3NW9A

Rat comt in complex with a methylpurin-containing bisubstrate inhibitor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition at the Active Site of Catechol-O-methyltransferase (COMT): Adenine Replacements in Bisubstrate Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 81
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nw9A00
2OB2A 4M38A 1SG9A 2IH2A 5EMJA 5K03A 5DM1A 4E2ZA 1YB2A 3Q7EA 2YX1A 1EJ6A 3M4XA 3LCUA 5U4XA 2CMHA 3G2QA 4L7VA 1JSXA 3FPGA 5DX1A 3FRHA 3VYWA 4BLVA 1X1CA 2VP3A 2ZZMA 3GJYA 2O05A 4WVLA 5EVJA 1N7JA 1B42A 3KR2A 1VP3A 4CWAA 4GBED 4YUXA 3HCDA 5GM1A 1JG1A 1XXLA 4AZVA 3E7PA 4MIKA 4RTPA 3LPMA 2EG5A 5ICGA 2ESRA 4YV2A 3A26A 3UJ6A 2YXDA 3FPFA 2OXTA 3CJRA 1YZ3A 5LQCA 2OB1A 4PINA 4U7PB 3NVMB 1L1EA 3HA7A 4RSRA 4EK9A 3EMDA 5GWXA 4ER5A 4FZVA 4DKJA 2ONYA 5K0GA 3QOWA 5LQJA 3PFGA 2Y1WA 3FPEA 3FTCA 2VZ9A 2YXLA 2B25A 5ICCA 5LQAA 1AQJA 5LR6A 4K6MA 3P71T 1G38A 4RX1A 1G8SA 2GPYA 2AR0A 1OR8A 2PVCA 3TQSA 1NBIA 1VL5A 1NW7A 1Q0TA 3DXYA 1RJFA 2BM8A 3OE5A 3ER8A 1KYZA 4FR0A 2F8LA 3BWBA 3NJRA 1XJ5A 1F3LA 1NW6A 1XDSA 4KWCA 5FQNA 1X1DA 3X0DA 2AS0A 5EC8A 2VDWA 2GB4A 2OBFA 4P7KA 3DR5A 5DXJA 4XUEA 2HMYB 4PWYA 3PT9A 1NE2A 4X1OA 5EZSA 4HC4A 2P3LA 2B2CA 2HWKA 2ZVJA 3DXXA 4HH4A 4RWZA 1L3IA 2AOVA 1SKMA 4EQZA 3G7UA 1RI5A 3A27A 1ZHFA 4FP9A 4P58A 1MJFA 3CC8A 3DP7A 3DUWA 3GWZA 1JTEA 1XCJA 1Z3CA 4DF3A 2HV9A 1FP1D 2H00A 2PXCA 3I64A 5DSTA 2FK7A 3DOUA 3UBTA 3LX6A 2IBSA 3MTIA 1P91A 3SSOA 5FUBA 3M6WA 1NT2A 1QAMA 2AN4A 3B89A 4OA8A 4P7FA 5DM2A 4FS8A 4PYIA 1JQ3A 1L3BA 1HMYA 3ANXA 5HIIA 3LGAA 4E30A 5HEKA 5LQNA 1EQAA 4HTFA 1RJGA 2G8NA 3R0QA 3ORHA 3G5TA 2LD4A 2YUIA 4EMSA 2JG3A 2B78A 1JG4A 3FYDA 3LCCA 4X61A 3UJCA 1WS6A 2AVNA 3CVOA 2IDKA 3AJDA 1AF7A 3ELWA 5E1BA 1DL5A 4BP3A 2XYRA 2ZTHA 3SX0A 3FTFA 3HVKA 3UJ7A 2ZLBA 3OFKA 3AWIA 4ISCA 4YMGA 3NW9A 5EIFA 3KQVA 1UFKA 3KPYA 4Y2HA 5HIMA 3EVZA 4GOLD 5DPMA 2FCAA 1VP9A 1BHJA 2AZTA 4XUCA 2XYVA 2ZW9A 4RTJA 1BC5A 3G8BA 2E5WA 3T7SA 4IWNA 3G5LA 3KQYA 3LKDA 3LL7A 4E2YA 2YTZA 2G1PA 1RJDA 5KQRA 2XVMA 3UA4A 4WXHA 2HR1A 2XBMA 1XDUA 3AXSA 5FA8A 3EEYA 5F2KA 4PYQA 4RTLA 4LECA 5GINE 3HNRA 2O0LA 3DMFA 3DXZA 3KPJA 3C6MA 4E33A 3KQSA 2PX2A 1MHTA 2VDVE 3HM2A 4RTNA 5BW5A 3MGGA 3EVCA 2FYTA 2GAFA 2IP2A 2NXNA 5E9WA 4MWZA 2P7HA 4YV1A 2EJTA 4RVHA 2VDUE 2R3SA 5LQRA 3DLCA 3B3GA 1TPYA 1M6YA 1SUSA 3HA5A 2PLWA 3ELYA 3C3PA 5EQJB 3PLAE 3FUTA 5DX8A 3BGIA 5FTWA 3P2KA 2ZBQA 3BWCA 3NDJA 4U7TB 4A6DA 4DMGA 1DCTA 5EHGA 3EVGA 3KQMA 4QTTB 4RTSA 2PJDA 4KW7A 1PJZA 3HVJA 5DTRA 3T7TA 5K09A 2YQZA 2PX5A 3SMQA 5CVJA 3R24A 2G71A 1R74A 1X1AA 2N47A 2P7IA 3E05A 3OU2A 4QQKA 5EGSA 2UZ4A 2FHPA 3KKZA 2HTEA 2Q41A 3BKWA 3GRRA 3GGDA 3CBGA 5EKXA 4PYLA 1FP2A 1QZZA 4KVZA 1QAQA 2PSSA 3EVFA 2GA9A 4O29A 4GUAA 2Z6AA 2AN5A 4KRGA 5E1DA 1YZHA 2P41A 1UIRA 3TRKA 4PNEA 3PVCA 1G6Q1 3NMUF 4GF5A 5T67A 3GIWA 4FSDA 3DTNA 3OCJA 5C9ZA 4PGHA 3P97A 4RVFA 4HGYA 3PB3A 2ZZNA 2EX4A 2VS1A 2QYOA 3OU7A 4ER3A 1UWVA 2C7OA 3JWJA 2PT9A 4PONA 4RTMA 1R18A 3MHTA 5IKMA 2OY0A 3OZSA 3FTEA 1VIDA 3BWYA 3OU6A 4OQDA 2H11A 3G88A 3UFBA 3KQQA 2I9KA 1G55A 4F84A 4YUZA 3M6XA 3R6TA 2JH8A 5DLYA 5DSXA 2UYOA 4QPPA 4YUVA 5F2NA 1H1DA 2ZWVA 1D2GA 3HA3A 4ER6A 1RI1A 3HCAA 2JH9A 4PIMA 3IEIA 5LSAA 4PYMA 3I58A 1QANA 2BR5A 4AUKA 5K0BA 2OO3A 3HCEA 3B3FA 2JHPA 4PYKA 2O57A 5HOQA 1JG3A 4C06A 5FWAA 4CXMA 4KIFA 1VE3A 3KU1A 5DXAA 2PGXA 3C0KA 3RODA 4C4AA 3EGIA 4GOOD 3JWIA 3LKZA 5DTMA 2H1RA 4AX8A 5K05A 2OYRA 3MAGA 3SGLA 2ZCJA 3CGGA 4GEKA 4F86A 3EVDA 3KR9A 2NXJA 5HIKA 4AZSA 5F2OA 2CWWA 1FPQA 3KQOA 3MCZA 1EJ0A 3K6RA 2QRVB 4Y30A 3PTAA 5GIPE 2UYCA 2JJQA 3TPZA 4QPNA 3A4TA 3B7PA 3EMBA 1N2XA 2ADMA 1KXZA 3B3JA 1IM8A 1L9KA 3CJTA 1JG2A 3FPHA 2IIPA 1VBFA 5CVUA 4E2XA 4UOEA 1SVUA 4BLUA 1EIZA 1BOOA 2AN3A 1ORIA 4RYLA 5EOVA 1VQ1A 4R6WA 1WXXA 3SSMA 3MERA 2AVDA 5ICFA 3G8AA 2PBFA 2AOXA 3VC1A 4MQ4A 1M0EA 3T0IA 4YUWA 3TOSA 2BR4A 4C04A 4EKIA 2GLUA 1R8XA 2IGTA 4R05A 2B3TA 5CCXA 1FJXA 3SVZA 3PX2A 5DTQA 3KPWA 3KQTA 3OPNA 5CM2Z 3HCFA 3ID6C 4MTLA 3LDGA 4RTQA 1IY9A 3F4KA 3DMGA 3FRIA 3TM5A 1KYWA 1WXWA 3DLIA 4GOND 4OA5A 1SQGA 4XCXA 2PWYA 5T6BA 2JHCA 3G89A 3O7WA 1AQIA 3OZTA 1RI3A 3KHKA 2ERCA 1NW3A 1YUBA 5CVEA 3HCBA 2AOTB 2IH5A 2G70A 4ER7A 4BY9E 3Q87B 3GNLA 3O4FA 5GOZA 3PX3A 3FUUA 5DM4A 4FT4A 4QTUB 4C03A 2ZBPA 3GXOA 1P1CA 4E70A 3CJQA 5JR3A 2XVAA 3UJBA 5HZMA 1P1BA 2NXEA 3GU3A 3MCTA 3V97A 1JQDA 4DM3A 4PYJA 2Z6UA 1KPGA 2AOUA 2I6GA 5E9JA 4CKEA 2QRVA 1X19A 4IV0A 5DX0A 3JWGA 5EMKA 3FPJA 3GDHA 4PCLA 3ERCA 4V0QA 2R6ZA 4FT2A 3EEOA 3MB5A 2EJUA 1N7IA 3G2MA 4G56A 4GOMD 4QDKA 4YV0A 3SXJA 4PCAA 1WZNA 2YXEA 5E8RA 3ELDA 4X63A 1I4WA 4CKBA 4RTOA 1R6AA 1Y8CA 3A7EA 4X60A 1ZGAA 3BZBA 5EPEA 5C0OE 3LDFA 3L8DA 3DULA 5JUWA 3IYLW 4KDRA 3SR4A 1KPIA 1AV6A 1KR5A 3HVIA 1SQFA 2FPOA 3I53A 3LBYA 4Z2YA 4HTFB 4ER0A 1Q0SA 3HVHA 4P7JA 5BXYA 1XCLA 2GS9A 4GC5A 5EIWA 4E32A 3GRZA 4C05A 2ZIFA 1M6EX 3PS9A 1G8AA 4C08A 1EAMA 2CKDA 5E2BA 1RJEA 2PV0A 5E1OA 1R00A 3M6VA 2BZGA 1KHHA 1PRYA 5ERGB 2PX8A 4QDJA 1ORHA 2NXCA 3LSTA 3VC2A 1XVAA 3MQ2A 3JWHA 3G2PA 5GP1A 2ZFUA 1DUSA 4RVDA 1TW3A 3DH0A 5FADA 3BKXA 3TR6A 1YFJA 4EKGA 3H2BA 2QM3A 5K0NA 2P35A 2OZVA 2DULA 3LDUA 5E2AA 2QE6A 1O54A 3BXOA 3GRUA 3LECA 4POOA 5K0CA 3LBFA 2ZIEA 3KR1A 2IH4A 1NKVA 4DCMA 4DQ0A 1RI4A 1NV8A 2WA1A 3K0BA 2CMGA 2I7CA 3M6UA 2KW5A 2NP7A 4LG1A 4DCGA 3I9FA 1IXKA 1KP9A 4FSXA 1ZG3A 2A14A 3LHDA 3P9CA 5FULA 3CCFA 1WY7A 5IH3A 4ATNA 4EVIA 5K8VA 5FA5A 3I5UA 2P3QA 5DRYA 5BW4A 4B17A 3NVKI 1JSZA 3P9IA 4E2WA 2P1DA 4A6EA 3GO4A 1YF3A 3KQWA 2C7PA 5M5BA 1R8YA 5EEHA 2P3OA 1FBNA 3HTXA 1VPTA 2ONZA 3P2EA 5CVVA 2QY6A 3IV6A 2B9EA 5KQSA 3BT7A 5LQUA 3UJ8A 5B1SA 3EGEA 5D1NA 4E31A 3B5IA 4RV9A 4PIPA 4OBWA 5EMMA 3FUWA 9MHTA 4V0RA 4R8SA 4OBXA 4QVGA 3NTVA 4YUYA 2PX4A 4KDCA 5CD1A 3NWBA 2UYHA 4OQEA 5KVAA 4M7RA 3S68A 1WG8A 2P40A 1O9GA 1T43A 1U2ZA 3C6KA 4FGZA 2Y1XA 2XYQA 3MTEA 3SSNA 4C07A 1INLA 5FCDA 1ZQ9A 3G2OA 2IDJA 5KS2A 3EVAA 5K01A 3TMAA 2EFJA 1D2CA 5K0LA 4CTKA 3TLJA 2AOTA 1VLMA 2PKWA 4HSGA 2CL5A 3KPUA 3PFHA 3TFWA 3UZUA 1EG2A 5DM0A 3WSTA 2C7RA 3M70A 4KIGA 5CVDA 3THRA 5GIOE 5E8JA 2NYUA 1NW5A 1NW8A 2O06A 5D1HA 2DPMA 1KIAA 4CTJA 1SUIA 3FYCA 2JHAA 3SM3A 5KYGA 2ZZKA 5MHTA 3CKKA 3ELUA 4LWPA 2ZULA 4GC9A 4BLWA 2HNKA 3O31A 2I62A 3OE4A 5K0JA 2NP6A 1QAOA 4XUDA 5K0FA 1YFLA 2FK8A 2WA2A 3BWMA 4ZTBA 4R6XA 2BR3A 4AZTA 1G60A 4P7GA 5CIYA 3M33A 2V74B 3P9NA 1ZGJA 3BGVA 3E8SA 3UWPA 1QYRA 4NECA 1JR4A 3P8ZA 3RIEA 2NNWB 3BGDA 1P39A 2FRXA 4F85A 4LWOA 5HILA 1I9GA 1BKYA 5FHQA 3ER9A 1ZKDA 3HP7A 4IV8A 3TKAA 4BP1A 5EZQA 1V39A 3NWEA 2O07A 2AOUB 1F38A 3EVBA 1JTFA 3RW9A 4DZRA 4IKPA 2ORED 1JQEA 3TKYA 3E23A 2OPBA 1O9HA 3LCVB 4HGZA 5FHRA 2BH2A 3AY0A 3HCCA 5P8WA 3FZGA 5LQKA 3DMHA 8MHTA 4OX9Y 4QQNA 2IFTA 2WK1A 3UA3A 2GH1A 4RVGA 3REOA 2PXAA 2AOWA 4PGGA 3V8VA 3QOXA 7MHTA 2PT6A 2V7EA 3FUXA 10MHA 1HNNA 3KPVA 4JXJA 3VSEA 5EKUA 4X41A 2G72A 5E9QA 4PYNA 3AXTA 3D2LA 5EEGA 2YVLA 3GRVA 5DT2A 3A7DA 5EHIA 5E1MA 1TW2A 2BM9A 3EPPA 3HEMA 3T7RA 3UJ9A 3FUVA 2ZIGA 1D2HA 5T64A 4QVKA 1XTPA 2UYQA 5DWQA 4M36A 4PYOA 3R9XB 3KQPA 3THSA 1X1BA 2IBTA 3UJAA 3GCZA 5H02A 2YR0A 3BUSA 2ZSUA 3OFJA 5EG5A 2PY6A 3A25A 2PXXA 1NV9A 2OKCA 2P8JA 2ZBRA 3P2IA 3U81A 4GQBA 3OZRA 2IPXA 5GM2A 3QV2A 3P9KA 1L3CA 5CCBA 5ICEA 5HFJA 5G02A 2ZWAA 3UJDA 1I1NA 4R8RA 1RI2A 4H0NA 1KPHA 3FTDA 1XDZA 4M37A 5CUQA 3TM4A 4AZWA 4RTKA 4YMHA 3IHTA 5DRTA 4DA4A 3EVEA 3NDIA 4CKCA 3GRYA 5K0EA 4HRAA 2Z6QA 5FWDA 3EGVA 3R3HA 2K4MA 5EMLA 5FQOA 5BP7A 5HIJA 3ME5A 3C3YA 2C7QA 2PWPA 4MHTA 4RTRA 5C1IA 1NBHA 3KR0A 4HG2A
chains in the Genus database with same CATH superfamily
4DRZA 2DQSA 1JP7A 5K03A 1AHHA 5AK3A 3VZDA 4PAQA 1AT1A 2C3PA 4CUZA 1RNLA 1F6BA 3DC7A 4FQ5A 4HWTA 3RBVA 2NAFA 2QYTA 2ZRFA 4MUMA 1QBKC 1R88A 4WSOA 1FE8A 2CW5A 4C7OA 1XEXA 1M67A 2NPIA 4MRRA 2PRSA 2CE7A 2CDRA 1O6ZA 4TX1A 4XI9A 3UW1A 3VH1A 5EJ2A 2GD6A 3RK1A 3HSSA 4WNIA 1MZPA 4BNZA 3LL4A 1V26A 3MJTA 1WW3A 3FCAA 3TRIA 3OESA 3U40A 2EG5A 1T5LA 4ENRA 3F3KA 2C94A 4HBZA 4UXJA 1SC4A 2X6RA 3JARA 4KRFA 3ZS8A 1CLUA 4WA7A 3NBMA 3D8TA 1YZ3A 1F8FA 1NHGA 1VCMA 2YXBA 1U6KA 3KAPA 4MKXA 2VJAA 1I01A 4O4JF 1DKOA 1E3DA 5BW8A 4EW3A 2N42A 4FYYA 1SWWA 2V5AA 4H3VA 3SYLA 3AVTA 2VI5A 2C7BA 3O8NA 5EI5A 1QV7A 5IJWA 5F1YA 4L5IA 5EINA 3IL2A 1PSWA 1Z35A 5EZ5A 3KXKA 5ULLA 4UE3S 5GGXA 4MLPA 2V4UA 3T3DA 2BHRA 2ZPTX 5C8YF 1FYXA 1NVDA 1YDMA 2UZ3A 2HIHA 4M8SA 4JASB 5LZ8A 4EY4A 4R2LA 1F0KA 3GD7A 4V0SA 5FQNA 2ZSFA 2BGRA 3UMSA 1XA3A 4HDOB 4L9AA 3ZCVA 5EXSA 4HY3A 2V7WA 4X54A 1Y5RA 3PZRA 4JWTA 2KBFA 5BQPA 3QX7A 5KQLA 1ZM9A 1WUTA 3AP3A 4FEGA 1CG6A 3KYBA 1DJPA 4FHFA 4POAA 3QF7A 4Q47A 3IAM1 4LDRA 5AHKA 1KE1A 3NAMA 5AUOB 2JHGA 2VJQA 3HJHA 3WQQA 4EQZA 5K20A 2X6TA 2WWWA 3T94A 3TE7A 2H5JA 2WZQA 1XMPA 2MTBA 3CLSD 3DUWA 1ZJZA 2O54A 1Z2AA 5EE3A 1XCPA 4PHCA 2B1GA 4G63A 1KARA 1VLZA 3PXEA 3NIBA 2FX5A 2G8LA 4W5JA 5EUQB 2VNHA 1GGNA 1N2OA 2WC1A 1TO2E 4RH0A 4EDHA 3IBYA 2C2KA 2IYTA 3SSOA 4ON9A 4ROSA 4HDQB 2DX7A 1BE0A 4NE2A 4BWGA 1QAMA 4U2BA 1JHXA 1SXHA 4MV6A 2B5VA 1LNQA 1WUKS 1GKLA 4RMGA 4U1RA 3WMEA 1CF4A 3D6VA 4E30A 2G7MC 4NU6A 1C8VB 4BNDB 1IHOA 2QYSA 2EBWA 1J56A 4BWFB 4TUYF 5CIQA 3RNLA 2DY1A 4DBLE 1FRNA 2W42A 3CXRA 3JTMA 1J99A 4KOAA 3FTFA 1LSSA 2FEWB 1HE2A 1SA0B 2H1HA 1TNDA 4A0RA 3N86A 1ZIPA 5H70A 4QFMA 3F49S 5JLJA 2XMQA 3KLPX 2D7CA 4JEMA 4KGXA 4WNYA 3ESBA 4QYWA 2HI0A 3KTAB 3OBIA 1US8A 5KMGB 3P19A 4FFDA 3D59A 3UMCA 2AZTA 5CH5A 2UZAA 121PA 1OW3B 3PEVA 1S2LA 4U9HS 2WQ7A 2HK6A 1DRUA 4US2R 1QHYA 2EFCB 1P2BA 3IQIX 4PBSA 4ZCRA 4FMPA 1G4HA 4QNRA 1BXZA 1KVTA 1V37A 1ZDMA 4WFIA 1UPFA 3GD5A 3W4JA 4CF3A 2XNDD 5IF3A 4E7PA 4JQOA 4LECA 4R9VA 4JQSA 4K6OA 4R1QA 1D6JA 3T3HA 3DMFA 1O1YA 3I2YX 3LPDA 4LA4A 5CMLA 3WBFA 1Q20A 1Y1QA 3W1VA 3ICQB 2VDVE 3BFVA 4F4UA 3DPSA 3SFTA 1PG5A 2FYTA 2GAFA 3DE0X 2ZUDA 4L8WB 1NU6A 4M55A 5BPFA 5FAKA 5IASA 4WCDA 3RV4A 2HL6A 4FB5A 1RXCA 3OECA 3AIMA 2QT9A 2GPAA 3BCRA 3WISA 2HF2A 4MGZR 4WBNB 2ZB4A 3DLPX 4ROTA 4UREA 2RI0A 3AJEA 5IARA 4DREA 1GTG1 2ZS9A 3C3PA 1QYIA 3GFPA 5A0TA 4WERA 4U7TB 1GFWA 1ONBA 5DN6A 1W73A 2DFNA 3Q1KA 4Y9SA 5T4BA 3SR0A 3WHIA 4PQRA 1KGSA 2E2WA 3IT0A 1M0TA 4KW7A 4S1WA 4L5AA 5IFKA 5FOSA 2C58A 4IJMA 1KZ6A 1O3YA 2YV3A 5CVJA 5GY7A 4IDHA 3VBCA 1X0VA 3ZS9A 1B0UA 1CE8A 3KB2A 3L2OB 2QN6A 4Q24A 1C7RA 4RQBA 5TARA 2WD7B 2F9MA 5C3UA 8ADHA 4NY1A 1FP2A 1S8OA 4YCLA 4P5DA 3E9DA 4BO7A 5B64A 4UC0A 1H23A 2OXRA 4XZ3A 4OB7A 1KO1A 3PC8A 3RV3A 3OO1A 1UIMA 1YULA 2NOAA 3ISVA 4HGYA 4RPCA 3LYLA 4P3OA 5IDYA 4EPWA 4LOAA 4MP3A 4F4IA 2ZUVA 2WSBA 3TW6A 1NW9B 5BSMA 2NPOA 5FKJA 4UTVA 3G88A 2DERA 4TKVB 1T6XA 3TQFA 2JZOA 2QAJA 5DBOA 1AQLA 2RGEA 3SQXA 2YN4A 2ZWVA 5J63A 5IZCA 4BQIA 4KQFA 1HDGO 1VIAA 3W6OA 4CFSA 4PYMA 2DHEA 2HDNB 4QNNA 1Z5NA 5K0BA 3H04A 1HOTA 1K27A 2PMBA 2JAPA 1UMCA 2VRBA 1P1KA 1XQ1A 2JARA 1O8BA 2JAXA 5FF9A 1UBMS 2NZJA 3SLKA 1CQIB 4MVJF 1H85A 1SG6A 4FJ2A 1LSJA 4MEAA 3ZIAA 2QTMA 4C7MA 2JLZA 1V95A 2C4TA 1JR6A 3TUIC 3W3AD 4F1WA 1FRQA 5JALA 3EVDA 2FW0A 2W6JD 5SY6A 5MN5A 2QP9X 4GXTA 4ND3A 4WCFA 4D6YA 3JAKA 2X7HA 3OPYB 5EQDA 1UBLS 1R15A 3TPZA 4I66A 1KWGA 1ECLA 3EZ9A 1MFZA 2FMKA 2IIPA 2PS9A 5CX4A 2YV2A 4CCSA 2C2ZA 3RHSA 2L69A 4JXXA 2P6UA 3Q8KA 1II8B 1QYVA 2P6OA 3PUWA 5T8KA 3VM6A 1M8KA 3MOSA 2G77B 1L5GB 4YJFB 4N0PA 5CCXA 1NY5A 4XASA 1NMQA 4ZFNA 1Q83A 2KLBA 3QLJA 5FLKA 4G5FA 3RVKA 3TXAA 4J2TA 4TL6A 1NZFA 2R8RA 4N40A 2PGDA 3ZE1B 2OCXA 2XNHA 1QFZA 3TG2A 4IGKA 2EX0A 2G4VA 4YGYA 4U9UA 2D1QA 4BX2A 2NZWA 4NLLA 3VAAA 1E2GA 5EIOA 2BBOA 3PZBA 5EE0A 2ZI7A 5ED0A 4JLKA 3FKQA 3SR3A 3VMMA 1SUCA 3D6MA 2M6LA 5I4CA 4MR9A 1Z36A 3OT4A 3QXXA 3OURA 3O8QA 1BCRB 1KIMA 5ECWA 1KQPA 2WAXA 1LRKA 2PU7A 3DR3A 5DM4A 1W76A 3CEHA 3CJQA 1G8YA 1E62A 3DXFA 2JLBA 2YN0A 1ZOSA 3HM9A 2BGWA 1BEZA 1R0ZA 2ZE7A 2O8EB 2J4FA 2QRVA 4C43A 1PT7A 3H1AA 5JASA 2BBSA 4KR7A 4I9NA 5A3QA 4BL5A 3S1SA 3RTEA 1MB9A 3LXUX 3TAXA 1CUVA 3B1VA 3C3AA 5ES4B 5HQ3B 3DV9A 5C1DA 4TZ6A 1U31A 3RWBA 4ND5A 4PC2A 1SXPA 3K6JA 5IT5A 2RJNA 2RK4A 2YXEA 3CONA 4CKBA 3WLJA 4ZYTA 1BWRA 3BN3A 4X7RA 2HMSA 5AM1A 2VFAA 2Z8YA 4LHYA 4CMHA 1L1QA 3CWCA 5JWRA 1ZK1A 3KWFA 4H6VA 5BQ5A 3AVUA 1UINA 1CUXA 2AF3C 2Z57A 3GZNA 4ZVKA 3S81A 2QI9C 4XJXA 5HS4A 4E5NA 4LFAB 1CUIA 2GXUA 1K3FA 3VU3A 1NONA 4CTOA 1PI3A 1RU3A 3G68A 4ZPXA 1J25A 2JLXA 3VFDA 3G3EA 5TVKA 1J8MF 1K8YB 3B6KA 3IUJA 2XDYA 1IC6A 1VG1A 3JSXA 4P4LA 1M8FA 4OYHA 4O4HA 4U7WA 5DCUA 4YONB 2HBQA 1LPNA 4UARA 4R01A 3RO7A 2DGDA 1YB7A 3GPBA 4FE3A 3EPKA 3WSVA 3U17A 2NXCA 4I6GA 2IHBA 1FOEB 3HO8A 1AUOA 1T0IA 1AXEA 4Z1OA 3O90A 2H2FA 2CMDA 1M66A 3AR8A 5LA6A 1SZDA 4RHEA 3K5IA 2R1UA 3OOSA 1QXSA 4WZAE 4BJ1A 1AUXA 3LECA 4BGDA 4LF5B 5HE9A 4D7AA 3GMSA 5JZ9A 5IRCD 5J5CA 1E7QA 1U28C 5SYNA 1P4AA 1ZH4A 4BGEA 2WA1A 3CEJA 2AJCA 1TJYA 4CG0A 3M6UA 1R6VA 4Q15A 1N2ZA 3A9CA 3HU2A 4B7ZA 5IH3A 3P9CA 1WU7A 3SX4A 1JXAA 4F56A 3VDXA 3VYSB 5FORA 1GKYA 4X64B 5JZMA 3WKDA 1US8B 1GL6A 3P9IA 3GYBA 5T41A 2VUTA 3M4NA 4I1YA 4GWGA 2FJPA 2XUKA 2XWBF 1AN9A 4UCWA 5KTOA 1LZLA 4AF8A 2FWNA 4HWRA 4ZDWA 4BVJA 1YF3A 2Q5QA 5TGDA 3G9XA 2WKPA 1ONNA 4QBIA 4QODA 4AWXA 2AEEA 1RRVA 1E9RA 1FJHA 2IE0A 2WNIA 5EEHA 1ARZA 2CLOB 1R9NA 3HTXA 4NHEA 2H7XA 2QM7A 4QARA 5CVVA 5DHRA 2BVNA 5CDTA 1ZH2A 3VBEA 4ENWA 5KYYB 1CFJA 1J8DA 3OZCA 2RBKA 4DUPA 1J2EA 2JJMA 3CTMA 4BN0A 4YJHB 2IS4A 2UXDB 4OBXA 3ENWA 1DCKA 1NJ2A 2ZJ8A 3WJAA 4UTPA 1Q19A 3CRZA 3CINA 1R5JA 2A1TS 4JLDA 4N7MA 4B80A 4D4KA 2C4KA 1S3SA 1Y1PA 1FRVA 1ULZA 3CLTC 5DW3A 2QUIA 1WMDA 5IKOA 4HNAA 5KO2A 1XWWA 3QFTA 1HQCA 3DMTA 1YRBA 2CZQA 3DV2A 1X7DA 1UEJA 5ALYA 1LA2A 4RO0A 1VSUA 2JGKA 5JBQA 3UKJA 1L7BA 3E82A 4WXYB 4D3DA 2WT4A 5AI8A 5I4KA 3CZCA 1XZGA 1JN0A 3N2KA 1D2CA 5I7HA 4AJIA 3RTCA 2RBGA 1SFRA 1Q21A 3JD2A 3OPMA 2HH9A 2Q1UA 4PAGA 5ADWA 5LU8A 1TK9A 2NX2A 1R0KA 1IBKB 1JGTA 3VKFA 4CG2A 3M5DA 2ZYVX 1QHXA 1UKVY 4OQNA 4YT5A 3THRA 2Q1YA 1TUEA 1FX1A 2SECE 1IBMB 1ZGGA 1HO3A 4Q01A 1Z2PX 1KIAA 2WFLA 3QUTA 1XU9A 4GZ5A 1HDCA 1HUQA 4DEYA 1USKA 1RXVA 5JQGA 1CPYA 3M81A 4XFJA 3FZNA 4AP5A 4B1FA 5C18A 1JYFA 1ZD1A 1Y89A 2GGSA 4YAOA 2O2EA 3IPLA 2YL2A 1Z7YA 3PRKE 4FHGA 3MLBA 3FRJA 4AZTA 4JMPA 1G60A 5J2TA 1T3TA 2VF7A 3N0VA 4ZIRA 5LKRA 1Z8HA 2H1CA 2YNMA 4HS4A 3WFJA 4TVSA 4MWOA 2JDIA 3EEBA 1YL6A 4ZV7A 3ZCXA 2Q99A 2RG7A 1CZLA 1N3YA 2H4JA 1XLUA 1QLWA 2WWFA 2IIQA 4LMPA 2C82A 3WYNA 1TA0A 1K08A 3WBKA 3A2NA 1A97A 2QRNA 3MBOA 2ATIA 1T26A 2AOUB 4KXVA 1ZICA 1NQAO 3A31A 3KOWA 3PXXA 4FHCA 3PNKA 1N57A 1RHMA 3ONFA 3IEMA 1A95A 3ESAA 4IFIA 1WOMA 2R6DA 1ZO8A 3F2IA 1V43A 2E0IA 2ZXFA 4IHJA 2YXPX 4EO7A 5L6LB 4FGWA 2CCGA 4MV5A 3TSWA 5BR7A 4I50A 5KYVA 2AX3A 4EA8A 1XO1A 5FPPA 1BRMA 2H4ZA 1Z37A 2J3HA 2V7EA 5GAJA 1G0NA 4NHOA 2KE5A 5ALWA 1DTWB 4EHJA 3PNPA 3QPAA 1HNWB 1DJOA 2PSDA 5HYVA 3ETLA 2VNIA 3W04A 1YVUA 2G0NA 3AIOA 1AG9A 3H1PA 2BDTA 4AF7A 4ERNA 2R6JA 3G0GA 4OXXA 1RRPA 2PZAA 4MUYA 3UT5A 3R9XB 4PS1A 1X1BA 5IWAB 3ASUA 5LBTA 3UJAA 1QVRA 3UT6A 2YR0A 3OFJA 4RJTA 4MB6A 3NORA 5F7OA 3STWA 1P33A 2XMRA 4QHTA 1LTQA 1Z82A 2W48A 3ANLA 4WESA 5KVSA 5MFPA 4IJKA 4GSYA 5EFOA 1GUZA 4QUBA 4CKYA 5LNK1 3C4JA 3KUKA 3TPCA 1KPHA 1RRMA 3PE3A 4LCBA 1JAZA 2P0EA 3IV7A 4HDMA 3B48A 4HDSA 4AMBA 3IHTA 4ISBA 3HZRA 2F3PA 5C1OA 1S9HA 3ONVA 4BMVA 5C7YA 2NLOA 4JLJA 5IUJC 4BP9A 1YZNA 1Q5PA 5BY2A 4DV1B 1NXQA 3EGVA 2BEUB 1BFDA 2ORWA 4MI3A 5FQOA 4IGAA 4MYUA 4OKNA 3KLBA 3ZWMA 4A0SA 4BV3A 1H4TA 4MYSA 1PJTA 1Q7BA 4LC1A 3J80A 1NFRA 4A91A 1G4UR 1GUYA 1XQVA 2JRCA 1S2DA 4MXDA 1BGWA 1M73E 2Y1CA 4B3FX 3T6KA 4E2ZA 1TCUA 3D81A 2QTFA 3ADBA 2NO6A 4L7VA 1G3MA 4GM0A 2CVQA 2GI4A 3IUPA 4HDSB 4N8EA 4YRTA 5IDVA 2BCGY 2C00A 4IIJA 2HWXA 4D3XA 4DS3A 4TRMA 4RIFA 5TPWA 3QEMB 1CY4A 3M6IA 4MGKR 1KMHB 2B7LA 3JYOA 4TV9A 1SMKA 5FOQA 2ADFA 3E70C 5FBZA 2J0SA 3TZCA 1DS6A 2V6BA 1A9QA 1P0PA 5LUAA 1NUTA 4HN4B 4PTLA 3QEBZ 4MGYR 2TMGA 2D54A 2I2CA 4P92A 3KQUA 1PEYA 2R4UA 3L43A 4LK3A 2LCQA 4B3BA 1EUDA 5AJXA 3CJRA 5IHXA 1ULSA 4DUGA 3HB9A 2XUAA 1Z4LA 3LUGA 3ST7A 1RZRA 3TUJC 4JLWA 4XR4A 3KLOA 3G5AA 1ULAA 5AJUA 4XWGA 2FPMA 1UBHS 3D1VA 3DHNA 4CR8A 3KS9A 3PDJA 3HJAA 2PK3A 3F3SA 4DDUA 3KKMA 2AXNA 5AKLA 3RKRA 1MLDA 3ANNA 2X3UA 5A05A 4NK4A 1J00A 4RHTA 1WUIS 3GJ0A 4CLRB 1XJ5A 1F3LA 2DLCX 3NNSA 2A9OA 2FP4B 3C1AA 4H3KB 5EAIA 4ZT6A 4C4XA 3RR2A 2PTGA 3T54A 1YJ5A 3DQZA 4YMTA 1EXVA 1NJ1A 4DR7B 1KVRA 5AVTA 2ZRKA 1NE2A 3IALA 3UQYS 1TLLA 4Q3OA 3PBKA 5K99A 2FPIB 1W0KD 1EFRA 1HZZA 1P2SA 2P1RA 1OLXA 3PWKA 1LFAA 3HPRA 4D0LB 5A5DA 1QIHA 3PG5A 1BMQA 2GX6A 4OMDA 2JFBA 1GSOA 4BB5A 2LWIA 5CLIA 3IIEA 1WVGA 2WJZB 3TLMA 2JIOA 5KNLA 4LJRA 4UM7A 1MJGA 2GBLA 4MSUA 3CU5A 2D74A 3L1IA 3N2EA 3G17A 2IU4A 3BIOA 4Q7EA 1FF9A 5TJHA 2JD2A 1FU7A 1XQ6A 4RM2A 3PYXA 2VWPA 4IIDA 2ECPA 4Y2TA 3UQZA 2AN4A 2D13A 3NEAA 3D8NA 1DOZA 1C2TA 1HWYA 1ATZA 2W43A 1UOPA 2ZOSA 1L3BA 3R8FA 2BMDA 4OL9A 2ZJFA 3E9RA 2XZLA 4IMRA 1NNSA 4GZLA 1VRWA 3T5TA 3IEVA 4KBFA 3G5TA 5I7SA 4ZCPA 3G0HA 1G1MA 2JLYA 1TJPB 2CE2X 2DPHA 2FQ1A 3AOGA 3L6UA 4IYRA 4M1YA 4GI5A 1H2AS 5EY5B 4LOKA 2BJVA 4WOJA 1SKAA 4W8GA 2ERXA 3F5FA 3GZJA 4I1PA 4FYVA 5EIFA 1VYHA 1UBUS 2JAUA 2P2CA 3H5TA 4MA0A 2A6PA 3MWKA 5AW6A 3H4TA 1ZS9A 4HNHA 1Z22A 2Q50A 3VPGA 5YASA 2XCRB 2FCAA 1C1YA 1DEAA 1BHJA 4OTZA 5CFNA 5HKKD 1RMYA 2MU1A 2C98A 4YPVA 1QBGA 5G1PA 2ONCA 2G1PA 5T5QA 1I5EA 1OXKB 4GX0A 1OJLA 1W2GA 4ZZ0A 2E18A 3EDMA 2X0DA 5JNUA 4FYHA 3EHEA 5AXBA 3C3KA 3E1KA 1MDBA 4TM8A 1JZTA 2A4MA 4R40A 1GD1O 4Q0MA 4D5EA 3ZVMA 4IDGA 3GC6A 3UXYA 4HNVA 1WXHA 1ADJA 2FQYA 2IEDA 4KACA 4M22A 4Q4AA 5HA5A 1Z0JA 1QYDA 2Z2ZA 3O9VA 4ZCMA 3OOJA 2EXXA 2JDID 2X9LA 5B3AA 5C46F 4JBGA 3DE6X 3WDSA 1BA2A 4M1SA 2JGAA 1BCSA 3CPHA 4FEAA 1L7MA 1JDNA 2HT1A 2HLDA 1BU8A 3EWSA 3ESZA 3QLEA 4RK4A 5F9HA 1PW7A 3LGSA 1PCXA 4GI7A 2HM7A 4FFOA 4GPZA 3ZK9A 2HDHA 2QE7D 1LUAA 1WXIA 2AMVA 2REOA 2ZJ5A 4GM4A 4FB4A 1A96A 3GUHA 5DX8A 1WXQA 2FUG1 1CHNA 2FOXA 2ZBQA 2R79A 3A1EA 3B2EA 4H18A 4JVNA 4XDYA 3VV2A 3IOMA 3C98A 1X1SA 5DEOA 3ZXUB 2PZGA 3EXFA 2FA9A 1CZRA 1GGVA 1UMBA 4BAGA 5JCXA 5JXIA 3AUJB 3COJA 2IU6A 1OWPA 4JI4B 5AI5A 3WGKA 3JVUA 4KYVA 4E4TA 4I81A 2VCYA 5JNRA 5LIRA 3IDZA 5LU9A 2DKFA 2HTEA 5FBHA 4TT8A 2QX7A 4B40A 4BLTA 1C30A 2QS9A 2I1VB 3RB8A 3SYKA 4KVZA 4AKIA 4B79A 3AB7A 3CMCO 2BYTA 1ESCA 1L4YA 2AN5A 2X2OA 1TCAA 4UUAA 2J3DA 3TZKA 3L8HA 3UGQA 4XWOA 1V47A 2DJ5A 4RIIA 1B8OA 5BMOA 3L8GA 3OCJA 3BOSA 4TTRA 5EYPB 1V8FA 3PB3A 1FSGA 1W9HA 4OM8A 3BHJA 3O73A 2BHTA 3RUCA 1W93A 1RW4A 2PMFA 1EBUA 1HLFA 1R4ZA 1WL8A 4NU5A 4ZVVA 4LNHA 1OBOA 4EHKA 1Z6GA 3U60B 4PR0A 4K6FA 4O08A 2DKNA 2E87A 5A04A 2JH8A 3DBRB 4Z1MA 4G3XA 4CBVA 5F5XA 4GD3Q 3RFVA 2C9ZA 4DIBA 5HKKA 1B0PA 3DYVA 3RSHA 5I9NA 2YMPA 3PT5A 4BGIA 3DHYA 4FMDB 5TC4A 1NLUA 4C89A 4AUKA 3HGMA 2WMOB 4I1UA 4QUGA 1H4SA 4PYKA 4BO6A 4GXQA 2P77A 4M0EA 1JEEA 4C06A 5DGDA 3U4HA 1Y34E 1WV0A 4QGFA 221PA 1TE2A 3DFUA 3ZE0B 1JFTA 3L7JA 2PGXA 1G17A 3C0KA 4DTIA 1CEEA 2FXVA 4IZHA 5K51A 2FMFA 5BYKA 4UUNA 3OLZA 3L7BA 5EMHA 1CJMA 5JSYA 3ROMA 5DP2A 1TM7E 1ISJA 1BG6A 1D5CA 2B8EA 2QRVB 1C0EA 5DB4A 2JJ2A 3TIGA 4RMIA 3UN1A 3SQWA 4L50A 4KXFB 3E3NA 4NH4A 1IVYA 1RCUA 4JQZA 2P9JA 3BEOA 2Y4OA 4LXXA 2F17A 5CLQA 3RC3A 2HHHB 2AN3A 3MS4A 3JQ9C 1RYNA 3RG8A 2QUAA 3ZHXA 3RVOA 4TWBA 1WXXA 3KEFA 1J90A 1Z47A 1CQJA 2GUGA 3A9UA 2H59A 3GUUA 3O1IC 4OAPA 3L7IA 1EA7A 3HYNA 2YWRA 1ZCFA 1OH7A 2GPNA 3ORFA 1Q7RA 4F5DA 1Q77A 2C29D 3CLRC 1JDJA 1ZX1A 5TXGA 1HSOA 2QZ9A 1ECPA 3L06A 3T5GA 4B32A 5JJCA 1DINA 2VUUA 3LC1O 3QSGA 1CT9A 3WJ2A 3NHYA 3VHRA 3X1KA 2XB8A 3G8YA 2ZU6A 1OWNA 2LPMA 3EXG2 3LLMA 4B3MB 2Q4OA 4HDKB 5AW4A 3L7NA 3IKTA 3HXQA 4MUAA 1DRVA 1GA1A 3ZWNA 1IZ9A 5THKA 3WGYA 2IUFA 2VXCA 1JWAB 4PTYA 2NQTA 5JSKA 3WJ7A 3EA0A 2XCSB 3QGMA 4CMIA 3F4BA 4HFRA 2QPOA 1M3SA 5EP3A 4C4TA 1HL7A 1UFVA 4EYOA 1QKJA 2OVFA 3R76A 3V97A 3EUEA 1N92A 3FNGA 1S8AA 3JAKB 4UXIA 4Y9RA 3A36A 3EFBA 3H11B 5EMKA 3CWQA 3JYPA 1UK9A 2JZCA 1NDQA 3TW8B 3ZH9B 1GN9A 5DYNA 3JQQA 2R9VA 3L40A 1TUBA 3LUBA 4FT2A 4J0HA 4MH0R 4C4PA 1N7IA 2CF6A 1DXYA 1TJ5A 1DQNA 4GW3A 3HYCA 4YV0A 3CW9A 3NANA 2NGRA 4D9GA 2AEMA 4JB0A 5TR9A 1CWUA 3DWGA 3U56A 4NZMA 4AK9A 4LXTA 3PQ3A 3RGWS 5INTA 1EQ2A 1Y9AA 1GVHA 2ANCA 2O2GA 3LQKA 5FUWA 5C34B 3IAHA 1QH9A 4KDRA 4PGFA 5A3RA 2GAAA 1BJKA 1ODLA 1R12A 2PGOA 2HCJB 3AEUA 2PKRA 1JLLA 1QO0D 1ADBA 4X45A 1QOQB 3DM5A 1KJ8A 1PJ4A 4KQ2A 2JCVA 3TD6A 3W6ZA 3LOPA 4YN3A 2O8NA 1HG0A 3C2QA 3EZ6A 4FPXA 1Z2OX 4FHDA 5DEIA 1EDOA 4D43A 1ECGA 4QOHA 4DV3B 4EG5A 2PLRA 2FUCA 4P98A 1JHOA 2VZLA 1N5DA 1ZCZA 4BO1A 4B6GA 1T29A 5JIBA 4HDMB 2NZXA 1KDYA 1NNEA 2XLCA 4FLEA 2B4QA 4BMYA 4RVDA 3KNZA 3IA2A 4E1VA 2EYUA 1GCOA 5KTPA 2COEA 1N4AA 3G9UA 4EKGA 4UVIA 4CDNA 2AFRA 4D9NA 3OTHA 1R0RE 2RGGA 1A88A 3HVRA 4K6KA 2M6SA 3EQ2A 2A5JA 1EUCA 2YOFA 1OAOC 1C8KA 1LPMA 3A0UA 4D41A 3LT2A 4B5LA 1EWYA 1T13A 3L01A 3GLFB 2CL7X 1JEAA 3HRHA 1H3NA 3E9CA 4KG7A 4JSTA 3AWDA 3NHUA 1EZZA 4Q9LA 1ECBA 2WABA 3C3DA 1HEIA 3WGTA 4M1TA 3I5UA 4TOIA 4TL7A 4I50B 5JPCA 2GM5A 2J7PD 3OEYA 4B17A 1T0UA 1GAQA 1C81A 1RLMA 1UT5A 4MROA 4PVDA 1GRNA 3HN6A 2JFYA 1C3VA 2YNMD 2ZQZA 3LA8A 3TTSA 4FR5A 4E11A 1QPZA 4QLAA 1UR5A 1K6IA 2D7JA 3F5SA 3FOBA 3OZVA 3AG6A 4D44A 1VHWA 2E1RA 4UKDA 1O57A 4Q3BA 3IV6A 2CFRA 1M2OB 5AUNB 4FDTA 2PRKA 1V0JA 4XM0A 3I5XA 1JJFA 4XDGA 4YPFA 1G7CA 1XDDA 3CT6A 4YCSA 3FUCA 2XHEA 3I2JA 1FXUA 1YFKA 4Z8XA 4DQLA 4LCJA 1NKSA 4FLFA 5K8UA 1PX2A 3FCOA 1BSVA 4DYDA 2UYHA 2P1ZA 3OKCA 1T2DA 1U2QA 3S68A 5DXFA 1CUHA 1MB3A 4BJ6A 3IUMA 4Z9BA 4XWYA 4Z0TA 5B5SA 3QXJA 2G28A 4U6NA 1U1EA 2J6BA 3EVAA 3CG0A 2EFJA 5LM3A 1U81A 3K9QO 1N1MA 1W4AA 4IOJA 1ZI8A 2WFLB 5D7NA 2HHLA 1V6CA 3UZUA 4M76B 1DG1G 3P0JA 5CW1A 3L7DA 1E1NA 3OZIA 5FI5A 4KK4A 2FFHA 5DHQA 3WYBA 3HUDA 1I6LA 1E7WA 1CNEA 4JYMA 1DX4A 2CJWB 4FN5A 4RFSB 4OSOA 1ZEJA 1V35A 4XEUA 2EHJA 3LVFO 2CXXA 1BMTA 4N5DA 3TAUA 3VRHA 2ZUFA 3QEOA 2RHRA 4GBMA 1T5OA 3TJRA 1CZOA 1W4ZA 1NM5C 3MD9A 1YFLA 1WP4A 1RVDA 2WLSA 1L4LA 3PUJA 1Q91A 3PIIA 5FWYB 5KB3A 1FY2A 3H17A 1A2QA 3P9NA 4QM7A 3RVMA 4NECA 3O2NA 4NBLA 1F8GA 4DRXA 1NC1A 2RGNA 3T7KA 4WOCA 5CW2A 3KO8A 2R0QC 1SAYA 1TIBA 3HLTA 4LZWA 3BGOS 2POCA 3WYEA 3KD2A 4ARUA 3CYFA 3K73O 2JJYA 3QUCA 2B5OA 1N2HA 1CBUA 1ZH8A 3SZUA 1F38A 4LF8B 3VJRA 1I7PA 2J1LA 3G2LA 3KWLA 4CIVA 1RKQA 1MC1A 2R96A 4KFTA 4WDRA 1RXIA 4BMZA 3Q12A 4AJNA 2QENA 5BORA 3JZIA 4ZRDA 3GJRA 1COZA 1RYHA 1V2HE 8MHTA 1GQYA 3FCCA 2IY9A 3IT3A 4JEHA 1QOZA 4DZZA 3CLVA 4CU5A 3PHCA 2IYXA 2PT6A 2EKPA 4RSGA 1DCMA 1DKMA 2WTEA 1GPWB 5ERXA 3S6JA 3UOGA 3IV9A 3KZCA 3CEAA 1E6KA 1Y0BA 2I55A 4HUJA 1ZL2A 4QQ8A 4MQ6A 4FOTA 1O97C 3FUVA 1D2HA 3G0CA 1NYTA 3ZY5A 4BATA 1HEYA 2HNBA 4RHYA 1GUFA 3GCZA 2IYNA 3AG5A 4QULA 3Q0TA 4Q4HA 2XQIA 1VKJA 3U3DA 4ACAA 3AKYA 2J30A 4IVPA 2GZHA 2E1PA 3AH8A 4EPVA 1NR5A 1SXJD 1XD8A 2H2GA 4DDHA 5I7OA 5TDHA 4R71A 4AMVA 1GM5A 3FTDA 4DWWA 3C4VA 3H86A 4FDUA 2FW6A 4GSKA 2AKEA 4QTYA 1WX1A 1MP0A 3B7WA 1TVCA 2O0JA 4KHZA 1L1RA 3NHJA 2DBRA 3K4QA 4AJ2A 5ITSA 4PBTA 3BK2A 1P2VA 2ZBEA 4AO6A 1F4PA 4PZZA 1PK9A 5BUCA 4EF5A 5BP7A 1AC5A 3SEFA 1E79D 4HAUA 2E4ZA 3V8NA 4HWGA 1ANKA 1BVYF 1H8HD 1LPBB 2EKDA 4KI7A 2O8FA 4JJGA 5K6TA 4PPNA 2F59A 1PZMA 3K0CC 1C7ZA 2IEZA 4L74A 1YB2A 3M4XA 2BFCA 1DKQA 2XGMA 1DAEA 1H94A 4UCXA 3UMRA 4CI0B 1X94A 3Q85A 4E22A 1X1CA 4KMRA 2XNSA 4L6IA 3UBMA 4WWHA 1N1GA 4FFWA 2JFVA 3YASA 1ZNZA 3GFFA 5LBUA 1SY7A 3CX3A 1C3OA 3SNHA 4AG5A 4CKCB 1A7KA 3VU1A 3L18A 3LAWA 4EO9A 5GM1A 4EIWA 2VTBA 2BEVB 1S2GA 2FZGA 4LKRA 1ZCAA 2PVSA 3PWSA 3ITEA 2VHUA 1EFKA 1MMFB 4H59A 2YXDA 3OOEA 4O2BB 4DSUA 2KX7A 4O4IA 1O6BA 4N5IX 4YMUA 4LZOA 2VJKA 2E6KA 4OJNA 3FPBA 3HA7A 2ARKA 3PC6A 3VHLB 3FPEA 3U09A 5ALDA 2I1QA 1RD4A 1GRRA 2YVAA 2O6HA 3H0KA 1KVUA 4OQLA 3EFOA 4OQMA 2R7AA 5AW2A 2P78A 4ZICA 3PGJA 2GBPA 2JI4A 1G4AE 2A9VA 1K8QA 1VG8A 2I6UA 2I03A 3C6ZA 1S1CA 2V9PA 2CMFA 3CF4A 2V7QD 4KC0A 2PLFA 3X0DA 4FYPA 3Q3VA 4U5XA 3A2KA 3L5KA 2W11A 3T7CA 3O8BA 4DMRA 2QNIA 3RHFA 5FYQA 1GGKA 1T9HA 1X39A 1FYEA 5ELLA 1W6RA 3S0JA 3DAOA 2UDPA 4FC7A 1MNAA 2JFHA 2EIXA 1JPNA 5EHQA 1QFXA 3H2JA 4QGBA 1HE3A 4Y2PA 5JSHA 3KE9A 1RI5A 3A27A 1P2TA 1BW9B 2WUWE 1YNSA 3D6HA 3MAAC 3MJEA 4FP9A 1U3DA 2VO1A 2ZAIA 4IIYA 4P58A 1JTEA 4UTXA 3CZAA 3P0HA 1KSHA 1RHKA 3PEUA 1CVRA 3PJEA 3TI9A 5IX8A 4ND1A 5J59A 4KZPA 5ES3A 4GGMX 1DWUA 3TF5A 3EH2A 4FQ8A 1JHUA 1KAQA 4KXYA 4WKGA 3I0ZA 4N49A 2W2NA 3OPYI 1ODKA 1SBTA 4WCFB 5EIEA 2VQEB 1MA0A 3IMCA 4GBJA 2WYWA 2BZ0A 5JI3E 1XLVA 3D3NA 2QROA 2JJ2D 3ILHA 1VHTA 5C1PA 5KYXA 3JQ8B 4AKHA 2WTMA 1KQ3A 3AL3A 4P36A 1S01A 1GQQA 1W0JA 2NUPA 3O3NB 4NG4A 1HDIA 2CEKA 3WNVA 3ZWXA 3OOYA 2IUYA 5DF1A 3E3MA 2FLKA 1CR4A 1PZFA 5F7XA 3HYTA 4RIEA 2AMYA 1Z26A 2XX3A 4P33A 5GIPE 3COSA 4ZT4A 1BXRB 2LCFA 2WE8A 5CXUA 1DAOA 2QW0X 5DI3B 1YD7A 4Q03A 4V3CA 2WHPB 2WUDA 4JN6B 5P21A 2ZW9A 4RPIA 1R5OA 1E4VA 2A9PA 5KQRA 4I0WB 2XVMA 4HDRB 3Q7RA 2D3TA 3NAQA 3GEPA 4NBUA 4K88A 4CNBA 5LDGA 1HYEA 3K31A 3KXIA 2VNKA 4U8GA 3BILA 3I23A 2H1VA 4OPMA 4X1KA 1P73A 4EHIA 3IXQA 4YXWA 1CV2A 4F92B 4BPRA 4PPFA 4ZT3A 3FDFA 4UHEA 3A9SA 4OM7A 3PPXA 4CTNA 3N8DA 5EIHA 2ZRBA 4A7PA 4ZN6A 2GXSA 1NUHA 4HTAA 2RFLA 1M74A 3L92A 4B3DA 3DBRA 4XR9A 3D8RA 5G2OA 1OZ0A 5SICE 3UHAA 1JEJA 1EXMA 2WPDA 2VJNA 2WJJA 4H2DA 1K6MA 2B6NA 1IN4A 1GZUA 2AKAB 1A9TA 3ZWCA 3ZW9A 4IUDS 4P31A 4U6SA 1JF8A 3ZHUA 4E4RA 4FOSA 4GVPA 3IDAA 4QDUA 4ALNA 4BVLA 4MDFA 1GUAA 1YZGA 5CX1B 4B09A 3JCZA 3N70A 3IX7A 1DC3A 4NMMA 4LY9A 3SAJA 3Q5GA 1PJBA 4D2IA 2JI9A 3TTUA 1LBHA 1CQWA 2P7IA 4QOFA 1JEYB 1NLFA 1YQQA 3BKWA 3GRRA 3PPVA 4JSYA 3ACCA 1RXSA 5G4KA 4AJPA 5T8KC 1RLOA 2IYYA 3A3YA 4LY3A 1PVDA 2LUOA 1KVSA 1UM9B 1FX0B 2D5LA 3P5SA 2FSVC 5AVZA 4QYMA 4TXLA 5K8CA 3ZVNA 1XMXA 1HT0A 1O6GA 1XAJA 3E48A 4LFBB 4HLCA 4NESA 1GARA 1JR3A 4S2UA 4I5GA 3M49A 3TVYA 1A8SA 2ZWIA 4PVCA 2CMKA 3QKRA 3ZQ6A 4CE6A 1M83A 5IKMA 5ITZA 3MTDA 1U5BA 4CEHA 2X1HA 4J16A 1ZD4A 1BIFA 1OFUX 1ZONA 1QYWA 2P8SA 3EXEA 3HU1A 1EE9A 3B78A 3H2GA 3M6XA 1H5NA 1P74A 2EJBA 3SZLA 3ZIDA 3L7AA 4H9GA 4TZ0A 5TRTA 2G76A 2FQXA 2RHHA 3MWJA 5AUQA 3TOZA 1LXCA 1LDEA 4RZUA 3CWZA 3N8IA 3WLHA 3BEDA 1LK0A 1VLQA 4DTCA 4YGXB 1X7XB 1OH6A 2VDOB 5EIXA 4MB2A 4G0QA 4HS9A 5LP6C 2D2VA 1UPUA 2G0TA 2FWAA 3R3VA 3HI6A 4L8FA 4OLAA 5DTMA 3VR4D 1G8GA 1GT91 3SGLA 3QBVA 1HE1C 1HR0B 1QJ4A 4HB4A 1JLRA 4F60A 4ZJUA 4LQCA 4Y30A 2EKQA 3F0TA 3ILSA 1MAWA 2VTDA 5AKZA 1AIPA 4BN5A 3K4HA 5JSUA 2ADMA 2FRDC 3DV0B 2IK8A 4JKIA 5EUMA 1VBFA 1YMVA 4UOEA 1RM4A 2E7ZA 1K5HA 4CDGA 1KMHA 1DBSA 5E0KB 3KLMX 1PR1A 1JZSA 2Y1DA 1T4MA 1J0DA 1H1TA 4XGQA 4Z0HO 2BIFA 3SVTA 4RAOA 1SD5A 3B2QA 3EODA 1HOXA 4OK5A 1YXMA 3VC1A 1JB9A 4G5OA 3UW3A 4C04A 1IK6A 1PWZA 2GLUA 3UMJA 5JISA 1DT3A 1ZWLA 4K46A 1QZXA 1K88A 2ZAMA 2D00A 3ZKWB 1X87A 2RHGB 1E3LA 3OPNA 2P5SA 1YQ9A 3CFYA 4WN9A 3L4SO 2AZMA 3EC7A 5DMHA 3DMGA 3ZHTA 2P2ZA 4LXUA 5CLGA 5BSVA 3U4GA 1GILA 3DWIA 4LNAA 3UCXA 4AY3A 2BL4A 1RBYA 2H2DA 4UEJA 4EMUA 1CY2A 1SGWA 2I2AA 2J0UB 4PX9A 3M3HA 3NNDA 5CT4A 1JDBB 1X8JA 2FJ0A 5H4HA 4BCBA 1PIWA 5LVAA 3F73A 4EW1A 4FQ7A 2QLTA 3A1WA 3PHJA 4FYMA 4US0R 4WESB 2HNAA 2Q4TA 1KI6B 1EDEA 4TMTA 2R8PA 4ZEOA 3T5CA 3VVBA 3ZDEA 5EJEA 2J9FB 3GU3A 4EHHA 1H0HA 3PPIA 1G5PA 2VUHB 4G8BA 3DA8A 4HAZA 2CXRA 2Q5OA 2V7VA 3AC0A 4V0QA 1KI3A 4N7JA 1TT5A 4BEWA 1EVKA 1PW5A 3MTJA 2PIAA 3R5XA 4HRYA 1B00A 3L0DA 4QUHA 5EJ9A 3BFPA 4X63A 3EZFA 1SOUA 5U9CA 3P1JA 4HAYA 4I4TB 4R0MA 1NLMA 3C7CB 1T6YA 2JI6A 1HLPA 4YAWA 2P2SA 4UVGA 4MVJD 3UJPA 3UC5A 2KB0A 3L6OO 4YQZA 1AB6A 3TLCA 4B8YA 4EENA 621PA 4NS1A 5EZYA 4DL9A 5F7JA 1R9MA 4C87A 1LZKA 3NT4A 1F6DA 4YR7A 4NZYA 2PUDA 2EQ5A 1K5PA 2XCLA 4KXLA 4ND7A 2V4ZA 3GLKA 3NBFA 5TNXA 1Y8RA 3GGSA 5LLSA 3I4CA 4FYJA 1QGUA 1QM5A 3OPQA 2K87A 2G83A 1JALA 4Y2RA 3SLRA 3NBYC 3L0ZA 2YWJA 4LZPA 5HJ7A 4E5DA 5KNBH 1OMOA 2Q8NA 2QPLA 2X3YA 1GQRA 1L5OA 2J9YB 3DBIA 2VBIA 3JQAD 4NYMQ 5HS6A 3DNPA 3GDOA 2Y0PA 3OTOB 3FSGD 4CT5A 2W2KB 3PWZA 5HE8A 3GAFA 3I01A 3PNMA 5AR1A 1ZUWA 1VJGA 1O96B 2IKQA 2P9QA 1EWRA 2Q07A 2WU1A 2ZB3A 3KELA 5JAOA 5ILOA 4YECA 4PSUA 4L6CA 3WGMA 1THGA 2XD9A 3A1UA 2MWMA 2ZPAA 4CLEA 4D81A 1R64A 2YY7A 2BMFA 4ZVTA 4WNAB 5IBCA 1FLNA 2ZIAA 2I2XB 4C76A 3MTAA 1F2TA 3QF4A 1JYEA 3GP3A 4F06A 2Q9CA 2SNIE 4WI1A 2C2OA 1TM4E 4KGDA 5F51A 2A1TR 4OFZA 4DCGA 1Y37A 2GSDA 5AWFC 5A3JA 1BZYA 3MT9A 4UBMA 4UFOA 5A4AA 2O8CB 2QVYX 2HPVA 1F1JA 1JSZA 1Z5GA 2FSUA 4ES6A 1QZ3A 3FMOB 3NUQA 1V1MA 3REQB 4R9RA 5HUJA 4KXWA 1DIOB 1O95C 1N2EA 2XMZA 3GJQA 1CVLA 4HNAB 3VPBA 1YBAA 3DG9A 3KQWA 1GV0A 2BMJA 4Q1FA 3ZWDA 4PX5A 4BAZA 4JUFA 2WVHA 4MVJE 3F7OA 3GY0A 1IN8A 2QRGA 4ODIA 4DEVA 3K7EA 3WV4A 3LUJA 1Y3HA 1YTUA 2IYRA 4D57A 1PS0A 3PGMA 3KJGA 3WNBA 3OF5A 3AM5A 4EGJA 4LRUA 5FL3A 3HZOA 4QVGA 3ZD7A 1B8VA 4GQIA 1VGVA 1ZVJA 1YRHA 2OL4A 2V0NA 4GZ3A 4QGSA 1YHYA 1VYTA 4B47A 4OQEA 4FZ3A 4V0MA 1GPKA 1ZMBA 3HY4A 4HATA 3FNEA 3MUEA 3VR5H 3PL5A 4F1JA 2UVPB 1U2ZA 2R5FA 4G65A 3WLQA 1H2WA 4CR6A 1KJNA 3MTEA 1U11A 4IXTA 2PX6A 2OM6A 3EXIB 3HKDA 3ZWWA 2FSIA 1ORWA 2IXTA 2AMFA 2I6SA 1IMJA 2W2XA 3G13A 3LE8A 4IRUB 5D3QA 1MO6A 1VA4A 2EBHX 2PM8A 3QBJA 1OZHA 2CDNA 4H17A 4UOZA 3QKRB 4QQFA 4B4VA 3PFHA 5DWVA 2R6CA 4ITRC 3NATA 3BF8A 1LTKA 4DY6A 2A9KA 4QPZA 2CFIA 4Q3LA 1U3FA 3U4DA 1B41A 1CHDA 1IEVA 1U8TA 3W7BA 3T9BA 3LDHA 3FYCA 1E9EA 4H7FA 5FX2A 4M7WA 1SQSA 3ULKA 3FSGA 3CLTD 1SXJA 4ZIRB 1SHZA 2DZDA 4BVAA 1KEUA 1XKXA 4CJXA 1FVFA 1TK3A 1ONSA 4B3SB 4WLOA 5K0FA 1DIHA 2JAOA 4XXHA 3BWMA 4JCOA 4ZAZA 4A8TA 1UP7A 2BR3A 1OROA 4YT4A 5IMBA 1JEYA 4BXOA 4A36A 3TCNA 4RKWA 2AN9A 4I5DA 3L4JA 3P8ZA 1W2WB 4R1SA 1W9MA 2C57A 3HBNA 4AY5A 3IB6A 4OSEA 3CVXA 3T9AA 3STXA 4C78A 5IXYA 4LMBA 1O77A 3WGQA 3D7RA 4G6ZA 3IDOA 4P3YA 4O1IA 3WNZA 5K3SA 3MG9A 5CFLA 421PA 3HP7A 1SOWA 4G5YA 4YEDA 3I45A 3TKAA 4D3FA 2BGMA 3K71B 3OX4A 2E85A 2BP7A 4BZPA 4DRYA 5KIAA 5T3YA 5LP6A 4S0ZA 2IYLD 4FIDA 5TQ0B 4J0GA 1UWCA 3O4VA 1CSEE 5EJAA 2HRBA 1RPAA 3D0KA 4OHVA 1B23P 3ROFA 2QAGA 2X2FA 1H6DA 1VJRA 2ZRNA 1USIA 3F4LA 3RKSA 4RF5A 2R8BA 1NVTA 2G1UA 3HB4X 3PHLA 4HQKA 2QX9A 5TVGA 2O4UX 3EY4A 2O0KA 1SCAA 3ESYA 1S6YA 2J5QA 2VF4X 3JTEA 1PT6A 4ICIA 4D97A 1MQAA 4YRPA 2E4UA 3P9RA 1T2FA 4M1ZA 2RHCA 1LSUA 3AL2A 1VFPA 1YS1X 3B7GA 2WKWA 4HDCA 4JENA 5H8WA 4I5FA 3CRVA 4CIXA 1NRJB 3L46A 3JVVA 3GZ4A 4CTJA 5AVSA 4OQ4A 3U81A 1J0EA 1VL0A 4DA0A 3WK4A 2NU8B 1THTA 2YBEA 2MSWA 2ZWAA 4LSGA 3VU0A 1SUFA 3ZWBA 4ZVOA 2AHOA 3UGTA 3U37A 4L8YA 1ESEA 4PO3X 1F6WA 3EVEA 4E5MA 5E7QA 4UAJA 2PIDA 5FPTA 2WP8J 2BKAA 5ER9A 1M33A 3AFNA 4IXWA 3DMTC 2J9ZB 3NFYA 3ME5A 2V0CA 1Z5WA 2VKTA 2ZXEA 4KWTA 3SJAA 3UUGA 2HJHA 1IEWA 1PL6A 3GHHA 1I5RA 3VR3D 4REMA 1HLDA 1J0AA 4NBTA 1CY0A 3MJHA 2Z95A 4GOJA 4Q6BA 5KKNB 1BVUA 4BQOA 1PLLA 1OXMA 2VH5R 3G2QA 3OEEA 3WL3A 4BOYA 3R7WB 1BXKA 1VA5A 1VE1A 3SDBA 3ZYZA 3UEOA 3MTQA 4BMCA 1N9KA 4MS4B 1NTRA 1K7FB 3WIDA 1FP6A 3G5MA 4YY3B 2Z08A 3CNNA 3DZKA 5JJIA 4S2EA 1BW9A 4PHTA 5BNWA 1MTOA 3ZQJA 1Z6AA 4BJ5A 3HCDA 3FHOA 1YOVA 1ONOA 1ID8A 1KYYA 4KI0A 3U31A 3TNDA 3WNDA 4B2PA 3F8WA 3T0FA 1HH4A 2BLNA 3DKIA 3EG9A 4RLHA 3FA2A 3ZGXA 4X1YB 1HKUA 1M1YE 3ABSB 5FI1B 2VL7A 2LIVA 3BSSA 5DNCA 4PINA 5AFSA 821PA 3PXGA 1A82A 1K3UB 3VPHA 3K70D 4OI2A 2ICAA 4JA2A 4MWCA 3J7AC 5JNWA 2ONYA 5NLLA 3O8LA 2B4RO 3PE6A 4TRNA 1DDOA 4CM6A 1GL9B 2B25A 4PRKA 5JAPA 2PLNA 2WEKA 2Q1WA 2OHFA 3M6MD 3UK0A 4CL8A 1G8SA 2GPYA 3M89A 1ZRSA 2OCBA 5HX7A 3BBPA 4YHHB 2G7ZA 4MUFA 1R9JA 3ZZNA 4MVYA 2A58A 4RZQA 3QTLA 3DT9A 4AM8A 4DJAA 1JR3D 1L7EA 2A30A 2O7NA 1W581 1TJNA 3L4BA 5BOSA 3GELA 3QP9A 3CLUC 4Y2SA 3TAHA 4URZR 1VZ2A 5EZSA 1DRKA 1D8AA 2OCKA 3MB8A 4N01A 2O8EA 4ABTA 1E2JA 1EB8A 1G5FA 2OAQ1 3HS3A 3P9PA 4S1NA 2MYNA 5AVJA 3SHOA 4FIZA 5TT1A 3R0XA 5IDQA 3H05A 3ZWQA 1E1LA 2F3SA 4QPJC 1FMLA 3QOFA 2HBRA 3FFAA 2ZTUA 2FGJA 1BWQA 1P77A 2Y9MB 4NMLA 2Q2NA 4PO9A 2W22A 2I3AA 1T9GR 1FP1D 3ZTWA 1RM3A 2H00A 3I64A 1O94D 3E8MA 4I9GA 3WO1A 1N33B 3T9DA 2ETXA 4U0KA 5FUBA 3M6WA 4HUQB 3SOZA 3E22A 3IE2A 3HCRA 2F43B 1J9GA 1E96A 1U5AA 3B89A 5DM2A 5E7JA 5ARCA 4EKEA 3MGKA 3ITKA 1P1JA 3KL4A 3LGAA 2CNNA 4HXGA 1TVKB 4O2AA 3NHBA 1XTUA 4Q18A 3CS3A 3R5SA 2G8NA 2CYBA 2AX4A 1KI6A 4KXQA 3P32A 2BD0A 4RMJA 2GILA 1WSWA 3E9NA 3IR6A 2PSHA 1AF7A 2FMIA 3KSUA 1DL5A 4YBZA 3MJ4A 2ZTHA 3MJVA 1II8A 4WXMA 2XVXA 4P3KA 3JQAB 1CY6A 3A4IA 2F1KA 3JR7A 4RK5A 3CB4A 2FFJA 2SCUA 1HKHA 1DXOA 1SU4A 2J4CA 4TRJA 3RANA 3BSFA 3AVVA 3V48A 4BYGA 5LZ9A 2XSZD 5EP1A 2DHRA 3D2AA 1SUBA 2O2HA 4LI0A 4BNJA 4YJGA 2RGRA 3CF0A 4WIAA 4BASA 2WAOA 4B8WA 1IB0A 3T7SA 4EY6A 3WBJA 2P3SA 3LKDA 1RJDA 3I9LA 4JC5A 4NBNA 5GZ3A 4AY6A 1F2DA 1YR1A 1Z0DA 1Z5UA 2CJWA 2P4QA 4M9ZA 4S1PA 5NULA 1OA1A 1ZH0A 2ZBDA 4L5JA 5JDIA 2OCLA 4ZCSA 1ZVQA 3O21A 4EZBA 1NWCA 2C0PA 1E9CA 2QL5A 4C4SA 4HQNA 1RHRA 5DCYA 4KRYA 2I7DA 4QOJA 2D2EA 3RIYA 5AVWA 5KMGA 3MNFA 2D1SA 3LRPA 1XAIA 4D9EA 1QVVA 4DUYB 4UQPA 3VDRA 5BR4A 4U0JA 4QDOA 3OSZA 4U2KA 5JVDF 3CVVA 3OA2A 4PG4A 3KZXA 4HSEA 1NMEA 3S2EA 2PYZA 3QKIA 4A0HA 4HDNA 1SPXA 3B51X 4O5AA 2MHCA 1UAYA 1Z0SA 1JHQA 3VVCA 3HCOA 2PGLA 1ORRA 1ODFA 1OBFO 1YQUA 3V8RA 4KO3S 2Q6KA 3FNRA 2G71A 4EAQA 1AJEA 1TO1E 2PL5A 2ZI5A 2X0RA 1KBQA 1R74A 3GHYA 3TW0A 3OU2A 4UULA 4BGUA 4CGYA 5WRFA 2ZI6A 4DCOA 1RADA 2EFGA 4YQEA 1Y63A 2IBMA 5U1PA 3U9TA 4C5CA 3U44A 2PQ6A 1DKLA 2OO5C 3S44A 3N28A 5B6IA 5LMZA 3KKEA 5DTJA 2PX3A 5K8IA 1OFUA 1IDN1 1UZLA 5GJBA 4IJUA 2R6AA 2VRWA 4ID3A 1R0BA 4BMDA 2W58A 2MIIA 3MN1A 1R5BA 2R65A 2V1XA 2Y1GA 3DC2A 3IKMB 1IAQA 3P4YA 4IQ4A 4JIMA 4TRRA 2PS3A 3DTVA 5A62A 3KVYA 2QYOA 2QX8A 1UWVA 1L6RA 3L0BA 4PONA 2XDQB 1Q11A 2O0HA 1CJBA 2DR3A 3FF1A 3NETA 5JPDA 4OQDA 1YU9A 2Q62A 4MGIR 1DHRA 1Y4UA 3VQTA 2I9KA 3DYBA 3S8EA 3QWAA 2WSLA 2VSNA 1M6NA 3FSEA 3G2NA 4G4SP 2W8ZA 4IH4A 2AC4A 3EASA 1J9EA 2RJ3A 4QXQA 3G0IA 2B1QA 4RXMA 3RSLA 2B36A 2PFKA 5DIZA 4KXUA 4CQMD 3BXXA 2TECE 4ER6A 1YB5A 4E5VA 3KT8A 1KJZA 5IKXA 3RUPA 4B9AA 3I58A 5CPFA 2J7PA 3LQ2A 4I36A 1VBKA 1CQZA 1VE6A 1XV5A 2J85A 3AR7A 4ZVMA 3QJYA 1PT9A 1ZGCA 3QTTA 3T1QA 1N2CA 3NH6A 3ECCA 3ZK7A 2WKRA 1WETA 4YYEA 1CY1A 1GNLA 2IYOA 2NV6A 3HY3A 3NOXA 4JCCA 3CO0S 4R31A 5FEMA 2LVBA 1SR8A 1A7AA 2EARA 3ETNA 4GEKA 4Q5IA 4YJ3A 5G1NA 4BQQA 3O84A 4DMUB 4DLAA 1Y9EA 2HC9A 5HDBB 4LF4B 3SICE 4Q4JA 3HI4A 2JJQA 4E5KA 4HZUB 3EMBA 3HYLA 1CQPA 3PHIA 2XGJA 1SCDA 1IM8A 4IDQA 3TTWA 4XPZA 1JDUA 3KTDA 3EWAA 4RXTA 1KDRA 2QG6A 4MKRA 2GZ2A 3BFJA 3GFRA 1Y4DE 3IEXA 5HG0A 1U8YA 3VXKA 2D5CA 3RIGA 1JHYA 1GTMA 3OO0A 4KGZA 2GM3A 4XYEA 3LG2A 5BYBA 5C8YB 4J7AA 2BR4A 1QTIA 2J0QA 1HXHA 2H48A 4O4JA 5CH3A 2ECOA 4Z7JA 3CZPA 3FX2A 3S28A 5AT1A 3KXPA 1H2FA 4OBBA 4RTQA 3C45A 2Q5FA 4G8DA 3HBFA 4CF4A 3CUSA 5BMVA 1QGUB 1KYWA 2BGTA 2ZROA 5HIAA 1X80B 1K2WA 1YTLA 5EJGA 5CA1B 1TEXA 5CP8A 1RJWA 2D8MA 4PF1A 3TK1A 1RAHA 3E6AA 3N53A 5CVEA 5A7FA 1W1UA 2AOTB 2I71A 4JT4A 1GCUA 1Q95A 1KDOA 3K1JA 4CLOB 13PKA 3VR6A 1TGYA 2L18A 4JBNA 3PEYA 2G3YA 2X1MA 1E9DA 1NC3A 2OZLA 2OV4A 4B4KA 3JQ8A 1NMXA 3VR3A 3GVHA 3W4KA 4F4HA 2IP4A 2XUJA 2IWRA 4UPEA 1MVNA 5E6UB 2QQ0A 4DQKA 5D5QA 2HK9A 2D2XA 2IW3A 4J1NA 3CSDA 4G4JA 1GG9A 2J3MA 3EWIA 5AOVA 1MCZA 2R1ZA 2C07A 3A9TA 2YMMA 2ZBGA 3NEYA 4JD5A 1TJ3A 2WLTA 4FCTA 4LYEA 4BQEA 5JJKA 1MC5A 2PZMA 2BFOA 5ALQA 1X7WA 2B9VA 3DHVA 2BM1A 3FNQA 4OH7A 5DKFA 2HCTA 2O2DA 3IJ5A 2LTAA 3H9GA 3BZBA 3SNKA 5KYWB 1MEEA 2FTKE 2R68A 3FD8A 4ALIA 4NH0A 2O23A 3MRSA 4L0CA 4Y2GA 1XPJA 1BROA 2IPLA 1IQPA 4F3TA 1LEHA 2G40A 4JKYA 3WLTA 2GS9A 2HIGA 1A4XA 3M9LA 3R6LA 1C7JA 4BX8A 1JPUA 4OJTA 4C05A 4DA7A 2Z4RA 1HFJA 3OEHA 2RGXA 1QTQA 4C08A 3R9WA 3MPOA 1R00A 2PGJA 2YZKA 3ROTA 3JYLA 3BMNB 1KZHA 1LF0A 4KL8S 1XKLA 4GECA 3Q6MA 2ZRHA 2V6FA 2JKVA 3QU2A 3RKUA 2SKDA 5PNTA 4BNLA 1CUYA 2G9NA 1N9GB 1I2CA 4F5ZA 1YDGA 2OC4A 1A8IA 4CKZA 1KFJB 1SOMA 1BJRE 2A59A 5D01A 3WYGA 2HY7A 4DDWA 1VBNA 2EQAA 2INGX 2QM3A 1PKXA 3A05A 4OUDB 4XJTA 2DULA 5FUMA 5IM4A 1I3CA 5LB2A 3NC0C 1G21A 4FFRA 2R4TA 1ZIDA 2EF1A 1PJLA 7GPBA 4KQHA 2I33A 4ZKDA 4PHHA 2DF8A 5JZVA 2ID8A 4W1SA 4X5OA 4DT1B 1BDHA 3WGUA 1NV8A 2IVZA 3NBZC 4INZA 1YK1A 1S4QA 4IDBA 4K9PA 5EJ8A 1UXOA 2H4YA 2FX3A 1VECA 1YB6A 1YE3A 2Y0EA 1A3CA 2A14A 2LE0A 4LJ8A 3CCFA 2A5YB 5DLPA 5HP4A 5K8VA 3JS5A 1PHPA 4I14A 4YDQA 3MWYW 1SOVA 3MSCA 5DNAA 5L51A 4Q00A 1JKXA 5LOVA 2RAFA 4RCYA 5LWQA 4IDEA 1XMOB 4NMXB 1UBGA 3NFRA 3CNQS 5BNZA 3E1GA 2D2FA 4DA8A 4ZGWA 2H7CA 3M8KA 4CKXA 2B9EA 2PPLA 2Q27A 5C7IO 1CB7A 5F1OA 2YDXA 4M83A 4NONA 2GYYA 2HWUA 3F2VA 4Z4HA 4LJ5A 3OMXA 2IXEA 2B83A 4LXYA 5D1NA 1OTXA 3WLOA 3OCUA 2YUTA 4PRZA 5EMMA 3HSYA 3Q3JB 3R6DA 2AL7A 2AQKA 2YMQA 1AO0A 4PZUA 5BV0A 4CG1A 1EEXB 4J76A 2C61A 4E15A 1KO5A 1MO5A 1Y3IA 1ND5A 2ZREA 1QMGA 3W5SA 4PRYA 1EZ4A 1YQDA 1WB5A 5E7IA 2ZYSA 1UM9A 3OQIB 2ZSJA 4PZ9A 2ODNA 1H3EA 2JIZA 2MDTA 2XXBA 3GLQA 4MS3B 3BWEA 2PL9A 4CMEC 1XP5A 2CNWA 5IXSA 1EFDN 2TMDA 4YP1A 4DYHA 3LY5A 3B1YA 4W5NA 1X15A 2A1UB 4MK4A 4V38A 4DWVA 5L3QB 1Y3FE 1ISGA 2VYCA 2D5IA 1U8AA 5IKEA 2CD7A 1WAMA 2Q5LA 2WHQA 3AESA 3CRNA 3I30X 4JYCA 3FYSA 1YQEA 2FQWA 4CUJA 3L1HA 3CVWA 1O87A 2Z1MA 2Z2YA 3CT4A 3NCTA 4O2LA 4OFWA 5GONA 3TD2A 3TD9A 4D8WA 1QQ7A 2JHAA 1SKBA 2DP4E 1RMQA 1PL0A 3B5JA 3HJCA 3O31A 4K28A 1AX9A 4P7BA 2BE7A 3E81A 1J2RA 2A1UA 3TINA 3V9PA 3DLBA 1M2WA 3WGOA 7REQB 4R6XA 1XL1A 2O5EA 4GE3A 3E7DA 5ALJA 1G16A 3X1ZA 4ZK2A 3N2GB 1QO7A 5FNVF 2JFQA 5LOVF 1GPLA 1HEUA 2VDMB 3WLRA 3BGDA 4D4LA 2VHYA 3F74A 1Q6YA 2FRXA 2J59A 4V0ME 5JAUA 1BH6A 1DFIA 2EW8A 5LZ5A 1ZSYA 1YS2X 4EUEA 4MMZB 4EG1A 2O2CA 4HAIA 2OENG 3DBVO 4DCUA 3KJFA 3NWEA 1CB0A 3NBAA 4IKPA 3O8CA 2WV7A 4R1MA 4MA5A 3EZ2A 3L0PA 1IM2A 4UJ5A 4A8PA 3KL2A 1I7NA 2FSFA 2I65A 4PLHA 1NMSA 2I76A 2IFTA 2NW6A 3CN9A 2PRJA 4DLYA 1O03A 3R5FA 2OQVA 1OLUB 3DQQA 1VJDA 3QOXA 4KR2A 4OB8A 1PT5A 4J1QA 4N76A 3IDQA 3MOGA 4B6EA 1DQYA 4EI8A 4MR7B 4XKJA 2NZUG 4AU1A 3O82A 4R8VA 4Y1RB 4J7UA 3NXSA 2GEVA 3WIEA 3GJXC 3RVSA 4Z3OA 3GA7A 2BM9A 1DC8A 4U2EA 3W6UA 5BYAA 5CYFA 4PLPA 2ANBA 4WFQA 4BMSA 1K4YA 3KQPA 2A9JA 1UJNA 3C5HA 4PM4A 1T3GA 2ECFA 1N3IA 4OHPA 4LFCB 1G2IA 2APJA 3WWCA 4G01B 3TQTA 4OB6A 4AMUA 1RPNA 4EJSC 1Q1QA 1FTSA 3E0XA 2XMGA 3O2SB 3JAWB 2H0QA 4KO8A 5CXSA 3TLGB 1SU6A 2B34A 1SCNE 1GOTA 3KG2A 4CCAA 5HNKA 2QQ5A 4DGQA 3L5OA 1U9IC 3GLIB 1ABEA 1KJJA 2PMKA 4AZWA 1BDBA 3FPCA 4RTKA 2VAXA 4OGGA 2DHCA 2AJ8A 2IZ1A 2QXTA 2W2TA 3ISTA 1P7VA 1SBCA 4EFLA 5K0EA 4JU8A 2Z6QA 4UUPA 4TS9A 5KOIA 2NO0A 2IPOA 3EJWA 3MA0A 4YDSA 3EEIA 4ZYZA 4EARA 4OX9B 1UEIA 1P3DA 2I80A 2VT6A 4EHDA 5CDHA 2HA5A 3OQBA 2FLVA 5C1IA 4EYQA 1YFZA 3C48A 4W1QA 3MWGA 3CNLA 2V03A 3WYDA 5JXWA 3S29A 1IUKA 2IH2A 1M1YB 4JWKA 3H7IA 4UVDA 2JIBA 4JI1B 3E7WA 3PQFA 2OUIA 3C8ZA 2RGDA 4J9UE 4ZCQA 1P44A 2BISA 5IJXA 1P29A 2AG1A 4YRZA 3AERB 2AI2A 1B42A 2WUVA 1ESNA 4YUXA 5CB4F 3DZHA 4ZPJA 3VKWA 4LOHA 4ME6A 4X6UA 1GZHB 2BGGA 5FOTA 2H9AA 4IAOA 1V9LA 3BWDD 2FWPA 3CX7A 3HFSA 2GO1A 3A26A 5LP6F 4YRRA 3EUAA 1M5RA 4JR0A 3E0QA 5FO0A 1FS5A 3CZQA 4HUQA 3CLUD 5EN4A 3CSSA 5JCOA 3RYHA 2QZ4A 4PO1A 3OLWA 2XTAA 1NWHA 3ZBPA 3ZDDA 3M82A 3OLYA 4R16A 4BZQA 1WV1A 3NRJA 3EMDA 1PTJC 1JQBA 4EK9A 1QH0A 3BQ9A 2W70A 5LQAA 2Y1WA 1Z16A 2YXLA 2QWXA 4X8HA 2X0NA 3FZYA 3MGCA 2HCRA 3QWIA 3EOAI 5G41A 4C4YA 4DLBA 3O4JA 1SCUA 2C5FA 4HJXA 4LVOA 2QN7A 1NW7A 2NO1A 4PAOA 1RJFA 1ZMOA 4NWIA 5ITWA 3ER8A 1O08A 3ZY6A 3WADA 3N7AA 5HMLA 1IN5A 5C37A 3QMVA 3EA5A 1NXWA 1TDJA 3OZBA 2EYQA 2DR0A 4KYIB 3MOIA 5AKYA 5EA2A 4AUNA 5AW5A 3MGBA 3IP9A 4CF6A 2B2CA 2ZVJA 3DXXA 3O38A 4QNMA 4A73A 2JS7A 1L3IA 4Q1EA 3E5HA 1CYEA 3G7UA 6ABPA 4QKQA 2YRXA 4CM7A 2XB4A 3GWZA 3AX6A 4HMQA 4X1IB 1PTKA 4JLNA 2QR2A 1EGQA 2C31A 2H1FA 1QF6A 4NEQA 2ZT8A 3EDQA 5DSTA 3HJUA 2Q1XA 2P5TB 3OIGA 2CB0A 4O59O 3VSAA 9ABPA 1P91A 3AI2A 5EE5B 1DLJA 1R7RA 5ALIA 5MDHA 1UBRS 2LV8A 4GPBA 4ZAGA 4CVNA 3O92A 5CBPA 4PHGA 4CCYA 3NT5A 4BWYA 1FRFS 4AZ3A 1M10A 5LQNA 1ZOPA 4HTFA 3X1XA 2IX3A 3NVAA 1TEZA 2BEUA 2D0DA 2X1VA 1XFDA 2I8CA 3A0RB 3B9QA 4KLNA 4YA6A 4X61A 3CVOA 1EK0A 2NPFA 1SCUB 4A4DA 2A5GA 1NAIA 4JQYA 1TM1E 3DAYA 3G7NA 5J4VA 1QLJA 4I3FA 4LQ4A 1XZDA 1KETA 4TXNA 2W2VA 3TTYA 2FPGA 1LDGA 2FPUA 2B7CA 2HRDA 1UF9A 2NV2B 1EB9A 1MD9A 2OV8A 1Z0AA 3KQVA 2ACVA 4IXMA 3M5PA 2Z58A 4P35A 4Y2HA 5ADUS 4XWKA 5EJ6A 5HVNA 1FA9A 1O89A 3OQPA 4JR2A 5F73A 4UU8A 5J5VA 3DZDA 4PAWA 4YAFA 3ZE8A 1ODTC 1ZXXA 4D0SA 1RYEA 4BMXA 1AV7A 3PITA 3LZDA 2JIRA 2YTZA 1JNYA 1IDOA 4O0MA 3TLXA 4DJFC 5FH9A 4LSMA 2Q28A 3K9NA 2I4IA 2FF5A 1TQ4A 4IFBA 5M34A 2PEYA 3EGCA 4RNCA 4TL9A 3GIDA 1GG2A 3ED1A 3H4MA 4RPGA 4Y0AA 4LY6A 5G0UA 5JO0A 2A0FA 4TN1A 1G20A 1IOVA 2PH1A 1PGQA 1TL7C 5DULA 4BXOB 4PS0A 3MGGA 5AVXA 3F7MA 3V1NA 1T4DA 3LYAA 2DPGA 4JJAA 4NMHA 4IJWA 3JU3A 4Y6QA 5E9WA 2PH3A 1T5HX 4N7BA 1M1YA 4KN8A 1V3VA 4XX0A 1XGKA 1T8RA 3M1AA 5CITA 2WU8A 4OK3A 1S02A 3DEZA 1R0WA 4ZQFA 5CB6A 2ASVA 1GFIA 1K6JA 4Q02A 5DLEA 4X7BA 3SP1A 5EQJB 1V7CA 5EP2A 2BAGA 4KLZA 4ZC8A 3FWPA 4G9BA 1ZW6A 2C8LA 1J2JA 3OJCA 5EHGA 2FCRA 1I3KA 1QJCA 1O0CA 3AF2A 3H0EA 2O2YA 4BB0A 3R24A 4OXKA 2LKDA 1OFHA 3N76A 3RASA 1YA6A 4W5RA 4L6AA 5BUSA 4UBOA 5J2TB 1K8XB 3MPUA 1Y3AA 3MINB 2X9QA 3N2GA 2CZCA 4G5SA 3EIOA 4TUYB 4EUNA 3L9XA 1RLTA 2QN1A 5KWEA 2G80A 1V11B 1WMSA 2GVZC 4E5UA 2Z6AA 2ZWPA 3AI3A 4OHYA 2QTCA 5HDQA 1MQSA 2I2FA 4CUKA 4JL5A 4IGIA 1FMJA 1GHTA 4PGHA 3TRHA 4A82A 3FJOA 3Q9NA 2O2XA 3L4EA 4MAMA 5L95A 4BO8A 4O2BF 2OD2A 3WZ2A 1MQ9A 1YR8A 3MHTA 1ZUNA 3HVUA 4WKOA 4X6YA 3RVRA