A;  3ZKJ C;  2HTH A;  2WF6 A;  2BKR B;  2K9X A;  3PTF C;  3AXC A;  5FR3 A;  1CRX A;  2QSD A;  4P4P A;  3TKA A;  3FC4 A;  1K1Q A;  9ICV A;  1WXV A;  2JWZ A;  3GII A;  1M94 A;  1T0R C;  4F72 A;  2LPE A;  1SIJ A;  3SFE B;  2FUG 1;  3GU3 A;  1TV9 A;  1S77 D;  2BPF A;  3ML9 A;  5KG6 A;  9ICE A;  3MC8 A;  2N4F A;  1HA5 A;  1SXE A;  1ZQO A;  2B0C A;  4EZJ A;  1KLU D;  4HPM B;  5GXG B;  4EOY A;  4ARC A;  4OVZ A;  1GJZ A;  2VRR B;  5BPC A;  3VAW A;  4G9B A;  2I5H A;  4IRD A;  2QC8 A;  5KG5 A;  4MEM A;  4HPL B;  2UWQ A;  4Y2S A;  4QWC A;  4NNJ B;  3GE3 C;  5HI1 A;  1ZDX A;  1TKD A;  2G1E A;  4JWN A;  3EFU A;  4Y2Y A;  2ZIW A;  1E8W A;  5EE0 A;  4ELU A;  2AL3 A;  3NGD A;  4RQ0 A;  3IXS A;  4M9H A;  2I1J A;  4QZ9 A;  2MEK A;  2HBL A;  4MEL A;  2AWT A;  1VLB A;  2FLN A;  4PGX A;  2WDV B;  5JHB A;  5III A;  4YP3 A;  4OD0 A;  2E6X A;  3UQB A;  1D4B A;  2KDM A;  4Z6C A;  3N3K B;  7ICK A;  1XCQ L;  1WRI A;  3FAH A;  2GWS A;  2C2R A;  3PO4 A;  4ECR A;  4FBU A;  5IKC M;  4IW0 A;  2LHE A;  3SV3 A;  3NRZ A;  2V3N A;  3DBR B;  2K6Q A;  2PPH A;  1F9J A;  3N9Y C;  1RQN A;  1FCL A;  3V72 A;  3KFU F;  2PJH A;  8ICY A;  3ISC A;  2EZY A;  1XNS A;  4HAI A;  1TVA A;  3TFS A;  3EPG A;  1L7M A;  4DFD A;  4GXB A;  3NUQ A;  3IVF A;  2QIE B;  4XYC A;  2LVO A;  3HRD D;  2DHZ A;  5AM2 A;  2MA9 B;  2KDE B;  1WY8 A;  1L2N A;  3V7L A;  4A55 A;  5AKH A;  4MF8 A;  4HVB A;  4LJX A;  3H8S A;  4PHE A;  5E6J A;  1EO6 A;  3LYS A;  4CHK A;  2O6V B;  7ICI A;  1PGA A;  5H92 C;  4BXO A;  4KLI A;  1YN3 A;  3JVZ X;  4RPY A;  1VR9 A;  3LYY A;  2HBM A;  1J7C A;  2EZZ A;  4I2J A;  2GLE A;  2BS3 B;  4EZK A;  4Y2Q A;  3M6Z A;  1J2M A;  8ICZ A;  4RFB A;  4G3I A;  4Q2J A;  5A0L A;  3VXW A;  4DLG A;  2UVU A;  5KG2 A;  2WGS A;  3BIN A;  4DQQ A;  3P63 A;  2HSZ A;  2ZPY A;  2ZIV B;  4K4I A;  4MDK E;  2DYB A;  4DO9 A;  3CSF A;  4P4M A;  5L1K A;  3QUQ A;  5DLG A;  4KZC A;  8ICP A;  4ZHP A;  1T8E A;  3R7Q A;  4F5N A;  2P6R A;  2XY6 A;  3V6C B;  4NL9 A;  3BII D;  4PS3 A;  4A3P A;  5DPS A;  9ICQ A;  2MBB B;  1GO3 F;  4ZYN A;  3M1Y A;  2M1M A;  1UF0 A;  1ZQV A;  2WXK A;  3M3J A;  4Y2V A;  4O3P A;  3PST A;  5EWE A;  1KLG D;  3KHH A;  4M02 A;  3S6J A;  4CRX A;  1PQS A;  4XZ4 A;  5H8Y E;  3ZVV A;  4TQ0 A;  3H1U A;  1HUZ A;  5ALD A;  2BGF A;  4K7S A;  2XBB C;  2W9M A;  2CN1 A;  3H4D A;  1B4F A;  2V4R A;  4J9L A;  1TAM A;  5G55 A;  2HTM E;  2IO3 B;  1JRP A;  4YFK A;  4EBD A;  1JQ4 A;  2JYT A;  3N1Y C;  3JPP A;  5B66 U;  4A8X C;  1NI3 A;  1ZQF A;  2KHQ A;  3AEE B;  8ICN A;  3RYT A;  2HHW A;  1IPG A;  1FXA A;  2Z0D B;  3IT6 B;  4PYU A;  4IRK A;  4Y2X A;  2V1Y A;  1UWM A;  2MRP A;  2R8H A;  5KFM A;  3U30 A;  3ZUN A;  4HDO A;  1BVS A;  2W3S A;  1TGZ B;  3ZNZ B;  2XK5 A;  4MF2 A;  1U9L A;  4ZRK A;  2O6V D;  3I76 A;  4II3 B;  3U52 E;  5FKA C;  5HP4 A;  4BFR A;  3D2Q A;  5L83 A;  2JWU A;  2KIW A;  4IQU A;  4DXG A;  2A1J A;  1ZJM A;  4ECZ A;  3KQ4 A;  3ZGZ A;  3AE7 B;  2K8C B;  4KN4 A;  4NAW B;  2H5X A;  4R8U B;  4IM3 A;  4RQ3 A;  3TUO A;  3PSE B;  3BQ7 A;  2NRX A;  4YMN A;  3UM9 A;  3A9J A;  5AM0 A;  2KFJ A;  4OZA A;  5IN7 A;  7ICF A;  2KMM A;  4LZG A;  5KFH A;  2GRI A;  4K1R B;  1FRR A;  2C22 A;  4M9G A;  1X42 A;  3N1Z C;  4P0P B;  1WGG A;  1IM4 A;  3M9N B;  3A9J B;  4ARI A;  3B0X A;  2RGF A;  4FZL A;  4J03 A;  4C0Z A;  4P7I A;  3DCG A;  1ZW7 A;  3VTU A;  1X40 A;  3MR2 A;  5CX3 A;  3V61 A;  1KLN A;  9ICK A;  2K5P A;  3QIJ A;  8ICT A;  2MJE A;  4II2 B;  4ECQ A;  5ALQ A;  1SJH D;  3RJF A;  1B9R A;  4DL2 A;  1WFY A;  5ALE A;  3RH4 A;  5AIC A;  3HW8 A;  4JUZ A;  2D3A A;  2BYE A;  3HM3 A;  4RUA A;  1F1H A;  2UVV A;  3BS5 A;  2MUT B;  3VHT C;  5J2H A;  4LNK A;  2NRW A;  4B9N A;  2E8N A;  2KLG A;  5DB6 A;  4F4K A;  3MFG A;  2JT4 B;  4GDL B;  2UYZ B;  3AU6 A;  3BZK A;  2VKQ A;  4UAW A;  3NVY A;  2C5L C;  1NK8 A;  4ECY A;  2K22 A;  4KIT B;  4CF3 A;  1F5S A;  3T3O A;  5KFO A;  2JY6 A;  2JEF A;  1XLN A;  2P35 A;  2CKH B;  4MM3 A;  1HUO A;  1QOF A;  3RNB C;  4QIW F;  3T5K A;  1BNP A;  2RD0 A;  4I2C A;  1KBU A;  1STE A;  2BHN A;  1SGH A;  4BBN F;  2KVR A;  2L5Y A;  4JMU A;  2IGG A;  2QLT A;  4FS2 A;  4IWQ A;  1UT5 A;  1YNT E;  4S17 A;  5BMG A;  2GBN A;  1T3N A;  1MA7 A;  4F4X A;  4ED7 A;  2KAN A;  3I9V 1;  4DQP A;  4GU2 A;  3UXP A;  4DBG A;  3MFI A;  4C4V A;  2OED A;  1L5P A;  3W1S C;  1SE9 A;  5KFT A;  3TAP A;  5E6P A;  2DPI A;  8ICG A;  4I2G A;  3C21 A;  4W9J A;  4I27 A;  3OJS A;  4QZB A;  1Z2M A;  4IQW A;  1BPX A;  4QWB A;  4CCH A;  3C2M A;  1TS4 A;  2MLB A;  1JCK B;  5HR6 A;  2CPR A;  1V2Y A;  4CE6 A;  3K1R B;  5KFF A;  4OJL A;  2HDE A;  2LI5 A;  4L23 A;  4BWM A;  4B9V A;  2LHD A;  1IXR A;  9ICF A;  4OJ5 A;  3RJG A;  3QUT A;  1SV0 C;  2BPC A;  5J0R A;  2WP9 B;  8ICR A;  4G0N B;  2IDY A;  2FMS A;  3TEX A;  4BXO B;  5HNK A;  5KG7 A;  3VH4 B;  4G11 A;  5EE1 A;  1S0N A;  2PFO A;  4LLG M;  2JMG A;  4PHD A;  1ZKH A;  3N4M B;  2MH7 A;  4BKG A;  2F1J A;  3H4B A;  4QIW C;  3P4Q B;  2WQY B;  4XX5 A;  5HHH A;  9ICC A;  4FO6 A;  2ZZP B;  4DHJ B;  2PKE A;  4WJN A;  4YN4 A;  3TAD A;  4DSI A;  2C9W B;  1L0V B;  2W7P A;  4IR9 A;  1ZQX A;  2V4I B;  3EFC A;  2R8I A;  1I4Q A;  1XSL A;  2VA8 A;  4QZG A;  4JV1 A;  5BYS A;  4XA5 A;  2LUM A;  2YML A;  2HBK A;  3GZN I;  2G5I B;  3WAL A;  1GNU A;  5J2B A;  1QQR A;  4GN1 A;  1DGJ A;  5DG8 A;  1E90 A;  4UAR A;  2NPT B;  1L6U A;  1NK9 A;  2R61 A;  5AI4 A;  5KFC A;  1WGH A;  4GSW A;  2IMW P;  1FFU A;  1YQ3 B;  3QU4 A;  5J2A A;  2KSO B;  2WDR B;  1QOG A;  4HCP B;  4AJY B;  4PH5 A;  2B6G A;  4P4O A;  5DDY A;  4DL7 A;  3RAQ A;  2KDI A;  1Z4N A;  3IN5 A;  3WIM A;  4G50 A;  3ISD A;  3I28 A;  1VRA B;  2G5H B;  3DEE A;  3Q3N C;  5MPO A;  3O0F A;  4B95 A;  3ONN A;  5ALR A;  2JXT A;  1X9W A;  1ARO P;  2NO5 A;  1DOQ A;  5EWF A;  2WXP A;  1QTM A;  3Q6B A;  4EX6 A;  5IAA C;  4DSF A;  4CO7 A;  4B9M A;  3CST A;  2ZCC A;  1JML A;  3Q3M C;  3RF9 A;  2BKE A;  1PK1 A;  3FIL B;  5ALN A;  4MJS B;  1SL2 A;  2ASL A;  4NQK E;  1NZP A;  2DKX A;  3PW5 A;  3TJP A;  3RNF C;  1QSY A;  4B9U A;  3D6J A;  2KJ5 A;  4RNM A;  3RJH A;  4QNL A;  1EUV B;  4EYI B;  2OJR A;  2HJ8 A;  1L6N A;  2W9N A;  3QUC A;  4X5V A;  4C56 C;  4XC2 A;  3V6K A;  5I4D A;  2K4P A;  4HCN B;  1J0G A;  3PV8 A;  1RXW A;  2BYF A;  1OEY A;  2LUE A;  4RQ8 A;  3ZJU A;  1S5L U;  3HP6 A;  5KFS A;  4J3O D;  3WAP A;  4UAT A;  1K5O A;  1Z1V A;  3TMP B;  1NYQ A;  9ICM A;  2Q5W D;  2W04 A;  4KIK B;  2KIV A;  3LWM A;  5ALY A;  1ZQS A;  1D6E C;  3ZXV A;  4P0Q B;  2LJI A;  4HKQ A;  3PML A;  1YQB A;  4WJQ A;  3B0Y A;  1NJZ A;  1ET9 A;  1WIA A;  4XRH A;  2JX5 A;  3KLS X;  1PUT A;  4MGZ E;  4HYK A;  2IBK A;  2IND C;  4ZRP A;  2L1A A;  3GP7 A;  4HPP A;  1TS5 A;  1ZQW A;  2ZIX B;  2MU2 A;  2KNB A;  3EHV A;  3KOO A;  5ALL A;  1Z1B A;  1XO1 A;  3PX6 A;  1FNV A;  2Y1J A;  5H2F U;  4F93 B;  3N7R C;  3KWV A;  1V9J A;  4OJP A;  4C8N A;  2N1W A;  5AKE A;  5KFA A;  1X2I A;  1NK0 A;  4RQ2 A;  3CRX A;  2NO4 A;  4RPZ A;  4JGH B;  3EW9 A;  1V49 A;  4XDD A;  2ZIV A;  1XO3 A;  2PTL A;  1HJP A;  4GIB A;  3SEB A;  4IC9 A;  3V05 A;  1Q8K A;  1WWU A;  3IG8 A;  2BT6 A;  4P1C C;  7ICP A;  5AKY A;  2VAN A;  5F9N A;  3OHB A;  1L0Y B;  3SDL C;  3WAN A;  2LGD A;  3RB3 A;  5KT3 A;  2RMM A;  3P4R B;  1E7U A;  5DDM A;  4I6P A;  4YQW A;  5JZE B;  1NI2 A;  2C7H A;  3AE5 B;  4JLC A;  2LKY A;  4ZDV A;  1TE2 A;  5ALZ A;  2O6V A;  3IV6 A;  4GGQ A;  4O3M A;  2NVU I;  2N9X A;  1TY0 A;  3ZDB A;  2X38 A;  3RBE A;  1U49 A;  4UAV A;  1TK8 A;  2GB1 A;  3B08 A;  5KT4 A;  4EFO A;  4DSE A;  3AL0 B;  3M9M B;  2ICI A;  4JX1 C;  4WWP A;  1QT9 A;  3RBD A;  5CTR C;  2ZVN A;  2O6K A;  2I38 A;  4EE2 A;  1I42 A;  3RNE C;  3IM1 A;  2OWO A;  5J2I A;  2K89 A;  2KZ3 A;  1GPX A;  2YMM A;  4NM2 A;  3RTV A;  3TSS A;  1KRP A;  3EGR A;  4NLC A;  2HVH A;  2MRL A;  1RZT A;  2PXI A;  1ACC A;  2M8S A;  2W9B A;  1L3S A;  2RDJ A;  2K25 A;  5CB1 A;  2Y5B B;  1X9M A;  2ODG A;  1S8O A;  4M0A A;  2MCN B;  4EX7 A;  2WHI A;  3H7P A;  3GV8 B;  2X8X X;  1XD3 B;  2QAR A;  2N9P C;  5DQI A;  4IM2 A;  1DOI A;  4RQ1 A;  4ECX A;  3N30 A;  3OAW A;  4EUT A;  9ICI A;  2W8L A;  3KYD D;  3QCA A;  3H8H A;  5J2C A;  1C78 A;  4EZ9 A;  2BYT A;  4P0Q A;  1U4A A;  1P9D U;  4TUS A;  1J2N A;  5ALI A;  3ZRF A;  4WWM A;  3AN1 A;  8ICU A;  5TZV A;  2HCF A;  4N6E B;  2BB6 A;  3OLM D;  2B21 A;  2KDF B;  4F7Z A;  5AI5 A;  3RB0 A;  4Y2R A;  2J4X A;  3PW7 A;  2FPK A;  3MTN B;  2KK0 A;  1KL9 A;  2Q4T A;  1NK7 A;  2ZXH A;  1FD6 A;  3AH7 A;  2ZW0 A;  4FHJ A;  2MX2 A;  4K7W A;  4M9L A;  3TBL D;  1N2X A;  2HHX A;  1XWL A;  3H0M B;  3PZP A;  3LDZ E;  2KQ4 X;  2FUH B;  1WI0 A;  3GS2 A;  1LFD A;  4EZL A;  2KOX A;  3V3X A;  4QWD A;  3QEA Z;  3LVW A;  5CRX A;  3BVG A;  4DQI A;  3P1M A;  3D32 A;  3QX1 A;  4O3R A;  5ALU A;  2WXM A;  4QAY A;  4J9M A;  2DX5 B;  2LVP A;  2BCU A;  2D8C A;  1V86 A;  2EEL A;  3DBL I;  5AKG A;  3QU7 A;  5J0X A;  4QWE A;  2LEK A;  3APC A;  3W1Y A;  2MSN A;  4QZA A;  3HUI A;  4US8 A;  1NYR A;  1RM6 C;  4NLN A;  3KD3 A;  3OSN A;  1JI7 A;  1I4P A;  5DCN A;  1PVP A;  5IOI A;  1YQ4 B;  1L7N A;  1N5W A;  3HIZ A;  2H3Z A;  2WB1 F;  4XWW A;  1J8C A;  4I2F A;  3EPI A;  1SV0 A;  4CDG A;  5TIS U;  5J8Y A;  2HMX A;  3PSI A;  3EZ5 A;  2L0T A;  4M0W A;  4ED8 A;  3SZ2 A;  3Q8M A;  2KFK B;  3T3N A;  3UPQ A;  1V5T A;  3DOW A;  4ZHO A;  4KTQ A;  3H40 A;  3HPO A;  2D2Q A;  1GOZ A;  1WYW B;  5KHO A;  5C5J A;  3PS6 A;  2OXO A;  2FNJ B;  4F5Q A;  4B6J A;  4IQV A;  4RF0 A;  5AKI A;  3PMN A;  1XLO A;  3BYY B;  4KGR A;  3C2L A;  1MSW D;  4MGK E;  1N5X A;  2KKP A;  3QK0 A;  4H2A A;  5DLF A;  2REX A;  1NK4 A;  1P3Q U;  2H3I A;  2MSE D;  3VUW A;  2ALZ A;  4B9K A;  3SQI A;  2ASQ A;  4U6P A;  3RAX A;  3AE2 B;  4FBT A;  4ED0 A;  1Z00 A;  2KJ8 A;  1F2R I;  1JWM D;  2IPK D;  1MPE A;  3U8Z A;  3HK0 A;  1Q10 A;  2HHS A;  1T6B X;  2PMV A;  2VZK B;  1WGK A;  8ICQ A;  1WMH A;  2INC C;  1X9S A;  2FJ6 A;  2DZJ A;  4F4Y A;  2ZTE A;  3ORY A;  4TQR A;  5KFQ A;  3A33 B;  4JL9 A;  4AOF A;  8ICS A;  2FCS A;  2Y3A A;  2ZJ5 A;  7ICL A;  4IS7 A;  2XCP A;  2CHZ A;  3E56 A;  1VD2 A;  2IZV B;  2YEP B;  2YB4 A;  4GLX A;  1SJE D;  1N62 A;  1MG4 A;  4BZA A;  3VTW A;  1YZ7 A;  1WR6 E;  4UB8 U;  1ZQN A;  5G5G A;  1VZ8 A;  1DK3 A;  3C8Y A;  2R8J A;  1UQV A;  2PFN A;  3NZU A;  4N58 A;  3BQ2 A;  4UB6 U;  1ZQT A;  3ETR A;  4EEY A;  3V6J A;  2C28 A;  3PSP A;  2CU3 A;  2ZIU B;  4KLM A;  1AWD A;  1NEK B;  1I4X A;  3T5L A;  3MAB A;  4NJ7 A;  4ZYS A;  3Q8K A;  2KWU B;  4LDT B;  2A3V A;  5KG4 A;  4Q45 A;  3WCQ A;  2HHU A;  4C8K A;  4FUL A;  1B0X A;  3MC9 A;  2W11 A;  3IP4 B;  1UNS A;  2K4I A;  2E8M A;  4Y2P A;  3V6E B;  1CK1 A;  3SAG A;  3H7P B;  4ED1 A;  1QQ5 A;  2NTT A;  1F0M A;  1LKY A;  2EAN A;  5AK4 A;  4YVZ A;  2ZNV B;  3NOB A;  3QU5 A;  2BCQ A;  2MQJ A;  3NG0 A;  4EEW A;  3HHM A;  3B9J A;  7ICQ A;  5G2N A;  5HFY A;  3PW4 A;  3G6X A;  2W9B B;  3KW5 B;  3TFR A;  4PPX A;  5DGA A;  1HXY D;  4LJO B;  4ACF A;  3JSV B;  3C5G A;  2FCN A;  3PVX A;  4EBC A;  2PMZ C;  5ALT A;  4JPS A;  2WHE A;  2MA1 A;  3HIL A;  1WGD A;  1V38 A;  2E8P A;  2LHT A;  3F2D A;  2DYO A;  3JYU A;  2VZK D;  1ZQH A;  4I6L B;  4LK0 M;  2H3F A;  4NPN A;  1YN5 A;  5EOZ A;  3MGH A;  1A76 A;  5DG7 A;  4QZF A;  4ZRQ A;  1CZP A;  1D8L A;  4DEZ A;  4ECV A;  2ISP A;  3ZRC A;  4MEX A;  4BKT A;  3UMC A;  4WIP A;  3DHH C;  1YN4 A;  1TBE A;  1WGR A;  3BS5 B;  4ANV A;  4FFD A;  4PZN A;  1EF5 A;  4W9C A;  1BXT A;  2Z8L A;  3SFD B;  2J6U A;  1WX8 A;  2IOF K;  1ECW A;  4NJ6 A;  4F5R A;  3PRZ A;  1Q0W B;  1UZX B;  2B3A A;  3RUI B;  4JE3 B;  1WX9 A;  5J17 A;  1IGD A;  4OZB A;  3U2S C;  3RJK A;  3C19 A;  2JQR B;  2DBY A;  2LXC A;  4ED3 A;  3EA6 A;  4ANX A;  2F8L A;  4P0P A;  3QAQ A;  3OSP A;  4KZ0 A;  4MEY A;  4W9E A;  3Q8C A;  2BVC A;  1ZQA A;  2JZP A;  4L2Y A;  4O3S A;  4OVU A;  2DYM A;  4XQ8 A;  3NS1 A;  5KFE A;  2ZIX A;  2XY7 A;  1T7P A;  5KFP A;  4I2A A;  5E6O A;  4YTN B;  4TUR A;  2K8C A;  3R7R A;  1NDD A;  1YIW A;  2KN5 A;  3VUY A;  2F1H A;  3RJI A;  1ZQB A;  2GBR A;  3GB1 A;  1QSS A;  1OGW A;  1WJ4 A;  5J0Q A;  2EAO A;  4UAY A;  3VRA B;  5J0O A;  1T5X D;  1WF9 A;  2FAZ A;  2KQS A;  2R8K A;  7ICH A;  5KFI A;  2J0J A;  4BBN C;  2HBJ A;  2DL0 A;  3N97 B;  5D4B A;  2JEJ A;  2OEH A;  9ICH A;  1XF5 L;  3RR8 A;  1GC7 A;  3GIL A;  2KWV B;  4NJC A;  5HR7 A;  1COO A;  3Q8R B;  1LXD A;  1SGG A;  1I4G A;  1KFD A;  2UVR A;  4MAC A;  1I7H A;  2INN E;  4FZM A;  4C8O A;  4ANU A;  2XIC A;  3ZYY X;  4ZOH C;  8ICB A;  1SWW A;  4GLS C;  3AI5 A;  3AEA B;  1D8Y A;  4M6W B;  2KFZ A;  2N7J A;  1YOV B;  3CF6 E;  1WM2 A;  2PVG C;  4M47 A;  3FDS A;  4KVG B;  3EC8 A;  3VTV A;  3UMG A;  2WS3 B;  4O1N A;  2MP2 B;  1WXS A;  5KFZ A;  2XGQ A;  2KLC A;  1R7S A;  9ICS A;  4RM9 A;  1KRH A;  2DF4 B;  5J2G A;  3NVV A;  5L1J A;  1D9F A;  2JGA A;  2BQU A;  1WJU A;  2F76 X;  1NKB A;  4HK2 A;  3MP9 A;  5KL8 B;  2QMT A;  4GMV A;  2L32 A;  3PLV A;  3SAF A;  4DHJ D;  3QQ8 B;  1T0Q C;  2JXX A;  1WJ6 A;  3A4S C;  2JXJ A;  1OFF A;  3E2E A;  3VFK A;  3V7K A;  3KKA A;  3RFZ B;  2P66 A;  4C8M A;  7ICJ A;  3GOE A;  1N63 A;  2YQE A;  1ZP0 B;  2NPT A;  3IBE A;  4C7Y A;  1A77 A;  1JUD A;  1UA1 A;  1C77 A;  5J0S A;  7ICR A;  1R4N B;  1FO4 A;  2ZTC A;  5G5H A;  1XSP A;  2J6T A;  3PRM B;  8ICE A;  2WU5 B;  3APD A;  4ELV A;  1IP9 A;  2MAX A;  4XWT A;  2F44 A;  4F4W A;  4IKG A;  5JHA A;  2WAQ C;  4WUR A;  1CQV A;  3Q8E A;  5IA7 A;  3DHI C;  2FDR A;  1QQ7 A;  3P4P B;  1QKZ A;  4M00 A;  5AZH A;  1OQR A;  3P4S B;  4KLF A;  2KC1 A;  1SB3 C;  4LCD E;  4MH8 A;  2W9C A;  7ICT A;  1F77 A;  3O13 A;  1ZOL A;  2G06 A;  3AE8 B;  1VJ5 A;  1S0M A;  4J9R A;  3X23 A;  4QZI A;  2O2V A;  5ALF A;  4C4T A;  1TAU A;  4I2E A;  2V3P A;  3ZDM C;  2XC9 A;  5CA7 A;  2ZUB A;  1ZQP A;  1D9D A;  3SU8 X;  2EZX A;  3BZD B;  1SWV A;  2BDU A;  4HRO A;  3NJT A;  1X9X A;  3PHX B;  2FID A;  3RPF C;  2KO3 A;  4RMA A;  5F9L A;  4Q43 A;  2VA3 A;  3PO0 A;  3L17 A;  2WF8 A;  2LGS A;  5DB7 A;  1YX6 B;  1PDX A;  2RPV A;  3M8R A;  2K8H A;  3UQ0 A;  4KN7 A;  4ACO A;  1VDV A;  5CEH A;  2WDT B;  5HHI A;  3E0F A;  2I6X A;  8ICH A;  2L52 A;  3NRW A;  4JWU C;  1H4R A;  4USA A;  5K4L A;  4UB2 A;  1JW9 D;  1P1A A;  1VCB A;  1FPY A;  2IA6 A;  1P7F A;  3GDX A;  2PKO A;  3KHG A;  4LNN A;  4PGY A;  2RDB C;  3BVM A;  1FXT B;  1T94 A;  3MC0 B;  5L9X A;  4U7C A;  1J7A A;  3QEB Z;  4BKS A;  5CR0 A;  2BWE S;  3DBH I;  3BY4 B;  2A5U A;  5AKJ A;  4NY0 A;  1K51 A;  3AV8 A;  1FNU A;  5J2K A;  4QW8 A;  3MBY A;  4IWO A;  2MBO A;  4RM8 A;  4NWI A;  2JUO A;  5AIA A;  1KLV A;  3Q8L A;  3KKA C;  1E5W A;  3WK8 A;  2BCS A;  1UHU A;  1EM7 A;  4B0M A;  4RF1 A;  1CI4 A;  5AKZ A;  4UB1 A;  1TY2 A;  2WXO A;  1OW5 A;  2W9C B;  1LO5 D;  5AI8 A;  1ROE A;  4FXC A;  1AQ6 A;  4DSK A;  4MSM B;  3FKY A;  2W7O A;  5HG2 A;  3Q8P B;  4MFF A;  2ZUD A;  4NLZ A;  4EKU A;  4YXD B;  1D5M C;  2K60 A;  5CHW A;  4ECT A;  2K1F A;  4RH6 A;  1TYG B;  5IIL A;  1ZUD 2;  2J53 A;  2KJH B;  3ALB A;  4A6Q A;  1KEJ A;  3UQA A;  4CF4 A;  3BQ1 A;  5KFR A;  3AMZ A;  1J97 A;  2N7E A;  4KMU A;  2WF9 A;  2Y5P A;  4EYH B;  4FJV B;  8ICF A;  3MFH A;  1OQY A;  3KTQ A;  5KT7 A;  2VIX A;  1RWS A;  2AXT U;  4AS1 A;  2FPM A;  2KJ9 A;  2KC2 A;  3VCB A;  1GAQ B;  2KZM A;  2IO2 B;  1IYF A;  1PFD A;  8ICA A;  3SD7 A;  4F92 B;  2J7Q B;  1T3Q A;  2H3Q A;  2CJO A;  3J9C A;  4O9M A;  1UGJ A;  3DPD A;  5J18 A;  3P42 A;  1XO0 A;  2KFK A;  1JXE A;  4IDI A;  3W2D A;  4FZN A;  1J19 A;  2DAF A;  1UA0 A;  1L3T A;  5JU5 A;  2KFN A;  4HRS A;  3GV5 B;  4YD1 A;  4ECU A;  2TSS A;  4LNO A;  1XLP A;  3L08 A;  2JZB A;  1MFW A;  4K7U A;  5T8I A;  1CEZ A;  4YMM A;  4UB5 A;  2MBE A;  5AK5 A;  1C3T A;  5D6J B;  2FMP A;  2DWQ A;  1GG3 A;  3ZNH B;  2D3G A;  2KXJ A;  2KMA A;  1UCV A;  5LXI B;  2HD5 B;  3DHG C;  1HEZ E;  3BQ0 A;  4DL4 A;  2PI5 A;  1HZ6 A;  5KTQ A;  3ZO5 B;  5KFB A;  4O0I A;  2IO1 B;  4NAW A;  2MJ3 A;  4JWS C;  1ZQZ A;  3TEY A;  4YR2 A;  1WWT A;  1HTQ A;  1JWB D;  3TAC B;  1V5O A;  4LZD A;  2KP7 A;  2ZJA A;  5J0P A;  3WKA A;  2KJ6 A;  1JRU A;  2LAS A;  4F8R A;  3KZI U;  4JK1 A;  9ICL A;  3Q8A A;  4PJ0 U;  2KZZ A;  1ZRM A;  3SR6 A;  1NJX A;  3MR5 A;  2XK5 B;  3H8J A;  3RCZ A;  5JXV A;  1J7B A;  1AN8 A;  4AQ7 A;  2NCN A;  2N7D A;  4DXA B;  5AIB A;  4PHP A;  1N6Z A;  2ISO A;  1PZN A;  2LGX A;  2E1F A;  2M0X A;  1KFT A;  2AQ1 B;  4MGY E;  4BUG A;  3RB4 A;  3Q8S B;  3FYH A;  4P1B C;  3C1Z A;  5KFV A;  4ELT A;  1Y56 A;  2Q0Z X;  2V9W A;  4Q8F A;  9ICP A;  1SL1 A;  1ZQM A;  2ZTD A;  1S97 A;  3NS8 A;  1WXM A;  3GIM A;  4EEN A;  1L8O A;  2IY1 B;  3D2N A;  4KLD A;  3TIX A;  1C4A A;  2JZZ A;  2JRH A;  3UQ2 A;  2W43 A;  5FK9 C;  5L1I A;  1PVR A;  4KLS A;  2D07 B;  1QOA A;  3L13 A;  1ZD3 A;  3O65 B;  4WWN A;  1X1M A;  2NBU A;  2FPL A;  5BMH A;  3ZXR A;  4GXJ A;  2HDO A;  1COK A;  2XY5 A;  2INP E;  4W9L A;  2EH9 A;  3ZNI D;  2XCA A;  4TUU A;  5D49 A;  4PK1 A;  2F8K A;  5AM4 A;  1OTR B;  4UQG A;  3TAR A;  5KNI A;  4AWJ A;  1RYJ A;  3ZDT A;  4FAD A;  3UI3 A;  3I5J C;  1SBB B;  2BQR A;  3R66 C;  5AZF A;  3HVD A;  1FNW A;  5KFK A;  1WXA A;  4K3B A;  1UWX A;  4F5P A;  2C7M B;  1WCN A;  2GBM A;  1RRB A;  4C4R A;  3TEZ A;  1YX5 B;  1C7Y A;  3SMV A;  1S0O A;  2XEW A;  2QB0 B;  5AI0 A;  2G45 B;  3S2A A;  1TKE A;  5KAF U;  3PW2 A;  3MHS D;  1ZQI A;  3QJZ A;  2WXF A;  1MG8 A;  1N61 A;  5EWG A;  2P6U A;  3BYT B;  3HVZ A;  1ET6 A;  5DPT A;  3X0W A;  2EMT A;  5KT2 A;  1QH9 A;  2DLB A;  3HM6 X;  3NTU A;  3ED5 A;  4A8E A;  1N60 A;  5CWR A;  2PI4 A;  2L0F A;  4HEA 1;  5ALJ A;  4IRC A;  4DOB A;  4RQ5 A;  2DKZ A;  2FE9 A;  3AE6 B;  4R66 A;  4N59 A;  5DKW A;  2VH2 A;  3A9K A;  4DDI D;  4W9K A;  1ZQR A;  2UU7 A;  2KV2 A;  3CNH A;  2F3N A;  2F77 X;  2LI6 A;  1SL0 A;  1ZQC A;  1KQQ A;  3ISB A;  3T3F A;  2G4S A;  1P7E A;  1Q3V A;  1TKY A;  1LKY B;  3F5A A;  4J9P A;  3MHZ A;  2FE8 A;  3PHW B;  7ICO A;  2HHQ A;  2DQN B;  3UMB A;  2IGH A;  2Y5C A;  2VJ5 A;  4PGQ A;  3KWL A;  3NUH B;  2BTE A;  1SF0 A;  1K52 A;  1UEL A;  1A70 A;  1X6J A;  3QYP A;  3PLU A;  1MN8 A;  2PEA A;  4C4S A;  3ZTD A;  2L83 A;  2N9L A;  3AUL A;  2MBH A;  3LXF A;  3ZJV A;  1B22 A;  5AI9 A;  4AYB C;  5DBB A;  3AQF A;  4UBC A;  1ZD5 A;  5KT5 A;  4A9A A;  2GBJ A;  1NJY A;  2KWC A;  3Q3F A;  1TS3 A;  3HJE A;  5ALW A;  2CJN A;  8ICK A;  2KZR A;  4O3Q A;  3T5J A;  1O08 A;  3C5F A;  3ZDC A;  1FEZ A;  4RNN A;  4UBB A;  1VZ6 A;  1UGM A;  4DF4 A;  1QCK A;  3ZDD A;  1DK2 A;  5GMV A;  1MHX A;  4DHZ E;  3GV7 B;  3IDW A;  5DQG A;  2OM6 A;  1NKE A;  4KV2 A;  2HHV A;  2ZVO A;  1V1P B;  4C00 A;  2W3R A;  4B0E A;  2AU0 A;  2AQ3 B;  3OWE B;  1Y88 A;  5F3X B;  1NEN B;  2SEB D;  4Q8E A;  2LJ5 A;  2G3Q B;  2KWD A;  4WJ3 B;  3ENE A;  2HE7 A;  1V8C A;  3NY5 A;  2WAQ F;  3MDC A;  4BJQ A;  4DCC A;  1E0Z A;  1ZD4 A;  3NZ3 A;  2N0S B;  2BW2 A;  1Q3U A;  3M7D A;  4UB3 A;  4KLU A;  2NBV B;  1LQB A;  4F2R A;  2LRU A;  5KHQ A;  4O5C A;  2BPG A;  1Z4O A;  2R2Q A;  3HWT A;  2MHJ A;  3T8M A;  4AYB F;  5DPW A;  3JW0 X;  2V0G A;  2JZB B;  3V7J A;  4KLT A;  4OVV A;  5AUI A;  2DUY A;  1WCL A;  3CWI A;  1QIL A;  2V4L A;  2KOB A;  3N1X C;  3DBR I;  1TFR A;  2FI1 A;  4F4Z A;  3SI8 A;  2IHM A;  5CHG A;  2AGO A;  1I4H A;  1DOX A;  2G09 A;  3K75 D;  3M8S A;  3WKC A;  1E6E B;  4ZRI A;  2WLB A;  4PT5 A;  2I1Q A;  3M9O B;  2CRX A;  4F3O A;  9ICX A;  5ALK A;  5ALM A;  4QW9 A;  5DG9 A;  1HE8 A;  2EAM A;  4NLK A;  1U48 A;  1NK6 A;  2LMR A;  4YG2 A;  3PV1 A;  2WNM A;  5D3D A;  4KKJ A;  2BKF A;  7ICV A;  1ZQL A;  2ZXI A;  4RUC A;  3NHE B;  5E79 U;  2OH2 A;  3G6V A;  2WTF A;  9ICJ A;  3Q8Q B;  4M01 A;  4PL1 A;  3AEC B;  2AGP A;  2A4Z A;  1RLF A;  2GI9 A;  3HT3 A;  3MGV A;  5FR6 A;  3BVZ A;  4D2K A;  2LBO A;  5AKX A;  2OJW A;  2K4H A;  1V1P A;  3AU5 A;  1U4B A;  3ZLZ A;  2FCM A;  1DRG A;  4O5E A;  4B9T A;  5D7G A;  1BNO A;  1V1O A;  3JPQ A;  4JB3 A;  4YSZ B;  1IIP A;  3A1Q A;  2M0A A;  2KTQ A;  4K4H A;  1EU3 A;  2OCE A;  1Q46 A;  3PRP B;  5GTH U;  4YL8 A;  3BZC A;  1ZQK A;  5TSS A;  1QOB A;  2KTR B;  4ITK A;  1UBI A;  4KDI C;  2BPS A;  1UUP A;  3U26 A;  4WQM A;  3F53 A;  5IIK A;  4B9L A;  2FCQ A;  5J2D A;  4DL6 A;  4R63 A;  9ICA A;  2OOB B;  2F2A B;  2PLP A;  5HMM A;  5IIN A;  4KX6 B;  5J0U A;  4RGT A;  1YZ6 A;  3PX0 A;  3LJ3 A;  4ZRJ A;  1F0Z A;  1GB1 A;  4WQO B;  2HVI A;  2KJR A;  2QAR B;  8ICO A;  2BGW A;  2KQ7 A;  2EQY A;  4AP9 A;  3Q2A C;  3DBL B;  1WZ0 A;  4DQR A;  1RQL A;  2ON8 A;  4ED6 A;  2D5G A;  3THV A;  2C2E A;  2EMS A;  2DZM A;  4P6V F;  3WK7 A;  1F2R C;  3PZD A;  3QAR A;  4M8M A;  2JV3 A;  2AH5 A;  3GIJ A;  3ZTC A;  3V6H A;  2KTR A;  4DFK A;  3BK1 A;  3U7Z A;  4DHZ B;  2PE6 B;  2QJL A;  4MM3 B;  1B43 A;  2E5S A;  1FCC C;  1S76 D;  2RPQ A;  4DSJ A;  2A1A A;  3SEN A;  1WH3 A;  1S0V A;  2RQ5 A;  3PW0 A;  2FBW B;  2NR2 A;  3TCA A;  1JWS D;  8ICJ A;  1FRD A;  3IAM 1;  2G0A A;  2KE7 A;  2UVW A;  4WWO A;  3VUX A;  2JEI A;  1WM3 A;  4GDL A;  4ASW C;  2KG5 A;  3DDC B;  2G9H D;  2V3S A;  2K0P A;  2LFI A;  3TAN A;  4UAU A;  3AEB B;  1SZP A;  5KL1 B;  1S10 A;  1E8X A;  2MUT A;  4RU9 A;  5T14 A;  9ICT A;  1F52 A;  3UIP B;  5KFJ A;  2RRD A;  3H8W A;  2W9A A;  1LGR A;  1SSN A;  2WXQ A;  1WR1 A;  2ZEQ A;  3GFK B;  5TR5 A;  4B9S A;  1OQQ A;  4A90 A;  3SEI A;  5IP4 D;  4B6W A;  4R65 A;  2ZCB A;  4HLE A;  2PMZ F;  2DPJ A;  3L54 A;  4BDP A;  1L3U A;  1SE3 A;  3Q8F A;  4YTM B;  5DBC A;  4QZD A;  1MQ2 A;  3BJY A;  1X66 A;  4NY8 A;  1WRD B;  2BF8 B;  1URJ A;  4P2H A;  5HML A;  4PL2 A;  2KEY A;  1FM0 D;  2Z59 B;  2N1V A;  4GDK B;  1L0X B;  4J9K A;  4TMA B;  5AI6 A;  5CJ7 A;  1ISN A;  4HWI B;  7ICE A;  1I35 A;  1DOY A;  2ES6 A;  3RZW C;  3PT2 B;  5EE3 A;  4HJG E;  1BT0 A;  4OHJ A;  4IUM B;  5CHF A;  1IG6 A;  2K4E A;  3QX7 A;  4QZH A;  1LV5 A;  4OO1 J;  5AM3 A;  3U4E G;  2NV3 A;  3RRH A;  5J0W A;  4PHA A;  4KLO A;  3TI0 A;  1DXS A;  4FHK A;  2DZI A;  3QC8 B;  5J2E A;  8ICX A;  3SAH A;  4R8U A;  2I9G A;  3AEV A;  2VJ4 A;  1XT9 B;  3CMM B;  5BO4 B;  4DK5 A;  1H38 A;  2KMC A;  2MP2 A;  4BVU C;  1L7O A;  5KT6 A;  5IIO A;  2M17 A;  1KTK A;  2KHV A;  2EKE C;  3DWM A;  4NV0 A;  3GE8 C;  1KOT A;  1L8L A;  4Z6E A;  2KN7 A;  2RHF A;  1L5U A;  2QEJ C;  5DPR A;  3H7I A;  2K6D B;  4DQS A;  3ZNG C;  4BX9 C;  1HIW A;  3G6Y A;  3AE4 B;  5KFW A;  4ECW A;  1T0Y A;  1EU4 A;  2XO7 A;  4ICU A;  4WAF A;  2Y0S C;  3ECI A;  4ICV A;  5AM1 A;  1ED1 A;  3RI7 C;  2LM4 A;  4TQS A;  1UPH A;  9ICW A;  2CS4 A;  2WX0 A;  4OJ6 A;  2JRI B;  1KSP A;  2YLM A;  9ICR A;  4CQN A;  4S0R A;  4E3C A;  4YXM A;  3LK9 A;  2KN4 A;  9ICN A;  1WX7 A;  5KFD A;  2H3V A;  3WKD A;  1TK5 A;  2AQ2 B;  3OJU A;  3ZD8 A;  4NXZ A;  5J2R A;  1PK1 B;  1RFA A;  3FIL A;  4MJS A;  1UT8 A;  3C28 A;  3RZF A;  3GZF A;  5KFL A;  2DEN B;  4E71 A;  1XS9 D;  1Y8R C;  4I2I A;  3RUL A;  4GIV A;  1S9F A;  1RAX A;  2HOI A;  4K3C A;  4L1B A;  4O5K A;  1BPZ A;  1K1S A;  1YT3 A;  1BGX T;  4NM1 A;  1N48 A;  4YT0 B;  3QUB A;  1PGB A;  3K9P B;  3R8B A;  2KVS A;  4O3N A;  4J9O A;  5ALV A;  1TKG A;  5BOM A;  3KVF B;  2KHW B;  3QNM A;  5BYR A;  2D3D A;  3L5K A;  4YCX A;  2W03 A;  4F2S A;  4EZ6 A;  1Z5S B;  2DNF A;  3QA8 A;  4TV3 A;  2JEG A;  3DDH A;  3V62 A;  5ALH A;  2H88 B;  3KHR A;  1RDF A;  2BS2 B;  5D94 A;  4YWG G;  1G6J A;  1V81 A;  1AYF A;  3I3T B;  3N20 C;  2KSO A;  4TQ1 A;  4C7Z A;  3C1Y A;  3AU2 A;  3BS7 A;  5AK3 A;  2LMC A;  1XC9 A;  3UF8 A;  3HKZ F;  4UAZ A;  2R8G A;  2V9H A;  3VVW B;  1EXN A;  3ZDA A;  4TKN A;  4BAX A;  4F91 B;  1SXD A;  1BML C;  1ZOY B;  2MBQ A;  3ZQ4 A;  3QHT A;  1D5X C;  2F1I A;  3C0R B;  4DLE A;  3N32 A;  1E7P B;  4Z6F A;  1YD8 U;  2WFA A;  1L3V A;  3QU2 A;  1A0P A;  2QDF A;  3WKE A;  4LDT D;  2BR0 A;  4W9D A;  3KBB A;  3RD2 A;  2B76 B;  4RQ6 A;  3RNG C;  4W9F A;  5KFU A;  4GC6 A;  1HQR D;  3L3F X;  1QLB B;  3TL5 A;  1KKX A;  5IIM A;  3ALR A;  3KUD B;  4DXF A;  4KMO B;  3FM9 A;  3DWG C;  5FP0 A;  1SZH A;  4NL9 C;  3WKB A;  3WK9 A;  1JWA D;  2W55 A;  2RR9 A;  3M62 B;  3VH3 B;  2HOF A;  3H8M A;  5JH5 C;  4Y2J A;  2AHO B;  4W9I A;  4GB9 A;  1DGS A;  4ICA A;  2V4Q A;  2KX3 A;  2L3Z A;  2R18 A;  2H89 B;  1C4C A;  3JPO A;  3MJ5 A;  5AKK A;  3M6K A;  2KTF A;  4F5O A;  1OEY J;  5DQH A;  5J2J A;  2JYE A;  1TS2 A;  1XXG A;  2KIC A;  3Q3J A;  4GFJ A;  4M9J A;  3OTQ A;  1C76 A;  1KN5 A;  1SKS A;  1TT5 B;  2WXI A;  1CMX B;  3CP8 A;  1QF6 A;  3T79 A;  3J81 j;  3DQV A;  4GC7 A;  4TUQ A;  3RR7 A;  1MJD A;  4YR3 A;  4Z6D A;  3KUC B;  1MC8 A;  4P16 A;  4ECS A;  3TAQ A;  1D8B A;  4UAS A;  4DS5 A;  4PYZ A;  4RZR A;  2VA2 A;  4TSS A;  5LNK 1;  3IT4 B;  3B2G A;  1ZQ1 C;  2OYY A;  3C29 A;  1IUE A;  3OPX A;  4K4G A;  4LVS A;  2WYQ A;  4RT2 A;  2WXH A;  1FFV A;  2EAP A;  3MJW A;  1ZXH A;  3PVL A;  1V85 A;  4YD2 A;  2W54 A;  1WJN A;  2L7R A;  1ZDV A;  4HKZ E;  2ZG6 A;  3CW2 C;  3CYM A;  4J9Q A;  4PZO A;  5C0Y A;  4KX3 A;  1HZ5 A;  1A5R A;  1RFK A;  2AJQ A;  4HDQ A;  4YSX B;  4RT3 A;  4FJY A;  2PIA A;  2O2V B;  4RCO A;  3L10 B;  2JU6 X;  4AP4 C;  2WF5 A;  4Q44 A;  5AUK A;  1EF1 A;  2BQQ A;  2XN9 C;  5AZG A;  2KAC A;  4AUQ C;  1WG8 A;  2ASJ A;  1RYU A;  2LYA A;  2BCR A;  2KX0 A;  1P98 A;  4DS4 A;  3RJE A;  1Z00 B;  3WK5 A;  2GOW A;  3PY8 A;  4IC7 B;  2PVO D;  3AU4 A;  1C9F A;  2AYO B;  1TJE A;  2E1E A;  4YXJ A;  3OHA A;  1C20 A;  1JWU D;  1ZQQ A;  1CUK A;  8ICW A;  2D6F C;  4KSK C;  3U7D A;  3V60 A;  1R4M B;  5ALG A;  4QWA A;  3LB8 C;  1NKC A;  2IJ0 A;  3K9O B;  1JN3 A;  1Q1O A;  5DB9 A;  3JPS A;  4REZ A;  1WXQ A;  1IV8 A;  2CR5 A;  4OCZ A;  5ALP A;  2HW3 A;  3H0L B;  2A19 A;  3RFA A;  1PYW D;  2KKV A;  3L4P A;  4RQ7 A;  2WF7 A;  4FLH A;  4UB4 A;  2W8K A;  2D11 A;  1SKR A;  2NBW B;  2R2O A;  1ZET A;  1T4G A;  4RNO A;  2G07 A;  1YJ1 A;  2D10 A;  3HKZ C;  4YR0 A;  1WZ3 A;  3BQT A;  1XCT L;  2WDQ B;  4DWF A;  1ZQY A;  1KF6 B;  1Q5W B;  2K8B A;  4I6N B;  4QJF B;  4DSL A;  2YMP A;  1WE6 A;  2N1R A;  3VDZ A;  4RPX A;  3DV9 A;  4ANW A;  4DL3 A;  3E9S A;  2BS4 B;  1KH0 A;  5C2T B;  1NVI D;  2LGI A;  1TAQ A;  3JPR A;  4OJO A;  2IGD A;  4JV2 A;  2C60 A;  4J9S A;  2FLL A;  1RYS A;  3M63 B;  4XUS A;  3UIN B;  4DFP A;  4E74 A;  2J6S A;  5JUM A;  3ABV B;  5EDS A;  3C2K A;  2J0M A;  3AE1 B;  4F8C B;  2KKC A;  2WXL A;  2A1J B;  4M9N A;  1R4M I;  5AM5 A;  4KGT A;  3IHQ B;  4KKI A;  3QU9 A;  5ALO A;  1JX4 A;  3UXN A;  4YSY B;  2NRT A;  1F44 A;  5AK6 A;  4HXD A;  1WWV A;  3W1S A;  4M6W A;  3EWA A;  1UH6 A;  2YTU A;  8ICI A;  2M19 A;  2VH1 A;  4E0D A;  4IOI E;  2G4D B;  2YN4 A;  1L6V A;  2MWS B;  1L4D B;  3BK2 A;  4OZC A;  5C23 A;  2RSU A;  3KH0 A;  5KG1 A;  1NJW A;  3W5V B;  4CNQ A;  4KX5 A;  5L1L A;  3PPA A;  2L05 A;  1I4R A;  5KFN A;  4KLJ A;  1TIF A;  3T5H A;  4IL6 U;  3LVV A;  8ICM A;  2YMQ A;  4I2B A;  4WJP A;  2NRZ A;  3BDP A;  2ZW1 A;  2ZJ8 A;  2XI9 A;  1K50 A;  1WSP A;  5KFY A;  4EEL A;  2BCV A;  4FJZ A;  4AJW A;  1R4N I;  2BZF A;  1PGX A;  1XLQ A;  3H6N A;  4KLE A;  2RDG A;  4MT5 A;  4M8N A;  3L16 A;  2DZK A;  2JF5 A;  3L0W B;  4M04 A;  4CF5 A;  1WGY A;  4GXI A;  3M95 A;  2J42 A;  5D2M B;  3HX0 A;  9ICB A;  3NZS A;  1L7Y A;  5C3J B;  2NRV A;  3WA0 A;  1WE7 A;  3D2S A;  5AKL A;  5LXH A;  3RRG A;  8ICL A;  3BWU D;  4W9G A;  3E58 A;  3WAM A;  3RNC C;  4QZE A;  4JIO U;  3EYZ A;  1QSL A;  3TAD C;  3JPT A; 
#chains in the Genus database with same CATH homology
 3W5U B;  2KWD A;  1UNS A;  2W3S A;  1V8C A;  1CK1 A;  1ESF A;  3AE9 B;  2J52 A;  2NTT A;  1VZ7 A;  1E0Z A;  1FEH A;  3NZ3 A;  3U52 E;  3B9J A;  2BW2 A;  2N0S B;  3AE3 B;  5FKA C;  1MHH E;  1VJK A;  5HFY A;  2JWU A;  4DXG A;  3KQ4 A;  2N9K A;  2WU2 B;  4RGM A;  3ZGZ A;  3AE7 B;  1HXY D;  4NAW B;  2V0G A;  2ONQ A;  1XEE A;  5AUI A;  3VQI A;  1C4P A;  4JPS A;  3TUO A;  3CWI A;  1QIL A;  2DYO A;  2VZK D;  4LK0 M;  4OZA A;  1DOX A;  1I4H A;  1YN5 A;  1E6E B;  1DYQ A;  2KMM A;  2WLB A;  4PT5 A;  2GRI A;  4ZRQ A;  1CZP A;  1FRR A;  2NMQ A;  4ARI A;  2BBC A;  2BB5 A;  4WIP A;  1YN4 A;  3R2T A;  4XE0 A;  3VR9 B;  1JAL A;  1BXT A;  2Z8L A;  3SFD B;  2K5P A;  3PZ7 A;  2MJE A;  2MJD A;  1YJJ A;  2WNM A;  3AED B;  5D3D A;  1IBX B;  4KKJ A;  1FMA D;  4JE3 B;  1SJH D;  1L4Z B;  1B9R A;  1IGD A;  4OZB A;  3U2S C;  3VRB B;  2JQR B;  5HHD G;  2DBY A;  3EA6 A;  3EUB 2;  3AEC B;  3URY A;  3AB5 A;  3Q8B A;  2GI9 A;  2WXJ A;  3Q8C A;  3MFG A;  4GDL B;  2JZP A;  4L2Y A;  3BVZ A;  4D2K A;  1AW7 A;  2DYM A;  3NVY A;  2NTS A;  2XNA C;  1V1P A;  3NS1 A;  2K22 A;  2I2Y A;  3T3O A;  1MI0 A;  5D7G A;  1XLN A;  4YTN B;  1V1O A;  4R3D A;  1QOF A;  4YSZ B;  1E9M A;  1STE A;  3GB1 A;  2M0A A;  2SAK A;  1EU3 A;  3VRA B;  2IGG A;  1T5X D;  5TSS A;  1YNT E;  5BMG A;  3NVZ A;  1E10 A;  1D5Z C;  1QOB A;  3I9V 1;  1WYG A;  4ITK A;  1YJI A;  1XF5 L;  1L5P A;  1UUP A;  2OED A;  4WQM A;  2K3U A;  4NJC A;  2PLP A;  1I4G A;  4MAC A;  1I7H A;  1TZO A;  2INN E;  2OHF A;  4KX6 B;  4RGT A;  1F0Z A;  1GB1 A;  1B1Z A;  3ZYY X;  4ZOH C;  4GLS C;  3CIR B;  1TS4 A;  3AEA B;  1JCK B;  1GB4 A;  3NVW A;  2ON8 A;  2N7J A;  2D5G A;  2HDE A;  4L23 A;  4P6V F;  2LHD A;  1F2R C;  1YMH E;  2PVG C;  2WP9 B;  2WS3 B;  3BK1 A;  4O1N A;  5D3I B;  5BYQ A;  2WXR A;  3U7Z A;  2QJL A;  4MM3 B;  4UDU C;  2IDY A;  2JSV X;  1FCC C;  3TEX A;  4RGN A;  4C80 A;  4NAM A;  1R7S A;  2FBW B;  4KGS A;  1C79 A;  1JWS D;  5EE1 A;  1KRH A;  1FRD A;  2M56 B;  3IAM 1;  3NVV A;  4LLG M;  2MH7 A;  3MP9 A;  3P4Q B;  2G9H D;  1IGC A;  2K0P A;  2L32 A;  2LFI A;  2QMT A;  2WQY B;  3AEB B;  4RNA A;  3ZJT A;  2WXQ A;  1SSN A;  4OW0 A;  4A90 A;  1L0V B;  1OFF A;  1M4V A;  1OQQ A;  3RFZ B;  2KAJ A;  2V4I B;  1I4Q A;  1SE3 A;  3Q8F A;  1N63 A;  5BYS A;  1IBX A;  1ZP0 B;  2LUM A;  4YTM B;  4C7Y A;  3W9C B;  1C77 A;  1FO4 A;  1JRO A;  5G5H A;  1FXI A;  1FM0 D;  1QQR A;  4GDK B;  1DGJ A;  4TMA B;  1L0X B;  1EWC A;  2WU5 B;  1L6U A;  1CJE A;  4XWT A;  2R61 A;  4IKG A;  1DOY A;  4OHJ A;  4HJG E;  1SE4 A;  5EE3 A;  4DQO C;  5EE9 A;  1FFU A;  1SXT A;  1YQ3 B;  4WUR A;  1CQV A;  3Q8E A;  3P4P B;  1QKZ A;  2WDR B;  1QOG A;  1OQR A;  3P4S B;  1ENF A;  2WXG A;  1SB3 C;  3U4E G;  4MH8 A;  1F77 A;  3O13 A;  3AE8 B;  3AM9 A;  3DWM A;  1KTK A;  1VRA B;  2V3P A;  2JXT A;  1ZXI A;  3BZD B;  2WXP A;  4HRO A;  2QEJ C;  1KFY B;  3PZ8 A;  2EKI A;  4WH4 A;  1JML A;  3AE4 B;  3RPF C;  1EU4 A;  3FIL B;  3PO0 A;  4WAF A;  2W82 A;  5BMI A;  1PDX A;  3I57 A;  2RPV A;  1VDV A;  1V97 A;  4CQN A;  2ACZ B;  2L52 A;  2KN4 A;  4JWU C;  2AQ2 B;  4USA A;  4C56 C;  1JW9 D;  2E3T A;  5I4D A;  3AEF B;  1P7F A;  3FIL A;  2PKO A;  3BVM A;  2WXN A;  3MC0 B;  3ZJU A;  1J7A A;  3R2I A;  4L1B A;  4J3O D;  1K51 A;  3AV8 A;  1FNU A;  1NYQ A;  4YT0 B;  1PGB A;  3R8B A;  2Q5W D;  1D6E C;  1TKG A;  2LJI A;  4HKQ A;  4YTP B;  2RDH A;  5BYR A;  1ET9 A;  2JX5 A;  1BUI C;  2PW9 A;  1K53 A;  3KLS X;  1PUT A;  1EM7 A;  4B0M A;  4ZRP A;  4RF1 A;  2L1A A;  1TY2 A;  2WXO A;  3GP7 A;  1TS5 A;  1LO5 D;  2H88 B;  2BS2 B;  1ROE A;  4FXC A;  4YWG G;  1AYF A;  5HG2 A;  1FNV A;  3Q69 A;  4TQ1 A;  4C7Z A;  3KWV A;  4YXD B;  1D5M C;  2LMC A;  1FIQ A;  4RH6 A;  4XDD A;  1TYG B;  2J53 A;  1XO3 A;  1ZUD 2;  2PTL A;  4A6Q A;  3SEB A;  3V05 A;  3TEW A;  1BML C;  3AMZ A;  4NZL B;  4US9 A;  2AX5 A;  2BT6 A;  1ZOY B;  2Y5P A;  3VR8 B;  3ZQ4 A;  1L0Y B;  1ZE3 D;  1D5X C;  2RMM A;  1E7P B;  1RWS A;  3P4R B;  2YEP F;  4AS1 A;  1GAQ B;  1PFD A;  2QIL A;  3J9C A;  3AEG B;  1T3Q A;  2B76 B;  2CJO A;  3AE5 B;  4XDC A;  1UGJ A;  1HQR D;  1QLB B;  3P42 A;  4IDI A;  3W2D A;  4DXF A;  1TY0 A;  2X38 A;  1ZPS A;  3DWG C;  4HRS A;  2GB1 A;  2TSS A;  1JWA D;  1XLP A;  5T8I A;  2W55 A;  2ICI A;  4JX1 C;  2DWQ A;  4LTU A;  1QT9 A;  4EE2 A;  2I38 A;  1HEZ E;  3B2F A;  1HZ6 A;  1SE2 A;  2H89 B;  1C4C A;  1SEB D;  3MJ5 A;  1GPX A;  2MJ3 A;  4JWS C;  3TSS A;  3EGR A;  3TEY A;  2JYE A;  1ACC A;  1TS2 A;  3IAS 1;  1WWT A;  1JWB D;  4RGO S;  1XXG A;  5MPO A;  1MVK A;  1EWY C;  1C76 A;  2WXI A;  3Q8A A;  1QF6 A;  3SR6 A;  2K9X A;  4P16 A;  5FR3 A;  2QSD A;  1DOI A;  3FC4 A;  5JXV A;  1J7B A;  1AN8 A;  4AQ7 A;  4TSS A;  5LNK 1;  1SIJ A;  1C78 A;  3H8H A;  3SFE B;  2BYT A;  2FUG 1;  3IT4 B;  3B2G A;  1IUE A;  2WXH A;  1FFV A;  2AQ1 B;  1ZXH A;  1HA5 A;  2W54 A;  1Y56 A;  3AN1 A;  4WWM A;  1ZDV A;  1KLU D;  5GXG B;  4HKZ E;  4ARC A;  4OVZ A;  4N6E B;  2BB6 A;  1HZ5 A;  1RFK A;  2J4X A;  4YSX B;  2PIA A;  5HI1 A;  1C4A A;  4RCO A;  1ZDX A;  2JU6 X;  2G1E A;  2ZW0 A;  3AH7 A;  1FD6 A;  5AUK A;  2XN9 C;  5EE0 A;  5FK9 C;  1QOA A;  3IXS A;  2KAC A;  2KQ4 X;  3GS2 A;  5BMH A;  2MEK A;  3V3X A;  2INP E;  3BVG A;  1VLB A;  3P1M A;  2WDV B;  2PVO D;  1C9F A;  1TJE A;  2WXM A;  2E6X A;  1JWU D;  1RYJ A;  2EEL A;  2KDM A;  1D4B A;  3LB8 C;  3UI3 A;  1SBB B;  2IJ0 A;  1XCQ L;  2LEK A;  1FNW A;  3FAH A;  1WRI A;  3HVD A;  1UWX A;  4REZ A;  3HUI A;  1WXQ A;  4US8 A;  1NYR A;  1RM6 C;  2LHE A;  3TEZ A;  3NRZ A;  2V3N A;  1PYW D;  3L4P A;  1I4P A;  3N9Y C;  1FCL A;  1TKE A;  1YQ4 B;  1N5W A;  4XWW A;  2WXF A;  1N61 A;  4M0W A;  3T3N A;  2SEB D;  1XCT L;  2QIE B;  2WDQ B;  3BYT B;  1ET6 A;  1KF6 B;  3HVZ A;  4ZHO A;  3HRD D;  2DLB A;  1GOZ A;  1N60 A;  4A55 A;  3E9S A;  2BS4 B;  4HEA 1;  1KH0 A;  4RF0 A;  5E6J A;  5C2T B;  1NVI D;  2LGI A;  1XLO A;  5H92 C;  1PGA A;  3BYY B;  4KGR A;  1YN3 A;  1N5X A;  3AE6 B;  4N59 A;  2IGD A;  1VR9 A;  4H2A A;  3LYY A;  1J7C A;  2BS3 B;  3ABV B;  3AE1 B;  2WXL A;  4RFB A;  4KGT A;  4Q2J A;  3AE2 B;  4KKI A;  1F2R I;  1JWM D;  2IPK D;  4YSY B;  1MPE A;  1P7E A;  1TKY A;  3P63 A;  3MHZ A;  3W1S A;  1Q10 A;  2FE8 A;  1T6B X;  2PMV A;  1WGK A;  2M19 A;  2IGH A;  2VZK B;  2Y5C A;  4IOI E;  3KWL A;  3NUH B;  1L6V A;  2BTE A;  1L4D B;  3BK2 A;  4OZC A;  1SF0 A;  1K52 A;  1A70 A;  3W5V B;  2Y3A A;  4ZHP A;  1I4R A;  3E56 A;  2L83 A;  2N9L A;  3LXF A;  3ZJV A;  2YEP B;  1SJE D;  3BII D;  1N62 A;  2ZW1 A;  4A9A A;  1K50 A;  1TS3 A;  1WSP A;  2CJN A;  5G5G A;  2WXK A;  1VZ8 A;  3C8Y A;  1PGX A;  1XLQ A;  1KLG D;  2RDG A;  1VZ6 A;  4MT5 A;  4N58 A;  5H8Y E;  4TQ0 A;  2J42 A;  1MHX A;  3ETR A;  5C3J B;  2HTM E;  1JRP A;  2CU3 A;  1JQ4 A;  2JYT A;  3BWU D;  4A8X C;  1AWD A;  1NEK B;  1NI3 A;  1V1P B;  2W3R A;  1I4X A;  4ZYS A;  3AEE B;  4B0E A;  2AQ3 B;  3OWE B;  1FXA A;  3IT6 B;  3WCQ A;  1NEN B;  1UWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...