3NVYA

Crystal structure of bovine xanthine oxidase in complex with quercetin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of a Xanthine Oxidase Complex with the Flavonoid Inhibitor Quercetin.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 40
structure length 164
sequence length 164
chains with identical sequence J
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3nvyA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3nvyA01
2QJLA 1N62A 4N59A 5G5GA 1GAQB 3AE2B 4KX6B 1NEKB 1N61A 3NVVA 1ZP0B 1E6EB 5C3JB 3P4QB 2DBYA 4HRSA 1XLOA 2L83A 4ZHOA 1QOFA 1YJIA 1FXAA 5EE3A 3B9JA 4JX1C 3AMZA 2WU5B 2Y5CA 4YTPB 4YSZB 3W9CB 2PVGC 1F0ZA 1DOXA 1ZUD2 5H8YE 2W55A 4ZOHC 3AM9A 1YQ3B 1WGKA 3SR6A 4C80A 1FFVA 1AYFA 1EWYC 4YXDB 1JRPA 1NVID 3ABVB 2W54A 3FC4A 1RM6C 4WQMA 3AB5A 1KRHA 1ZOYB 2JQRB 2KMMA 1ZXIA 1DGJA 3PO0A 3VRBB 2W3RA 3L4PA 2WLBA 3AECB 2MH7A 5H92C 2FBWB 1OQRA 1RYJA 2CU3A 3SFEB 1XLNA 1WRIA 1L6UA 5EE9A 1VDVA 3NVYA 2WQYB 2BS2B 1FIQA 1N5XA 2WDRB 3W5VB 2E3TA 1UWMA 1IUEA 1L6VA 3CWIA 4YSYB 3AE1B 3VR8B 1L5PA 3NS1A 4P6VF 3DWGC 3HVZA 3P63A 2OHFA 3RPFC 3LXFA 1WWTA 1NI3A 1YJJA 2K9XA 3AV8A 2WP9B 1FRDA 3HUIA 1JROA 4ITKA 3AEDB 5EE0A 4N58A 4ZHPA 1VJKA 3AE3B 1CJEA 1NENB 1L0VB 1TKEA 2MJEA 2PVOD 3AE5B 3W5UB 3AEGB 1A70A 1E7PB 5AUIA 1QOBA 1N60A 5GXGB 3EUB2 3AEFB 4FXCA 5EE1A 1QF6A 3AE6B 1E9MA 1JW9D 3B2GA 4YSXB 1QLBB 1FMAD 1VLBA 1XLPA 1TKGA 2KAJA 1T3QA 3BIID 3LB8C 1JQ4A 4C7YA 4IDIA 3P1MA 4JWSC 1FRRA 1SB3C 2DWQA 3SFDB 3AN1A 1SIJA 1KFYB 3AE4B 5G5HA 1NYRA 3DWMA 1V97A 2HTME 2JX5A 1FXIA 4HROA 3ZYYX 2WS3B 2WU2B 5MPOA 1I7HA 1JWBD 1V8CA 5C2TB 4C7ZA 1QOGA 1KF6B 4YTNB 3P4SB 2CJNA 1XLQA 3NRZA 3VR9B 4US8A 1J7CA 1FM0D 1TYGB 4YTMB 1N63A 2M19A 3AEBB 3AE7B 1OFFA 1OQQA 3NVWA 2Q5WD 3AEAB 2MJ3A 2N0SB 3FAHA 3P4RB 2M56B 3HRDD 1RWSA 2ACZB 2BS4B 3NVZA 3AEEB 1QOAA 1R7SA 2LEKA 1B9RA 3B2FA 1N5WA 3P4PB 2AX5A 2K5PA 2BS3B 3AE9B 3WCQA 2K22A 4YT0B 2G1EA 2QIEB 1DOYA 2H89B 2B76B 1SF0A 2PKOA 2WDVB 1GPXA 1YQ4B 2MJDA 2PIAA 1PDXA 3VRAB 1DOIA 1WXQA 3ETRA 1FO4A 1JALA 1PFDA 1PUTA 4WWMA 1NYQA 1TKYA 4USAA 1RFKA 1CZPA 2H88B 1XO3A 4JWUC 4N6EB 4A9AA 2W3SA 1TJEA 1ROEA 2CJOA 3AE8B 2WDQB 3KWLA 1AWDA 4US9A 3CIRB 1E10A 1WYGA 2BT6A 3AH7A 2EKIA 5AUKA 1FFUA 1J7AA 1JWAD 2L52A 1E0ZA 1QT9A 1J7BA 4LTUA
chains in the Genus database with same CATH superfamily
1YN3A 4QJFB 1D9DA 4F8RA 1UA1A 8ICNA 2X38A 4DL7A 2KNBA 2MA9B 4BXOB 5AICA 2RQ5A 1YMHE 2KZMA 4ZRQA 2YX8A 1UWXA 1EU4A 2EMTA 2RMMA 2ZIXB 2LPEA 5J0PA 4J9LA 2WXOA 7ICEA 2F1JA 2LVPA 3OGUA 3BQ0A 4DQSA 4HAIA 1SV4A 4ED6A 1NK7A 1YQBA 4MELA 1ZUD2 4PL2A 1E5WA 5B66U 1X6JA 4RMAA 1D8YA 3N28A 4NY8A 4E3CA 3NZSA 5K4LA 2LUMA 4YG2A 2F1HA 3QARA 4CGZA 1ZXIA 5KFIA 2D2QA 1ZW7A 2G09A 2WXHA 2A1JA 3PO0A 1OXJA 3NS8A 1Z3EB 3AU5A 4DQQA 4F4ZA 4OHJA 3ZIMA 5CB1A 2PE6B 4IQVA 5KFXA 4MJSB 4XQ8A 4CNQA 3JPQA 2ISOA 2E3TA 4Y2YA 1Y56A 2M4NA 1BMLC 4DXFA 4M9NA 2WFAA 4F3OA 2CHZA 2J7QB 3RNGC 4EEKA 2ZIVB 3HILA 3KYDD 3H40A 1V6EA 2QKQA 1F9JA 3BINA 3MDCA 1PK1B 5IIJA 5D49A 1YZ6A 2L0FA 5DPTA 4K7WA 2A19A 1R4MB 9ICTA 3IAM1 3W5UB 1K1QA 4HPMB 2W11A 1L8LA 5HFYA 1P1AA 4GLXA 4TV3A 5LNK1 5ALEA 1ZQBA 1IGCA 4ICUA 2NRWA 1H38A 1FEZA 4C4SA 4MFAA 1L6NA 2BB5A 2ICIA 4YCXA 1U45A 3N32A 4KX5A 3F2CA 2AEHA 5E6PA 3SV3A 2AGPA 4UARA 2JX5A 3LYYA 2M17A 3Q14C 4HROA 5KT4A 4YVZA 4XWWA 2RRDA 2D3BA 1QOGA 2ODGA 4UAWA 3U8ZA 5DG8A 1XLQA 5IINA 4HCNB 1JX4A 4US8A 5DPRA 3K9OB 2ZTCA 1Z1VA 1BPYA 2J6TA 1ZYQA 1UD7A 1X9SA 3TEZA 1GG3A 1UZXB 3KWVA 2W82A 2Q0ZX 1WH3A 5CP2A 1P7FA 4D2KA 3NVZA 2K89A 4EELA 3NZUA 1QLNA 2WXLA 7ICPA 3U7ZA 2WXRA 3ZDAA 5ALXA 2F76X 4IWOA 1VZ8A 2ASJA 1TGZB 1YQ4B 2PIAA 2KKCA 4BVUC 3FYHA 2QB0B 5KFJA 1Z00A 1C3TA 3B0XA 3C2KA 4WWMA 1V9PA 2KKPA 2FIDA 1CZPA 2VIXA 1UBQA 4RF0A 2W7PA 3R7QA 3QE9Y 2XK5A 4IOIE 2NPTB 2ZIUB 4S0RA 4BOSC 2N1WA 4QZAA 3MJ5A 5IA7A 2L52A 3OSNA 5ALZA 3MR5A 4IQTA 1XC9A 5AZGA 1KEJA 2QJLA 5AK5A 1R4NI 2DFLA 2RP5A 4FE3A 1SXDA 2KMCA 4FLHA 4EENA 3GE8C 4RGTA 1XO1A 2FCQA 3R2TA 3ISCA 2A3VA 1L0XB 3OPXA 2K6QA 3LVVA 2PVGC 3ZNHB 1DOXA 1ZQVA 4XYCA 1KFSA 4LNNA 1FPYA 2K60A 3AM9A 3IT6B 1WGKA 4C80A 3IM1A 3Q8AA 2RDGA 3UINB 4K4IA 1RYUA 2DENB 4BKGA 1SKWA 1D6EC 2JXTA 1LV5A 4L23A 2J53A 3AU6A 1R4NB 1L3VA 5ALPA 4ED3A 4LJOB 4HVBA 1MSWD 1OQRA 2CU3A 4RQ0A 1O03A 1WSPA 1SWVA 1OTRB 2XBBC 1KBUA 1NZPA 4YQWA 2AWTA 3WKCA 1K8RB 3H7SA 4PL1A 2HI0A 3SZ2A 4RF1A 3V72A 5J2GA 4KMOB 2W03A 4DO9A 2KX0A 4A90A 9ICRA 1JROA 1ZQCA 2JH1A 2OJWA 1U4AA 3JSVA 3ZJVA 2EH9A 7ICTA 2DZMA 4GMVA 2OEDA 9ICIA 2JPHA 1OEYJ 1TKDA 4YWGG 5EE1A 3KBBA 3KFUF 1XT9B 3B08A 4F92B 3BIID 3BVMA 4JPSA 5KL1B 1IGDA 4C7YA 3RH6A 4NAWB 5C5JA 7ICOA 2IA6A 2WXIA 3PW5A 4LCDE 3JPPA 4E0DA 2HJ8A 3WAMA 5DBBA 3ZYYX 3DBHI 4KDIC 2ZJDA 3LYSA 1V8CA 1ZD5A 1MPEA 4F5PA 3RB3A 2PI5A 2DQNB 2F1IA 1TYGB 2KE7A 2HHSA 1EF5A 1B0XA 2Q5WD 1UNSA 4XRHA 5ALLA 3FILA 1I42A 1COKA 4QW9A 1KTKA 5LXHA 2K5PA 2JT4B 3MJWA 5KFMA 2YMQA 5IILA 1GUAB 3BZDB 4U6PA 1TFRA 3C0RB 1PDXA 2BVCA 1PFDA 1JALA 2Y0SC 2MCNB 4UB6U 3M62B 4XE0A 2HHVA 2KDEB 4LJXA 3A4SC 3EFCA 1L7PA 1ZQDA 1V1PA 4NQLB 2KNJA 1NJYA 1OW5A 4P4PA 4B9VA 1JWAD 1X1MA 5KG2A 4M47A 2ONQA 4M01A 2J6UA 2M1MA 2AL3A 2KJ8A 4Y2RA 2E1EA 3AE2B 3PZDA 2IOFA 2KVRA 1XLOA 2XN9C 1YZ7A 1KH0A 3PHXB 2O2VB 3PRPB 1UT5A 5AIBA 3MABA 1E90A 2AQ2B 2OJRA 2V3NA 3JW0X 2KQ7A 5AM0A 2RLTA 1D8BA 1KOTA 2M0NA 2W55A 2BCRA 3EFUA 2D6FC 1ET6A 2MP2A 1X6IA 5AKLA 4O3OA 1MC8A 1L3TA 1BPDA 1ENFA 1ZOYB 4Y2PA 4WIPA 4F8CB 4BXOA 4B9TA 3AECB 4WH4A 3H6NA 4KLMA 1D5MC 4I29A 2RGFA 4W9EA 2Z8LA 2BS2B 4BBNF 2WTFA 4Q8EA 1IUEA 1QILA 3TACB 1UA0A 1Q46A 4F7ZA 1L5PA 5KG5A 3ONSA 2B3AA 3P63A 2OHFA 1PK3A 3D2QA 2JU6X 2RSUA 2HBLA 3NASA 1NZBA 4TQ0A 3MGVA 2FPMA 5KNIA 2LZ6A 1A0PA 5L1MA 1D3ZA 2NBWB 3WAPA 1WE6A 2FPKA 1MA7A 2KKVA 4Y2XA 5AUIA 3PZ7A 4KIKB 3TQ1A 1MVKA 2LGSA 3MFGA 3E56A 1WJ4A 3CMMB 1E9MA 1JW9D 2XK5B 1QCKA 3RAQA 4FULA 1T0QC 5JU5A 1T3QA 4PJ0U 1L0YB 3PSIA 1WRDB 3Q69A 4BFRA 1DOQA 1TT5B 4JWSC 3V3XA 3ICXA 2VA3A 4LDTD 4ICVA 4XDCA 3V05A 1SIJA 1RZTA 1A77A 2N7EA 2N1RA 1PK1A 2GBJA 1I7HA 3HWTA 3SEBA 5E6JA 1QQRA 1FM0D 2HDEA 2ASDA 3BK1A 3M7DA 3BQTA 1QTMA 1DGSA 3BYTB 4WJNA 4C4VB 3HM6X 3U2SC 4I6PA 2IO1B 3IHQB 1JWMD 5KT6A 3EZ5A 4DOCA 2JSVX 4G9BA 2PW9A 2G45B 2KHVA 3LWMA 2V3PA 4N9F4 1C9FA 2I5HA 5DB8A 3QUQA 2B0CA 4DL5A 1ZETA 1HA5A 2R61A 3S2AA 4GDKA 9ICNA 3KZIU 1WMHB 5KFSA 3RN9C 3DCGA 4G3XB 3BQ7A 5CX3A 1HTQA 2XIDA 1PUTA 3KW5B 1F2RI 1RFKA 3KZXA 1UBIA 9ICFA 4JWUC 2VJ5A 3AE8B 3KWLA 1WWVA 1ZQUA 1ZQRA 8ICYA 1P7EA 1J7AA 4J9RA 3RAXA 1URJA 1JXEA 4G11A 3ZXVA 2BKEA 1BPEA 2IY1B 4DHZB 2UVWA 1F1HA 1GO3F 3C19A 2JUOA 2C7NB 3BVGA 3DV9A 5AK4A 2JEGA 2QARB 2NV3A 4F50A 2HTHA 1E6EB 4UB8U 1ZQPA 2INDC 2LGDA 1CRXA 1E8ZA 1QOFA 4XX5A 1NBFC 3H0LB 3MTNB 1WGDA 2V9WA 4AJWA 1HUOA 4ACFA 2A4ZA 3ENEA 3DHIC 5FK9C 3DDCB 4KIKA 2K4IA 2KMMA 2FAZA 1HIWA 1DGJA 3JSVB 1KDHA 4DQPA 2W8KA 2BQRA 2WHEA 1BUIC 1EF1A 1ZQJA 3TEXA 3RNCC 4DSJA 5FR3A 5CEHA 5TISU 1Q3VA 3UXOA 1K5OA 3RJKA 8ICUA 3NG0A 4REZA 1E7VA 1S3SG 2LVQA 2A1AA 3DVGY 4M9HA 4IS7A 1WZ3A 3E2EA 3NS1A 3KUZA 1HTOA 3MHZA 3DBRB 7ICNA 3H1UA 5DB7A 2EQYA 2FIFA 4RUCA 2BCSA 2WP9B 3I9V1 3O13A 4P0PA 4C4VA 3UF8A 4G50A 1L0VB 1ZJNA 2GLEA 4Y2TA 3TI0A 1BXTA 4DFJA 1XO0A 1ZQLA 4J9SA 2BZFA 4IRKA 1KL9A 3PW0A 2C22A 2WB1C 5AI8A 9ICHA 2NRXA 3EWAA 1DK2A 3BS5B 2J0KA 4NPNA 2BKFA 4YD1A 3J81j 1XF5L 5DGBA 1F52A 3PSFA 3A0HU 3UQ2A 1NYRA 3FM9A 4I2JA 2XCAA 2J6SA 3PLVA 2LJIA 4ED2A 2IZVB 4R8UB 2E5SA 4TQ1A 5KT7A 4U7CA 3Q8SB 1KF6B 3PSEB 4PZOA 1QSYA 3R7RA 1MJDA 4IC7B 1N63A 4PS3A 3THVA 2ZXHA 1Q0WB 2DUYA 2LASA 4RCOA 2OCEA 3ML8A 2DAJA 3HRDD 2M56B 1SBBB 3PS6A 2IO3B 2ASLA 1QOAA 3RB6A 2JEIA 3PRZA 2BS3B 4MSMB 1S0MA 2ASQA 2HHTA 4I2FA 2H89B 2WDVB 4DWFA 8ICTA 2G5HB 4FZLA 1QH9A 1UQVA 4GXIA 1JI7A 4O5KA 3B0AA 3N3KB 4JGHB 4K7UA 3QYPA 4YMNA 2E6XA 2ZZPB 2KIVA 2WHIA 2JRIB 2O6VD 3OJ3A 4KGTA 1IBXB 4FS1A 4GGQA 4JUZA 9ICEA 4M0WA 4AQ7A 9ICXA 2W9CB 2KOBA 4ECVA 1SJED 1YX6B 4UBBA 3QU7A 1DRGA 1J7BA 1NJWA 2M9NA 3HKZF 5G5GA 3HM3A 2HMXA 4YD2A 4RM9A 1FD6A 3NVVA 2OH2A 4J9OA 5ALWA 3RFAA 2MSNA 3W1SC 2MSED 2EAMA 1AW7A 4ZHOA 4CF5A 3K75D 5KFOA 2R8KA 2Y5CA 1TK5A 1CUKA 1YIWA 4ANWA 3IBEA 1L7MA 3GS2A 5ALVA 1WM3A 2CN1A 3TL5A 2KC1A 2R8HA 1HJPA 2VKQA 2V1YA 4F1SA 1T6BX 5G55A 1KRHA 5H2FU 1NJZA 1NK6A 2K1FA 3M9NB 4OVUA 1KW4A 2BQ3A 4YXMA 2AYOB 2KOXA 3L16A 2H5XA 3SV4A 4OZAA 3ZRFA 5ALMA 4E71A 7ICMA 1RFAA 3SD5A 3PY8A 2HJ1A 4NJ6A 4JE3B 1A5RA 9ICQA 4BKSD 7ICJA 3GDXA 5J18A 3ZD8A 1JIHA 1ET9A 1E8XA 4F4YA 4A8XC 5AKKA 2PFNA 8ICSA 4AOFA 4MF2A 4JWNA 4TMAB 1JCKB 3A9KA 4XC2A 2HE7A 2JZBB 2ZIWB 5DQIA 1L4ZB 3R9KA 1MI0A 3AEFB 5GXGB 2EAPA 3SD7A 4DHZE 2WX1A 3A9JB 1D9FA 3IAS1 1I4RA 4GIVA 4ZRKA 1V2YA 1TIFA 3WKDA 2ZIVA 3IVFA 5AM2A 1VRAB 1BVSA 3X23A 4C00A 5KFAA 4TURA 3QIJA 1TK8A 2NO5A 3T9LA 1K1SA 2E1FA 2LYAA 3RJIA 1TS4A 4M02A 1I4HA 4RQNA 2KQSA 1U9LA 4GOCA 1WIAA 4IM3A 5DBCA 2INCC 4MH0E 3PSPA 3OG5A 2BDPA 4UB5A 4LNKA 1OFFA 3RB0A 2BHNA 4F5RA 3WA0A 2DHZA 1OQYA 3GFKB 5BYRA 3EGRA 2Y9UA 4BX9C 1B9RA 2F2AB 1N5WA 3ONNA 2HOFA 3VTVA 2Q4TA 1BGXT 4FFDA 4OJLA 3HW8A 1NDDA 2O2VA 4G0NB 2QIEB 5KG0A 1XSPA 2P6RA 2H3QA 1B22A 3PPAA 3VRAB 4CYEA 4DXAB 1V5OA 3C2LA 2IBKA 4L1BA 2LWPA 1IIPA 4UBCA 4IKGA 2INNE 4JL9A 4EZLA 4OW0A 1LKYB 1NJXA 4QZGA 5I4DA 3MR6A 3IHPC 2WDTB 1JUDA 1RXWA 3ZDEA 4QZCA 3GZNI 3SAHA 4O3PA 2UVRA 2RDJA 4NQKE 3U52E 1ZQQA 1CK1A 3FDSA 3UM9A 4JWMA 3PW7A 1ZOLA 4ACOA 2BYVE 5ALSA 3PLUA 4HEA1 2JRZA 2W43A 3P4QB 4HDQA 2DF4B 1ZQAA 5BOLA 4WWPA 1SE3A 3APDA 3VUXA 3I28A 1S0OA 1MG4A 1QQ5A 1T4GA 4DQOC 1NKCA 4P0QA 3Q8MA 3B1LX 5AM1A 4DS4A 1ISNA 4J9NA 4LNOA 1ZD3A 3IV6A 3NOBA 4OD0A 3WKAA 1A6SA 2NRVA 3ETLA 5KFNA 3Q2AC 2NTSA 5H92C 1L6UA 4AS1A 3EPIA 1FIQA 2WDRB 4S17A 3Q8LA 3U30A 3CNHA 4AP9A 1AQ6A 2L00B 3BQ2A 2C60A 3JVZX 2K4HA 3N20C 3JYUA 4X5VA 2KN7A 3MC0B 2D5GA 4KLQA 3F53A 4B6JA 5AKYA 5KFQA 2HOQA 1Q5WB 3ZO5B 1XCTL 4CF4A 4KGSA 2NRZA 2ON8A 1ZE3D 4W9IA 2IGHA 2DZIA 4RQ5A 1XQQA 4JIOU 4CF3A 4AUQC 4OZCA 1L7OA 3A1QA 1QLBB 1TE2A 3LJ3A 2K8AA 3UPQA 2EELA 2KN5A 5DB6A 7ICVA 3N97B 1ZKHA 1CEZA 2KDBA 4P1BC 1UUPA 4QZDA 2C7HA 3GILA 4CCHA 3AE4B 3UGBB 2L3ZA 2FLNA 2W9BA 2K8CB 2RPQA 1R4MI 4CO7A 5MPOA 2HHXA 2FUG1 4BAXA 1A76A 2KANA 2ZW0A 1WR1A 3VR9B 5J2RA 5ALFA 2LHTA 4IR1A 1IYFA 5L9XA 5AKEA 5E6NA 2NO4A 3HX0A 5HG2A 3AI5A 1I4XA 1OQQA 3NVWA 1WG8A 5ALDA 4C4TA 2Z0DB 3HIZA 1C78A 3PREA 5CTRC 3UI3A 4ARCA 1ZQSA 5FKAC 5J29A 4EFOA 2JY6A 3ZNZB 2DZJA 4DL4A 3QX7A 2H3IA 4KLLA 4GC7A 3MHSD 5IN7A 4GDLA 2Y9TA 2MJDA 2AHOB 4IQWA 4C0ZA 2FLPA 2IGGA 4DOBA 5AKZA 1U47A 5HR7A 3MC9A 8ICAA 2BYEA 4DDGD 3RR7A 3UXPA 3DDHA 3I5JC 1J2MA 4ZYNA 4A9AA 5T8IA 5KFZA 1ROEA 4DQIA 1VJ5A 2Y5BB 4LDTB 3RB4A 1XWLA 1N48A 1YT3A 2C9WB 1FFUA 3C5GA 3R8BA 1SGGA 2FI1A 1ZQIA 3QAQA 4TUPA 3UIPB 5KAIU 3V6KA 2BW2A 2PJHA 2IYDB 1STEA 1N62A 4EUTA 1G6JA 3GOEA 4MSQB 2BTEA 4I2CA 2NMQA 3KKAC 4B95A 3KHGA 3VDZA 3RRHA 4K1RB 4JMUA 2DAFA 4LLGM 3DVNV 2BKRB 3SENA 2DYBA 4OJOA 4Q2JA 8ICRA 1Y8RC 4M0WB 2XGPA 1LB2B 1WX7A 3CSTA 1EWYC 5GTIU 4J9KA 4I2HA 5ALJA 3WANA 2FPLA 4II3B 3EHVA 3RD2A 1IG6A 2INPE 3KQ4A 2KVSA 1HXYD 3VRBB 2N9KA 2JMGA 3L4PA 4KLDA 1V80A 4MM3B 5CRXA 4RFBA 3GE3C 1WRIA 2XICA 1IPGA 2L1AA 3NVYA 2LRUA 4HKZE 1QQ6A 2IDYA 2ALZA 2K4PA 2KHQA 3F5AA 3AE1B 5GMVA 3E58A 5AI5A 4AJYB 2NS5A 9ICPA 2KFJA 3L17A 3T5HA 3RPFC 3RJEA 3SQIA 4DSIA 5J2FA 1D4BA 1WWTA 3KUCB 4XZ4A 1KLVA 3ZXRA 2XVTA 2QILA 3HPOA 5J0UA 1VJKA 3HHMA 1DXSA 1NNLA 2WAQC 2LXCA 3QC8B 4DDID 2KP7A 1Q3UA 3AEGB 2GBMA 3ORYA 2UVVA 3UMGA 2ZPNA 3C1ZA 1F2RC 2WXMA 3AE6B 8ICEA 1VLBA 5DG9A 2EAOA 3LWLA 1SIFA 3LB8C 3QEBZ 4ECSA 1UF0A 1PQSA 3QK0A 1SB3C 3DOWA 3Q3NC 4W9FA 5G5HA 1FNWA 5AK3A 1NI2A 2WF5A 5AI0A 5J2AA 4F5OA 1JWBD 3VTUA 4FBTA 2DPJA 2KSOA 2BF8B 2W9AA 4XWTA 4YTMB 5KHQA 2LHEA 4DF4A 1TK0A 2F8LA 5J17A 3V60A 1L4DB 3D6JA 1SE9A 3EC8A 4RQ4A 2ZIXA 1DK3A 5BYQA 1M6YA 4P7IA 3WCQA 5C1ZA 1ZQXA 4JQWC 2IO0B 3ZJUA 4OCZA 2MBBB 3KD3A 4PHDA 3KUDB 5IIIA 1MQ2A 3Q6BA 2LXAA 4MGYE 3PV8A 5GTHU 3JPNA 1P98A 4MACA 1IV8A 2YEPF 4GLSC 3MFIA 2LGXA 3Q8FA 4C8OA 2WDQB 5BMIA 4US9A 5ALOA 5CWRA 3QZ8A 4R8UA 5IO9A 4FJVB 2XI9A 1WFYA 2GB1A 2N9PC 3NUHB 4KZCA 2LBOA 4C8KA 2BR0A 5AZFA 2HCFA 1QT9A 3ZDMC 2FMPA 4QWCA 4YL8A 2ZJAA 4NAMA 1WMHA 1MG8A 1ZP0B 2E8OA 1QSSA 3PO4A 3T79A 2DNFA 2P35A 3ALRA 3B9JA 3WAOA 3PRMB 1PGBA 4O1NA 2WU5B 1RQNA 3QJZA 5L1LA 3SHQA 2D3DA 2LMCA 1X40A 4YXDB 2YB1A 3RYTA 3RJHA 3CW2C 3U26A 1RM6C 2JWZA 2C2DA 1EUVB 4YR3A 2K0PA 4H2AA 4WQMA 5JXVA 2LMRA 1ECWA 1JXLA 2JQRB 1AN8A 3ZLZA 2WXFA 3N30A 5TSSA 3IG3A 4I2AA 2BCUA 1HEKA 1Z4OA 4J03A 2WLBA 4ED8A 1KFDA 5KFRA 3V7JA 2MH7A 2FBWB 3M95A 4CDGA 4JK1A 3WK7A 1IM4A 4ECQA 1P7DA 2WQYB 1GJZA 1ZQMA 4FHJA 4YFKA 4NLGA 3TCAA 3TARA 3GZNB 3Q8CA 3VC8A 3VR8B 2A1JB 2OOBB 2UYZB 2WF9A 9ICVA 2V4QA 8ICXA 5J2KA 5ALRA 5L95C 1KLUD 3H4DA 3DHHC 1COOA 5EE0A 2W9BB 4ZHPA 4BOZB 2GOLA 1FXTB 2KK8A 4FS2A 2LHDA 3AE3B 4YXJA 1CJEA 3AE5B 1TKEA 2PFOA 4Q43A 4O3NA 2LKYA 1NK0A 1N60A 1FNUA 4YN4A 1QF6A 2E8MA 3V7KA 2R2OA 3O65B 3TAPA 2C5LC 1HQRD 4RPXA 1TKGA 3Q3FA 2LYBA 3H8SA 5E79U 5J2EA 1JQ4A 4TUQA 3WU2U 2CR5A 4Z6FA 4A3OA 3C2MA 1B4FA 1AROP 3MR3A 4I6LB 1KQQA 2MRLA 2HHWA 2WS3B 3NJTA 3DBHB 2XO7A 1B43A 3TFSA 2PKEA 5AI4A 4M8NA 8ICHA 3QA8A 4YTNB 2VJ4A 4RNNA 4FBUA 1XXGA 3NUQA 3H7PB 4F5QA 4HLEA 2HVHA 2RR9A 4M0AA 3TKAA 4PHPA 4UDUC 3RUIB 3D2SA 2YLMA 4RGMA 8ICGA 1LKYA 2ZIWA 3P2BA 1T94A 3ZTCA 1DOYA 3JPTA 1T5XD 2ZPYA 3OSPA 2ZTDA 1YD8U 1M4VA 3V6EB 2CHXA 1TKYA 2KTRB 3C5FA 9ICGA 2WXQA 1TZOA 2JYTA 2K39A 1XO3A 5G2NA 4N6EB 5HHHA 3WK6A 1X2IA 2HOIA 3VHTC 2QB0A 3L3FX 2K8BA 3RJJA 2FCMA 3WALA 4LTUA 2YY6A 4B9MA 3MR2A 3RI7C 1GAQB 2LM4A 4P2HA 1T0RC 3VTWA 5J0QA 4IQUA 3OWEB 4HRSA 2WAQF 3APFA 4Q8FA 2REXA 4W9KA 2L83A 1Z4NA 1T3NA 1KLNA 3H8HA 4GFJA 2MU2A 3L5KA 4K3CA 4P1CC 5KG4A 4YSZB 4UW9A 4QWBA 2ESEA 4UAYA 3J9CA 4HJGE 4W9DA 3V6CB 4PT5A 4HKQA 1OUQA 4FN2A 4FBJB 1HZ6A 1ZQWA 2I1QA 4IR9A 4GB9A 5KHOA 1ZQTA 5KTQA 4LJPB 4QZ8A 3PNCA 2OEHA 1KJTA 4DSFA 4OO1J 2JXJA 2EANA 2P66A 2PFPA 4W9CA 1V38A 5J8YA 1ZGUB 4OVZA 5EWGA 5KL8B 2W9CA 3ECIA 3U7DA 5J2BA 2KTQA 4UB3A 4NL9C 2B6GA 5LLIA 5CHGA 2D3CA 4I2IA 4MFCA 1FRDA 1UELA 3KLSX 3AEDB 4ECYA 2AL6A 7ICGA 4ECRA 2KEYA 1QKZA 2KSOB 4O9MA 4MH8A 1WWUA 3GIIA 4DL6A 3E0FA 1WZ0A 1UPHA 3IFWB 4KKJA 4KLUA 2VH2A 3H9DA 3PX6A 4JB3A 1BPBA 1ZJMA 4M9GA 4HPPA 4B0MA 4IM0A 3K1ZA 3PW2A 2KAJA 2C2EA 3AL0B 3OJ4B 2MBQA 5KFCA 5DQHA 4O5CA 5HHIA 3R3MA 3DWMA 1V97A 5DB9A 3MGIA 4ECUA 2AGOA 2PEAA 1V5TA 1S9FA 2JXXA 2G08A 5C2TB 5IP4D 2L05A 2N7JA 2K8BB 2NVUI 1SE2A 2N4FA 3DBRI 3TMPB 4CE6A 5EDSA 3BVZA 2AQ0A 2ZIUA 3H8JA 4QZFA 1K50A 3AE7B 3AEAB 5LXIB 3M8RA 2Y1JA 4I27A 2ZTEA 2LI5A 3P4PB 2JEFA 3QUTA 4ANUA 2IPKD 1B1ZA 2IMWP 3L0WB 3N1XC 1FO4A 3WKEA 4EOYA 2YMMA 1FCCC 1S76D 1U48A 3OTQA 1L3UA 5HNKA 1GB1A 3ZJTA 4JV0A 4QZEA 3MBYA 4DSKA 3T5JA 3MC1A 2KVZA 3L10B 5J2IA 2G5IB 3M1YA 2LVOA 1SKRA 1AARA 5HMMA 4N59A 3DEEA 4KX6B 3RJFA 4P0PB 2FMQA 1PVPA 4QWDA 2XY6A 1T7PA 4FHKA 1WXSA 3QU4A 4TUSA 1WX8A 4GIBA 4CRXA 2I6XA 1TTNA 4HDOA 4FJZA 4OJPA 4TSSA 1C4PA 1WGHA 3RBEA 4FADA 5AKJA 2CKHB 2IHMA 4ANVA 3Q8EA 4O5EA 1ZD4A 2Y0SF 1RRBA 3T3FA 2VH1A 3D2NA 5J2DA 2OWOA 5JHAA 3QNMA 5J0WA 3HKZC 3NZ3A 3Q3MC 5BMGA 4PYZA 4IWPA 3TUOA 3EA6A 4I28A 3Q8QB 3I1YA 4ECTA 4NWIA 2F8KA 5C23A 3M63B 1QQ7A 3C29A 2F3NA 1OEYA 3QUCA 4M6WA 4NJ8A 3RNAC 1GC6A 4O3SA 1D5XC 4J9QA 2KD1A 3V7LA 5IKCM 1XNSA 4MEMA 4W9GA 1ZRMA 4UQGA 5DLFA 4XUSA 3M9OB 2H3ZA 4DXGA 5J2CA 3G6YA 4PGYA 2PVOD 1NOMA 3QU2A 3MGHA 4W9HA 4UAZA 8ICKA 2MWSB 5CJ7A 2XY7A 2NBUA 2AGQA 2XCPA 4KLIA 4WAAA 3B2GA 4F5NA 1JMLA 3SAGA 1C77A 4RQ3A 2JEJA 1WCLA 4HK2A 4IRCA 4ECXA 1JWSD 4MJSA 2DKXA 1P0RA 5IAAC 3ZRCA 2M0AA 3ISDA 2GBKA 4B6WA 1FXIA 1X66A 4MEXA 2G4SA 4EEYA 4YMMA 3PX0A 2Z59B 2NYVA 2FE8A 5L1KA 4I2GA 4GU2A 1JWUD 2HDOA 3AU4A 2KWDA 2EDUA 1J2NA 8ICVA 9ICOA 3Q8KA 4KLOA 2PMZC 1TS2A 4RT2A 5IIMA 4IM2A 5KT2A 2N0SB 7ICLA 2ZUDA 1SL0A 1RWSA 1XS9D 3QX1A 4F4WA 4BJQA 2AX5A 5KFKA 2G1EA 1RQLA 3BDPA 1GPXA 5HHDG 3ML9A 4K7SA 3A0BU 1DOIA 2JR5A 5DPSA 4R63A 2EZXA 3DBLI 1BT0A 1K53A 5D4BA 2KX3A 4JLCA 2QB1A 2KO3A 2JH7A 3GU3A 4KX3A 3BQ1A 2BT6A 3BWUD 3ZW3A 4RQ7A 2KHWB 5AI9A 1SGHA 3X0WA 1Z00B 3SU8X 2KMDA 4KVGB 5ALGA 1I4GA 1Z2MA 5AM4A 5B5EU 3ZDCA 3IT4B 3ZDDA 1N61A 4A20A 3PO5A 4F2SA 1E8YA 5KT5A 2KVCA 3BY4B 4F72A 3IG5A 3AU2A 4RNAA 2BWFA 1YJIA 2KXJA 5EE3A 4EYIB 1SXEA 5KAFU 1FCLA 5BMHA 4R65A 3K4GA 2ZJ8A 4WJQA 2CU1A 3A9JA 9ICLA 2N9XA 4AP4C 4ZOHC 4WQOB 4C8LA 4PHEA 3VH4B 3H4BA 2AJQA 1WE7A 1JRUA 1XU4A 3GV8B 3DBSA 5FP0A 4K4GA 3T5KA 1TV9A 4Q45A 2LFIA 4MGKE 1V9JA 2FMSA 1S0VA 2ZVOA 2CRXA 2BDUA 1UT8A 3VFKA 2BBCA 3MDAA 4YR2A 3MFHA 4NLBA 2XC9A 1HZ5A 1KLGD 5D7GA 1MHHE 5AI6A 3JPOA 4ZRPA 3RNEC 1L5UA 4OJ6A 3PMNA 4GXBA 2HBMA 5ALTA 3HUIA 2XY5A 1U4BA 3SI8A 1YOVB 4FA6A 3CRXA 2J4XA 3GP7A 1GC7A 3ISBA 4YR0A 1E7PB 5AM5A 3RNBC 5KFFA 3PX4A 4DCCA 4IUMB 2IBIB 4B9LA 3F2DA 2KK0A 4ECZA 2LD9A 2YVCA 1Y88A 1VZ6A 5L1JA 3ZGZA 5KFEA 4ARIA 1C4AA 1I4PA 4QZBA 4MDKE 4AYBF 1X9MA 3UQ0A 1O08A 4L2YA 1UHUA 3C1YA 4R66A 1TBEA 3C23A 1T0SC 2X8XX 2BWES 2PE9A 1C20A 4WJOA 3SDLC 1JN3A 1WM2A 1ZXHA 2CJNA 4UASA 1MN8A 4KSLC 2BGWA 2Y1IA 4EZKA 2BYFA 1TAUA 5DG7A 2KC2A 2D11A 4HYKA 8ICBA 4CQNA 1YJ1A 2O6VA 2PXIA 7ICHA 1ZQZA 2MJ3A 3IRUA 3ZKJC 7ICRA 4GSWA 1SWWA 2KFKA 1IBXA 2K22A 2J0JA 3K1RB 3T5LA 2WX0A 2QDFA 1I4QA 2D3GA 3DPDA 3VH3B 2YQEA 4F71A 1UGJA 3ZNGC 3PTFC 2NBVB 7ICFA 5AEKB 5DKWA 2MRPA 3ZD9A 5KFDA 1SV0C 2C2RA 2H88B 3RZWC 4EX6A 1ZRNA 3WK4A 1S0NA 2KYWA 4DWIA 1C79A 1E10A 5DPWA 1WYGA 4F4KA 2KMAA 2YEPB 5KG1A 4UATA 4ECWA 2MLBA 3AQFA 3CWIA 2KDMA 4ZYSA 2AU0A 3DHGC 4BBNC 1Q8KA 3L08A 3KOOA 5DDMA 2F44A 5C3JB 2DBYA 3BZKA 2H3VA 5D6JB 8ICWA 3KVFB 4DHJB 2JGAA 3R66C 4OVVA 3SMVA 4ELUA 1L2NA 2BCVA 3H0RB 2UWQA 2FUHB 3PGEA 4Y2JA 4TUUA 1WUDA 1F0ZA 5TR5A 4Y2SA 2W8LA 4RQ2A 2ZEQA 3RR8A 1D5ZC 2LJ5A 3F2BA 1V86A 1ZQGA 2E8NA 3QWZB 2PLPA 2ZG6A 1FFVA 4URKA 3QCAA 2AH5A 3UQBA 2W54A 2FLLA 2CXYA 1T8EA 1TZ1A 1LO5D 2Y3AA 2ZW1A 4EZ6A 3D32A 2N7DA 1E7UA 2WWZA 3HVDA 2KZ3A 1WJNA 1WCNA 2EZYA 1LXDA 4ELVA 2MBHA 1RYJA 3PSTA 3TSSA 1XLNA 2ZNVC 3RNFC 3ZUNA 1VDVA 3W5VB 2OM6A 2KFNA 2PTLA 3T3OA 4DS5A 3PV1A 4NJCA 1GOZA 4ZH4A 4RZRA 2V4LA 4IG7B 2YB4A 2HBKA 3AEVA 1GB4A 4NL9A 3TEWA 2JZBA 1ESFA 4TKNA 3TADC 2IY0B 2K9XA 2LI6A 2I1JA 3AULA 2CHWA 2O6VB 2WF8A 3NTUA 4NLZA 2O6KA 1XEEA 4ANXA 1ZQ1C 2IOHA 4Z6DA 3I76A 3QZ7A 2R8GA 2HD5B 2MJEA 5F3XB 1A70A 2DPIA 1HE8A 2GLSA 2KFKB 3GIKA 1U49A 1LM8B 3H8WA 3EUB2 4DSLA 4ED1A 5L1IA 1ZQHA 4LNIA 2QHOA 4BKTA 1FMAD 2UVUA 1XLPA 2KLCA 2OYYA 5CR0A 3FKYA 4LNFA 4IDIA 3IN5A 4ZRJA 2IOFK 1UH6A 4RQ1A 2FDRA 1GNUA 1MFWA 2V0GA 2KZRA 3Q3OC 3VUWA 5KFVA 2D07B 4M00A 3LDAA 2KICA 7ICQA 3C21A 1E8WA 3AQEA 4MEYA 4DL3A 4PYUA 2RD0A 3RT3B 2ATLA 1V85A 1IP9A 8ICPA 4B9NA 2DLBA 2KT7A 3TANA 3ZDTA 1RYRA 2JYEA 2G0AA 2YMLA 4R64A 1BNPA 2HHQA 1MHXA 2JHDA 2OXOA 3TAQA 3GIJA 2AQ3B 3QEAZ 2ACZB 3KKAA 4ZDVA 2RPVA 1FNVA 4NV0A 8ICZA 4AYBC 3BK2A 1SF0A 2JZPA 4RQMA 5AKIA 2WXGA 4O3QA 3L54A 2MX2A 1NK8A 1SL1A 1PVRA 1N2XA 2VANA 4GXJA 2KJ9A 2WNMA 2L8JA 4NM2A 1WGYA 2CPRA 1TJEA 5KFWA 2KWUB 2C28A 1XD3B 3RFZB 2KQ4X 3MP9A 4QAYA 2FJ6A 1NKBA 1NK5A 5AKHA 4DF8A 1TAQA 3AUOA 2GRIA 4G3IA 3RULA 3SYZA 3WK8A 2KWCA 1N6ZA 3OJUA 4BWMA 4GXKA 2K3UA 5ALNA 1X9WA 1P9DU 1YNTE 3ZQ4A 4B0EA 2KFZA 1WXMA 4KLJA 4GDKB 2G07A 4Z6EA 3I63C 9ICBA 5H8YE 2R18A 3CSFA 1YQ3B 3SR6A 1AYFA 3V62A 4KLSA 4LZGA 3ABVB 4MGIE 1RDFA 1ZDXA 1UCVA 2A5UA 3AB5A 4WJ3B 3OJSA 8ICLA 2JV3A 1F0MA 1S97A 3GZFA 1V81A 1TVAA 2KJ5A 2NTTA 2KG5A 2BQQA 4O3RA 3HT3A 1ZQNA 3HP6A 5FR6A 4EZJA 2KJHB 4KSKC 3NHEB 5L83A 5CHVC 5ALUA 2YTUA 1UWMA 3VCBA 4DLGA 5DLGA 2KJRA 3RZFA 2IGDA 3N1YC 3DWGC 3BS7A 4KTQA 1HEZE 5IOIA 3F5EA 1TS3A 3WIMA 3UMCA 4DL2A 1C1YB 2LGIA 1H8CA 1F77A 1UGMA 3APCA 2PI4A 1LGRA 4RPYA 3BZCA 4QIWF 3BJYA 2VZKB 4KGRA 5D94A 1KKXA 3N9YC 4MHVA 3A33B 2PMVA 4BWJA 2Z0EB 1F5SA 2MA1A 1NK9A 5AK6A 2NPTA 2MUTA 5HMLA 4M2YA 2D10A 3P1MA 4E74A 3QHTA 5HI1A 1PZNA 3OHAA 3AN1A 3SEIA 2ZUBA 4KLGA 2DYOA 3PHWB 2HBJA 3OAWA 3GIMA 9ICCA 5JH5C 2E8PA 4F4XA 4EBCA 4NNJB 2Y5PA 3NRZA 5KFYA 1K51A 1PGAA 2QLTA 2F77X 2B21A 4M8MA 2LM1A 2GWSA 2WF7A 4DFKA 2K8HA 4PS8A 4BUGA 3PR4A 3AEEB 4GC6A 2BS4B 2I1KA 4FZMA 3AE9B 4HCPB 2LYHA 4YT0B 2KD0A 2PKOA 4IC9A 2I38A 2KTFA 4ICAA 4MF8A 2R2QA 4IWQA 2KIWA 1XCQL 4FJYA 4A6QA 3G6VA 4RQ6A 2HVIA 4HPLB 5JZEB 1J0GA 1P3QU 2CJOA 5IIOA 9ICAA 3CIRB 3H7IA 1H4RA 5AUKA 1MQ3A 1D8LA 2ISPA 4TQSA 1ED1A 8ICFA 2QSDA 4RM8A 2R8JA 3M3JA 4RNOA 1PVQA 3KHRA 4MT5A 2J42A 1NEKB 4RQ8A 5KFBA 3PZPA 4NLNA 2D8CA 2I2YA 4DOAA 1OGWA 2QC8A 5BO4B 2RDBC 1FXAA 9ICSA 2TSSA 3LDZE 1SKSA 2ZVNA 4EBEA 4M9JA 8ICMA 2V4RA 1WXAA 4EEWA 1XSLA 4I2DA 5KG3A 4DEZA 9ICUA 2NCNA 4X57B 5JUMA 3RH4A 4K3BA 4Y2QA 2AQ1B 4FO6A 7ICKA 3PVXA 4DK5A 3FC4A 1YX5B 5J0SA 4XA5A 2V9HA 8ICOA 1SJHD 1RPLA 3IG8A 1KSPA 2W3RA 2W7OA 1L3SA 4J6IA 5KT3A 1JMSA 5EE9A 4NXZA 5IIKA 4BGDA 4KITB 3GQCA 1NK4A 1WJ6A 1N56A 1SXTA 2XEWA 5JRTA 5J8YC 1L6VA 3U4EG 4QZ9A 2HW3A 4A3PA 4KLHA 3N7RC 5KFPA 2GO7A 4KLFA 3LXFA 3L13A 2ZCBA 3AV8A 4QWEA 1Q1OA 2IO2B 4EE2A 4QZHA 2BGFA 3UIOB 2L76A 2M8SA 1ZQOA 1ZQEA 2MW5A 2QEJC 1RXVA 4EX7A 4MFFA 3EW9A 4FXCA 2KLGA 2EMSA 2WF6A 4M6WB 3VQIA 3TFRA 3UMBA 4JV2A 4R3DA 3LK9A 5DBAA 3A9KB 1HUZA 1FRRA 2JZZA 1S8OA 3OHBA 3Q8BA 1L8OA 2DGZA 5EWFA 2KACA 4GDLB 1K52A 1SSNA 3W1YA 2WU2B 3ZDBA 5BOMA 5BYSA 3WK5A 2BPCA 4P4OA 5KFTA 1J7CA 2RDIA 2RHFA 4I2BA 5CHFA 3NGDA 3UXNA 4IL6U 3AEBB 4AWJA 3S6JA 5ALKA 4C8MA 3A1QB 1ZPSA 4I6NB 1Q10A 2K6DB 4BKSA 3FAHA 3P4RB 4UAVA 4B9SA 2Z7JA 4KDLB 2LEKA 1R7SA 1TY0A 4NLCA 4OZBA 3IP4B 5BPCA 2VA2A 1BNOA 7ICUA 2K25A 1ZD2P 4I2EA 4KN7A 3H8MA 1QZEA 4TQRA 2K8CA 5D2MB 1KFTA 4C8NA 3ETRA 4PK1A 5CHWA 3VAWA 3QUBA 1C76A 2WYQA 1VZ7A 5HP4A 1YN4A 3RJGA 3UQAA 3T3NA 2G9HD 2KDIA 4ELTA 4RU9A 4ED0A 3EECA 5HKHA 4W9JA 4O3MA 1AWDA 2RDHA 2VZKD 4XGAB 3BS5A 4B9UA 1C4CA 5KFUA 4PGQA 4RGNA 2GOWA 4JV1A 2GH1A 2FNJB 3I57A 2L5YA 2MHJA 4IRDA 4BZAA 2D3AA 4RGOS 1ZDVA 4W9LA 5AZHA 5TZVA 1CMXB 4P0QB 4KN4A 2N9LA 2XNAC 4K4HA 4PHAA 1X9XA 4DFDA 3AMZA 2BPFA 3NY5A 4HXDA 1RAXA 4YTPB 2JF5A 3W9CB 4BDPA 5HR6A 3CP8A 2J52A 2YMPA 1Z19A 2HHUA 4A55A 5CA7A 1KM7A 4LK0M 3NRWA 2IJ0A 1NVID 3C28A 1WJUA 1I35A 3V6JA 3V6HA 5KG6A 2I9GA 1WR6E 2ZUCA 1SL2A 2PMZF 3MC8A 4DBGA 5T14A 3KHLA 1TAMA 2ZJ5A 3QXGA 5J0YA 1V1OA 5D3DA 4K81A 4NAWA 4QNLA 3SFEB 2BQUA 8ICCA 4PGXA 2BCQA 2UU7A 4J3OD 3W1SA 5EOZA 2PPHA 3IDWA 1ACCA 1RLFA 4F2RA 4YSYB 3PMLA 2ZCCA 3AXCA 2MUTB 3KYCD 2BYTA 4ED7A 2L0TA 3G6XA 1SV0A 4OJ5A 4C56C 4J9MA 2HSZA 2N1VA 1NI3A 5KFHA 1YJJA 2FE9A 3RF9A 4ITKA 4N58A 1ZQFA 4A8EA 4II2B 1Z1BA 5KG7A 5KFLA 4YP3A 4DFPA 1NENB 2L32A 1CI4A 5AKGA 3A4RA 3E9SA 4P16A 9ICWA 1S1QB 2WXJA 1WY8A 3B0YA 4UB1A 3RH5A 3URYA 3TEYA 2BPSA 4KKIA 1WGRA 4KZ0A 3PZ8A 1PUZA 2PFQA 4Y2VA 4QIWC 3T8MA 2GI9A 2KTRA 2DWQA 2V3SA 3SFDB 4DQRA 4NY0A 1Z5SB 3EYZA 3Q8RB 2GBNA 2HTME 2LUEA 4WWNA 2XGQA 2AXTU 3M9MB 9ICKA 2IHNA 3BYYB 4M9LA 4C7ZA 3PR5B 2QCZA 2KN4A 1RYSA 3VUYA 3KTQA 3VXWA 4EKUA 2EZZA 2KV2A 5J0OA 5DDYA 1FEHA 2WXNA 3TBLD 1S5LU 4KLTA 3RCZA 3N7PD 5AHXA 4Z6CA 1YN5A 4KLEA 2W9MA 3LVWA 2WGSA 3B2FA 3Q3JA 2JVCA 3RMKC 1CQVA 1EO6A 1NKEA 2DZKA 2FCNA 3ALBA 4WWOA 2MAXA 4MGZE 2H3FA 3HJEA 1F44A 1L7YA 4HWIB 2DX5B 5KFGA 2P6UA 3W2DA 4USAA 3DVGX 5AIAA 2DL0A 1RG6A 4DSEA 2CS4A 5ALIA 1C7YA 2KZZA 4WJPA 1DYQA 2W04A 4UB2A 4FZNA 3AH7A 4B9KA 3GV7B 4PS7A 3WKBA 1E0ZA 4EYHB 4M04A 5ALHA 4QW8A 2M0XA 5F9NA 1PYWD 3TJPA 4RT3A 2BPGA 5C0YA 4IW0A 2NRTA 4RNMA 3PT2B 4NZLB 2YN4A 3QU9A 3FILB 3P42A 3GV5B 4JX1C 2V4IB 1S10A 1WXVA 4RH6A 3QU5A 2ZXIA 2NR2A 7ICSA 3GB1A 4YMOA 5J0TA 1BPXA 2LGYA 3TADA 3KH0A 2W9NA 4MM3A 3K9PB 5JHBA 2G06A 1JRPA 4P4MA 3ZNID 3M6ZA 4WAFA 2JWUA 3Q8PB 1EU3A 3DBLB 5E6OA 1J97A 1EXNA 2VA8A 3JPRA 4F91B 1EM7A 1V1PB 3KHHA 2VRRB 2G3QB 3M8SA 3SAFA 4HJKA 4NJ7A 3HK0A 5DGAA 4F93B 4ASWC 1J8CA 5AKXA 5AM3A 4ZRIA 3RRGA 2J0MA 4NLKA 1LVHA 1N5XA 2LRWA 2MBEA 2DYMA 3QQ8B 4QZIA 1KN5A 1M94A 4KMUA 4PH5A 5J0RA 2L7RA 7ICIA 3PVLA 4DHJD 1TY2A 4P6VF 3HVZA 1WI0A 1QSLA 4PPXA 3V61A 2G4DB 4XDDA 3R2IA 5J2HA 3C8YA 2ZNVB 2MQJA 4GN1A 4Q44A 2SEBD 5D3IB 3N7SC 4CHKA 4EZ9A 1LFDA 2MBOA 3ZVVA 3O0FA 2AQ4A 4NM1A 5DQGA 2BB6A 1WYWB 2DKZA 1QOBA 2WXKA 1KTQA 2N9EB 2SAKA 3H0MB 1V49A 1VD2A 2KWVB 1WGGA 3ED5A 4YSXB 3RBDA 5A0LA 4UB4A 4WURA 1IXRA 3ZTDA 1ZQKA 4RPZA 2QMTA 4RUAA 8ICQA 1KFYB 4QWAA 1X42A 5D46A 5DCNA 1EWCA 3VVWB 4O0IA 1S77D 3ZI4A 2EKEC 1SZPA 8ICJA 1SEBD 3P4SB 3DQVA 4LZDA 4J9PA 1J19A 5F9LA 3CF6E 3EPGA 3N4MB 5ALQA 4Y2UA 9ICMA 2M19A 1L7NA 2GMIC 2QARA 3RTVA 3IXSA 2JRHA 1T0YA 4UAUA 1XSNA 1LQBA 2C7MB 3PW4A 4DFMA 4LVSA 1SZHA 1WX9A 1TS5A 1SE4A 2KJ6A 3TIXA 2B76B 1KRPA 2KDFB 2ES6A 3M6KA 5ALYA 3I3TB 1WXQA 5J0XA 3OLMD 2WB1F 1VR9A 1NYQA 2WXPA 4C4RA 2R8IA 3DVNU 3H7PA 2JZ3B 2MEKA 2K4EA 2W3SA 4DLEA 5EWEA 1VCBA 3WK9A 2FCSA 1WF9A 4PZNA 4EBDA 2EKIA 4KV2A 3CYMA 2GBRA 2MP2B 1ZQYA 5J2JA 3N1ZC 3JPSA 1BPZA 5JTIA 9ICJA 8ICIA 1PGXA
chains in the Genus database with same CATH topology
1YN3A 2GRIA 2X38A 5G5GA 1GAQB 1FD6A 3NVVA 1YMHE 3OWEB 4HRSA 4ZRQA 1UWXA 1AW7A 1EU4A 2K3UA 2L83A 2RMMA 4ZHOA 2WXOA 1YNTE 3ZQ4A 4B0EA 3H8HA 4GDKB 2Y5CA 4YSZB 1ZUD2 5H8YE 1YQ3B 3GS2A 3J9CA 4HJGE 3SR6A 1AYFA 3ABVB 4PT5A 4HKQA 1ZDXA 1T6BX 2LUMA 1KRHA 3AB5A 1HZ6A 1ZXIA 2WXHA 2NTTA 3PO0A 4OZAA 4OHJA 2E3TA 1UWMA 1Y56A 1BMLC 4OVZA 4DXFA 2IGDA 4JE3B 3DWGC 1HEZE 1TS3A 1ET9A 1FRDA 2LGIA 3KLSX 3AEDB 4A8XC 1F77A 3IAM1 3W5UB 1QKZA 4TMAB 1JCKB 4MH8A 5HFYA 4KGRA 2VZKB 4KKJA 1L4ZB 3N9YC 5GXGB 1MI0A 2PMVA 3AEFB 5LNK1 1IGCA 3IAS1 1I4RA 4B0MA 2BB5A 2KAJA 2ICIA 3P1MA 1VRAB 5HI1A 3AN1A 3DWMA 1V97A 2JX5A 3LYYA 4HROA 2DYOA 4XWWA 1TS4A 5C2TB 1QOGA 1XLQA 2N7JA 3NRZA 1I4HA 4US8A 1K51A 1PGAA 2Y5PA 1SE2A 3BVZA 3TEZA 3AE7B 1K50A 1OFFA 3AEAB 3KWVA 2W82A 5BYRA 1P7FA 2BS4B 3NVZA 3AEEB 3EGRA 3U7ZA 4D2KA 2WXLA 1B9RA 1N5WA 3P4PB 3AE9B 2WXRA 4YT0B 2QIEB 2PKOA 1VZ8A 1YQ4B 2IPKD 2PIAA 2I38A 1B1ZA 3VRAB 1FO4A 1XCQL 4L1BA 4WWMA 4A6QA 4IKGA 2INNE 1FCCC 1CZPA 4OW0A 4RF0A 5I4DA 2CJOA 4IOIE 3CIRB 3MJ5A 5AUKA 1GB1A 2QSDA 3ZJTA 2L52A 3U52E 1CK1A 2QJLA 4MT5A 4N59A 4KX6B 2J42A 1NEKB 4HEA1 3P4QB 4RGTA 2I2YA 1FXAA 2TSSA 1SE3A 4TSSA 1C4PA 3R2TA 1L0XB 2PVGC 1DOXA 3Q8EA 3AM9A 3IT6B 1WGKA 4DQOC 4C80A 2AQ1B 3Q8AA 2RDGA 3FC4A 1D6EC 2JXTA 3NZ3A 5BMGA 1SJHD 2J53A 4L23A 3TUOA 3EA6A 2W3RA 2NTSA 5H92C 1OQRA 2CU3A 5EE9A 1L6UA 4AS1A 1FIQA 1SXTA 1WSPA 2WDRB 1L6VA 3U4EG 1D5XC 4RF1A 3LXFA 3MC0B 2D5GA 3AV8A 4A90A 1JROA 4DXGA 4EE2A 1XCTL 3ZJVA 2PVOD 4KGSA 2QEJC 2ON8A 2OEDA 1ZE3D 2IGHA 4FXCA 5EE1A 4YWGG 3B2GA 4OZCA 1JMLA 1C77A 1QLBB 3BIID 3BVMA 2EELA 4JPSA 3VQIA 1IGDA 4R3DA 4C7YA 4NAWB 1FRRA 1UUPA 2WXIA 1JWSD 3AE4B 3Q8BA 2M0AA 2KACA 1FXIA 3ZYYX 4GDLB 1K52A 1SSNA 2WU2B 5MPOA 1V8CA 2FE8A 1MPEA 2FUG1 5BYSA 1JWUD 2ZW0A 2KWDA 3VR9B 1J7CA 1TYGB 1TS2A 3AEBB 5HG2A 1I4XA 1OQQA 3NVWA 2Q5WD 1ZPSA 3UI3A 1Q10A 1C78A 1UNSA 3FAHA 2N0SB 3P4RB 3FILA 4ARCA 1RWSA 2LEKA 1R7SA 1TY0A 5FKAC 1KTKA 2AX5A 2K5PA 4OZBA 2G1EA 1GPXA 3BZDB 5HHDG 2MJDA 1PDXA 1DOIA 2IGGA 3ETRA 1PFDA 1JALA 1C76A 1VZ7A 4XE0A 1K53A 1YN4A 3T3NA 2G9HD 4A9AA 5T8IA 1ROEA 1V1PA 1AWDA 2RDHA 2VZKD 3BWUD 2BT6A 1FFUA 3R8BA 1JWAD 1C4CA 4RGNA 1I4GA 2BW2A 2ONQA 3I57A 3IT4B 1STEA 1N62A 3AE2B 4RGOS 1ZDVA 2BTEA 2NMQA 1N61A 1XLOA 4RNAA 2XN9C 1KH0A 2N9LA 1YJIA 2XNAC 4LLGM 5EE3A 1FCLA 5BMHA 3AMZA 4YTPB 2AQ2B 3W9CB 2V3NA 4Q2JA 2J52A 2W55A 4ZOHC 4A55A 4LK0M 1ET6A 1EWYC 2IJ0A 1NVID 1ENFA 1ZOYB 2INPE 3KQ4A 4WIPA 1HXYD 3VRBB 5D3DA 2LFIA 2N9KA 1V1OA 3L4PA 3AECB 4WH4A 4MM3B 1D5MC 3SFEB 4RFBA 1WRIA 2L1AA 3NVYA 2Z8LA 4HKZE 2BS2B 4J3OD 3W1SA 2IDYA 1ACCA 1IUEA 1QILA 2BBCA 4YSYB 1HZ5A 3AE1B 1L5PA 1KLGD 5D7GA 2BYTA 1MHHE 4ZRPA 3P63A 2OHFA 2JU6X 3RPFC 4C56C 1D4BA 1WWTA 1NI3A 1YJJA 4TQ0A 3HUIA 2QILA 4ITKA 4N58A 1VJKA 2J4XA 1NENB 3GP7A 2L32A 3AEGB 1E7PB 4P16A 3E9SA 3PZ7A 5AUIA 1MVKA 3MFGA 1F2RC 2WXJA 2WXMA 3E56A 3URYA 3TEYA 3AE6B 1E9MA 1JW9D 4KKIA 3PZ8A 1VLBA 3LB8C 1VZ6A 1L0YB 1T3QA 3Q69A 2GI9A 3ZGZA 4ARIA 4JWSC 1C4AA 1I4PA 3V3XA 3V05A 1SB3C 2DWQA 4XDCA 3SFDB 1SIJA 5G5HA 1FNWA 4L2YA 2HTME 1I7HA 1JWBD 3BYYB 4C7ZA 2KN4A 1ZXHA 3SEBA 2CJNA 4XWTA 5E6JA 1QQRA 4YTMB 2HDEA 1FM0D 3BK1A 4CQNA 3BYTB 2LHEA 1FEHA 2WXNA 3U2SC 1JWMD 2MJ3A 2JSVX 2PW9A 1L4DB 2V3PA 1YN5A 1C9FA 3B2FA 5BYQA 2R61A 1HA5A 1IBXA 3WCQA 1CQVA 2K22A 3ZJUA 1I4QA 1UGJA 1PUTA 3W2DA 4USAA 1F2RI 1RFKA 4MACA 2H88B 2YEPF 4GLSC 4JWUC 3Q8FA 3AE8B 3KWLA 2WDQB 1C79A 1DYQA 4US9A 5BMIA 1E10A 1P7EA 1WYGA 3AH7A 1J7AA 2GB1A 3NUHB 2YEPB 1E0ZA 1QT9A 3CWIA 1PYWD 2KDMA 4ZYSA 3BVGA 4NAMA 1ZP0B 1E6EB 5C3JB 2DBYA 4NZLB 3FILB 1QOFA 3P42A 3B9JA 4JX1C 1PGBA 2V4IB 4O1NA 2WU5B 1F0ZA 4RH6A 3GB1A 1D5ZC 2PLPA 1FFVA 2LMCA 4YXDB 1JRPA 2W54A 5FK9C 4H2AA 2JWUA 1RM6C 1EU3A 4WAFA 2K0PA 4WQMA 5JXVA 1LO5D 2Y3AA 2ZW1A 2KMMA 1AN8A 1EM7A 1V1PB 2JQRB 2WXFA 5TSSA 1DGJA 1BUIC 3HVDA 2WLBA 2MH7A 3TEXA 2FBWB 1RYJA 5FR3A 3TSSA 1XLNA 1VDVA 2WQYB 3W5VB 1N5XA 4REZA 2DYMA 3T3OA 2PTLA 4NJCA 3Q8CA 3VR8B 1GOZA 3NS1A 1TY2A 4P6VF 1GB4A 3HVZA 3MHZA 3TEWA 4XDDA 1ESFA 3R2IA 1KLUD 2K9XA 3C8YA 2WP9B 3I9V1 3O13A 5EE0A 4ZHPA 2SEBD 5D3IB 1XEEA 3AE3B 2LHDA 1CJEA 1L0VB 1TKEA 2MJEA 3AE5B 1BXTA 1A70A 2BB6A 1QOBA 2WXKA 2SAKA 1N60A 1FNUA 3EUB2 1QF6A 4YSXB 1FMAD 1HQRD 1XLPA 1TKGA 4WURA 1JQ4A 4IDIA 2QMTA 1XF5L 1KFYB 2V0GA 1EWCA 1NYRA 2WS3B 2LJIA 4TQ1A 4YTNB 1KF6B 1SEBD 3P4SB 1XXGA 2DLBA 1N63A 2M19A 2JYEA 3IXSA 1MHXA 4RCOA 2AQ3B 2M56B 3HRDD 4UDUC 1SBBB 2ACZB 4RGMA 1QOAA 2BS3B 2RPVA 1FNVA 1SE4A 1TS5A 3BK2A 1DOYA 2H89B 2B76B 1SF0A 2WDVB 2JZPA 1T5XD 1WXQA 2WXGA 1M4VA 1VR9A 2E6XA 1NYQA 1TKYA 2WXQA 2WXPA 1TZOA 2JYTA 2WNMA 1XO3A 4KGTA 1IBXB 4N6EB 2MEKA 2W3SA 1TJEA 4M0WA 2EKIA 4AQ7A 3RFZB 2KQ4X 3MP9A 1SJED 4LTUA 1J7BA 1PGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJL A;  1N62 A;  4N59 A;  5G5G A;  1GAQ B;  3AE2 B;  4KX6 B;  1NEK B;  1N61 A;  3NVV A;  1ZP0 B;  1E6E B;  5C3J B;  3P4Q B;  2DBY A;  4HRS A;  1XLO A;  2L83 A;  4ZHO A;  1QOF A;  1YJI A;  1FXA A;  5EE3 A;  3B9J A;  4JX1 C;  3AMZ A;  2WU5 B;  2Y5C A;  4YTP B;  4YSZ B;  3W9C B;  2PVG C;  1F0Z A;  1DOX A;  1ZUD 2;  5H8Y E;  2W55 A;  4ZOH C;  3AM9 A;  1YQ3 B;  1WGK A;  3SR6 A;  4C80 A;  1FFV A;  1AYF A;  1EWY C;  4YXD B;  1JRP A;  1NVI D;  3ABV B;  2W54 A;  3FC4 A;  1RM6 C;  4WQM A;  3AB5 A;  1KRH A;  1ZOY B;  2JQR B;  2KMM A;  1ZXI A;  1DGJ A;  3PO0 A;  3VRB B;  2W3R A;  3L4P A;  2WLB A;  3AEC B;  2MH7 A;  5H92 C;  2FBW B;  1OQR A;  1RYJ A;  2CU3 A;  3SFE B;  1XLN A;  1WRI A;  1L6U A;  5EE9 A;  1VDV A;  3NVY A;  2WQY B;  2BS2 B;  1FIQ A;  1N5X A;  2WDR B;  3W5V B;  2E3T A;  1UWM A;  1IUE A;  1L6V A;  3CWI A;  4YSY B;  3AE1 B;  3VR8 B;  1L5P A;  3NS1 A;  4P6V F;  3DWG C;  3HVZ A;  3P63 A;  2OHF A;  3RPF C;  3LXF A;  1WWT A;  1NI3 A;  1YJJ A;  2K9X A;  3AV8 A;  2WP9 B;  1FRD A;  3HUI A;  1JRO A;  4ITK A;  3AED B;  5EE0 A;  4N58 A;  4ZHP A;  1VJK A;  3AE3 B;  1CJE A;  1NEN B;  1L0V B;  1TKE A;  2MJE A;  2PVO D;  3AE5 B;  3W5U B;  3AEG B;  1A70 A;  1E7P B;  5AUI A;  1QOB A;  1N60 A;  5GXG B;  3EUB 2;  3AEF B;  4FXC A;  5EE1 A;  1QF6 A;  3AE6 B;  1E9M A;  1JW9 D;  3B2G A;  4YSX B;  1QLB B;  1FMA D;  1VLB A;  1XLP A;  1TKG A;  2KAJ A;  1T3Q A;  3BII D;  3LB8 C;  1JQ4 A;  4C7Y A;  4IDI A;  3P1M A;  4JWS C;  1FRR A;  1SB3 C;  2DWQ A;  3SFD B;  3AN1 A;  1SIJ A;  1KFY B;  3AE4 B;  5G5H A;  1NYR A;  3DWM A;  1V97 A;  2HTM E;  2JX5 A;  1FXI A;  4HRO A;  3ZYY X;  2WS3 B;  2WU2 B;  5MPO A;  1I7H A;  1JWB D;  1V8C A;  5C2T B;  4C7Z A;  1QOG A;  1KF6 B;  4YTN B;  3P4S B;  2CJN A;  1XLQ A;  3NRZ A;  3VR9 B;  4US8 A;  1J7C A;  1FM0 D;  1TYG B;  4YTM B;  1N63 A;  2M19 A;  3AEB B;  3AE7 B;  1OFF A;  1OQQ A;  3NVW A;  2Q5W D;  3AEA B;  2MJ3 A;  2N0S B;  3FAH A;  3P4R B;  2M56 B;  3HRD D;  1RWS A;  2ACZ B;  2BS4 B;  3NVZ A;  3AEE B;  1QOA A;  1R7S A;  2LEK A;  1B9R A;  3B2F A;  1N5W A;  3P4P B;  2AX5 A;  2K5P A;  2BS3 B;  3AE9 B;  3WCQ A;  2K22 A;  4YT0 B;  2G1E A;  2QIE B;  1DOY A;  2H89 B;  2B76 B;  1SF0 A;  2PKO A;  2WDV B;  1GPX A;  1YQ4 B;  2MJD A;  2PIA A;  1PDX A;  3VRA B;  1DOI A;  1WXQ A;  3ETR A;  1FO4 A;  1JAL A;  1PFD A;  1PUT A;  4WWM A;  1NYQ A;  1TKY A;  4USA A;  1RFK A;  1CZP A;  2H88 B;  1XO3 A;  4JWU C;  4N6E B;  4A9A A;  2W3S A;  1TJE A;  1ROE A;  2CJO A;  3AE8 B;  2WDQ B;  3KWL A;  1AWD A;  4US9 A;  3CIR B;  1E10 A;  1WYG A;  2BT6 A;  3AH7 A;  2EKI A;  5AUK A;  1FFU A;  1J7A A;  1JWA D;  2L52 A;  1E0Z A;  1QT9 A;  1J7B A;  4LTU A; 
#chains in the Genus database with same CATH topology
 1YN3 A;  4QJF B;  1D9D A;  4F8R A;  1UA1 A;  8ICN A;  2X38 A;  4DL7 A;  2KNB A;  2MA9 B;  4BXO B;  5AIC A;  2RQ5 A;  1YMH E;  2KZM A;  4ZRQ A;  2YX8 A;  1UWX A;  1EU4 A;  2EMT A;  2RMM A;  2ZIX B;  2LPE A;  5J0P A;  4J9L A;  2WXO A;  7ICE A;  2F1J A;  2LVP A;  3OGU A;  3BQ0 A;  4DQS A;  4HAI A;  1SV4 A;  4ED6 A;  1NK7 A;  1YQB A;  4MEL A;  1ZUD 2;  4PL2 A;  1E5W A;  5B66 U;  1X6J A;  4RMA A;  1D8Y A;  3N28 A;  4NY8 A;  4E3C A;  3NZS A;  5K4L A;  2LUM A;  4YG2 A;  2F1H A;  3QAR A;  4CGZ A;  1ZXI A;  5KFI A;  2D2Q A;  1ZW7 A;  2G09 A;  2WXH A;  2A1J A;  3PO0 A;  1OXJ A;  3NS8 A;  1Z3E B;  3AU5 A;  4DQQ A;  4F4Z A;  4OHJ A;  3ZIM A;  5CB1 A;  2PE6 B;  4IQV A;  5KFX A;  4MJS B;  4XQ8 A;  4CNQ A;  3JPQ A;  2ISO A;  2E3T A;  4Y2Y A;  1Y56 A;  2M4N A;  1BML C;  4DXF A;  4M9N A;  2WFA A;  4F3O A;  2CHZ A;  2J7Q B;  3RNG C;  4EEK A;  2ZIV B;  3HIL A;  3KYD D;  3H40 A;  1V6E A;  2QKQ A;  1F9J A;  3BIN A;  3MDC A;  1PK1 B;  5IIJ A;  5D49 A;  1YZ6 A;  2L0F A;  5DPT A;  4K7W A;  2A19 A;  1R4M B;  9ICT A;  3IAM 1;  3W5U B;  1K1Q A;  4HPM B;  2W11 A;  1L8L A;  5HFY A;  1P1A A;  4GLX A;  4TV3 A;  5LNK 1;  5ALE A;  1ZQB A;  1IGC A;  4ICU A;  2NRW A;  1H38 A;  1FEZ A;  4C4S A;  4MFA A;  1L6N A;  2BB5 A;  2ICI A;  4YCX A;  1U45 A;  3N32 A;  4KX5 A;  3F2C A;  2AEH A;  5E6P A;  3SV3 A;  2AGP A;  4UAR A;  2JX5 A;  3LYY A;  2M17 A;  3Q14 C;  4HRO A;  5KT4 A;  4YVZ A;  4XWW A;  2RRD A;  2D3B A;  1QOG A;  2ODG A;  4UAW A;  3U8Z A;  5DG8 A;  1XLQ A;  5IIN A;  4HCN B;  1JX4 A;  4US8 A;  5DPR A;  3K9O B;  2ZTC A;  1Z1V A;  1BPY A;  2J6T A;  1ZYQ A;  1UD7 A;  1X9S A;  3TEZ A;  1GG3 A;  1UZX B;  3KWV A;  2W82 A;  2Q0Z X;  1WH3 A;  5CP2 A;  1P7F A;  4D2K A;  3NVZ A;  2K89 A;  4EEL A;  3NZU A;  1QLN A;  2WXL A;  7ICP A;  3U7Z A;  2WXR A;  3ZDA A;  5ALX A;  2F76 X;  4IWO A;  1VZ8 A;  2ASJ A;  1TGZ B;  1YQ4 B;  2PIA A;  2KKC A;  4BVU C;  3FYH A;  2QB0 B;  5KFJ A;  1Z00 A;  1C3T A;  3B0X A;  3C2K A;  4WWM A;  1V9P A;  2KKP A;  2FID A;  1CZP A;  2VIX A;  1UBQ A;  4RF0 A;  2W7P A;  3R7Q A;  3QE9 Y;  2XK5 A;  4IOI E;  2NPT B;  2ZIU B;  4S0R A;  4BOS C;  2N1W A;  4QZA A;  3MJ5 A;  5IA7 A;  2L52 A;  3OSN A;  5ALZ A;  3MR5 A;  4IQT A;  1XC9 A;  5AZG A;  1KEJ A;  2QJL A;  5AK5 A;  1R4N I;  2DFL A;  2RP5 A;  4FE3 A;  1SXD A;  2KMC A;  4FLH A;  4EEN A;  3GE8 C;  4RGT A;  1XO1 A;  2FCQ A;  3R2T A;  3ISC A;  2A3V A;  1L0X B;  3OPX A;  2K6Q A;  3LVV A;  2PVG C;  3ZNH B;  1DOX A;  1ZQV A;  4XYC A;  1KFS A;  4LNN A;  1FPY A;  2K60 A;  3AM9 A;  3IT6 B;  1WGK A;  4C80 A;  3IM1 A;  3Q8A A;  2RDG A;  3UIN B;  4K4I A;  1RYU A;  2DEN B;  4BKG A;  1SKW A;  1D6E C;  2JXT A;  1LV5 A;  4L23 A;  2J53 A;  3AU6 A;  1R4N B;  1L3V A;  5ALP A;  4ED3 A;  4LJO B;  4HVB A;  1MSW D;  1OQR A;  2CU3 A;  4RQ0 A;  1O03 A;  1WSP A;  1SWV A;  1OTR B;  2XBB C;  1KBU A;  1NZP A;  4YQW A;  2AWT A;  3WKC A;  1K8R B;  3H7S A;  4PL1 A;  2HI0 A;  3SZ2 A;  4RF1 A;  3V72 A;  5J2G A;  4KMO B;  2W03 A;  4DO9 A;  2KX0 A;  4A90 A;  9ICR A;  1JRO A;  1ZQC A;  2JH1 A;  2OJW A;  1U4A A;  3JSV A;  3ZJV A;  2EH9 A;  7ICT A;  2DZM A;  4GMV A;  2OED A;  9ICI A;  2JPH A;  1OEY J;  1TKD A;  4YWG G;  5EE1 A;  3KBB A;  3KFU F;  1XT9 B;  3B08 A;  4F92 B;  3BII D;  3BVM A;  4JPS A;  5KL1 B;  1IGD A;  4C7Y A;  3RH6 A;  4NAW B;  5C5J A;  7ICO A;  2IA6 A;  2WXI A;  3PW5 A;  4LCD E;  3JPP A;  4E0D A;  2HJ8 A;  3WAM A;  5DBB A;  3ZYY X;  3DBH I;  4KDI C;  2ZJD A;  3LYS A;  1V8C A;  1ZD5 A;  1MPE A;  4F5P A;  3RB3 A;  2PI5 A;  2DQN B;  2F1I A;  1TYG B;  2KE7 A;  2HHS A;  1EF5 A;  1B0X A;  2Q5W D;  1UNS A;  4XRH A;  5ALL A;  3FIL A;  1I42 A;  1COK A;  4QW9 A;  1KTK A;  5LXH A;  2K5P A;  2JT4 B;  3MJW A;  5KFM A;  2YMQ A;  5IIL A;  1GUA B;  3BZD B;  4U6P A;  1TFR A;  3C0R B;  1PDX A;  2BVC A;  1PFD A;  1JAL A;  2Y0S C;  2MCN B;  4UB6 U;  3M62 B;  4XE0 A;  2HHV A;  2KDE B;  4LJX A;  3A4S C;  3EFC A;  1L7P A;  1ZQD A;  1V1P A;  4NQL B;  2KNJ A;  1NJY A;  1OW5 A;  4P4P A;  4B9V A;  1JWA D;  1X1M A;  5KG2 A;  4M47 A;  2ONQ A;  4M01 A;  2J6U A;  2M1M A;  2AL3 A;  2KJ8 A;  4Y2R A;  2E1E A;  3AE2 B;  3PZD A;  2IOF A;  2KVR A;  1XLO A;  2XN9 C;  1YZ7 A;  1KH0 A;  3PHX B;  2O2V B;  3PRP B;  1UT5 A;  5AIB A;  3MAB A;  1E90 A;  2AQ2 B;  2OJR A;  2V3N A;  3JW0 X;  2KQ7 A;  5AM0 A;  2RLT A;  1D8B A;  1KOT A;  2M0N A;  2W55 A;  2BCR A;  3EFU A;  2D6F C;  1ET6 A;  2MP2 A;  1X6I A;  5AKL A;  4O3O A;  1MC8 A;  1L3T A;  1BPD A;  1ENF A;  1ZOY B;  4Y2P A;  4WIP A;  4F8C B;  4BXO A;  4B9T A;  3AEC B;  4WH4 A;  3H6N A;  4KLM A;  1D5M C;  4I29 A;  2RGF A;  4W9E A;  2Z8L A;  2BS2 B;  4BBN F;  2WTF A;  4Q8E A;  1IUE A;  1QIL A;  3TAC B;  1UA0 A;  1Q46 A;  4F7Z A;  1L5P A;  5KG5 A;  3ONS A;  2B3A A;  3P63 A;  2OHF A;  1PK3 A;  3D2Q A;  2JU6 X;  2RSU A;  2HBL A;  3NAS A;  1NZB A;  4TQ0 A;  3MGV A;  2FPM A;  5KNI A;  2LZ6 A;  1A0P A;  5L1M A;  1D3Z A;  2NBW B;  3WAP A;  1WE6 A;  2FPK A;  1MA7 A;  2KKV A;  4Y2X A;  5AUI A;  3PZ7 A;  4KIK B;  3TQ1 A;  1MVK A;  2LGS A;  3MFG A;  3E56 A;  1WJ4 A;  3CMM B;  1E9M A;  1JW9 D;  2XK5 B;  1QCK A;  3RAQ A;  4FUL A;  1T0Q C;  5JU5 A;  1T3Q A;  4PJ0 U;  1L0Y B;  3PSI A;  1WRD B;  3Q69 A;  4BFR A;  1DOQ A;  1TT5 B;  4JWS C;  3V3X A;  3ICX A;  2VA3 A;  4LDT D;  4ICV A;  4XDC A;  3V05 A;  1SIJ A;  1RZT A;  1A77 A;  2N7E A;  2N1R A;  1PK1 A;  2GBJ A;  1I7H A;  3HWT A;  3SEB A;  5E6J A;  1QQR A;  1FM0 D;  2HDE A;  2ASD A;  3BK1 A;  3M7D A;  3BQT A;  1QTM A;  1DGS A;  3BYT B;  4WJN A;  4C4V B;  3HM6 X;  3U2S C;  4I6P A;  2IO1 B;  3IHQ B;  1JWM D;  5KT6 A;  3EZ5 A;  4DOC A;  2JSV X;  4G9B A;  2PW9 A;  2G45 B;  2KHV A;  3LWM A;  2V3P A;  4N9F 4;  1C9F A;  2I5H A;  5DB8 A;  3QUQ A;  2B0C A;  4DL5 A;  1ZET A;  1HA5 A;  2R61 A;  3S2A A;  4GDK A;  9ICN A;  3KZI U;  1WMH B;  5KFS A;  3RN9 C;  3DCG A;  4G3X B;  3BQ7 A;  5CX3 A;  1HTQ A;  2XID A;  1PUT A;  3KW5 B;  1F2R I;  1RFK A;  3KZX A;  1UBI A;  9ICF A;  4JWU C;  2VJ5 A;  3AE8 B;  3KWL A;  1WWV A;  1ZQU A;  1ZQR A;  8ICY A;  1P7E A;  1J7A A;  4J9R A;  3RAX A;  1URJ A;  1JXE A;  4G11 A;  3ZXV A;  2BKE A;  1BPE A;  2IY1 B;  4DHZ B;  2UVW A;  1F1H A;  1GO3 F;  3C19 A;  2JUO A;  2C7N B;  3BVG A;  3DV9 A;  5AK4 A;  2JEG A;  2QAR B;  2NV3 A;  4F50 A;  2HTH A;  1E6E B;  4UB8 U;  1ZQP A;  2IND C;  2LGD A;  1CRX A;  1E8Z A;  1QOF A;  4XX5 A;  1NBF C;  3H0L B;  3MTN B;  1WGD A;  2V9W A;  4AJW A;  1HUO A;  4ACF A;  2A4Z A;  3ENE A;  3DHI C;  5FK9 C;  3DDC B;  4KIK A;  2K4I A;  2KMM A;  2FAZ A;  1HIW A;  1DGJ A;  3JSV B;  1KDH A;  4DQP A;  2W8K A;  2BQR A;  2WHE A;  1BUI C;  1EF1 A;  1ZQJ A;  3TEX A;  3RNC C;  4DSJ A;  5FR3 A;  5CEH A;  5TIS U;  1Q3V A;  3UXO A;  1K5O A;  3RJK A;  8ICU A;  3NG0 A;  4REZ A;  1E7V A;  1S3S G;  2LVQ A;  2A1A A;  3DVG Y;  4M9H A;  4IS7 A;  1WZ3 A;  3E2E A;  3NS1 A;  3KUZ A;  1HTO A;  3MHZ A;  3DBR B;  7ICN A;  3H1U A;  5DB7 A;  2EQY A;  2FIF A;  4RUC A;  2BCS A;  2WP9 B;  3I9V 1;  3O13 A;  4P0P A;  4C4V A;  3UF8 A;  4G50 A;  1L0V B;  1ZJN A;  2GLE A;  4Y2T A;  3TI0 A;  1BXT A;  4DFJ A;  1XO0 A;  1ZQL A;  4J9S A;  2BZF A;  4IRK A;  1KL9 A;  3PW0 A;  2C22 A;  2WB1 C;  5AI8 A;  9ICH A;  2NRX A;  3EWA A;  1DK2 A;  3BS5 B;  2J0K A;  4NPN A;  2BKF A;  4YD1 A;  3J81 j;  1XF5 L;  5DGB A;  1F52 A;  3PSF A;  3A0H U;  3UQ2 A;  1NYR A;  3FM9 A;  4I2J A;  2XCA A;  2J6S A;  3PLV A;  2LJI A;  4ED2 A;  2IZV B;  4R8U B;  2E5S A;  4TQ1 A;  5KT7 A;  4U7C A;  3Q8S B;  1KF6 B;  3PSE B;  4PZO A;  1QSY A;  3R7R A;  1MJD A;  4IC7 B;  1N63 A;  4PS3 A;  3THV A;  2ZXH A;  1Q0W B;  2DUY A;  2LAS A;  4RCO A;  2OCE A;  3ML8 A;  2DAJ A;  3HRD D;  2M56 B;  1SBB B;  3PS6 A;  2IO3 B;  2ASL A;  1QOA A;  3RB6 A;  2JEI A;  3PRZ A;  2BS3 B;  4MSM B;  1S0M A;  2ASQ A;  2HHT A;  4I2F A;  2H89 B;  2WDV B;  4DWF A;  8ICT A;  2G5H B;  4FZL A;  1QH9 A;  1UQV A;  4GXI A;  1JI7 A;  4O5K A;  3B0A A;  3N3K B;  4JGH B;  4K7U A;  3QYP A;  4YMN A;  2E6X A;  2ZZP B;  2KIV A;  2WHI A;  2JRI B;  2O6V D;  3OJ3 A;  4KGT A;  1IBX B;  4FS1 A;  4GGQ A;  4JUZ A;  9ICE A;  4M0W A;  4AQ7 A;  9ICX A;  2W9C B;  2KOB A;  4ECV A;  1SJE D;  1YX6 B;  4UBB A;  3QU7 A;  1DRG A;  1J7B A;  1NJW A;  2M9N A;  3HKZ F;  5G5G A;  3HM3 A;  2HMX A;  4YD2 A;  4RM9 A;  1FD6 A;  3NVV A;  2OH2 A;  4J9O A;  5ALW A;  3RFA A;  2MSN A;  3W1S C;  2MSE D;  2EAM A;  1AW7 A;  4ZHO A;  4CF5 A;  3K75 D;  5KFO A;  2R8K A;  2Y5C A;  1TK5 A;  1CUK A;  1YIW A;  4ANW A;  3IBE A;  1L7M A;  3GS2 A;  5ALV A;  1WM3 A;  2CN1 A;  3TL5 A;  2KC1 A;  2R8H A;  1HJP A;  2VKQ A;  2V1Y A;  4F1S A;  1T6B X;  5G55 A;  1KRH A;  5H2F U;  1NJZ A;  1NK6 A;  2K1F A;  3M9N B;  4OVU A;  1KW4 A;  2BQ3 A;  4YXM A;  2AYO B;  2KOX A;  3L16 A;  2H5X A;  3SV4 A;  4OZA A;  3ZRF A;  5ALM A;  4E71 A;  7ICM A;  1RFA A;  3SD5 A;  3PY8 A;  2HJ1 A;  4NJ6 A;  4JE3 B;  1A5R A;  9ICQ A;  4BKS D;  7ICJ A;  3GDX A;  5J18 A;  3ZD8 A;  1JIH A;  1ET9 A;  1E8X A;  4F4Y A;  4A8X C;  5AKK A;  2PFN A;  8ICS A;  4AOF A;  4MF2 A;  4JWN A;  4TMA B;  1JCK B;  3A9K A;  4XC2 A;  2HE7 A;  2JZB B;  2ZIW B;  5DQI A;  1L4Z B;  3R9K A;  1MI0 A;  3AEF B;  5GXG B;  2EAP A;  3SD7 A;  4DHZ E;  2WX1 A;  3A9J B;  1D9F A;  3IAS 1;  1I4R A;  4GIV A;  4ZRK A;  1V2Y A;  1TIF A;  3WKD A;  2ZIV A;  3IVF A;  5AM2 A;  1VRA B;  1BVS A;  3X23 A;  4C00 A;  5KFA A;  4TUR A;  3QIJ A;  1TK8 A;  2NO5 A;  3T9L A;  1K1S A;  2E1F A;  2LYA A;  3RJI A;  1TS4 A;  4M02 A;  1I4H A;  4RQN A;  2KQS A;  1U9L A;  4GOC A;  1WIA A;  4IM3 A;  5DBC A;  2INC C;  4MH0 E;  3PSP A;  3OG5 A;  2BDP A;  4UB5 A;  4LNK A;  1OFF A;  3RB0 A;  2BHN A;  4F5R A;  3WA0 A;  2DHZ A;  1OQY A;  3GFK B;  5BYR A;  3EGR A;  2Y9U A;  4BX9 C;  1B9R A;  2F2A B;  1N5W A;  3ONN A;  2HOF A;  3VTV A;  2Q4T A;  1BGX T;  4FFD A;  4OJL A;  3HW8 A;  1NDD A;  2O2V A;  4G0N B;  2QIE B;  5KG0 A;  1XSP A;  2P6R A;  2H3Q A;  1B22 A;  3PPA A;  3VRA B;  4CYE A;  4DXA B;  1V5O A;  3C2L A;  2IBK A;  4L1B A;  2LWP A;  1IIP A;  4UBC A;  4IKG A;  2INN E;  4JL9 A;  4EZL A;  4OW0 A;  1LKY B;  1NJX A;  4QZG A;  5I4D A;  3MR6 A;  3IHP C;  2WDT B;  1JUD A;  1RXW A;  3ZDE A;  4QZC A;  3GZN I;  3SAH A;  4O3P A;  2UVR A;  2RDJ A;  4NQK E;  3U52 E;  1ZQQ A;  1CK1 A;  3FDS A;  3UM9 A;  4JWM A;  3PW7 A;  1ZOL A;  4ACO A;  2BYV E;  5ALS A;  3PLU A;  4HEA 1;  2JRZ A;  2W43 A;  3P4Q B;  4HDQ A;  2DF4 B;  1ZQA A;  5BOL A;  4WWP A;  1SE3 A;  3APD A;  3VUX A;  3I28 A;  1S0O A;  1MG4 A;  1QQ5 A;  1T4G A;  4DQO C;  1NKC A;  4P0Q A;  3Q8M A;  3B1L X;  5AM1 A;  4DS4 A;  1ISN A;  4J9N A;  4LNO A;  1ZD3 A;  3IV6 A;  3NOB A;  4OD0 A;  3WKA A;  1A6S A;  2NRV A;  3ETL A;  5KFN A;  3Q2A C;  2NTS A;  5H92 C;  1L6U A;  4AS1 A;  3EPI A;  1FIQ A;  2WDR B;  4S17 A;  3Q8L A;  3U30 A;  3CNH A;  4AP9 A;  1AQ6 A;  2L00 B;  3BQ2 A;  2C60 A;  3JVZ X;  2K4H A;  3N20 C;  3JYU A;  4X5V A;  2KN7 A;  3MC0 B;  2D5G A;  4KLQ A;  3F53 A;  4B6J A;  5AKY A;  5KFQ A;  2HOQ A;  1Q5W B;  3ZO5 B;  1XCT L;  4CF4 A;  4KGS A;  2NRZ A;  2ON8 A;  1ZE3 D;  4W9I A;  2IGH A;  2DZI A;  4RQ5 A;  1XQQ A;  4JIO U;  4CF3 A;  4AUQ C;  4OZC A;  1L7O A;  3A1Q A;  1QLB B;  1TE2 A;  3LJ3 A;  2K8A A;  3UPQ A;  2EEL A;  2KN5 A;  5DB6 A;  7ICV A;  3N97 B;  1ZKH A;  1CEZ A;  2KDB A;  4P1B C;  1UUP A;  4QZD A;  2C7H A;  3GIL A;  4CCH A;  3AE4 B;  3UGB B;  2L3Z A;  2FLN A;  2W9B A;  2K8C B;  2RPQ A;  1R4M I;  4CO7 A;  5MPO A;  2HHX A;  2FUG 1;  4BAX A;  1A76 A;  2KAN A;  2ZW0 A;  1WR1 A;  3VR9 B;  5J2R A;  5ALF A;  2LHT A;  4IR1 A;  1IYF A;  5L9X A;  5AKE A;  5E6N A;  2NO4 A;  3HX0 A;  5HG2 A;  3AI5 A;  1I4X A;  1OQQ A;  3NVW A;  1WG8 A;  5ALD A;  4C4T A;  2Z0D B;  3HIZ A;  1C78 A;  3PRE A;  5CTR C;  3UI3 A;  4ARC A;  1ZQS A;  5FKA C;  5J29 A;  4EFO A;  2JY6 A;  3ZNZ B;  2DZJ A;  4DL4 A;  3QX7 A;  2H3I A;  4KLL A;  4GC7 A;  3MHS D;  5IN7 A;  4GDL A;  2Y9T A;  2MJD A;  2AHO B;  4IQW A;  4C0Z A;  2FLP A;  2IGG A;  4DOB A;  5AKZ A;  1U47 A;  5HR7 A;  3MC9 A;  8ICA A;  2BYE A;  4DDG D;  3RR7 A;  3UXP A;  3DDH A;  3I5J C;  1J2M A;  4ZYN A;  4A9A A;  5T8I A;  5KFZ A;  1ROE A;  4DQI A;  1VJ5 A;  2Y5B B;  4LDT B;  3RB4 A;  1XWL A;  1N48 A;  1YT3 A;  2C9W B;  1FFU A;  3C5G A;  3R8B A;  1SGG A;  2FI1 A;  1ZQI A;  3QAQ A;  4TUP A;  3UIP B;  5KAI U;  3V6K A;  2BW2 A;  2PJH A;  2IYD B;  1STE A;  1N62 A;  4EUT A;  1G6J A;  3GOE A;  4MSQ B;  2BTE A;  4I2C A;  2NMQ A;  3KKA C;  4B95 A;  3KHG A;  3VDZ A;  3RRH A;  4K1R B;  4JMU A;  2DAF A;  4LLG M;  3DVN V;  2BKR B;  3SEN A;  2DYB A;  4OJO A;  4Q2J A;  8ICR A;  1Y8R C;  4M0W B;  2XGP A;  1LB2 B;  1WX7 A;  3CST A;  1EWY C;  5GTI U;  4J9K A;  4I2H A;  5ALJ A;  3WAN A;  2FPL A;  4II3 B;  3EHV A;  3RD2 A;  1IG6 A;  2INP E;  3KQ4 A;  2KVS A;  1HXY D;  3VRB B;  2N9K A;  2JMG A;  3L4P A;  4KLD A;  1V80 A;  4MM3 B;  5CRX A;  4RFB A;  3GE3 C;  1WRI A;  2XIC A;  1IPG A;  2L1A A;  3NVY A;  2LRU A;  4HKZ E;  1QQ6 A;  2IDY A;  2ALZ A;  2K4P A;  2KHQ A;  3F5A A;  3AE1 B;  5GMV A;  3E58 A;  5AI5 A;  4AJY B;  2NS5 A;  9ICP A;  2KFJ A;  3L17 A;  3T5H A;  3RPF C;  3RJE A;  3SQI A;  4DSI A;  5J2F A;  1D4B A;  1WWT A;  3KUC B;  4XZ4 A;  1KLV A;  3ZXR A;  2XVT A;  2QIL A;  3HPO A;  5J0U A;  1VJK A;  3HHM A;  1DXS A;  1NNL A;  2WAQ C;  2LXC A;  3QC8 B;  4DDI D;  2KP7 A;  1Q3U A;  3AEG B;  2GBM A;  3ORY A;  2UVV A;  3UMG A;  2ZPN A;  3C1Z A;  1F2R C;  2WXM A;  3AE6 B;  8ICE A;  1VLB A;  5DG9 A;  2EAO A;  3LWL A;  1SIF A;  3LB8 C;  3QEB Z;  4ECS A;  1UF0 A;  1PQS A;  3QK0 A;  1SB3 C;  3DOW A;  3Q3N C;  4W9F A;  5G5H A;  1FNW A;  5AK3 A;  1NI2 A;  2WF5 A;  5AI0 A;  5J2A A;  4F5O A;  1JWB D;  3VTU A;  4FBT A;  2DPJ A;  2KSO A;  2BF8 B;  2W9A A;  4XWT A;  4YTM B;  5KHQ A;  2LHE A;  4DF4 A;  1TK0 A;  2F8L A;  5J17 A;  3V60 A;  1L4D B;  3D6J A;  1SE9 A;  3EC8 A;  4RQ4 A;  2ZIX A;  1DK3 A;  5BYQ A;  1M6Y A;  4P7I A;  3WCQ A;  5C1Z A;  1ZQX A;  4JQW C;  2IO0 B;  3ZJU A;  4OCZ A;  2MBB B;  3KD3 A;  4PHD A;  3KUD B;  5III A;  1MQ2 A;  3Q6B A;  2LXA A;  4MGY E;  3PV8 A;  5GTH U;  3JPN A;  1P98 A;  4MAC A;  1IV8 A;  2YEP F;  4GLS C;  3MFI A;  2LGX A;  3Q8F A;  4C8O A;  2WDQ B;  5BMI A;  4US9 A;  5ALO A;  5CWR A;  3QZ8 A;  4R8U A;  5IO9 A;  4FJV B;  2XI9 A;  1WFY A;  2GB1 A;  2N9P C;  3NUH B;  4KZC A;  2LBO A;  4C8K A;  2BR0 A;  5AZF A;  2HCF A;  1QT9 A;  3ZDM C;  2FMP A;  4QWC A;  4YL8 A;  2ZJA A;  4NAM A;  1WMH A;  1MG8 A;  1ZP0 B;  2E8O A;  1QSS A;  3PO4 A;  3T79 A;  2DNF A;  2P35 A;  3ALR A;  3B9J A;  3WAO A;  3PRM B;  1PGB A;  4O1N A;  2WU5 B;  1RQN A;  3QJZ A;  5L1L A;  3SHQ A;  2D3D A;  2LMC A;  1X40 A;  4YXD B;  2YB1 A;  3RYT A;  3RJH A;  3CW2 C;  3U26 A;  1RM6 C;  2JWZ A;  2C2D A;  1EUV B;  4YR3 A;  2K0P A;  4H2A A;  4WQM A;  5JXV A;  2LMR A;  1ECW A;  1JXL A;  2JQR B;  1AN8 A;  3ZLZ A;  2WXF A;  3N30 A;  5TSS A;  3IG3 A;  4I2A A;  2BCU A;  1HEK A;  1Z4O A;  4J03 A;  2WLB A;  4ED8 A;  1KFD A;  5KFR A;  3V7J A;  2MH7 A;  2FBW B;  3M95 A;  4CDG A;  4JK1 A;  3WK7 A;  1IM4 A;  4ECQ A;  1P7D A;  2WQY B;  1GJZ A;  1ZQM A;  4FHJ A;  4YFK A;  4NLG A;  3TCA A;  3TAR A;  3GZN B;  3Q8C A;  3VC8 A;  3VR8 B;  2A1J B;  2OOB B;  2UYZ B;  2WF9 A;  9ICV A;  2V4Q A;  8ICX A;  5J2K A;  5ALR A;  5L95 C;  1KLU D;  3H4D A;  3DHH C;  1COO A;  5EE0 A;  2W9B B;  4ZHP A;  4BOZ B;  2GOL A;  1FXT B;  2KK8 A;  4FS2 A;  2LHD A;  3AE3 B;  4YXJ A;  1CJE A;  3AE5 B;  1TKE A;  2PFO A;  4Q43 A;  4O3N A;  2LKY A;  1NK0 A;  1N60 A;  1FNU A;  4YN4 A;  1QF6 A;  2E8M A;  3V7K A;  2R2O A;  3O65 B;  3TAP A;  2C5L C;  1HQR D;  4RPX A;  1TKG A;  3Q3F A;  2LYB A;  3H8S A;  5E79 U;  5J2E A;  1JQ4 A;  4TUQ A;  3WU2 U;  2CR5 A;  4Z6F A;  4A3O A;  3C2M A;  1B4F A;  1ARO P;  3MR3 A;  4I6L B;  1KQQ A;  2MRL A;  2HHW A;  2WS3 B;  3NJT A;  3DBH B;  2XO7 A;  1B43 A;  3TFS A;  2PKE A;  5AI4 A;  4M8N A;  8ICH A;  3QA8 A;  4YTN B;  2VJ4 A;  4RNN A;  4FBU A;  1XXG A;  3NUQ A;  3H7P B;  4F5Q A;  4HLE A;  2HVH A;  2RR9 A;  4M0A A;  3TKA A;  4PHP A;  4UDU C;  3RUI B;  3D2S A;  2YLM A;  4RGM A;  8ICG A;  1LKY A;  2ZIW A;  3P2B A;  1T94 A;  3ZTC A;  1DOY A;  3JPT A;  1T5X D;  2ZPY A;  3OSP A;  2ZTD A;  1YD8 U;  1M4V A;  3V6E B;  2CHX A;  1TKY A;  2KTR B;  3C5F A;  9ICG A;  2WXQ A;  1TZO A;  2JYT A;  2K39 A;  1XO3 A;  5G2N A;  4N6E B;  5HHH A;  3WK6 A;  1X2I A;  2HOI A;  3VHT C;  2QB0 A;  3L3F X;  2K8B A;  3RJJ A;  2FCM A;  3WAL A;  4LTU A;  2YY6 A;  4B9M A;  3MR2 A;  3RI7 C;  1GAQ B;  2LM4 A;  4P2H A;  1T0R C;  3VTW A;  5J0Q A;  4IQU A;  3OWE B;  4HRS A;  2WAQ F;  3APF A;  4Q8F A;  2REX A;  4W9K A;  2L83 A;  1Z4N A;  1T3N A;  1KLN A;  3H8H A;  4GFJ A;  2MU2 A;  3L5K A;  4K3C A;  4P1C C;  5KG4 A;  4YSZ B;  4UW9 A;  4QWB A;  2ESE A;  4UAY A;  3J9C A;  4HJG E;  4W9D A;  3V6C B;  4PT5 A;  4HKQ A;  1OUQ A;  4FN2 A;  4FBJ B;  1HZ6 A;  1ZQW A;  2I1Q A;  4IR9 A;  4GB9 A;  5KHO A;  1ZQT A;  5KTQ A;  4LJP B;  4QZ8 A;  3PNC A;  2OEH A;  1KJT A;  4DSF A;  4OO1 J;  2JXJ A;  2EAN A;  2P66 A;  2PFP A;  4W9C A;  1V38 A;  5J8Y A;  1ZGU B;  4OVZ A;  5EWG A;  5KL8 B;  2W9C A;  3ECI A;  3U7D A;  5J2B A;  2KTQ A;  4UB3 A;  4NL9 C;  2B6G A;  5LLI A;  5CHG A;  2D3C A;  4I2I A;  4MFC A;  1FRD A;  1UEL A;  3KLS X;  3AED B;  4ECY A;  2AL6 A;  7ICG A;  4ECR A;  2KEY A;  1QKZ A;  2KSO B;  4O9M A;  4MH8 A;  1WWU A;  3GII A;  4DL6 A;  3E0F A;  1WZ0 A;  1UPH A;  3IFW B;  4KKJ A;  4KLU A;  2VH2 A;  3H9D A;  3PX6 A;  4JB3 A;  1BPB A;  1ZJM A;  4M9G A;  4HPP A;  4B0M A;  4IM0 A;  3K1Z A;  3PW2 A;  2KAJ A;  2C2E A;  3AL0 B;  3OJ4 B;  2MBQ A;  5KFC A;  5DQH A;  4O5C A;  5HHI A;  3R3M A;  3DWM A;  1V97 A;  5DB9 A;  3MGI A;  4ECU A;  2AGO A;  2PEA A;  1V5T A;  1S9F A;  2JXX A;  2G08 A;  5C2T B;  5IP4 D;  2L05 A;  2N7J A;  2K8B B;  2NVU I;  1SE2 A;  2N4F A;  3DBR I;  3TMP B;  4CE6 A;  5EDS A;  3BVZ A;  2AQ0 A;  2ZIU A;  3H8J A;  4QZF A;  1K50 A;  3AE7 B;  3AEA B;  5LXI B;  3M8R A;  2Y1J A;  4I27 A;  2ZTE A;  2LI5 A;  3P4P B;  2JEF A;  3QUT A;  4ANU A;  2IPK D;  1B1Z A;  2IMW P;  3L0W B;  3N1X C;  1FO4 A;  3WKE A;  4EOY A;  2YMM A;  1FCC C;  1S76 D;  1U48 A;  3OTQ A;  1L3U A;  5HNK A;  1GB1 A;  3ZJT A;  4JV0 A;  4QZE A;  3MBY A;  4DSK A;  3T5J A;  3MC1 A;  2KVZ A;  3L10 B;  5J2I A;  2G5I B;  3M1Y A;  2LVO A;  1SKR A;  1AAR A;  5HMM A;  4N59 A;  3DEE A;  4KX6 B;  3RJF A;  4P0P B;  2FMQ A;  1PVP A;  4QWD A;  2XY6 A;  1T7P A;  4FHK A;  1WXS A;  3QU4 A;  4TUS A;  1WX8 A;  4GIB A;  4CRX A;  2I6X A;  1TTN A;  4HDO A;  4FJZ A;  4OJP A;  4TSS A;  1C4P A;  1WGH A;  3RBE A;  4FAD A;  5AKJ A;  2CKH B;  2IHM A;  4ANV A;  3Q8E A;  4O5E A;  1ZD4 A;  2Y0S F;  1RRB A;  3T3F A;  2VH1 A;  3D2N A;  5J2D A;  2OWO A;  5JHA A;  3QNM A;  5J0W A;  3HKZ C;  3NZ3 A;  3Q3M C;  5BMG A;  4PYZ A;  4IWP A;  3TUO A;  3EA6 A;  4I28 A;  3Q8Q B;  3I1Y A;  4ECT A;  4NWI A;  2F8K A;  5C23 A;  3M63 B;  1QQ7 A;  3C29 A;  2F3N A;  1OEY A;  3QUC A;  4M6W A;  4NJ8 A;  3RNA C;  1GC6 A;  4O3S A;  1D5X C;  4J9Q A;  2KD1 A;  3V7L A;  5IKC M;  1XNS A;  4MEM A;  4W9G A;  1ZRM A;  4UQG A;  5DLF A;  4XUS A;  3M9O B;  2H3Z A;  4DXG A;  5J2C A;  3G6Y A;  4PGY A;  2PVO D;  1NOM A;  3QU2 A;  3MGH A;  4W9H A;  4UAZ A;  8ICK A;  2MWS B;  5CJ7 A;  2XY7 A;  2NBU A;  2AGQ A;  2XCP A;  4KLI A;  4WAA A;  3B2G A;  4F5N A;  1JML A;  3SAG A;  1C77 A;  4RQ3 A;  2JEJ A;  1WCL A;  4HK2 A;  4IRC A;  4ECX A;  1JWS D;  4MJS A;  2DKX A;  1P0R A;  5IAA C;  3ZRC A;  2M0A A;  3ISD A;  2GBK A;  4B6W A;  1FXI A;  1X66 A;  4MEX A;  2G4S A;  4EEY A;  4YMM A;  3PX0 A;  2Z59 B;  2NYV A;  2FE8 A;  5L1K A;  4I2G A;  4GU2 A;  1JWU D;  2HDO A;  3AU4 A;  2KWD A;  2EDU A;  1J2N A;  8ICV A;  9ICO A;  3Q8K A;  4KLO A;  2PMZ C;  1TS2 A;  4RT2 A;  5IIM A;  4IM2 A;  5KT2 A;  2N0S B;  7ICL A;  2ZUD A;  1SL0 A;  1RWS A;  1XS9 D;  3QX1 A;  4F4W A;  4BJQ A;  2AX5 A;  5KFK A;  2G1E A;  1RQL A;  3BDP A;  1GPX A;  5HHD G;  3ML9 A;  4K7S A;  3A0B U;  1DOI A;  2JR5 A;  5DPS A;  4R63 A;  2EZX A;  3DBL I;  1BT0 A;  1K53 A;  5D4B A;  2KX3 A;  4JLC A;  2QB1 A;  2KO3 A;  2JH7 A;  3GU3 A;  4KX3 A;  3BQ1 A;  2BT6 A;  3BWU D;  3ZW3 A;  4RQ7 A;  2KHW B;  5AI9 A;  1SGH A;  3X0W A;  1Z00 B;  3SU8 X;  2KMD A;  4KVG B;  5ALG A;  1I4G A;  1Z2M A;  5AM4 A;  5B5E U;  3ZDC A;  3IT4 B;  3ZDD A;  1N61 A;  4A20 A;  3PO5 A;  4F2S A;  1E8Y A;  5KT5 A;  2KVC A;  3BY4 B;  4F72 A;  3IG5 A;  3AU2 A;  4RNA A;  2BWF A;  1YJI A;  2KXJ A;  5EE3 A;  4EYI B;  1SXE A;  5KAF U;  1FCL A;  5BMH A;  4R65 A;  3K4G A;  2ZJ8 A;  4WJQ A;  2CU1 A;  3A9J A;  9ICL A;  2N9X A;  4AP4 C;  4ZOH C;  4WQO B;  4C8L A;  4PHE A;  3VH4 B;  3H4B A;  2AJQ A;  1WE7 A;  1JRU A;  1XU4 A;  3GV8 B;  3DBS A;  5FP0 A;  4K4G A;  3T5K A;  1TV9 A;  4Q45 A;  2LFI A;  4MGK E;  1V9J A;  2FMS A;  1S0V A;  2ZVO A;  2CRX A;  2BDU A;  1UT8 A;  3VFK A;  2BBC A;  3MDA A;  4YR2 A;  3MFH A;  4NLB A;  2XC9 A;  1HZ5 A;  1KLG D;  5D7G A;  1MHH E;  5AI6 A;  3JPO A;  4ZRP A;  3RNE C;  1L5U A;  4OJ6 A;  3PMN A;  4GXB A;  2HBM A;  5ALT A;  3HUI A;  2XY5 A;  1U4B A;  3SI8 A;  1YOV B;  4FA6 A;  3CRX A;  2J4X A;  3GP7 A;  1GC7 A;  3ISB A;  4YR0 A;  1E7P B;  5AM5 A;  3RNB C;  5KFF A;  3PX4 A;  4DCC A;  4IUM B;  2IBI B;  4B9L A;  3F2D A;  2KK0 A;  4ECZ A;  2LD9 A;  2YVC A;  1Y88 A;  1VZ6 A;  5L1J A;  3ZGZ A;  5KFE A;  4ARI A;  1C4A A;  1I4P A;  4QZB A;  4MDK E;  4AYB F;  1X9M A;  3UQ0 A;  1O08 A;  4L2Y A;  1UHU A;  3C1Y A;  4R66 A;  1TBE A;  3C23 A;  1T0S C;  2X8X X;  2BWE S;  2PE9 A;  1C20 A;  4WJO A;  3SDL C;  1JN3 A;  1WM2 A;  1ZXH A;  2CJN A;  4UAS A;  1MN8 A;  4KSL C;  2BGW A;  2Y1I A;  4EZK A;  2BYF A;  1TAU A;  5DG7 A;  2KC2 A;  2D11 A;  4HYK A;  8ICB A;  4CQN A;  1YJ1 A;  2O6V A;  2PXI A;  7ICH A;  1ZQZ A;  2MJ3 A;  3IRU A;  3ZKJ C;  7ICR A;  4GSW A;  1SWW A;  2KFK A;  1IBX A;  2K22 A;  2J0J A;  3K1R B;  3T5L A;  2WX0 A;  2QDF A;  1I4Q A;  2D3G A;  3DPD A;  3VH3 B;  2YQE A;  4F71 A;  1UGJ A;  3ZNG C;  3PTF C;  2NBV B;  7ICF A;  5AEK B;  5DKW A;  2MRP A;  3ZD9 A;  5KFD A;  1SV0 C;  2C2R A;  2H88 B;  3RZW C;  4EX6 A;  1ZRN A;  3WK4 A;  1S0N A;  2KYW A;  4DWI A;  1C79 A;  1E10 A;  5DPW A;  1WYG A;  4F4K A;  2KMA A;  2YEP B;  5KG1 A;  4UAT A;  4ECW A;  2MLB A;  3AQF A;  3CWI A;  2KDM A;  4ZYS A;  2AU0 A;  3DHG C;  4BBN C;  1Q8K A;  3L08 A;  3KOO A;  5DDM A;  2F44 A;  5C3J B;  2DBY A;  3BZK A;  2H3V A;  5D6J B;  8ICW A;  3KVF B;  4DHJ B;  2JGA A;  3R66 C;  4OVV A;  3SMV A;  4ELU A;  1L2N A;  2BCV A;  3H0R B;  2UWQ A;  2FUH B;  3PGE A;  4Y2J A;  4TUU A;  1WUD A;  1F0Z A;  5TR5 A;  4Y2S A;  2W8L A;  4RQ2 A;  2ZEQ A;  3RR8 A;  1D5Z C;  2LJ5 A;  3F2B A;  1V86 A;  1ZQG A;  2E8N A;  3QWZ B;  2PLP A;  2ZG6 A;  1FFV A;  4URK A;  3QCA A;  2AH5 A;  3UQB A;  2W54 A;  2FLL A;  2CXY A;  1T8E A;  1TZ1 A;  1LO5 D;  2Y3A A;  2ZW1 A;  4EZ6 A;  3D32 A;  2N7D A;  1E7U A;  2WWZ A;  3HVD A;  2KZ3 A;  1WJN A;  1WCN A;  2EZY A;  1LXD A;  4ELV A;  2MBH A;  1RYJ A;  3PST A;  3TSS A;  1XLN A;  2ZNV C;  3RNF C;  3ZUN A;  1VDV A;  3W5V B;  2OM6 A;  2KFN A;  2PTL A;  3T3O A;  4DS5 A;  3PV1 A;  4NJC A;  1GOZ A;  4ZH4 A;  4RZR A;  2V4L A;  4IG7 B;  2YB4 A;  2HBK A;  3AEV A;  1GB4 A;  4NL9 A;  3TEW A;  2JZB A;  1ESF A;  4TKN A;  3TAD C;  2IY0 B;  2K9X A;  2LI6 A;  2I1J A;  3AUL A;  2CHW A;  2O6V B;  2WF8 A;  3NTU A;  4NLZ A;  2O6K A;  1XEE A;  4ANX A;  1ZQ1 C;  2IOH A;  4Z6D A;  3I76 A;  3QZ7 A;  2R8G A;  2HD5 B;  2MJE A;  5F3X B;  1A70 A;  2DPI A;  1HE8 A;  2GLS A;  2KFK B;  3GIK A;  1U49 A;  1LM8 B;  3H8W A;  3EUB 2;  4DSL A;  4ED1 A;  5L1I A;  1ZQH A;  4LNI A;  2QHO A;  4BKT A;  1FMA D;  2UVU A;  1XLP A;  2KLC A;  2OYY A;  5CR0 A;  3FKY A;  4LNF A;  4IDI A;  3IN5 A;  4ZRJ A;  2IOF K;  1UH6 A;  4RQ1 A;  2FDR A;  1GNU A;  1MFW A;  2V0G A;  2KZR A;  3Q3O C;  3VUW A;  5KFV A;  2D07 B;  4M00 A;  3LDA A;  2KIC A;  7ICQ A;  3C21 A;  1E8W A;  3AQE A;  4MEY A;  4DL3 A;  4PYU A;  2RD0 A;  3RT3 B;  2ATL A;  1V85 A;  1IP9 A;  8ICP A;  4B9N A;  2DLB A;  2KT7 A;  3TAN A;  3ZDT A;  1RYR A;  2JYE A;  2G0A A;  2YML A;  4R64 A;  1BNP A;  2HHQ A;  1MHX A;  2JHD A;  2OXO A;  3TAQ A;  3GIJ A;  2AQ3 B;  3QEA Z;  2ACZ B;  3KKA A;  4ZDV A;  2RPV A;  1FNV A;  4NV0 A;  8ICZ A;  4AYB C;  3BK2 A;  1SF0 A;  2JZP A;  4RQM A;  5AKI A;  2WXG A;  4O3Q A;  3L54 A;  2MX2 A;  1NK8 A;  1SL1 A;  1PVR A;  1N2X A;  2VAN A;  4GXJ A;  2KJ9 A;  2WNM A;  2L8J A;  4NM2 A;  1WGY A;  2CPR A;  1TJE A;  5KFW A;  2KWU B;  2C28 A;  1XD3 B;  3RFZ B;  2KQ4 X;  3MP9 A;  4QAY A;  2FJ6 A;  1NKB A;  1NK5 A;  5AKH A;  4DF8 A;  1TAQ A;  3AUO A;  2GRI A;  4G3I A;  3RUL A;  3SYZ A;  3WK8 A;  2KWC A;  1N6Z A;  3OJU A;  4BWM A;  4GXK A;  2K3U A;  5ALN A;  1X9W A;  1P9D U;  1YNT E;  3ZQ4 A;  4B0E A;  2KFZ A;  1WXM A;  4KLJ A;  4GDK B;  2G07 A;  4Z6E A;  3I63 C;  9ICB A;  5H8Y E;  2R18 A;  3CSF A;  1YQ3 B;  3SR6 A;  1AYF A;  3V62 A;  4KLS A;  4LZG A;  3ABV B;  4MGI E;  1RDF A;  1ZDX A;  1UCV A;  2A5U A;  3AB5 A;  4WJ3 B;  3OJS A;  8ICL A;  2JV3 A;  1F0M A;  1S97 A;  3GZF A;  1V81 A;  1TVA A;  2KJ5 A;  2NTT A;  2KG5 A;  2BQQ A;  4O3R A;  3HT3 A;  1ZQN A;  3HP6 A;  5FR6 A;  4EZJ A;  2KJH B;  4KSK C;  3NHE B;  5L83 A;  5CHV C;  5ALU A;  2YTU A;  1UWM A;  3VCB A;  4DLG A;  5DLG A;  2KJR A;  3RZF A;  2IGD A;  3N1Y C;  3DWG C;  3BS7 A;  4KTQ A;  1HEZ E;  5IOI A;  3F5E A;  1TS3 A;  3WIM A;  3UMC A;  4DL2 A;  1C1Y B;  2LGI A;  1H8C A;  1F77 A;  1UGM A;  3APC A;  2PI4 A;  1LGR A;  4RPY A;  3BZC A;  4QIW F;  3BJY A;  2VZK B;  4KGR A;  5D94 A;  1KKX A;  3N9Y C;  4MHV A;  3A33 B;  2PMV A;  4BWJ A;  2Z0E B;  1F5S A;  2MA1 A;  1NK9 A;  5AK6 A;  2NPT A;  2MUT A;  5HML A;  4M2Y A;  2D10 A;  3P1M A;  4E74 A;  3QHT A;  5HI1 A;  1PZN A;  3OHA A;  3AN1 A;  3SEI A;  2ZUB A;  4KLG A;  2DYO A;  3PHW B;  2HBJ A;  3OAW A;  3GIM A;  9ICC A;  5JH5 C;  2E8P A;  4F4X A;  4EBC A;  4NNJ B;  2Y5P A;  3NRZ A;  5KFY A;  1K51 A;  1PGA A;  2QLT A;  2F77 X;  2B21 A;  4M8M A;  2LM1 A;  2GWS A;  2WF7 A;  4DFK A;  2K8H A;  4PS8 A;  4BUG A;  3PR4 A;  3AEE B;  4GC6 A;  2BS4 B;  2I1K A;  4FZM A;  3AE9 B;  4HCP B;  2LYH A;  4YT0 B;  2KD0 A;  2PKO A;  4IC9 A;  2I38 A;  2KTF A;  4ICA A;  4MF8 A;  2R2Q A;  4IWQ A;  2KIW A;  1XCQ L;  4FJY A;  4A6Q A;  3G6V A;  4RQ6 A;  2HVI A;  4HPL B;  5JZE B;  1J0G A;  1P3Q U;  2CJO A;  5IIO A;  9ICA A;  3CIR B;  3H7I A;  1H4R A;  5AUK A;  1MQ3 A;  1D8L A;  2ISP A;  4TQS A;  1ED1 A;  8ICF A;  2QSD A;  4RM8 A;  2R8J A;  3M3J A;  4RNO A;  1PVQ A;  3KHR A;  4MT5 A;  2J42 A;  1NEK B;  4RQ8 A;  5KFB A;  3PZP A;  4NLN A;  2D8C A;  2I2Y A;  4DOA A;  1OGW A;  2QC8 A;  5BO4 B;  2RDB C;  1FXA A;  9ICS A;  2TSS A;  3LDZ E;  1SKS A;  2ZVN A;  4EBE A;  4M9J A;  8ICM A;  2V4R A;  1WXA A;  4EEW A;  1XSL A;  4I2D A;  5KG3 A;  4DEZ A;  9ICU A;  2NCN A;  4X57 B;  5JUM A;  3RH4 A;  4K3B A;  4Y2Q A;  2AQ1 B;  4FO6 A;  7ICK A;  3PVX A;  4DK5 A;  3FC4 A;  1YX5 B;  5J0S A;  4XA5 A;  2V9H A;  8ICO A;  1SJH D;  1RPL A;  3IG8 A;  1KSP A;  2W3R A;  2W7O A;  1L3S A;  4J6I A;  5KT3 A;  1JMS A;  5EE9 A;  4NXZ A;  5IIK A;  4BGD A;  4KIT B;  3GQC A;  1NK4 A;  1WJ6 A;  1N56 A;  1SXT A;  2XEW A;  5JRT A;  5J8Y C;  1L6V A;  3U4E G;  4QZ9 A;  2HW3 A;  4A3P A;  4KLH A;  3N7R C;  5KFP A;  2GO7 A;  4KLF A;  3LXF A;  3L13 A;  2ZCB A;  3AV8 A;  4QWE A;  1Q1O A;  2IO2 B;  4EE2 A;  4QZH A;  2BGF A;  3UIO B;  2L76 A;  2M8S A;  1ZQO A;  1ZQE A;  2MW5 A;  2QEJ C;  1RXV A;  4EX7 A;  4MFF A;  3EW9 A;  4FXC A;  2KLG A;  2EMS A;  2WF6 A;  4M6W B;  3VQI A;  3TFR A;  3UMB A;  4JV2 A;  4R3D A;  3LK9 A;  5DBA A;  3A9K B;  1HUZ A;  1FRR A;  2JZZ A;  1S8O A;  3OHB A;  3Q8B A;  1L8O A;  2DGZ A;  5EWF A;  2KAC A;  4GDL B;  1K52 A;  1SSN A;  3W1Y A;  2WU2 B;  3ZDB A;  5BOM A;  5BYS A;  3WK5 A;  2BPC A;  4P4O A;  5KFT A;  1J7C A;  2RDI A;  2RHF A;  4I2B A;  5CHF A;  3NGD A;  3UXN A;  4IL6 U;  3AEB B;  4AWJ A;  3S6J A;  5ALK A;  4C8M A;  3A1Q B;  1ZPS A;  4I6N B;  1Q10 A;  2K6D B;  4BKS A;  3FAH A;  3P4R B;  4UAV A;  4B9S A;  2Z7J A;  4KDL B;  2LEK A;  1R7S A;  1TY0 A;  4NLC A;  4OZB A;  3IP4 B;  5BPC A;  2VA2 A;  1BNO A;  7ICU A;  2K25 A;  1ZD2 P;  4I2E A;  4KN7 A;  3H8M A;  1QZE A;  4TQR A;  2K8C A;  5D2M B;  1KFT A;  4C8N A;  3ETR A;  4PK1 A;  5CHW A;  3VAW A;  3QUB A;  1C76 A;  2WYQ A;  1VZ7 A;  5HP4 A;  1YN4 A;  3RJG A;  3UQA A;  3T3N A;  2G9H D;  2KDI A;  4ELT A;  4RU9 A;  4ED0 A;  3EEC A;  5HKH A;  4W9J A;  4O3M A;  1AWD A;  2RDH A;  2VZK D;  4XGA B;  3BS5 A;  4B9U A;  1C4C A;  5KFU A;  4PGQ A;  4RGN A;  2GOW A;  4JV1 A;  2GH1 A;  2FNJ B;  3I57 A;  2L5Y A;  2MHJ A;  4IRD A;  4BZA A;  2D3A A;  4RGO S;  1ZDV A;  4W9L A;  5AZH A;  5TZV A;  1CMX B;  4P0Q B;  4KN4 A;  2N9L A;  2XNA C;  4K4H A;  4PHA A;  1X9X A;  4DFD A;  3AMZ A;  2BPF A;  3NY5 A;  4HXD A;  1RAX A;  4YTP B;  2JF5 A;  3W9C B;  4BDP A;  5HR6 A;  3CP8 A;  2J52 A;  2YMP A;  1Z19 A;  2HHU A;  4A55 A;  5CA7 A;  1KM7 A;  4LK0 M;  3NRW A;  2IJ0 A;  1NVI D;  3C28 A;  1WJU A;  1I35 A;  3V6J A;  3V6H A;  5KG6 A;  2I9G A;  1WR6 E;  2ZUC A;  1SL2 A;  2PMZ F;  3MC8 A;  4DBG A;  5T14 A;  3KHL A;  1TAM A;  2ZJ5 A;  3QXG A;  5J0Y A;  1V1O A;  5D3D A;  4K81 A;  4NAW A;  4QNL A;  3SFE B;  2BQU A;  8ICC A;  4PGX A;  2BCQ A;  2UU7 A;  4J3O D;  3W1S A;  5EOZ A;  2PPH A;  3IDW A;  1ACC A;  1RLF A;  4F2R A;  4YSY B;  3PML A;  2ZCC A;  3AXC A;  2MUT B;  3KYC D;  2BYT A;  4ED7 A;  2L0T A;  3G6X A;  1SV0 A;  4OJ5 A;  4C56 C;  4J9M A;  2HSZ A;  2N1V A;  1NI3 A;  5KFH A;  1YJJ A;  2FE9 A;  3RF9 A;  4ITK A;  4N58 A;  1ZQF A;  4A8E A;  4II2 B;  1Z1B A;  5KG7 A;  5KFL A;  4YP3 A;  4DFP A;  1NEN B;  2L32 A;  1CI4 A;  5AKG A;  3A4R A;  3E9S A;  4P16 A;  9ICW A;  1S1Q B;  2WXJ A;  1WY8 A;  3B0Y A;  4UB1 A;  3RH5 A;  3URY A;  3TEY A;  2BPS A;  4KKI A;  1WGR A;  4KZ0 A;  3PZ8 A;  1PUZ A;  2PFQ A;  4Y2V A;  4QIW C;  3T8M A;  2GI9 A;  2KTR A;  2DWQ A;  2V3S A;  3SFD B;  4DQR A;  4NY0 A;  1Z5S B;  3EYZ A;  3Q8R B;  2GBN A;  2HTM E;  2LUE A;  4WWN A;  2XGQ A;  2AXT U;  3M9M B;  9ICK A;  2IHN A;  3BYY B;  4M9L A;  4C7Z A;  3PR5 B;  2QCZ A;  2KN4 A;  1RYS A;  3VUY A;  3KTQ A;  3VXW A;  4EKU A;  2EZZ A;  2KV2 A;  5J0O A;  5DDY A;  1FEH A;  2WXN A;  3TBL D;  1S5L U;  4KLT A;  3RCZ A;  3N7P D;  5AHX A;  4Z6C A;  1YN5 A;  4KLE A;  2W9M A;  3LVW A;  2WGS A;  3B2F A;  3Q3J A;  2JVC A;  3RMK C;  1CQV A;  1EO6 A;  1NKE A;  2DZK A;  2FCN A;  3ALB A;  4WWO A;  2MAX A;  4MGZ E;  2H3F A;  3HJE A;  1F44 A;  1L7Y A;  4HWI B;  2DX5 B;  5KFG A;  2P6U A;  3W2D A;  4USA A;  3DVG X;  5AIA A;  2DL0 A;  1RG6 A;  4DSE A;  2CS4 A;  5ALI A;  1C7Y A;  2KZZ A;  4WJP A;  1DYQ A;  2W04 A;  4UB2 A;  4FZN A;  3AH7 A;  4B9K A;  3GV7 B;  4PS7 A;  3WKB A;  1E0Z A;  4EYH B;  4M04 A;  5ALH A;  4QW8 A;  2M0X A;  5F9N A;  1PYW D;  3TJP A;  4RT3 A;  2BPG A;  5C0Y A;  4IW0 A;  2NRT A;  4RNM A;  3PT2 B;  4NZL B;  2YN4 A;  3QU9 A;  3FIL B;  3P42 A;  3GV5 B;  4JX1 C;  2V4I B;  1S10 A;  1WXV A;  4RH6 A;  3QU5 A;  2ZXI A;  2NR2 A;  7ICS A;  3GB1 A;  4YMO A;  5J0T A;  1BPX A;  2LGY A;  3TAD A;  3KH0 A;  2W9N A;  4MM3 A;  3K9P B;  5JHB A;  2G06 A;  1JRP A;  4P4M A;  3ZNI D;  3M6Z A;  4WAF A;  2JWU A;  3Q8P B;  1EU3 A;  3DBL B;  5E6O A;  1J97 A;  1EXN A;  2VA8 A;  3JPR A;  4F91 B;  1EM7 A;  1V1P B;  3KHH A;  2VRR B;  2G3Q B;  3M8S A;  3SAF A;  4HJK A;  4NJ7 A;  3HK0 A;  5DGA A;  4F93 B;  4ASW C;  1J8C A;  5AKX A;  5AM3 A;  4ZRI A;  3RRG A;  2J0M A;  4NLK A;  1LVH A;  1N5X A;  2LRW A;  2MBE A;  2DYM A;  3QQ8 B;  4QZI A;  1KN5 A;  1M94 A;  4KMU A;  4PH5 A;  5J0R A;  2L7R A;  7ICI A;  3PVL A;  4DHJ D;  1TY2 A;  4P6V F;  3HVZ A;  1WI0 A;  1QSL A;  4PPX A;  3V61 A;  2G4D B;  4XDD A;  3R2I A;  5J2H A;  3C8Y A;  2ZNV B;  2MQJ A;  4GN1 A;  4Q44 A;  2SEB D;  5D3I B;  3N7S C;  4CHK A;  4EZ9 A;  1LFD A;  2MBO A;  3ZVV A;  3O0F A;  2AQ4 A;  4NM1 A;  5DQG A;  2BB6 A;  1WYW B;  2DKZ A;  1QOB A;  2WXK A;  1KTQ A;  2N9E B;  2SAK A;  3H0M B;  1V49 A;  1VD2 A;  2KWV B;  1WGG A;  3ED5 A;  4YSX B;  3RBD A;  5A0L A;  4UB4 A;  4WUR A;  1IXR A;  3ZTD A;  1ZQK A;  4RPZ A;  2QMT A;  4RUA A;  8ICQ A;  1KFY B;  4QWA A;  1X42 A;  5D46 A;  5DCN A;  1EWC A;  3VVW B;  4O0I A;  1S77 D;  3ZI4 A;  2EKE C;  1SZP A;  8ICJ A;  1SEB D;  3P4S B;  3DQV A;  4LZD A;  4J9P A;  1J19 A;  5F9L A;  3CF6 E;  3EPG A;  3N4M B;  5ALQ A;  4Y2U A;  9ICM A;  2M19 A;  1L7N A;  2GMI C;  2QAR A;  3RTV A;  3IXS A;  2JRH A;  1T0Y A;  4UAU A;  1XSN A;  1LQB A;  2C7M B;  3PW4 A;  4DFM A;  4LVS A;  1SZH A;  1WX9 A;  1TS5 A;  1SE4 A;  2KJ6 A;  3TIX A;  2B76 B;  1KRP A;  2KDF B;  2ES6 A;  3M6K A;  5ALY A;  3I3T B;  1WXQ A;  5J0X A;  3OLM D;  2WB1 F;  1VR9 A;  1NYQ A;  2WXP A;  4C4R A;  2R8I A;  3DVN U;  3H7P A;  2JZ3 B;  2MEK A;  2K4E A;  2W3S A;  4DLE A;  5EWE A;  1VCB A;  3WK9 A;  2FCS A;  1WF9 A;  4PZN A;  4EBD A;  2EKI A;  4KV2 A;  3CYM A;  2GBR A;  2MP2 B;  1ZQY A;  5J2J A;  3N1Z C;  3JPS A;  1BPZ A;  5JTI A;  9ICJ A;  8ICI A;  1PGX A; 
#chains in the Genus database with same CATH homology
 1YN3 A;  2GRI A;  2X38 A;  5G5G A;  1GAQ B;  1FD6 A;  3NVV A;  1YMH E;  3OWE B;  4HRS A;  4ZRQ A;  1UWX A;  1AW7 A;  1EU4 A;  2K3U A;  2L83 A;  2RMM A;  4ZHO A;  2WXO A;  1YNT E;  3ZQ4 A;  4B0E A;  3H8H A;  4GDK B;  2Y5C A;  4YSZ B;  1ZUD 2;  5H8Y E;  1YQ3 B;  3GS2 A;  3J9C A;  4HJG E;  3SR6 A;  1AYF A;  3ABV B;  4PT5 A;  4HKQ A;  1ZDX A;  1T6B X;  2LUM A;  1KRH A;  3AB5 A;  1HZ6 A;  1ZXI A;  2WXH A;  2NTT A;  3PO0 A;  4OZA A;  4OHJ A;  2E3T A;  1UWM A;  1Y56 A;  1BML C;  4OVZ A;  4DXF A;  2IGD A;  4JE3 B;  3DWG C;  1HEZ E;  1TS3 A;  1ET9 A;  1FRD A;  2LGI A;  3KLS X;  3AED B;  4A8X C;  1F77 A;  3IAM 1;  3W5U B;  1QKZ A;  4TMA B;  1JCK B;  4MH8 A;  5HFY A;  4KGR A;  2VZK B;  4KKJ A;  1L4Z B;  3N9Y C;  5GXG B;  1MI0 A;  2PMV A;  3AEF B;  5LNK 1;  1IGC A;  3IAS 1;  1I4R A;  4B0M A;  2BB5 A;  2KAJ A;  2ICI A;  3P1M A;  1VRA B;  5HI1 A;  3AN1 A;  3DWM A;  1V97 A;  2JX5 A;  3LYY A;  4HRO A;  2DYO A;  4XWW A;  1TS4 A;  5C2T B;  1QOG A;  1XLQ A;  2N7J A;  3NRZ A;  1I4H A;  4US8 A;  1K51 A;  1PGA A;  2Y5P A;  1SE2 A;  3BVZ A;  3TEZ A;  3AE7 B;  1K50 A;  1OFF A;  3AEA B;  3KWV A;  2W82 A;  5BYR A;  1P7F A;  2BS4 B;  3NVZ A;  3AEE B;  3EGR A;  3U7Z A;  4D2K A;  2WXL A;  1B9R A;  1N5W A;  3P4P B;  3AE9 B;  2WXR A;  4YT0 B;  2QIE B;  2PKO A;  1VZ8 A;  1YQ4 B;  2IPK D;  2PIA A;  2I38 A;  1B1Z A;  3VRA B;  1FO4 A;  1XCQ L;  4L1B A;  4WWM A;  4A6Q A;  4IKG A;  2INN E;  1FCC C;  1CZP A;  4OW0 A;  4RF0 A;  5I4D A;  2CJO A;  4IOI E;  3CIR B;  3MJ5 A;  5AUK A;  1GB1 A;  2QSD A;  3ZJT A;  2L52 A;  3U52 E;  1CK1 A;  2QJL A;  4MT5 A;  4N59 A;  4KX6 B;  2J42 A;  1NEK B;  4HEA 1;  3P4Q B;  4RGT A;  2I2Y A;  1FXA A;  2TSS A;  1SE3 A;  4TSS A;  1C4P A;  3R2T A;  1L0X B;  2PVG C;  1DOX A;  3Q8E A;  3AM9 A;  3IT6 B;  1WGK A;  4DQO C;  4C80 A;  2AQ1 B;  3Q8A A;  2RDG A;  3FC4 A;  1D6E C;  2JXT A;  3NZ3 A;  5BMG A;  1SJH D;  2J53 A;  4L23 A;  3TUO A;  3EA6 A;  2W3R A;  2NTS A;  5H92 C;  1OQR A;  2CU3 A;  5EE9 A;  1L6U A;  4AS1 A;  1FIQ A;  1SXT A;  1WSP A;  2WDR B;  1L6V A;  3U4E G;  1D5X C;  4RF1 A;  3LXF A;  3MC0 B;  2D5G A;  3AV8 A;  4A90 A;  1JRO A;  4DXG A;  4EE2 A;  1XCT L;  3ZJV A;  2PVO D;  4KGS A;  2QEJ C;  2ON8 A;  2OED A;  1ZE3 D;  2IGH A;  4FXC A;  5EE1 A;  4YWG G;  3B2G A;  4OZC A;  1JML A;  1C77 A;  1QLB B;  3BII D;  3BVM A;  2EEL A;  4JPS A;  3VQI A;  1IGD A;  4R3D A;  4C7Y A;  4NAW B;  1FRR A;  1UUP A;  2WXI A;  1JWS D;  3AE4 B;  3Q8B A;  2M0A A;  2KAC A;  1FXI A;  3ZYY X;  4GDL B;  1K52 A;  1SSN A;  2WU2 B;  5MPO A;  1V8C A;  2FE8 A;  1MPE A;  2FUG 1;  5BYS A;  1JWU D;  2ZW0 A;  2KWD A;  3VR9 B;  1J7C A;  1TYG B;  1TS2 A;  3AEB B;  5HG2 A;  1I4X A;  1OQQ A;  3NVW A;  2Q5W D;  1ZPS A;  3UI3 A;  1Q10 A;  1C78 A;  1UNS A;  3FAH A;  2N0S B;  3P4R B;  3FIL A;  4ARC A;  1RWS A;  2LEK A;  1R7S A;  1TY0 A;  5FKA C;  1KTK A;  2AX5 A;  2K5P A;  4OZB A;  2G1E A;  1GPX A;  3BZD B;  5HHD G;  2MJD A;  1PDX A;  1DOI A;  2IGG A;  3ETR A;  1PFD A;  1JAL A;  1C76 A;  1VZ7 A;  4XE0 A;  1K53 A;  1YN4 A;  3T3N A;  2G9H D;  4A9A A;  5T8I A;  1ROE A;  1V1P A;  1AWD A;  2RDH A;  2VZK D;  3BWU D;  2BT6 A;  1FFU A;  3R8B A;  1JWA D;  1C4C A;  4RGN A;  1I4G A;  2BW2 A;  2ONQ A;  3I57 A;  3IT4 B;  1STE A;  1N62 A;  3AE2 B;  4RGO S;  1ZDV A;  2BTE A;  2NMQ A;  1N61 A;  1XLO A;  4RNA A;  2XN9 C;  1KH0 A;  2N9L A;  1YJI A;  2XNA C;  4LLG M;  5EE3 A;  1FCL A;  5BMH A;  3AMZ A;  4YTP B;  2AQ2 B;  3W9C B;  2V3N A;  4Q2J A;  2J52 A;  2W55 A;  4ZOH C;  4A55 A;  4LK0 M;  1ET6 A;  1EWY C;  2IJ0 A;  1NVI D;  1ENF A;  1ZOY B;  2INP E;  3KQ4 A;  4WIP A;  1HXY D;  3VRB B;  5D3D A;  2LFI A;  2N9K A;  1V1O A;  3L4P A;  3AEC B;  4WH4 A;  4MM3 B;  1D5M C;  3SFE B;  4RFB A;  1WRI A;  2L1A A;  3NVY A;  2Z8L A;  4HKZ E;  2BS2 B;  4J3O D;  3W1S A;  2IDY A;  1ACC A;  1IUE A;  1QIL A;  2BBC A;  4YSY B;  1HZ5 A;  3AE1 B;  1L5P A;  1KLG D;  5D7G A;  2BYT A;  1MHH E;  4ZRP A;  3P63 A;  2OHF A;  2JU6 X;  3RPF C;  4C56 C;  1D4B A;  1WWT A;  1NI3 A;  1YJJ A;  4TQ0 A;  3HUI A;  2QIL A;  4ITK A;  4N58 A;  1VJK A;  2J4X A;  1NEN B;  3GP7 A;  2L32 A;  3AEG B;  1E7P B;  4P16 A;  3E9S A;  3PZ7 A;  5AUI A;  1MVK A;  3MFG A;  1F2R C;  2WXJ A;  2WXM A;  3E56 A;  3URY A;  3TEY A;  3AE6 B;  1E9M A;  1JW9 D;  4KKI A;  3PZ8 A;  1VLB A;  3LB8 C;  1VZ6 A;  1L0Y B;  1T3Q A;  3Q69 A;  2GI9 A;  3ZGZ A;  4ARI A;  4JWS C;  1C4A A;  1I4P A;  3V3X A;  3V05 A;  1SB3 C;  2DWQ A;  4XDC A;  3SFD B;  1SIJ A;  5G5H A;  1FNW A;  4L2Y A;  2HTM E;  1I7H A;  1JWB D;  3BYY B;  4C7Z A;  2KN4 A;  1ZXH A;  3SEB A;  2CJN A;  4XWT A;  5E6J A;  1QQR A;  4YTM B;  2HDE A;  1FM0 D;  3BK1 A;  4CQN A;  3BYT B;  2LHE A;  1FEH A;  2WXN A;  3U2S C;  1JWM D;  2MJ3 A;  2JSV X;  2PW9 A;  1L4D B;  2V3P A;  1YN5 A;  1C9F A;  3B2F A;  5BYQ A;  2R61 A;  1HA5 A;  1IBX A;  3WCQ A;  1CQV A;  2K22 A;  3ZJU A;  1I4Q A;  1UGJ A;  1PUT A;  3W2D A;  4USA A;  1F2R I;  1RFK A;  4MAC A;  2H88 B;  2YEP F;  4GLS C;  4JWU C;  3Q8F A;  3AE8 B;  3KWL A;  2WDQ B;  1C79 A;  1DYQ A;  4US9 A;  5BMI A;  1E10 A;  1P7E A;  1WYG A;  3AH7 A;  1J7A A;  2GB1 A;  3NUH B;  2YEP B;  1E0Z A;  1QT9 A;  3CWI A;  1PYW D;  2KDM A;  4ZYS A;  3BVG A;  4NAM A;  1ZP0 B;  1E6E B;  5C3J B;  2DBY A;  4NZL B;  3FIL B;  1QOF A;  3P42 A;  3B9J A;  4JX1 C;  1PGB A;  2V4I B;  4O1N A;  2WU5 B;  1F0Z A;  4RH6 A;  3GB1 A;  1D5Z C;  2PLP A;  1FFV A;  2LMC A;  4YXD B;  1JRP A;  2W54 A;  5FK9 C;  4H2A A;  2JWU A;  1RM6 C;  1EU3 A;  4WAF A;  2K0P A;  4WQM A;  5JXV A;  1LO5 D;  2Y3A A;  2ZW1 A;  2KMM A;  1AN8 A;  1EM7 A;  1V1P B;  2JQR B;  2WXF A;  5TSS A;  1DGJ A;  1BUI C;  3HVD A;  2WLB A;  2MH7 A;  3TEX A;  2FBW B;  1RYJ A;  5FR3 A;  3TSS A;  1XLN A;  1VDV A;  2WQY B;  3W5V B;  1N5X A;  4REZ A;  2DYM A;  3T3O A;  2PTL A;  4NJC A;  3Q8C A;  3VR8 B;  1GOZ A;  3NS1 A;  1TY2 A;  4P6V F;  1GB4 A;  3HVZ A;  3MHZ A;  3TEW A;  4XDD A;  1ESF A;  3R2I A;  1KLU D;  2K9X A;  3C8Y A;  2WP9 B;  3I9V 1;  3O13 A;  5EE0 A;  4ZHP A;  2SEB D;  5D3I B;  1XEE A;  3AE3 B;  2LHD A;  1CJE A;  1L0V B;  1TKE A;  2MJE A;  3AE5 B;  1BXT A;  1A70 A;  2BB6 A;  1QOB A;  2WXK A;  2SAK A;  1N60 A;  1FNU A;  3EUB 2;  1QF6 A;  4YSX B;  1FMA D;  1HQR D;  1XLP A;  1TKG A;  4WUR A;  1JQ4 A;  4IDI A;  2QMT A;  1XF5 L;  1KFY B;  2V0G A;  1EWC A;  1NYR A;  2WS3 B;  2LJI A;  4TQ1 A;  4YTN B;  1KF6 B;  1SEB D;  3P4S B;  1XXG A;  2DLB A;  1N63 A;  2M19 A;  2JYE A;  3IXS A;  1MHX A;  4RCO A;  2AQ3 B;  2M56 B;  3HRD D;  4UDU C;  1SBB B;  2ACZ B;  4RGM A;  1QOA A;  2BS3 B;  2RPV A;  1FNV A;  1SE4 A;  1TS5 A;  3BK2 A;  1DOY A;  2H89 B;  2B76 B;  1SF0 A;  2WDV B;  2JZP A;  1T5X D;  1WXQ A;  2WXG A;  1M4V A;  1VR9 A;  2E6X A;  1NYQ A;  1TKY A;  2WXQ A;  2WXP A;  1TZO A;  2JYT A;  2WNM A;  1XO3 A;  4KGT A;  1IBX B;  4N6E B;  2MEK A;  2W3S A;  1TJE A;  4M0W A;  2EKI A;  4AQ7 A;  3RFZ B;  2KQ4 X;  3MP9 A;  1SJE D;  4LTU A;  1J7B A;  1PGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...