3NWBA

Rat comt in complex with a fluorinated desoxyribose-containing bisubstrate inhibitor avoids hydroxyl group
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
molecule keywords Catechol O-methyltransferase
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nwbA00
2O06A 3P97A 3ELUA 2IFTA 3BWCA 5FWAA 2ZZKA 3KQMA 1D2HA 2ZLBA 3BGDA 4PGHA 3G2MA 5DX1A 5DX0A 4QPNA 1N2XA 1L9KA 2NP6A 3ID6C 4FS8A 3SSMA 3PTAA 2VDVE 3EEYA 5BW4A 1DUSA 3LDFA 3RODA 1VQ1A 2B78A 3BWMA 3P9KA 3DXZA 4QPPA 1H1DA 3FUXA 2IBTA 2JG3A 3HA5A 3UJ8A 3WSTA 5DSXA 4L7VA 1BC5A 1EJ0A 2JH9A 2ONYA 3KPWA 3R0QA 3LKZA 1I1NA 3ER9A 1RJFA 2ZTHA 3UJCA 2NP7A 1ZKDA 3Q87B 1O54A 3A4TA 5DT2A 5EMKA 2O0LA 3SVZA 5CVVA 4CKCA 1QZZA 3R6TA 5HIMA 2BR4A 3AY0A 3DMGA 3FPGA 4F86A 5KS2A 2AOUA 5ICFA 3HVJA 1BKYA 4FR0A 4GBED 3LCUA 4MWZA 5CVUA 2PX2A 3NWEA 3UWPA 2AS0A 1P1BA 2KW5A 2GB4A 2YX1A 4ZTBA 5T67A 5HIIA 3C6KA 1U2ZA 1Q0SA 4ER0A 3EVEA 3MAGA 2P7IA 2EG5A 1SQFA 3GDHA 1YUBA 4RTOA 2PT9A 3O7WA 1UIRA 3I5UA 5EKUA 4RSRA 5EIFA 5B1SA 4BLUA 1ORHA 3BGVA 2JHCA 2AOTB 1WG8A 1XVAA 3HCCA 3KPVA 5EOVA 5LQCA 3UJ9A 5F2NA 3EVAA 2B25A 3E7PA 4Z2YA 2O57A 1Q0TA 3CJQA 4YMHA 3ERCA 3LPMA 3ELDA 5T6BA 5K09A 2IBSA 1UFKA 3A7EA 5GWXA 3T0IA 4M36A 2I62A 1QAOA 2OY0A 2CMHA 4AUKA 2DPMA 2Y1XA 2PWYA 4FGZA 2PT6A 5CVEA 5EZQA 4YUXA 2O07A 4KWCA 3NTVA 2PSSA 2YUIA 3FTCA 3O4FA 2FPOA 3C3YA 3CKKA 3CBGA 1XCJA 3EGVA 3THRA 2HR1A 3G2OA 3K6RA 3QV2A 4CKBA 3GU3A 4PGGA 3FUVA 3OCJA 3REOA 1NW6A 2QRVA 4RYLA 3GGDA 3KR2A 2NNWB 1HNNA 3EGIA 1JR4A 3VC2A 4YV1A 1EQAA 3EVCA 4XCXA 5EHGA 4KIFA 4M7RA 3FRIA 3UJ6A 3Q7EA 3UBTA 4PIMA 2C7RA 2Z6QA 3A25A 5LQAA 4IWNA 2PV0A 5K05A 3P2KA 1KPHA 3JWGA 5K0GA 3OFKA 2Q41A 4HH4A 5ERGB 1JQ3A 4O29A 3EEOA 4MIKA 2P40A 1RJGA 4F84A 4PYQA 3IV6A 1JG4A 2AN5A 3I64A 3R24A 5EZSA 3ME5A 5LQNA 4DA4A 3O31A 1VIDA 4HGYA 5FADA 1ZGJA 2UYHA 3I58A 3UJBA 3G5LA 5DSTA 3ER8A 5LSAA 5T64A 3LL7A 4P7FA 4C06A 1KYWA 2BM8A 1XDUA 5E2AA 1G8AA 4V0QA 2AVNA 4KIGA 1O9GA 3FUUA 1X1CA 2ZSUA 2V74B 3HP7A 3L8DA 3KU1A 3TMAA 1RI2A 2R3SA 3R3HA 4B17A 1EJ6A 3AXSA 4E70A 1KPIA 3GXOA 1R00A 4XUDA 1JG2A 1XTPA 4PYIA 3A26A 3FYCA 2PXCA 2ADMA 4A6DA 5E1OA 1IXKA 5LQUA 3CGGA 5DX8A 3FTDA 4DZRA 1OR8A 1P1CA 2B9EA 4HTFB 4RVHA 4YUWA 4RTRA 3KKZA 4XUEA 3HCDA 1R74A 3B5IA 2YXDA 2ZULA 3UFBA 5HIJA 3TOSA 1L3BA 4QDJA 2ZCJA 4QVKA 1I4WA 2B2CA 1WY7A 3P9IA 2AZTA 2ZZNA 2OKCA 2GH1A 4PCLA 3GWZA 5G02A 3VSEA 1BHJA 2BR3A 3DXYA 5DWQA 2I9KA 3GRVA 4CKEA 4AZSA 2GPYA 4QTUB 3THSA 3G88A 3GCZA 1G55A 2NXCA 3P9NA 4OBXA 1JTFA 4PIPA 2F8LA 5ICCA 4HC4A 4GOMD 1SUSA 4FSDA 2QM3A 1MJFA 4GOLD 2AOTA 4RV9A 5BP7A 2NXNA 2OYRA 1SVUA 2ZVJA 2ZFUA 3HA3A 3FTEA 4Y2HA 4C03A 1NE2A 1D2CA 3BWYA 2H1RA 1XJ5A 4LG1A 3UA3A 5KYGA 3ELWA 4MQ4A 5GP1A 3OZTA 1PRYA 3OU6A 3EVDA 2FRXA 4QQNA 2UYOA 1VBFA 1NV8A 5CVDA 5C1IA 5CIYA 5HZMA 5CVJA 5EPEA 3GRUA 2PGXA 4RWZA 5DM1A 3LDGA 3U81A 4FSXA 2K4MA 2PX8A 3I53A 3UJAA 3GRZA 3FUTA 3K0BA 4EMSA 2XVAA 4LWPA 2AOVA 3EVZA 3DLCA 4WVLA 1X19A 3VC1A 1L3IA 1R6AA 3M6VA 4C4AA 3MERA 2G8NA 4RTQA 1G8SA 3DR5A 4AZTA 4GC9A 5CD1A 3KQSA 5K8VA 1Y8CA 3M33A 1TW3A 2HWKA 5DTMA 5EVJA 4MHTA 2G72A 3BXOA 5K0JA 3OZSA 3TQSA 2ZBQA 2XYRA 4X60A 3TRKA 2BH2A 4AX8A 4FZVA 3B3GA 3LBFA 4EKIA 2P8JA 3KQYA 5DRTA 5FHRA 3SSOA 3SSNA 1NBIA 2IH5A 3OFJA 4BP1A 2VS1A 1D2GA 3TM5A 1SKMA 2UYQA 3LCVB 3X0DA 1X1BA 4RVDA 3EPPA 4HGZA 5DXJA 1JQEA 4U7TB 4ATNA 1SQGA 2BR5A 3RIEA 3TR6A 2E5WA 3SMQA 1KYZA 4XUCA 3SXJA 2PBFA 3G2QA 3M70A 4PWYA 2PXAA 3AJDA 4RTKA 3QOWA 4DKJA 5GIOE 1KR5A 3UA4A 5DM4A 2AVDA 2PJDA 3BZBA 3HM2A 5HEKA 4OQDA 4GF5A 5CCXA 5H02A 3R9XB 4C08A 4IV8A 1ZG3A 4P7GA 2UYCA 4GOND 2NYUA 3A27A 2UZ4A 2XYVA 2IP2A 4QTTB 1NW3A 2I6GA 3P8ZA 4BLWA 1MHTA 3EVFA 2R6ZA 1X1DA 4PYNA 3DULA 1I9GA 4Y30A 3RW9A 5JR3A 2IIPA 3DOUA 3TFWA 2ZIEA 2OB1A 3B3JA 5DPMA 1Z3CA 5FCDA 4C05A 1UWVA 3BWBA 4ER7A 3JWIA 1ORIA 2P35A 1F3LA 4KRGA 5GM2A 5K0LA 1XXLA 2ZIFA 3BKWA 2EFJA 5DRYA 3LGAA 4RVGA 3G8AA 2GAFA 4BY9E 1QAQA 4LWOA 4E2YA 4GUAA 3DUWA 3G8BA 1F38A 5K03A 3HCFA 5C9ZA 1NKVA 1NT2A 4E2ZA 2FK8A 1VP9A 3DXXA 3LDUA 4E2XA 5HIKA 2ONZA 3OE5A 1RI5A 4JXJA 2H00A 2C7OA 1VP3A 3BUSA 2H11A 3FPJA 4QDKA 2P3LA 3HCAA 3KPUA 2OZVA 5FQNA 5GINE 3BT7A 2AOXA 1M0EA 5EC8A 3TKAA 3IEIA 1JSZA 3NW9A 3OZRA 1R18A 5JUWA 5KQSA 5DM0A 3D2LA 3E23A 3BGIA 5E8RA 3PX3A 5M5BA 2EJUA 5GOZA 4YMGA 2ZWAA 3V97A 2IH2A 4HSGA 2CMGA 3UZUA 3CJTA 3OE4A 1QANA 1YB2A 3HTXA 3NJRA 1X1AA 2C7QA 3I9FA 3T7SA 4GOOD 4OA5A 2HV9A 1ZQ9A 4DF3A 2GS9A 2ZW9A 3NDIA 3PX2A 5D1NA 4E31A 3M6XA 2P3QA 4AZWA 4BP3A 1TW2A 4X41A 5GM1A 1T43A 5LR6A 1YFLA 1VE3A 4PCAA 4RTMA 1G60A 1IY9A 4PYOA 5K0NA 2PWPA 1YF3A 2IDKA 2QY6A 3LECA 3SX0A 1AF7A 5E1MA 4BLVA 3E05A 2P7HA 5C0OE 1KP9A 4M37A 3VYWA 4E32A 4R8RA 2YVLA 1XDZA 1L1EA 3DMHA 3LHDA 1EG2A 4FP9A 4X63A 2IPXA 4V0RA 4IV0A 3T7RA 2IH4A 3KQTA 3FPEA 1EAMA 3NMUF 3AWIA 1EIZA 3IHTA 4P7KA 4DCMA 1INLA 3P71T 4ER5A 5LQRA 3DTNA 2HNKA 3ELYA 3M4XA 2JH8A 5EEHA 1KIAA 2VZ9A 5F2KA 1NBHA 5LQJA 5CCBA 4RTPA 5DLYA 3G5TA 2P1DA 5E9JA 1KHHA 3C3PA 3FPHA 5HOQA 3EVBA 3PVCA 4RTLA 3QOXA 1SG9A 3S68A 1AQIA 1V39A 5F2OA 4F85A 4LECA 3EGEA 2YR0A 4KDCA 5BXYA 4YUZA 4X61A 2CL5A 4KDRA 1TPYA 2V7EA 3HEMA 1DL5A 3BKXA 3P9CA 5DTRA 4YV0A 1HMYA 4PYLA 5KVAA 2ZIGA 3TLJA 5DM2A 5BW5A 2AR0A 2PXXA 3HA7A 4OA8A 1YZ3A 1FJXA 3PT9A 2ORED 3KHKA 3LCCA 2CKDA 4U7PB 2EJTA 5EG5A 3KQQA 5K0EA 4R6WA 1IM8A 5U4XA 2CWWA 3A7DA 3IYLW 4EK9A 3NDJA 3DP7A 4CTJA 4M38A 3DLIA 1M6EX 1QAMA 3FZGA 5EIWA 4DMGA 2G1PA 2PX4A 3B89A 4C07A 2PVCA 3LKDA 2B3TA 1WXXA 1WZNA 1VLMA 2P41A 10MHA 5CM2Z 9MHTA 5GIPE 3KPYA 3MTIA 3HCBA 2ESRA 3MCZA 4QVGA 1RI4A 1P39A 3CVOA 4DM3A 3HVKA 4E30A 2VDWA 2ZBPA 2G71A 2FK7A 2LD4A 5FUBA 2YTZA 3GO4A 2O05A 2I7CA 3UJ7A 1M6YA 1YFJA 4PONA 3KR0A 3PFHA 5FQOA 2VP3A 5K01A 2ERCA 3C6MA 8MHTA 5ICEA 4PYMA 2WA2A 3PFGA 3JWJA 2A14A 5EMMA 4G56A 2N47A 1WXWA 7MHTA 3FUWA 2QE6A 2BM9A 5K0FA 5EMJA 3SM3A 1FBNA 1N7IA 4HTFA 5FHQA 2AN4A 1FPQA 3PB3A 3TPZA 5K0BA 3FTFA 1L3CA 3TKYA 3P2EA 3GIWA 5FTWA 4R05A 2Z6UA 3B7PA 3FPFA 1B42A 1AQJA 1WS6A 1O9HA 2QYOA 3GJYA 4OBWA 4OQEA 4DQ0A 2JJQA 3NVKI 3F4KA 3KPJA 3LBYA 3OU2A 2AOWA 4IKPA 3ANXA 4DCGA 4CXMA 3KQOA 1R8YA 1RI1A 2XBMA 3KR1A 3B3FA 2DULA 1JSXA 3NVMB 4KW7A 1NW5A 3TM4A 4RTNA 1JTEA 4KVZA 2FYTA 1DCTA 2ZWVA 1G38A 1PJZA 4ER6A 4FT2A 2Y1WA 1NW7A 3MGGA 2OPBA 3GRRA 3DMFA 3HCEA 3NWBA 4GQBA 4P58A 3FRHA 4C04A 4UOEA 5LQKA 1XCLA 2PX5A 2Z6AA 5EMLA 3DH0A 3KQPA 4YUVA 1YZHA 3JWHA 5FWDA 5E1DA 2GA9A 4NECA 2FHPA 1ZHFA 4MTLA 3V8VA 2XYQA 3PS9A 2AOUB 3E8SA 2C7PA 4ER3A 2AN3A 3MCTA 2BZGA 1R8XA 2JHAA 2NXJA 4AZVA 1AV6A 4YV2A 3GRYA 4H0NA 4HRAA 1G6Q1 5K0CA 2IGTA 4POOA 5EQJB 2GLUA 2YQZA 4A6EA 2XVMA 2OB2A 2OBFA 1RJEA 1JG1A 1RI3A 1KXZA 4GEKA 1NW8A 1N7JA 3FYDA 3LX6A 3G2PA 4P7JA 3MB5A 5IH3A 1SUIA 3CCFA 5MHTA 3KQVA 3T7TA 2YXLA 3LSTA 3UJDA 3CJRA 3GNLA 2WK1A 2VDUE 5HILA 3OU7A 5EEGA 1ZGAA 5E2BA 4GC5A 5P8WA 1XDSA 5E1BA 5ICGA 3M6UA 3P2IA 3EVGA 5E9QA 2JHPA 5EHIA 4EQZA 3EMDA 3HVHA 4HG2A 4X1OA 3EMBA 1KPGA 5DTQA 1BOOA 4R8SA 3G89A 2EX4A 1JQDA 2IDJA 5FA8A 2HTEA 3H2BA 4FT4A 3PLAE 4CTKA 2HMYB 4R6XA 3AXTA 4PNEA 1VPTA 5EGSA 3KR9A 2YXEA 5FA5A 4EKGA 2PY6A 4CWAA 4YUYA 2FCAA 2PKWA 4WXHA 2P3OA 4E33A 3G7UA 4RTSA 5D1HA 3OPNA 2QRVB 5HFJA 5KQRA 1RJDA 3KQWA 3MQ2A 1QYRA 4EVIA 3M6WA 1FP2A 4RVFA 4PYKA 3ORHA 3MHTA 4OX9Y 2WA1A 3HNRA 2G70A 1P91A 1FP1D 3C0KA 5E8JA 3HVIA 1NV9A 2OXTA 4E2WA 4K6MA 2OO3A 5IKMA 2NXEA 5CUQA 4PYJA 1VL5A 3SGLA 3MTEA 5DXAA 2PLWA 4RTJA 4RX1A 5FULA 5EKXA 4ISCA 3SR4A 4PINA 1JG3A 3CC8A 4QQKA 2ZBRA 2ZZMA 5E9WA
chains in the Genus database with same CATH superfamily
5JD5A 1U80A 3TL3A 2B4KA 4G07A 2VUHB 2QNIA 4MJXA 1J2JA 4X8HA 3URMA 5TNXA 2IPOA 3GMTA 1SCNE 1KORA 4FS8A 1QFZA 4Y1RA 3TD9A 2WUGA 2VAVA 3OEHD 4L9WA 1GQFA 5BY2A 4TYYA 2PUFA 3BB3A 4EDHA 5HK9A 2WNSA 3ZHCA 5E4TA 1B76A 4L7VA 4AJ9A 3KPWA 4LE2A 4RPLA 5I45A 3EQ2A 1NU8A 1E6EA 1SCJA 3AW8A 1E3WA 2CDAA 2VKQA 1ZKDA 2Q5OA 3D6MA 2JFGA 3I72A 3KFLA 3PFFA 1MABB 1RPJA 2HQBA 2OORA 2PD4A 4IYJA 3R6TA 4ZZIA 1KK1A 1EVIA 4RIIA 4O2AA 5CLQA 2AT1A 2ON6A 2CNWA 4D4LA 3EX7C 4FYJA 5ITZB 2PDAA 3I6QA 3CNQS 2L0XA 3NT5A 4V2UA 1KFKB 4FD3A 5FR2A 4B5LA 1LPAB 2KW5A 3F7OA 4NNOA 2V5AA 5E4FA 1PJTA 3EZGA 5KKCA 2H9YA 4QXRA 3ET4A 5ED0A 5E2IA 1OBCA 1YSCA 5A5GA 4WZZA 2GN1A 2H2AA 4FI3F 3BGVA 2XLCA 1G8YA 3E3LA 1FOEB 1ZINA 4HFMA 4XH9B 1GQYA 2O6HA 4MV3A 3KZ1E 5CPFA 3T5DA 3HH8A 4CV1A 5F2NA 1WM1A 1IG3A 1M7GA 2HLDD 1NMEA 1PYGA 3GOHA 2WAOA 3A31A 3E7PA 3UH0A 4CN9A 2YFHA 1NDHA 4H0CA 3QRWA 2LKDA 2ZRPA 3ELDA 1VKHA 3AM3A 3GIDA 3UMMA 1UJ2A 3NHFA 3A7EA 4GOKA 3ISJA 3TSZA 4NYJQ 4Z4FA 2JKYA 3CEAA 4N5LA 4DIMA 2BGIA 5LMNB 4WZAA 2B3DA 2PWYA 2GHTA 4QIHA 3RYTC 2P5YA 2O3SA 4XGRA 3RPEA 3PGKA 3ZLJA 2IP4A 3L4KA 3TBKA 2QQEA 4CLXA 5AW0A 2GPSA 4HXEB 2JF0A 4IR7A 2GKOA 3E58A 3IVRA 2R6CA 2E4XA 4LJYA 2VTBA 2AHOA 2I1VB 4N40A 1P75A 1T10A 2V58A 5B5SA 2Q9AA 5F73A 4BVJA 5HGXA 4GHWA 1B3BA 1F06A 3BK7A 4ARZB 2W98A 4G8DA 3IOBA 4A5SA 3W5BA 3NTLA 1T3SA 1MAAA 1P4GA 3HMKA 5EJMA 4CTMA 1JP7A 1MP0A 1NYLA 2QIPA 1ORDA 3TIVA 3E0XA 4WSOA 1N0UA 2HK8A 4CVNA 4H7HA 3EXHC 4HGYA 3VNRA 5UKDA 1NP3A 1FFDA 1TQ4A 3LTEA 1PNVA 3SY8A 4ENSA 3PJFA 4P7FA 3QVUA 4DIDA 3DYBA 4RIGA 1M10A 1YDMA 4ZO4A 1LGYA 1F51E 4BFZA 4W82A 4H31A 2JIRA 5CLJA 2PTHA 1L8AA 3KU1A 3MTGA 1Q50A 4X91A 3RD5A 2OO7A 4NHEA 1CVLA 1KPIA 3DT8A 3I12A 2DH5A 3BSYA 3HO6A 3JS5A 4JHXA 3EJWA 4XUDA 5B4UA 3MPOA 1I1QB 4UTVA 4X6LA 1MG0A 2BMVA 4EWLA 2P6RA 4R98A 1V1JA 4I1OA 3R7FA 2HWXA 3ILSA 1J6UA 1SU7A 1U8XX 3LGSA 2I6QA 1QH0A 1US8B 1FNSA 5CIWA 4NMXB 4D4HA 1MO5A 1RWVA 4CMBA 4CG1A 3HDVA 1EFPA 2GD6A 3PPXA 3CUSA 4CODB 1A88A 2GYVA 1OZAA 3H8VA 3U39A 5FUXA 2OKCA 3C5EA 4MPTA 4WCVA 3VMMA 4AJIA 2QTGA 5DNAA 2FSFA 4S24A 3RV3A 1GNLA 4UMEA 3ZDYB 1PFQA 3CLVA 5CFQA 2JIZA 3BCSA 4B9AA 4YAFA 3H2ZA 5REQB 1QUFA 4MW4A 2O8BA 5JWHA 5L7TA 4GMDA 1R8QA 1O2DA 1N2CB 4GM0A 4KITB 3PJEA 3ABRB 2HK7A 2A7XA 3CLRD 1T4MA 2A1TR 4NCHA 2AOTA 1ZNQO 4BLOA 3IE1A 1VGVA 1E3IA 2NXNA 2BCGY 2X4DA 2R1TB 3QJYA 3QPDA 3ZV4A 4QXAA 4B3BA 4W8HA 3KHUA 2JFZA 3IAS1 1T5HX 3KJNA 1TA4A 1D0SA 1MMFB 3LUFA 3CLKA 4XB6B 3UA3A 1OXBB 2EFDB 3C8UA 2WJHA 2OHIA 3MUFA 2YWRA 4RHXA 5NULA 3GFFA 4GZ3A 4V0KA 3UMBA 2V7BA 4XSVA 1IOWA 2C42A 1XIVA 5EPEA 2O5VA 5KHAA 2QR5A 2W70A 1UR5A 6ABPA 1V8ZA 3WA6A 5IHXA 4KYIB 2I2CA 3JVEA 1MAWA 3R3YA 4ND8A 1ESDA 3TTSA 2A86A 1VRWA 3FUTA 2GKGA 4GZLA 4KXUA 1PJBA 2XVAA 1F20A 2GAOA 3EIQA 3F9RA 4LWPA 3RSHA 1KDPA 2IPNA 1M8PA 2IRWA 3M6VA 3MPUA 3UMFA 1E2BA 4CR6A 3W04A 1XQVA 3ABOB 3STWA 1KSJA 3OOJA 4M0PA 3H13A 2ZUUA 2HEIA 3L06A 1JECA 1G3MA 2BFEA 2H52A 3IDZA 3NEYA 4JC5A 4Y0NA 4DRYA 3H2SA 2ZRJA 4ZI3A 3PHBE 3H2KA 1C14A 1N1EA 3FVQA 4QJ4A 4RMJA 1G2PA 4IIJB 4ZVRA 3RNOA 4EHHA 4ZYUA 2GYWA 4AULA 1RAFA 3NO4A 1C81A 3EXHA 4J4BA 4EM6A 4HVLA 5AVZA 4W9MC 3F90A 5ENDA 4BEJA 2GDJA 2RGXA 2VHVA 4TTIA 2G09A 4CKXA 1TTPB 4F5WA 3NUZA 4ZQHA 5G3YA 1GLGA 3RYFA 1T2VA 4Z9AA 5IJ9A 1Q17A 3R3WA 3ICEA 2R65A 1IZZA 2LIVA 2P9ZA 1JA9A 1BU5A 3VH2A 3WB9A 1MF7A 1GADO 4RBNA 3GWGA 1JQEA 1FFCA 4U7TB 4B09A 2FF7A 1F12A 1R0XA 3SQLA 2XKAA 3RS9A 2XGSA 3Q40A 3IL2A 5BSHA 5CYPA 2YXPX 3AJDA 1H1LA 3LYAA 4X44A 5LYJB 3C5HA 5ECWA 5J2UF 2GHQA 2WIDA 1QNFA 4E1AA 5KINB 1C0LA 1MORA 1UQRA 4RGYA 2ZI4A 1WQ1R 1UWCA 2XDYA 2QSUA 5K3EA 2FKNA 2JGMA 4IBOA 3M1AA 4X90A 3WIOA 1QH1A 3ADKA 4JV5B 1NW3A 3QX8A 5JH7B 2JJ8A 1S8AA 3EVFA 3FKSD 2Z3WA 1TM7E 4BVKA 2ZUDA 5EAIA 1BX1A 2PWZA 4KUGA 3V4PB 3E9DA 1X8LA 3Q7IA 5K2OA 3CHYA 2J46A 1OZHA 3N07A 1Q7CA 1M6WA 4JI4B 3OMXA 5IKOA 1I4TD 1CETA 4OIFA 4EPWA 3NP9A 4QQ8A 3FH0A 1I6KA 3JZIA 4JASB 2JA2A 4NV3A 1VLHA 1XXLA 1S1CA 3IKJA 5AM5A 4CU2A 4RFLA 1FUKA 5KYUB 4UQOA 1AQYA 3KO8A 4Q9JA 4PICA 3O8NA 2FR1A 4Q4LA 1E1CA 1YQXA 3V8EA 1WXQA 3V1KA 4AVYA 4GMKA 2FP4A 5L3QB 4AN0A 4JUBA 5CFLA 3KLPX 4N1AA 4ME6A 1KMCA 4IRXA 3GD5A 1HFKA 2QYSA 2XB8A 1JHVA 1J09A 1KBZA 1WNFA 3HBNA 1UBTS 3OLXA 5G0UA 3KVRA 4JBLA 1WZUA 5TX7A 2Y27A 421PA 2GEJA 1NXVA 3NC1C 4PHFA 3BT7A 3BXEA 1GDHA 4TTQA 3S44A 1FSPA 1JSZA 2ATCA 2QD5A 3EOZA 5KQSA 1MIOB 1U1IA 3E23A 2EJUA 2IEZA 1CF9A 3UVEA 2UDPA 3V4FA 2BHNA 4BNXA 4G0UA 3S2UA 2ECFA 3RFUA 1FX0B 1QGUB 4OJMX 1BO6A 4F4CA 2J33A 2B9VA 2Z98A 5A6SB 1W36B 4OA5A 1QKIA 4FFBA 5B3LA 2WYUA 4HAXA 3KJXA 3UMCA 1THGA 1MX9A 3LT4A 4WXRA 4YH1A 4H3SA 5DVZA 4BP3A 1GZ4A 4U2CA 1CRWG 3DNPA 4QASA 1ILEA 5LZ5A 3OCXA 1T6YA 4GI2A 4UDOA 2VCEA 3O4JA 1C1YA 1UOOA 2NACA 2PRZA 1YRQA 1MW9X 1XD2B 3ILXA 1YS6A 2IDKA 1MN6A 2H92A 2QT9A 4KXMA 4WBNF 1T35A 1X87A 2O6LA 2OBLA 3ETGA 5C0OE 4J4HA 4R8RA 4BQSA 2H4FA 3ZGZA 2JIQA 3ZXSA 1IMOA 4U5XA 1Z6GA 3GVHA 1RZVA 2B8WA 2ZSKA 3LHDA 4IXWA 4LBWA 2QRJA 2EJCA 2HMSA 4ZVTA 1G9SA 3LBNA 1VMDA 3RS2A 3N8HA 1EIZA 1UJ4A 1N36B 4U0KA 4ZVQA 2O5CA 1UZMA 3BOSA 3A1NA 3L0ZA 3ZHXA 3NGXA 5ALZA 5F2KA 4RTPA 5DM60 2YHIA 1ENPA 1OLUA 3JD3A 2BHTA 3BTVA 3L0DA 1DX6A 3DTTA 1ZM9A 5ALGA 5GJVC 5SYMA 3ZV6A 4B75A 5HOQA 2KBEA 1KP3A 1XFAA 2XADA 2J3DA 2JJMA 1ADCA 3WNQA 5EIOA 4I9FA 3TQFA 1UJ6A 3QW4B 3DKIA 3DDSA 1EFRA 1ORRA 2B36A 1DO8A 3LW7A 4G0NA 1IATA 4CF3A 1WXFA 2ZG6A 3OIFA 3W5JA 5JNUA 5KVAA 3LQKA 5ALTA 1N6KA 3SJBA 3UOAB 1G5QA 2AKYA 1Y8RB 3CSUA 4OAPA 4U7PB 1O87A 4R6WA 2UUPA 2ZQYA 3LBHA 4M9ZA 2P0AA 3WLLA 4EUNA 2P65A 4JUAA 1BXGA 4QHTA 1UKAA 2WPNA 2EZUA 1WZIA 5AVKA 4Z1MA 4F60A 1SK9A 3M6AA 2VWQA 1QGED 1VKOA 2FH5B 4R9UC 4AZ3A 4FWTA 2VTKA 1QE0A 1I80A 3L1KA 2VT3A 1VCOA 1T0HB 4MRSA 2PQMA 5LN1A 4E30A 1UEXC 2RB5A 3E3AA 1M83A 1FQJA 2CLHB 1G5TA 4JNKA 4KC0A 1YFJA 4V0SA 3WK4A 3SVLA 4HAVA 2R96A 1S89A 1W2WB 3H3JA 4G2NA 1HL7A 3ZDEA 3PWKA 5ICEA 9ABPA 1QZTA 1D1TA 4E46A 2P79A 3D6FA 2J0QA 3R0ZA 3IXMA 1N5JA 3NHBA 4OI1A 1TO6A 4EA6A 2RG7A 1VJCA 1T5OA 1SKYB 4MZDA 3N3BC 3B9RA 2RK6A 3AUXA 5AOAA 1DT5A 1GV0A 4LGVA 3L93A 5EIAA 3ZHUA 1B16A 2WU1A 3U4CA 2PQ0A 3IA2A 4RQAA 9LDTA 4KR0A 3W1EA 2N3ZA 2DMRA 1V3VA 5BRJA 1S8OA 2W48A 2PLNA 2YW9A 2C7BA 2BM0A 4LF4B 1U0SY 3KETA 2Z8XA 1UIMA 3NBQA 3MC1A 1BGXT 5KQPA 1CNFA 2IX9A 3NQ41 4UHCA 1TYAE 2WJJA 4M54A 1J0BA 4RL6A 1SD5A 1ZCZA 1ECCA 2AFIA 3LGXA 3D31A 2AWOA 4OQZA 2K7FA 3FSJX 1PZFA 1ZS9A 1WDWB 1QG4A 2QA5A 3PP8A 4KGDA 3KR1A 4F1WA 2XA9A 5A02A 5C4MA 3PX7A 2RH4A 3DV0A 1KJIA 1EJ2A 2PPVA 3QLUC 3EA0A 1JS1X 3CX7A 4ER6A 2IY8A 2PD3A 1OI4A 2XB6A 5BORA 3W5SA 1R4NA 2ID9A 1DHRA 1R9MA 5KJFA 3HK2A 3LU1A 2G6TA 3EXAA 3RRZA 1UOPA 3HU3A 1N9KA 5FBKA 4KVGA 5I5EA 2DHEA 1E1DA 3K4QA 3J80A 2ZXEA 2OSVA 4KXLA 4B31A 5EHQA 4D4KA 3O1IC 3W5HA 2QL5A 2VRNA 3T6KA 2JHAA 2VNKA 2A94A 4G5SA 5JSYA 2CUZA 1U28C 3DFUA 4ES6A 3TEMA 1Q21A 1XZIA 4K1XA 3BHIA 4ALJA 4U3JA 2P4QA 3T0FA 3P0JA 5TJHA 5K0CA 2YQZA 1SWVA 1SUEA 4HXYA 2C99A 4W8GA 1F2VA 2GVNA 1VM6A 4HYTA 4NE2A 4AJHA 1CR2A 1II8B 1C9MA 1SXQA 5K0SA 4RHYA 2QPOA 1BMDA 3ZTTA 2JFPA 4ZCIA 3IAXA 1QYXA 1NKTA 2NT3A 2WU0A 3R7NA 1HC7A 4LQDA 5ALLA 2C96A 3NIDB 2QNBA 4KE9A 5KYXB 3I30X 1HL3A 3PHGA 2D1SA 4FQ8A 1U5BA 2IE8A 3GPCA 4MR8A 1CRQA 3TUJC 2ZBUA 4AY6A 3D6HA 3NVAA 2Z2YA 1V4NA 4IFEA 2A5LA 2GZSA 3N76A 2VJBA 3L8EA 4J1QA 4LYAA 5DTQA 4B4OA 1MT3A 4HQKA 4NPAA 5F21A 1IY8A 5EWJB 1UPUA 3WLJA 3H1EA 4BB6A 4IWYA 5BSRA 2MHCA 1N2GA 3IP8A 2D5LA 2R5FA 1LWNA 4YHHB 2OLJA 4X9XA 5JWRA 4I8XA 4KUHA 4P5DA 3EHDA 4RD3A 3HFRA 4HB0A 2REQB 4WXHA 4QDZA 5DZSA 1EQ2A 1NVFA 1SA0A 2I1QA 1KQNA 4E13A 3WZMA 4IRMA 2BFAA 1EGVB 2J3QA 1QYRA 3NIGB 1P0MA 2ZQ5A 5DYYA 3M6WA 3GUHA 1SD1A 2GSWA 1P31A 4OLJA 1HR0B 4CGZA 2WU4A 4ZYLA 4US1R 3I9OA 5D5PA 2HMAA 1E7YA 1JLKA 4CFSA 3AUTA 4UNRA 4A2CA 1NN0A 3VTFA 2BMWA 2IEDA 5FPHA 1J7JA 4DSTA 1Y7LA 2EBHX 5AI5A 1MA0A 3WICA 3DT6A 2VNJA 3KSUA 4XQEA 1AKWA 1XTZA 1NNUA 1MEEA 3CO5A 1Y1KE 2HHJA 1LQUA 3H8JA 4PQEA 1OV4A 1XNJA 1ZD1A 1KSHA 3QLUA 1RXUA 2O14A 4XW2A 1N0WA 2OT3B 2BLLA 3WLHA 4A26A 3VSBA 1O8CA 3GRCA 2GK7A 5ALSA 4C3OB 3AEKB 1WUJS 2H4JA 2WB4A 3WSVA 4DLBA 1JHOA 3ZU3A 4MW5A 1H1DA 3MRSA 1YMQA 1EVEA 3ZCTA 3GRPA 3OX2A 1I1NA 2OV2A 1SY7A 4HNUA 2OAP1 2QRKA 4MIYA 4O4LF 3OWOA 2BR4A 2JAHA 2VDKB 2JDID 3L07A 4MLDA 3MT7A 1HDXA 5AUNB 5ICFA 1NDUA 5K4AA 1U28A 2B5OA 5G0TA 2HF8A 3KD2A 4HAOA 1BMFD 1K0FA 3AGPA 3Q5EA 5TPZA 4Z7OB 4II2A 4HGOA 2J9XB 4WRRA 4R2KA 1NVGA 1KK2A 3RAJA 3GPBA 5IARA 1RRGA 1Q0LA 3BB4A 3KSDO 4Q37A 5K3DA 1BD3A 4RTOA 5IXJA 4KOEC 4QECA 2WD7A 2XX3A 3SIRA 3I5UA 2Y0CA 3KJQA 4GLJA 4WEQA 1KYQA 1PQPA 3OHPA 1DBIA 2CF6A 1LK7A 5ABPA 4NBNA 3RYCA 4H4DA 3I9V1 2A67A 3AONB 1ZPDA 2JFUA 4R9RA 3EAQA 4AF8A 1L5OA 1YNOA 2AQ8A 4BXOA 1XCMA 2B6NA 4EJSB 2V8BA 2X4GA 1NXXA 3V1MA 3O2JA 4FXPA 3OAAD 3FFTA 4FJ0A 5ALMA 1D9XA 1SPXA 1SZDA 2C94A 4NICA 4B33A 1E9BA 3HBAA 4J3JA 3O4FA 5CT4A 1U2EA 2AD1A 3QIAA 4L16A 4EUFA 4CKYA 1GGFA 2XB9A 3UM9A 1JBKA 3AKEA 2FDRA 1CZRA 3ZDZB 3ONDA 1TA9A 1L8QA 1RYEA 2FUKA 2YC4C 3PD7A 1CVIA 1JR4A 4LXQA 4AKEA 4YRBA 5JXIA 1P61B 4I5FA 3TGLA 2C7RA 2RC6A 3TGPA 1XPRA 2XZPA 3VNSA 3DLBA 3I0MA 4XVHA 3P2KA 1UM9A 2QLFA 4W7IA 1F5NA 2OZPA 4X7RA 4BX8A 4WV3A 4IXMA 4F6LA 4X1KA 1MX3A 3CVJA 1YS2X 3QSYA 3OEED 4AQ7A 4KHPB 3C3JA 4J8PA 2HJHA 1HDYA 1GNRA 2Z04A 3BIWA 4FN4A 1I4EB 2G0NA 4WASA 1E6WA 2UYHA 2QDXA 3ER8A 5DSTA 2R7LA 4R9NA 1NBMA 4R1PA 3E3NA 4Z9YA 3NTQA 3R6LA 2AKAB 1GPJA 3KALA 1NNSA 5AWFC 4V0QA 3TPFA 2FW0A 3FGNA 2AX4A 2I4NA 2YOFA 3IMKA 4MW1A 3ZKAA 5JZMA 1PFKA 3HP7A 4KKXB 1UMDA 2O0MA 3AR8A 3INTA 1R00A 3PQ5A 4NPHA 3V4SA 1WXHA 2CXTA 2F43A 2R66A 2ZT7A 3BMCA 2HQOA 3DE5X 1NVEA 4HLDA 1BH6A 5JTUA 3U2QA 4S0ZA 3HJBA 3KJGA 5C3UA 3TN7A 3GB9A 3LZCA 4KXVA 4RTRA 1Y4ZA 1YKSA 1YL7A 1YQ9A 3QVTA 3LBAA 3FOFC 1NSFA 4JVMA 4B83A 3PGA1 1LF5A 3Q10A 2PGLA 4LZWA 2AI1A 2ZSFA 4PCLA 2GH1A 1CUIA 4H59A 4EELA 4MWTA 4M53A 3WDMA 3AHIA 3CZRA 1CZHA 5KTTA 1GTL1 1Q0PA 1BWPA 3JPYA 2OGTA 2VDMB 2VC2B 3MJSA 4Q24A 4PHGA 1P2BA 3V4RA 2ZJZA 4YRLA 2HUNA 3OE7D 1SUCA 3RTCA 3O93A 3ETJA 3S0JA 3ZD8A 4K9PA 5KOYA 1FB5A 4OYHA 2ODAA 3WGMA 2IXBA 5TF0A 1DJOA 3OQ1A 4GX5A 1ZJJA 1C7FA 4FMBB 1VRVA 4C03A 2BHLA 1T6BY 2VCHA 2WTEA 3QEKA 3OZTA 3RF7A 2R86A 5C1IA 1SR8A 4AS3A 3GRUA 4LXIA 2Q6KA 1K89A 2I6XA 4MQLA 4HWKA 4WXEA 2Q2QA 5DOVA 2VP0A 3DLPX 1LD3A 5CLFA 2PX8A 5LD2B 3B51X 2EIXA 1NJFA 2RJOA 1ISPA 4U7HA 1CCWA 1UAYA 3HJAA 1AE1A 5EN4A 3CUYA 4Y0VA 3SSOA 1EBFA 2QE7A 5COAA 1RBZA 4DMMA 2C95A 1U7OA 1YQEA 1K4YA 3VH4A 3CO0S 1ZOIA 5JSZA 5CB4A 5DIFA 3TTXA 3EARA 1NU6A 3TDKA 3I9JA 4RQTA 3E70C 3HE3A 1F9EA 3QEMB 4JP8A 5KVVA 1GFIA 4K6HA 1PX2A 4PE5B 3MSXA 4EGAA 4FGLA 3OZSA 1TU0A 5AK6A 3CNBA 1CLUA 4HAIA 5EE9A 3SM9A 1GDTA 3JQGA 1HG1A 1YBHA 3H1FA 5EXXA 5H70A 5A2GA 4R83A 4D6XA 5HM6A 3H5TA 1A4IA 1D2GA 1QHSA 3ANYB 3TW8B 3ZVKA 1C3EA 5TRTA 1LDEA 1IM5A 2RGGA 2RHCA 4Y2QA 1DINA 1QZXA 4H0FA 1U4SA 4EL5A 3K96A 3QXXA 5CEJA 5ESXA 1RZRD 2Z1DA 3NOQA 1L5HA 3O3CA 1JHAA 2PYZA 4BAZA 1GTG1 1UP6A 2GZ1A 4TWIA 3GLFB 3T1HB 2JFWA 2JI9A 1Y4AE 4MKFA 1U8AA 1W4BA 2IPAB 3DOFA 4Q48A 4EKDA 4OCZA 4LVCA 2TMDA 3C3MA 5DM4A 3CS3A 3PDIA 4ZK2A 1AA6A 3MTJA 4HYYA 3QKRA 5I9BA 3HB7A 2HA0A 2GEUA 2JAQA 3A1DA 3GMIA 1G0OA 4NABA 1JIVA 5EZ6B 2XYVA 1CY1A 2UZ4A 4BLWA 3WWEA 4HEQA 4L76A 3ZGLA 1DJPA 1H2XA 4YJ3F 1UFVA 2F67A 5CA0F 5F98A 1A3CA 4I6GA 1TD9A 3A4NA 4RMHA 4MP8A 1XTRA 2OB1A 1R5NA 4C01A 2XVXA 4E5VA 4YQFA 2F3SA 5LPNA 3E03A 2HIAA 2BBOA 1OROA 2GO1A 2VAWA 1L5YA 2WQ6A 1OT3A 3BAZA 4RF4A 2MCFA 4KNVA 5MFZA 1EWRA 3TQRA 1W5AA 2BTQB 3WYFA 1DAMA 1UBOS 3B8EA 4E2YA 4F06A 2VDNB 1NTRA 2OZEA 1ZNXA 1RXIA 2PGIA 4NZNA 2JBWA 5DLPA 1EUDB 1WCV1 4FOPA 2A33A 3OIUA 1QQ7A 5DV9A 4CUJA 1DE0A 2RAUA 5CYOA 2FK8A 1VP9A 3F3YA 4WY8A 3T1NA 3ANLA 1I3LA 4GGMX 4CLOB 5HR5A 5D3QA 4IVRA 3LW8A 2QTCA 5CX1A 2FUCA 3EZ2A 5TIIA 1P60A 2FN3A 5A5EA 1E58A 2K2QB 4CM4A 3Q2KA 3DDHA 2CDCA 1G19A 1Y0BA 3KPUA 2MYTA 1Z2CA 2BVNA 2X13A 3GLKA 2JGFA 2FU5C 1TB4A 3OA0A 4JT8A 4FKBA 1K92A 1X3SA 2VT7A 4RYDA 3KL2A 3QELA 3VKFA 5B6JA 5ILQA 1I0ZA 2A9OA 2ETXA 1DC3A 2X2EA 3D2LA 5CNMA 5CT8A 4AJ4A 4RKEA 4CN8A 5A4IS 1AQLA 3ZH2A 3VU9B 2WUVA 2YXBA 4NBRA 4BFVA 1GCIA 4DSUA 5GAJA 4HSGA 2CMGA 3OE4A 1ZR2A 4Z4HA 1CZOA 4QBHA 1GTMA 2C7QA 5DLEA 3DJFA 4UZFA 1ZHOA 5LZ4A 1JFLA 5EIBD 5CFRA 4L75A 1JQ5A 3IUEA 4QHYA 1PLLA 3HYTA 2HNBA 4Q18A 3OC0A 3PIIA 3AB3A 4Z3OA 4P3XA 1KI2A 1LVGA 1CB7A 1SG6A 1WE2A 2VSOA 4L15A 4AJOA 2LV8A 3LPNA 4WFJA 1FYEA 4FOLA 3W78A 1OX6A 2JZOA 1W9MA 4Z7QB 1OWLA 3DVQX 2TSYB 4AXBA 3ZQUA 3R74A 3ZE7A 2QPTA 4L9SA 2XRYA 3HHEA 4D74A 4LVNA 1XCGB 5K4HA 2R87A 1C3XA 4URZR 2FEPA 3SYMA 2IXEA 4UXIA 3P71T 1QORA 1AQNA 3PJRA 1E3SA 2XWJI 4A1FA 1A0OA 1NASA 2JBAB 2QX7A 3G9TA 4FDTA 5CCBA 5EJ9A 3U44A 4ZI7A 1R6DA 1ZC4A 2OV6A 3FR7A 3PQ6A 3CVUA 3Q4GA 3DPSA 4IDOA 1IEVA 2FOLA 3FPHA 5T4BA 3V8PA 8ABPA 4PLWA 1JG6A 3PFKA 3S68A 3C8HA 1V39A 3FN4A 4IIYA 2AWNA 4ND5A 2EHJA 4WHMA 3EUEA 4PLGA 3EN0A 4ZOLB 5CR9A 4OMUA 3DBLB 3GLRA 3B6IA 1N0IA 1D1SA 2GCPA 5GGXA 1K8YB 4ND1A 3K73O 4NOJA 1J2UA 3SLGA 4YV0A 1Y9ZA 3WYAA 1W4ZA 2CHUA 2ZITA 5AR1A 4AAYA 1QDLB 1BTOA 2QLBA 2XUFA 4C4RA 2W93A 1NUTA 4OQYA 4W5QA 1GYQA 3N0WA 2W2TA 3ZWNA 3HJFA 1V5FA 1A4XA 5DO9A 4RGVA 4IINA 3CM0A 4TYWA 2EJTA 4DEYA 5D7BA 3U4QA 1Y3HA 3UK0A 4GDMA 3H84A 1IM8A 3AVXA 1ZOOA 4ZO6A 1JEYB 3ACBA 2L69A 4ZEWA 4YJHA 1CRZA 4LCJA 1X2EA 2IHUA 4CQMA 3HO8A 4XWGA 4I08A 1O6BA 4X00A 1V3QE 2WFZA 5A9TA 3U9TA 1ESZA 2IV3A 1WUIS 1COZA 1KMNA 3A3KA 1NR1A 2YYYA 3K5IA 4BQOA 3K20A 3AX6A 2FK7A 5FFFA 3RVOA 3VSDA 4RENA 1DEHA 3V46A 4PSKA 1F17A 5J2UB 1GKYA 2A4MA 5KKNB 5L4LA 2VP3A 2AFRA 3C6MA 4WERA 4PYMA 1HK7A 3FB4A 2I99A 3N58A 4YYEA 5AJTA 4EYOA 4PGMA 4O4JB 1WXWA 3JR3A 1D09A 3OUTA 3WGGA 4E5UA 2QV7A 4YAKA 5K0FA 4GKKB 1WP4A 4YGXB 3TPZA 2VYFA 1VL1A 1YR7A 2ZSEA 2ZRAA 1J8VA 1HSZA 1G3QA 2GNOA 3P5SA 4BZXA 4Q3BA 3UGQA 1EPUA 1JQAA 4FCWA 1WS6A 1FUIA 2VYVD 2QYOA 1N8NA 4FJ2A 4CEIA 2LUOA 1Z3IX 2GCOA 2JPDA 1OFHA 3FTPA 1WL8A 3PQCA 3TI7A 4Q05A 1UP4A 3Q6NA 1ADYA 1N92A 4XVCA 5JEDA 3B3AA 2H2IA 2OHFA 3GEHA 1ORWA 4JVSB 5IAOA 1NW5A 3UJPA 3ZGOA 4W5RA 4U9HS 1U3FA 1URPA 2OV1A 3KAQA 4G8BA 1VSTA 5L3RA 4BKPA 2CHVA 3BERA 2OPBA 4GXTA 3PNYA 4TT3A 4N0DA 3AHCA 1N34B 1GM5A 2UXBB 2I6SA 2I3DA 4WK6A 4ZI2A 1U7ZA 3ZW8A 1UBEA 2AMVA 3JWHA 1DC6A 1DKPA 1VLQA 4U1RA 4EG8A 3I6BA 4NECA 1HTWA 3VO2A 4QC2A 2P9FA 4CKCB 1ONBA 1YJAA 1ZHFA 4RA6B 3G8YA 3OZGA 4C6TA 1QIFA 1DHTA 5KNDD 2QL9A 4YCLA 4GXNA 3Q12A 4LJ6A 4NYIQ 2FSVC 1B6RA 2I5PO 2ISQA 4PRZA 2W2QA 3PJGA 4DR2B 5GJCA 2IXFA 1OLSA 1A8HA 1TXGA 1VHTA 4QZVA 1A9RA 1WPXA 3FVRA 2RH9B 4JGGA 3TYXA 5E95A 1ZQ1A 4D4JA 5ESDA 1JXOA 1NG9A 4BDSA 3D4OA 4TYPA 3L2OB 1MQ8B 3NX4A 5BSKA 4LSGA 1NYTA 2QRHA 2VHZA 2YN0A 3O8OA 1LK0A 1RC1A 4KO2S 4X64B 4D82A 5FUQA 4OLBA 2QI9F 4L4SA 1B43A 3ETHA 4I55F 5C3MA 4HV4A 1T9HA 5J23A 1ZGAA 5KC9A 3PITA 4MW9A 4PG8A 2GDZA 3TCNA 3V34A 1K9SA 2DWOA 2H17A 1FZTA 1L5VA 2DKNA 3DOCA 3HBJA 1T2NA 1FQOA 5BSUA 4X1OA 4IH9A 1YDHA 3LYLA 4JBXA 2WD9A 1OREA 4LTDA 5JZ9A 5FUYA 3QLJA 2UUAB 1KAGA 2VH1A 3MD9A 1F1BA 4OMDA 4WCFB 1RBMA 4G5OA 4HVAA 3NXSA 3P4XA 1V7PC 3VZPA 2FPLA 2XLBA 2P3OA 4E33A 3RRBA 4DUGD 2H07A 2JFFA 4LOJA 4BFCA 4P33A 4CM8B 1ZGHA 4LGCA 4UHJA 2F3TA 2J07A 5TQ0B 2JK0A 5JBQA 1L7XA 4EHIA 1QOPB 1UQTA 1TU3A 3F6YA 4H6VA 3W8RA 3WGQA 3MGAA 2GJKA 4K6MA 1N2HA 1MH1A 2WM3A 1ZGZA 1DJQA 5KDDA 2BPOA 1JZQA 3MTEA 2G4VA 4JQCA 2WBLC 2E1PA 4JR0A 4EI2A 5IDVA 2HSGA 1I36A 3PEWA 2QRPA 1Q3TA 2E82A 3PPVA 4RE5A 3CG4A 4S05A 2DPHA 3AU9A 3PHLA 3E15A 4YFVA 1PT9A 2IXGA 2MDTA 4QPNA 4JBWA 4DA0A 1JSLA 3JV7A 3GUCA 4Y2VA 5AVWA 2BUCA 4TMWA 2PNFA 2GK3A 5BT9A 2Y1GA 4YPOA 4M0UA 3NDRA 3LDFA 2EKDA 3R0IA 1M5UA 3FUXA 4C43A 1Y1PA 4JHLA 3HA5A 2BFPA 5DBEX 1E96A 1EJ0A 4G67A 5F2EA 4HSEA 4FGSA 1TLFA 3T38A 4E1BA 2XXAB 1QHXA 1PDOA 1RJFA 1RWKA 3EDCA 3UJCA 4IO1A 2OBBA 3IPAA 3JQ9C 1WB9A 2X0NA 2FSVA 3WP0A 1GTSA 2FW8A 2GEKA 2GPNA 3BHNA 3K1AB 4LSWA 4URHA 3S2YA 1DBPA 2X0IA 3KKKA 4CMAA 2Y0EA 1NPTO 1XC7A 2PBZA 1D1PA 4M4SA 4WMLA 1W8IA 5E6RA 2IIBA 3S2GA 4HXFB 4JP5A 3SZUA 3WNVA 3RSLA 4P32A 2GASA 4I81A 3UQYS 3N0RA 2Y6UA 1YKFA 1U0LA 4PFQA 2CUTA 2YHSA 3WADA 1LBEA 3C6KA 3WKCA 1LDNA 1NWCA 2E37A 3MAGA 4U2EA 1KZHA 3FMVA 3VO8A 5HP4A 3BWXA 4RGQA 5B58T 1YUBA 2OFOA 4QELA 3O7WA 1ZK3A 4QE3A 5ARCA 3DLAA 4D4GA 1CFJA 1KEZA 2HIGA 1GNSA 4NJEA 3RABA 2VK4A 4LYEA 2M98A 1WTAA 2P4UA 2Q3LA 3HCCA 3N0VA 4KYVA 4OUDB 3RWOA 4DBLE 5AQEA 1E9EA 3JQAB 4F46A 2X1VA 2FW6A 2AL7A 3FFAA 1T3HA 1EZZA 2XUHA 1BJTA 2ZVQX 4PLYA 4Q3OA 3ZZ1A 4B7ZA 2CXPA 4GRDA 3THXA 3TL2A 1PZMA 3ZNOA 4P82A 2M1ZA 3OQJA 5JO0A 3T3PB 3VPAA 4XFJA 2CDNA 2ZGVA 1N32B 1DGQA 4TMKA 3OMWA 1I7PA 2WJ3A 2ZDGA 3EW7A 3WIDA 1Z37A 4R4JA 2HYDA 2R4TA 4FBMA 4BQIA 1DAIA 3RVNA 2V7WA 2HR1A 3K6RA 1SELA 1TEVA 3UGTA 3D4BA 3MG9A 2Y4OA 1EGMB 2JEZA 2L42A 4MROA 4E07A 1C3OB 1QKKA 4M9RA 1K8ZB 2BF7A 3VC2A 1KE1A 4ENQA 5J1SB 1FDIA 5CCDA 3EXEA 4XVUA 1PP4A 3PXUA 2O3RA 3I04M 4UUNA 3Q2IA 3IP6A 1XMOB 2RGBA 2B2XA 1PLKA 1JQ3A 3EEOA 4EYGA 1UP7A 2XE4A 3F6SA 4PSCA 2A7QA 8AT1A 4YMVA 1E6MA 1DAHA 2QTRA 2I87A 3GAZA 4LXTA 5B7GA 3TR5A 3L18A 4ECEA 5F3WB 3LOUA 1MX1A 1VB5A 1V5GA 4BWYA 4YQEA 4CFYA 2CUNA 2HHAA 3C4QA 3WI7A 1GSAA 2DKOA 4DSOA 3AINA 2A3RA 2Z8ZA 1IQPA 1L0BA 1NL3A 4CCYA 3G0IA 2HSEA 2BW0A 4IHJB 3TMAA 3DMNA 3VR4H 1L2TA 3R3SA 1EHIA 3GXOA 4NR0A 3P32A 4B4WA 4BLPA 3V6MA 3MA0A 3VPHA 2HCBA 2O50A 3HABA 3FYCA 4TXMA 3BF7A 3UQZA 2NQTA 3JQ9A 4N9WA 5HA5A 1IXKA 1X80B 4G65A 4B74A 4EB8A 1SBHA 4EBFA 3E0QA 4HHEA 1BDHA 3Q3IA 3IE2A 3ZDCA 2R8BA 3KKZA 1KARA 3T99A 4EW1A 5LCXA 2XRZA 4JYMA 3HXOA 1RAEA 4G23A 4INOA 5INTA 3G7SA 4IG9A 1YHYA 3RVRA 4IEFB 3LUJA 4BX9A 5LC1A 3AOGA 1CDOA 4XD7D 4PIVA 2AZTA 3GNSA 2MINA 3CKLA 3FPSA 3VOAA 4JU8A 1XFDA 2JVKA 5JS2A 1NRXA 3W6ZA 1CUVA 1Q2UA 2NPOA 1DKLA 2OV8A 3HGMA 3TXYA 3A3YA 3TTYA 3H1AA 1XJ0A 1U0GA 4RWEA 1FTNA 1IE3A 1JU3A 4WOCA 2C5BA 2VSQA 3GT4A 4NONA 3K9WA 4OQ4A 3P9NA 5J4KA 4GM4A 1QGDA 3K8OE 5KOIA 2DQYA 1DQRA 4HC4A 5ICCA 2C5LA 3ACDA 3CUEF 4HY3A 4X3CA 2O8NA 2MR5A 2WKQA 4FSDA 3TCXB 1G5FA 2O48X 3WP1B 5LJLA 4IDBA 4ARSA 1NHWA 3HLKA 3EFEA 4M7PA 2HGSA 1S2OA 4NF2A 3QY9A 1GPDG 3U7QA 1HTBA 1O6CA 3CPEA 1FMFA 2QRMA 3BWYA 3DW1X 3MSCA 5CB0A 2E48A 4KK4A 4BJHB 1NXWA 4DPKA 4KO3S 4HZGA 2Q9UA 4WEOA 3WGZA 4QQNA 5H16A 4CUZA 3HXMA 1X14A 1K8XB 1JEQB 3IP9A 4H4CA 3I83A 4O4LB 2GZDA 1PVOA 2QGFA 3O7MA 3SEFA 1POXA 5J40A 5AW4A 2GN9A 3E82A 2ODQA 3EGCA 1O96B 1HQDA 1SB8A 3BD6A 1M2OA 2Q1WA 2Y0BA 2ZJYA 3GFOA 1DC8A 4UEJA 1UMCA 2LGJA 4OJKA 5FBZA 1YHZA 4HDRB 4YREA 3URKA 2AJDA 4MVJD 5IC4A 2FSHA 1Z4KA 3N8IA 3GGGA 4FNMA 1ZJ4A 1QVAA 4KN9S 2SNIE 4N01A 1MOSA 2G1JA 1TW3A 1L4EA 3B2NA 3PK0A 5EIEA 3RKRA 2YYSA 2OD9A 2PS1A 4L5YA 1GSOA 1BXZA 1AGPA 1XCBA 1P74A 1VPDA 1DEXA 2VBFA 3MELA 3E1SA 4JD5A 3PGLA 5AXBA 3WDSA 1NQXA 3S99A 2FW7A 2H5EA 2P8JA 4RUKA 5AKYA 5DRTA 4CMHA 4EVSA 2FWPA 2DXIA 2F9FA 2X0JA 4LZLA 2HU8A 3OFJA 3K0HA 2ORIA 1AK1A 5LM3A 3NU1A 2HOQA 1CJUC 1DG9A 1SKMA 2PSDA 4LAFA 4BO5A 5AESA 5JYBA 2DU8A 3CLUD 4OYYA 4RVDA 3GEDA 3GVCA 2O2CA 4L6IA 2BR5A 2V96A 3TR6A 3DD1A 1P6UA 4KTTE 4WDRA 4QFBA 1Z7EA 1QMPA 1LZLA 3SXJA 1EJBA 1E99A 1IHOA 1YAHA 1G8HA 3U3KA 3KTOA 1JAXA 4BE7B 3KQUA 4F0JA 3E61A 4RTKA 1DKNA 2EWVA 2PA0A 3Q0EA 1TYBE 3Q9NA 3H11A 5C1BA 2PUVA 1BWQA 1YBFA 1GQ2A 1SCAA 2WLSA 3SC2B 4AJ1A 4CM6A 3R5KA 2X4LA 3H5VA 2QS9A 4IVNA 4YR9A 1JKJB 3OZIA 1DUIA 2ODWA 1QXSA 3UUEA 4C08A 2UYCA 2GX6A 1OX4A 1XF9A 1XWFA 2HSWA 3KKQA 4J6FA 4J0KA 4LC0A 4PCVA 1ACJA 1NN5A 1WHSA 2HN9A 3ESXA 1E2GA 2ZJ3A 1F6BA 3B1JA 3H9QA 4MO9A 5SICE 2DCUA 3W4JA 5CT9A 2CZGA 1UAAA 3VR0A 5CCEA 1YJXA 3ZW7A 3ABSB 1EDDA 2HWUA 1KMIY 5J5CA 4FILA 4YJFA 4YI3A 2W6JA 3KSRA 3UF0A 3IKTA 1FJGB 1QP4A 3OO0A 3UICA 4LJLA 1F1JA 5GZ6A 1CR4A 3RAEC 3G8AA 1KSFX 2JW5A 3EZ7A 3OM9A 5FKJA 3WXMA 3OOEA 1CDDA 3QIVA 4QUEA 1OIXA 3W9YA 3U5ZB 1E79D 3AFNA 2BEUA 2BFFB 3DE2X 1KYXA 2W5UA 3RC9A 3COSA 4IGFA 1LS6A 4MVJG 4B3XA 4RPCA 2HZ7A 1TMGE 1A77A 5P21A 1UPTA 2B69A 4MRMB 2IK8A 1JNYA 2B83A 2IZZA 4HOYA 4LBZA 2A5GA 2ZPAA 3V8BA 4JJFA 1BCSA 3B6JA 3TLXA 4EPXA 4QD3A 4BFTA 1RDFA 2G36A 1RHQA 4I9NA 4DNQA 5JUWA 4QVIA 3QKIA 1ONSA 4JL8A 2VP6A 4ZJPA 5AO9A 1BDJA 3CUWA 4FYYA 4O2AF 4WQMA 2I9PA 3LLVA 1XAJA 1F14A 4OFZA 4ITVA 2IH2A 2BGTA 3BC1A 3O38A 2KSQA 4C0BA 1QANA 2EERA 4LY6A 3ZXIA 4XPIA 5C53B 3O4VA 3HTXA 2ABWA 4A8PA 1GAJA 2AC7A 2HQSA 4OV6B 5KNBD 3HKCA 1PL7A 1XEXA 4NAVA 3L6UA 3DZJA 1Q0RA 4M1TA 4AZWA 4MUKA 3HU1A 4M46A 1BS1A 4DA6A 5A7HA 4WY5A 4C6HA 3AHFA 4PCAA 4D8VA 1ZVMA 4AP9A 5BUSA 4XZ3A 4YRAA 1OIVA 1NPYA 2I8LA 2ZYIA 3HB5X 3G9UA 3SX0A 3A2KA 1T0UA 4MGZR 2DT8A 4PPNA 2HADA 4BLVA 1XZLA 2B8TA 4BZZA 1E2IA 3T4PA 3D6NB 1HE3A 1FW6A 4Q9KA 5AJZA 5JJLA 1AUPA 3N8KA 3WLEA 5FTMA 3DMHA 1XLVA 1EG2A 4W5NA 2A9PA 1QO9A 1YRYE 3D0QA 3KQTA 3NMUF 1GSHA 2IA5A 5FO1A 1X7XB 1BW9A 1PAUA 4FYWA 4LOLA 4KU4A 4UUOA 3FFXA 1T2EA 4QDUA 5GY7A 4MPJA 2J3LA 4OQMA 4DR3B 1NZDA 2Y68A 1KHHA 1MA3A 4X66B 3CF6R 4B79A 1DWQA 2CLFB 5G2OA 1SXJE 3HACA 3S2SA 1A27A 1BXRA 1XLWA 4UOQA 1RWBA 2AYZA 4QG7A 3R6WA 4FMDB 1PNQA 4X1YB 3GA7A 2HBYA 4FN5A 4QU5A 1EAYA 3BKXA 1RJ9A 1J2YA 2B4AA 4LDJA 4D56A 2ZIGA 1QR6A 5DM2A 3QF7A 3K9FC 2OENG 3KYDA 4B6EA 5K3OA 3KWFA 2DFVA 4O8CA 3AC0A 4BV9A 3WNDA 4C4PA 2CWWA 1JF8A 4Q6WA 3UWDA 4BMYA 1AHPA 3FZGA 1KH3A 2ECQA 2WJIA 1SBIA 2FQYA 4YROA 4PSDA 1TZBA 4J03A 1RRKA 1ZOSA 4HDNA 4L5BA 1VLMA 2QTFA 4RS3A 4ZVVA 3VR5D 4D26A 2XUZA 4IJWA 3DBHA 3INNA 2PUCA 2A9VA 5AJXA 1LEHA 3H5OA 2VDWA 3OM8A 3OX1A 1GPLA 1QCDA 2ROQA 4GICA 4JUCA 1SCUB 3QHPA 4X0EA 5F77A 3JD2A 3CNEA 4XWWA 3TLKA 1W1WA 2I7CA 1HE1C 4MKZA 3D6JA 1UT5A 1K08A 1WMFA 3F9IA 3KR0A 4RVCA 4TUYA 5FQOA 4RM3A 4WH0A 1GP2A 1XQ6A 2YZMA 4ND4A 3SZGA 5AK5A 1EFCA 1PJ4A 1V1MA 3U4MA 5HYVA 1MO3A 5EMMA 3TTTA 1RU3A 2N47A 2AW5A 1F0NA 1Z18A 1CJKC 3GJXC 4YJ3B 5EMJA 3HS3A 4BNWA 3JWEA 4EEKA 4KQGA 4RLSA 1FPQA 2ZBGA 1XJWA 4JQOA 1E3QA 1XEAA 5FTWA 2IWHA 4BNJA 3GNQA 3SS9X 3SJUA 4BNVA 1Z0KA 1PF7E 1B42A 4JX9A 4ZOCA 4D43A 4D4MA 9ATCA 2AC2A 2TRSB 1IPEA 2WZQA 3QVMA 3L82B 3GJTA 4DQ0A 1V11B 4MP3A 3EK2A 3EQZA 2XD4A 3NEPX 4LISA 4C7OB 2CNWD 3AEQA 3CLSD 3PDJA 5HBRA 3HKDB 4LFAB 3ORRA 5HCNA 2FOIA 1T3GA 5CM9C 1CUSA 1KY5A 5IPFA 1YOVA 2H4ZA 2O7SA 1NUHA 1Y5RA 4Q1AA 1PR9A 3O90A 4LVUA 2ZI3A 1EFLA 1PUXA 3LUPA 1PVVA 3BFJA 4MI9A 2B5VA 4GQBA 3U17A 4UOEA 5JJCA 5LBIA 3GUYA 3KAKA 4OB8A 1H5NA 4P5EA 1JJ7A 1ZICA 5JYEA 3BJIC 1XEWX 1MC8A 3C4VA 3LYHA 4OOEA 5JOQA 3HLYA 4Z99A 1XL1A 3PGXA 2ECKA 3STVA 4BNYA 4TVBA 5KJ6A 5H8WA 4EENA 4OHVA 1MC4A 2MU1A 2YV1A 3P9PA 4BBAA 2CLLB 4EJ2A 1EVKA 1V8PA 1F48A 4JVOA 1AUVA 3V8NA 2ZIWB 3ZI0A 1GKLA 2YC2C 3MCTA 3ONVA 2JLXA 1EX9A 3RJTA 3UT6A 1BGWA 3DOHA 2ZROA 4HNQA 3VKGA 5FBQB 4ARUA 1N2JA 3JX9A 4UBIA 4POOA 1OXMA 3ABQB 3BH7A 1Z8DA 3K35A 3T4EA 1H8HA 5AK3A 4NX2A 3WL7A 2Q45A 2V7UA 4OP1A 1A2BA 5HW0A 4P7JA 5KHLB 2J6IA 5D01A 3MB5A 1SUIA 2XUAA 3LRPA 1WXDA 4IV5A 3OQNA 4G1FA 2I4IA 1U3TA 3RARA 1TCCA 4TQ9A 5NLLA 2VDQB 4LFBB 3GNLA 3T1QA 5HILA 1BD4A 2CHQA 3K1JA 5KBYA 1N4DA 2BGKA 2XVZA 3ASYA 1CFZA 5IYZA 4GC5A 4A16A 1NC3A 6PFKA 1ISGA 4MPDA 3UW1A 2CXOA 3HVHA 4KPUA 4EEZA 2BF4A 2LCIA 3IP1A 1HH4A 5KYTA 1ZM4A 2W71A 2FFQA 3T5AA 2HTEA 3E1KA 3PLAE 4CYMA 2GD0A 3AOEC 2D8MA 5L3VA 2OEPA 1OKKD 1S4QA 2XUGA 4EHDA 3IDOA 1XU7A 2BN4A 3FOZA 1A5BB 3T7IA 5D1HA 1J9GA 3V5NA 3IALA 3RHTA 3P20A 5ALPA 1RRFA 1ABEA 4QBGB 3EWSA 2P9HA 4I9HA 1HKUA 1YJCA 3W5DA 1FUYB 4MKRA 4WZBA 3ICWA 3CN7A 4DV1B 4NRDA 2EARA 1DFGA 4Y1GA 5CDGA 1ZIXA 4I14A 5K3CA 3U16A 2N1MA 3FF4A 3PQ3A 5CJ2A 3ZTYA 2EKLA 3QVVA 1XPOA 1LPPA 1GD1O 2YVQA 4GPBA 2I9KA 3NHRA 4FWIB 1PGNA 1W94A 1SKAA 1F8UA 1W0CA 2G9QA 3E7DA 1TQ6A 3N28A 2D0DA 4AF6A 4EG5A 1DXYA 1RKUA 2P6UA 1UT6A 2Y3IA 1Z5GA 4N3GA 5FWAA 4B84A 3BGDA 4D98A 1Z5WA 1DWUA 1OD6A 1N6PA 2QP9X 1N2XA 4C1NA 2WI8A 3RC3A 4A7PA 1K06A 2ECOA 1XZHA 3CB4A 3JQEA 3SSMA 3UK1A 2E1RA 5A0TA 1XSEA 4BJ1A 4CF7A 2JIZD 5H80A 4RJ2A 1NQVA 4QPPA 4B47A 1Y3CE 4F8JA 3ISVA 4AC9A 3PNKA 4O59O 3DO6A 4J49A 3R0QA 4UD6A 3L0OA 4HVCA 1U2TA 2QN2A 1QRTA 2QTMA 1XD8A 5HZKA 1L7AA 2XCLA 4ZT2A 3VAZA 5DT2A 1I2ZA 5CAEB 2GZMA 3PA6A 3U3OA 4AI6A 5AJWA 1I2DA 1ZH0A 3DMGA 3ZU2A 4ENVA 2WFMA 1JU4A 4FR0A 1R0RE 1E0JA 2ZRHA 3DL7A 4XOUA 8LDHA 5BT8A 1SB9A 1SVLA 3EXG2 2C2HA 4QPZA 1XNRB 1EFTA 5EWMA 1SOVA 4CRWB 3R6GA 1E1LA 2YWHA 3AY6A 2H4YA 1CZUA 1CUCA 3GZNB 1N5DA 3GDHA 4G81A 2NU8B 4CTOA 5I3CA 2AF3C 4H15A 4NEQA 4ZJYA 2B4QA 1KO7A 4BLUA 3ZY3A 1U2RA 2D7JA 3I3OA 4Q9AA 2JZNA 5K2MA 3MYRA 4HWTA 1IZ8A 4P2GA 2WHYA 4JA0A 3L5KA 4KPYA 2DR0A 4BP9A 4HS9A 1J8DA 4IDNA 1ZX1A 1YTLA 3C4JA 5HRAA 1G6OA 4DCTA 3WR5A 1AQUA 1C2YA 4ICIA 5DP1A 3EZNA 4EG3A 5H5JA 4RK5A 1YVRA 1G21B 1S3FA 3IT0A 1T9GR 3L0IB 3BN3A 2VPWA 3D1LA 3EFHA 1YO6A 3EA5A 3H7AA 4X5OA 1L7PA 3W4IA 6LDHA 4CL2A 5J47A 2ZI5A 2ASEA 5SZJA 3MTDA 2I3GA 5L51A 1I3MA 2QUZA 3T1TA 4B2LA 3EGVA 3IR6A 3ZWQA 2QMQA 1K5PA 3KRTA 4CKBA 1QTIA 1MV8A 3DD5A 3KEFA 4DCVA 4KQMA 5DH9A 3KJZA 1NY5A 4FS3A 5FNZA 4Q4HA 2I34A 1DQNA 1M6VA 3FXAA 1GL3A 3BWEA 5EHGA 5KQGA 4PAGA 1P5JA 1Y6QA 3DHWC 3FKQA 2JLCA 3TUIC 5LP6F 3U6KA 2PV0A 4DIOA 1E4OA 4EG6A 3C3AA 3ZWWA 3AZOA 4D8UA 4MIKA 2CNDA 2BYTA 3FWYA 4Y6GB 3ZBTA 1KAQA 3QA9A 3UIEA 3F6BX 1IHUA 4EHJA 4WJLA 4DA4A 3NTUA 5FADA 1LH0A 5A4JA 2VJMA 4DQUA 4RVOA 1OH5A 2O2GA 3KCQA 4C06A 1KYWA 4OQFA 4R3UC 1YACA 5A1TA 2IY7A 4P3NA 3EFOB 1NLFA 2X5OA 4UFPA 2PJZA 2WYOA 3WLOA 2IITA 4E70A 3GPDG 5L6LB 1HT2E 3TJMA 4YIKA 3KSBC 1EXVA 3UWMA 1OBFO 3TWOA 3G49A 4GR4A 1VYUA 4W6QA 4LA4A 2NQ2C 3AFGA 2J67A 3DB1A 2J9FA 4DZRA 4LYJA 2WJPA 3B9PA 2CNKA 3DBOB 3ICPA 1VCMA 4GSKA 2JEYA 3UT5B 2DRIA 3B5IA 2G8LA 3LUDA 3AV0B 5A71A 3I0ZA 3GX1A 1J22A 1X7YA 3A3NA 5FPSA 4CJXA 1IZ9A 4GWGA 3DCNA 4IZ6A 5CT6A 3RUEA 3C39A 4WLVA 3S40A 2Z4RA 3GWZA 5G02A 2GR9A 2J9YB 1S2GA 4W7SA 3Q3CA 3K0CC 5HFNA 4AYXA 1VG9B 2FN4A 1WLSA 2FWMX 3DHNA 1S3SA 1IH8A 4GD3Q 1TM3E 3IC5A 2WIGA 2P5UA 4LKRA 1GJRA 2ZRDA 1UFRA 2F8LA 2IYWA 2RG1A 4PIPA 4ZT4A 2H31A 1P7ZA 2PZJA 4GOMD 3QP9A 3D2BA 4PZDA 5KX5A 1GTVA 2P4HX 1Z2NX 2QWXA 4GOLD 4UULA 3UMVA 2VHQA 3TK1A 1QG6A 1L5NA 3ROEA 4CCWA 2C9MA 4Y9DA 3HA3A 3KKOA 1EE9A 3K0FB 2IC5A 2P2NA 2AJBA 2XV1A 3WL5A 1DIOB 1XJ5A 4BMOB 4YIHA 3PA8A 3GQBB 2WIKA 4V0NA 2XUPA 2Y1FA 4HEA6 2NO1A 2VF4X 3PQDA 4IMPA 1ADJA 4KXYA 1H4QA 5T4EA 3ITKA 5AW5A 4NTZA 5CIYA 3NLLA 2JLBA 2ZM5A 1XKLA 4RFSB 2NV2B 4NU6A 1JJBA 3EG5A 2GM9A 3RROA 4H6PA 4URFA 3U81A 3KB8A 1EX1A 4BVGA 4ZEOA 4C4TA 4ND6A 1RKQA 1NT4A 3HN7A 1IRIA 3F98A 2AQKA 4WVLA 4D0GA 4F2HA 5IZCA 4IIVA 2EX0A 3TIFA 3ZE2B 2YZKA 4RTQA 4BMSA 4H18A 3D7SA 2RSLA 5JS1A 1HDOA 2M6RA 3DOEA 2MSDB 4ZMBA 5KSZA 2IYPA 4QG3A 4IG4A 5AIAA 3W77A 4ZEVA 3MOIA 4ENTA 5C2JB 1S0UA 1G6KA 3AV3A 5BN5A 2AI2A 5F1KA 5E0KB 2OKGA 4CIYA 2VPZA 1L9XA 3ODGA 1RAHA 1OC2A 1RKBA 1YZKA 2O8FB 3SP1A 1USKA 1XRSB 5BNZA 4IDPA 5HKKA 2J9ZB 1VTKA 4D46A 2BGGA 1KU6A 2BBSA 1EFRD 1HYQA 2O4UX 2V0CA 2YOGA 5BSGA 4PAOA 1X1BA 3PD1A 3IERA 4KE8A 1W8DA 4KO1S 2FMHA 1SQGA 4ETIA 2IEAA 1GN8A 3W2GA 4YWJA 1W1UA 1P5RA 2JD2A 4NE7A 4EMTA 3GZJA 4FSHA 1LQTA 3ZY2A 4DYDA 4RZ3A 3JQ8B 4RETA 1IQRA 2PXAA 5EUBA 3KZMA 1MIHA 1NVTA 3CCCA 5F1OA 3R7LA 3U80A 3WNCA 4V03A 1M2JA 3F96A 3NFYA 4RD1A 1E6LA 4UATA 1ZDMA 3QUBA 2PJDA 2EG9A 3QI7A 3VZCA 1MB3A 1L5ZA 3ZCSA 2MYPA 3OHSX 1YV9A 2H18A 3SVTA 3V2UA 4I36A 5ADUS 4GOND 2NYUA 4MHOA 3H9GA 4JI1B 3UAXA 1DIAA 2GM3A 1QP0A 4NV1A 1K9VF 5MF6A 1I9GA 2HD4A 3GCGA 4QAQA 1HNZB 3F1KA 2J0UA 3LHSA 3BXZA 4HQ0A 5JR3A 3ZE0B 3K0CA 4LWQA 1WCIB 3AEYA 5LWHA 3MOGA 1UWVA 3GYGA 3MMPA 2V3VA 3CBQA 3N2NA 5IFKA 1C9KA 3G3EA 2OSBA 2WU3A 3FD8A 1OXSC 2WOOA 4JBIA 1X7GA 4KRGA 1UOEA 4LDRA 5D6NA 1Q6ZA 2PSJA 3BKWA 5CMLA 1X77A 1PJLA 1VBNA 2Z58A 3A6DA 4D0RA 4I8IA 2XECA 3UKDA 3T3DA 4BNDA 3C70A 1SWWA 2FEWB 3DUWA 5BQ5A 5C1OA 3HCFA 1R88A 4OSPA 4Z49A 3IAHA 1J70A 1RABA 3CZQA 4FFMA 3TX2A 3FWKA 1AV6A 4X1IA 4YJGB 4XSHA 3M83A 3T7DA 3UAVA 3GLVA 5K99A 2FTKE 3NBYC 3EQ8A 3UV6A 1ECLA 1VKNA 4JT9A 5TQ2A 2Y77A 1KEEB 4QDKA 3HCAA 4KVFA 5HF5A 2V6MA 3V4LA 3O91A 4QEKA 3LI2A 4ZJZA 4MR7B 1Q84A 2FVYA 2CLSA 5CA1A 2DHQA 3THYA 2P9CA 2O2ZA 3FMOB 2H7CA 2Q0SA 1YR2A 2AUNA 3QPWA 4PLTA 5BQPA 2X9QA 4TYMA 4K03A 2H1WA 3X1DA 1DFIA 1LUAA 2ZWAA 5LA6A 3NOVA 2I80A 1NQOA 1NIPA 3EWIA 3T7SA 3B9BA 1RYZA 4PQFA 1UBFA 1G59A 3UOWA 2YFYA 4GZ5A 1WR8A 5D1NA 3CZ5A 2BMFA 4RK6A 1ISSA 3UC9A 5LR6A 1P1IA 4E5MA 3GLGE 3NR2A 1VE3A 1T1RA 3QVLA 4N5IX 4ZO8A 5BYBA 3STHA 4BVAA 4C0AC 4PZZA 2XTZA 4MV1A 2X14A 1P3JA 4LY0A 2GRJA 1FTQA 1Z6TA 1M6HA 4Y2UA 2ZYVX 5E1MA 3KTAA 1E2EA 3E05A 3UWKA 2VWGA 4R5MA 2EW2A 1NI4B 4XFKA 1ZUNB 1XRJA 4L8LA 4OJTA 3FOWA 3RU2A 5HQ3B 3O8RA 3GLIB 2IUTA 2PEZA 5HE8A 1EA5A 2VH2A 2IPXA 3FBTA 4AYTA 2G0TA 4Q9LA 2EKQA 1J1ZA 3Q5DA 4OX9B 2F1RA 1DFHA 5GONF 4H3KB 2VTEA 1TIKA 5AI9A 3L9XA 3NC0C 4PC1A 1SBYA 2REXB 2PMFA 2VAPA 1PUIA 4LK2A 2QMYA 4RZQA 5DLYA 2QTZA 3DB2A 1UXIA 2RBKA 3QOXA 3OIVA 4UEQA 4FWBA 4NP6A 2VDJA 4RTLA 4BVLA 3SLRA 3R9XA 3EBLA 3OEWA 2ANCA 2CL5A 4JJ4A 1TL7C 1UANA 3FOCA 3FDXA 1BQEA 1HMYA 1LF0A 2EVWX 2F1JA 4CETA 2FUEA 3QUAA 2PXXA 4S1PA 3PE4A 4L3VA 2A58A 3MJTA 2NUBA 1TNDA 4JXXA 4OGWA 4P54A 3S8MA 4KV9A 4QU8A 1X15A 3IYLW 1SVOA 2OV4A 3KEQA 4BGVA 4C3ZA 1I5OA 3KDAA 3DE0X 4HNGA 3IVCA 2EXXA 4KCGA 4NCNA 3QXHA 4C0XA 5JECA 1VJ5A 3KOXA 2EZ8A 1ZN2A 1M1NA 2J3MA 2QLTA 3KFXA 2B3TA 3SQMA 1HOTA 1CJCA 3NM4A 5GIPE 5HJEA 2WQZA 3HCBA 2PAFA 3DV9A 3HXPA 1TI7A 2DAPA 1RI4A 4L08A 4NOLA 1Y9JA 3OCWA 1HWYA 4LC9A 1P77A 1G7TA 4LPSA 4NFYA 3T4XA 5HKBA 1O4WA 1OW3B 1ZSNA 2ZJOA 5ADVA 3SDZA 1YIAA 3OJOA 3KJFA 1RFLA 4UNPA 4PPGA 1JKIA 2LPMA 5D7NA 3OG9A 5A7FA 5F23A 1CUFA 5DNEA 2G9VA 4PVDA 3B9QA 4M8KA 2C2YA 2V7QD 5G41A 3TQTA 3U4DA 1M74A 4MCJA 2F2TA 3BREA 4TPKA 1M1UA 1MAHA 1NN1A 4LOKA 1N5MA 4GO1A 2NQ8A 2FXVA 1QVWA 4DR6B 1KI4A 3PR2B 2YZNA 5FHQA 1NLZA 3L01A 2VLIA 3T34A 4IIEA 3BHJA 1R2QA 1VE9A 3BWDD 2SCUA 4G24A 3M89A 5AHRA 4Y3UA 3VH3A 2W2KA 1DCMA 2RHWA 5TS3A 1Z2OX 3OTGA 3B7WA 2P6NA 5FLXA 2W6MA 4XRGA 2AOWA 3N5CA 1FU7A 1JPUA 3BULA 4NJOA 2OCBA 4R7TA 1ATZA 3W2IA 3HYRA 2IS6A 2RI6A 1HE8B 3I1IA 3PYXA 5EHNA 4X20A 4KW7A 2X2OA 2BFBA 3HXTA 1XG5A 3BRWA 4Q19A 4Y1RB 5KWIA 4Q1FA 1T13A 5B3AA 1G38A 1PJZA 4B6QA 2BMEA 3NRJA 3C5VA 2R4QA 3GRRA 4COOA 3A4LA 3WWZA 5DT9A 1LZKA 3G0CA 1CZNA 3HJNA 5DYNA 3BB1A 3VO1A 4TWAA 2BFNA 5K3BA 3IIJA 4CI0B 2OGWA 4R51A 5CD9A 1H93A 3IIKA 2QMEA 4R2IA 2BSXA 1AT1A 4GFDA 4C1BA 5B2EA 3IOEA 5T7BA 4O2AB 3GBSA 3EDOA 2BZGA 4NAUA 4OHOA 4J0IA 1TCAA 1A82A 4HJRA 3VJLA 2FQQA 2FW9A 4L4XA 4P92A 4F6CA 4PO3X 2FA9A 4H0NA 3GHHA 2O0KA 3R40A 4J91A 1ZR4A 1UBHS 2ZAYA 5DYTA 2XZTA 2XGGA 3VQTA 5CB4F 3G0DA 2FG5A 4CLRA 3BJZA 4ZHQF 1H23A 2IY9A 5LIRA 1D8AA 1YCHA 3KXDA 4QFDA 1KK3A 2PH1A 3ITNA 2F8MA 3IUPA 2FZWA 1OGYA 4Q82A 4DLTA 1U6IA 1RYDA 3K5PA 2C84A 4ZVKA 3IESA 1Q0QA 1W2HA 1E5DA 2GRUA 5EL0A 1FSGA 4OMCA 4JQSA 4NYMR 2FZ5A 1JYEA 1MTZA 3E18A 3S7TA 2DF8A 2Q4RA 3RIGA 2ZYDA 2YMLA 5E9QA 3TOCA 3AESA 4IOKA 4FMPA 3WJAA 2WKPA 5KPDA 3FSGA 4WZAB 2F1OA 2I2DA 4UJ3A 4TLDA 4BMVA 3ZJTA 1H66A 3SDBA 2BONA 1TOAA 4KSYA 4OXYA 3O4HA 1CY0A 4RABA 3DE3X 4QLAA 3MCVA 1C7JA 4DWVA 1ZA2A 4TTVA 5M7EA 1FIUA 4GP6A 3STUA 1XLTC 1YFZA 3V80A 2JGKA 2FWRA 1KOJA 4ZDIA 4MMZB 2JAWA 1Z4PX 3EODA 3VPGA 3OBIA 2WA1A 3HNRA 4QREA 3HY4A 4DRXA 1K7FB 3LX4A 4EI7A 5IS2A 4J0QA 1DKQA 1UBJS 3LP5A 3WC4A 4EP1A 2L18A 1KDYA 2NU6A 2WAAA 3RSZA 4BO0A 2HU2A 2PKCA 2C2WA 4UNSA 1VL5A 1ZN7A 4PYJA 2Z1NA 1CJBA 3DQZA 2GWRA 2OXEA 3VJRA 4ARIA 2HBQA 3VBEA 1P33A 2C1ZA 3K0SA 1KO4A 2DQKA 4NU5A 1L8LA 1JKMA 4LX0A 1YOBA 3BD7A 1TQDA 3Q7PA 5FWXB 5LKAA 3OM0A 5CPBA 2P75A 3L7MA 5JAMA 1ZCJA 1MB9A 2CLCX 3I2HA 5KSPA 4H7KA 1EM8A 4G1VA 1EBUA 1P62B 1CU1A 2BE9A 1E0DA 4K6GA 3RSFA 1UK6A 3H6HA 3CH5A 5AW8A 2OG2A 2VFAA 5CP8A 1SC4A 4TM7A 1IB0A 1VQ1A 4R81A 3UXYA 3P9KA 4BVBA 5CBKA 3ABZA 1N3YA 2CNBA 3UJ8A 1BU8A 1BC5A 4CKZA 5ES4B 1HY3A 2JK1A 6AT1A 1DCFA 2ZTHA 1JHXA 1U1CA 3GUUA 5H4HA 1F7UA 5JNSA 4H7JA 4BX3A 5I7VA 3PKZA 2PR7A 1N25A 5K4GA 3ROPA 2JLAA 2RDMA 3NUGA 1PK9A 3QVGA 3PNMA 5CVUA 5JZBA 3NEJA 5MDHA 4HXGA 2QLLA 1SEVA 4QYTA 4U7WA 2H08A 1WKVA 5EQFA 4YDQA 1M7BA 1YU6A 3FFBA 4K05A 2VTVA 7ABPA 2EFEB 3A6EA 4QRDA 2YYZA 1QJCA 5DHAA 1UIRA 4JLBA 3MWDA 2O8BB 4QBFA 4R2XA 3X1JA 3K09C 2QE7D 1CF4A 1JB9A 2AOTB 2D74A 3HKBB 1UCFA 2WVGA 2X77A 4BUCA 3PEYA 1EXMA 4Z2YA 4IDFA 3ZS8A 1V4VA 4AB1A 4UTNA 1QVZA 2WTBA 1GQOA 2YYAA 4EABA 1KVTA 5K09A 4QGBA 5THXA 4NBVA 1BVHA 2QBYA 5JS6A 4P34A 2CMHA 2YJ3A 4D9GA 3FOAA 4F45A 2PG3A 2PT7A 3QGMA 4YUXA 2BRUA 2PCLA 1KGSA 2D5BA 3FTCA 5F5LA 1XLTA 4QM7A 2HT6A 2VWHA 3V7YA 4F4FA 2H1OA 1XE3A 4ZQEA 5HRCA 5LQDA 3UPDA 3LOQA 1P8AA 1YB6A 1ZCFA 3FUVA 1A8UA 4JKYA 4M9CA 4BFYA 3KXPA 1JIXA 3GK3A 2GWHA 3L41A 1K7YA 4CDNA 2EZ4A 1SVWA 4KQ1A 4OHMA 4MW0A 1SAYA 3EVCA 1H8ED 4G0YA 4KIFA 4M7RA 2IXAA 2BFEB 1BE8A 2C8JA 2DYKA 7MDHA 5LQAA 2B37A 1AVTA 5K8IA 1DRVA 3WL6A 1H6DA 4OB7A 2R97A 1AHIA 1NAHA 1RWNA 2NWQA 3EXHB 4YCCA 2L2QA 3I64A 4INPA 1YQQA 4M1MA 1RLOA 1W44A 2VZLA 4N76A 2H5JA 1ENYA 3ZCXA 2J9GA 1PJ8A 3IELA 2WV7A 5BSTA 3UJBA 3NTXA 3ZUGA 4P36A 2PXHA 3NETA 2WOJA 2RAFA 2VYND 4EMSA 4YMLA 3EZXA 1XDUA 1TX4B 2JA1A 1Z7BA 2YY7A 4KIGA 4NDZA 4HF7A 2RJNA 2IUUA 3TL6A 2D1FA 1QK4A 1UKVY 1D2NA 1SHKA 1W0KD 2V74B 3PVSA 1MQSA 1B1AA 1WMAA 2IOYA 2HM7A 2PL3A 3ZK9A 4ABTA 2XSZA 1ZMTA 2C2BA 1H1LB 1RZ3A 2OCLA 4R69A 3GH1A 4I1IA 1O58A 2XT9A 3RH0A 2G07A 3VDRA 4QGHA 2BTEA 3WS7A 4B6PA 5LXTF 5B3KA 1OR8A 3CIFA 3VVBA 1NVKA 2CD9A 1QH1B 4YRIA 4R8VA 3R8XA 2WYWA 4AUEA 1C9YA 3AR2A 4KO8A 2ZBVA 2JI8A 4QVKA 2R60A 1HOXA 4HQLA 2O3UA 1M1YE 4ROTA 1XU4A 5FEUA 2FOXA 2ORVA 1OF1A 4S2EA 4CT5A 1NQTA 1OJLA 3T7KA 3OPYB 1P2GA 1GGHA 4D9NA 1JIQA 2OCGA 1PDVA 4E51A 3RIHA 3K09A 2B1RA 5DEOA