3NWBA

Rat comt in complex with a fluorinated desoxyribose-containing bisubstrate inhibitor avoids hydroxyl group
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nwbA00
2QE6A 4QTUB 3GDHA 4Y2HA 3TMAA 5K0CA 2B25A 4R05A 3FTCA 2PV0A 3EGVA 5DXJA 3KQMA 3PX3A 3SXJA 2YUIA 2P7HA 1PRYA 2XVAA 2ZVJA 1TPYA 3MQ2A 1KR5A 1L3CA 4K6MA 5HIKA 4CXMA 1ZGJA 2P3OA 2ZLBA 5LQRA 3FTEA 4ER6A 3P2KA 4PGHA 4PYLA 5EKXA 2HWKA 3FYCA 4FGZA 4HGYA 5EMMA 1EJ6A 5FA8A 3TRKA 5E9WA 3UJCA 2Z6AA 1VE3A 3AY0A 2Q41A 3JWIA 4P58A 3S68A 3PFGA 4PNEA 3ERCA 3M4XA 3VSEA 3EVEA 3C3YA 5FUBA 3UJAA 3NW9A 3G5LA 1R8YA 4YUYA 4LWPA 2XYRA 1Y8CA 4E30A 4EQZA 5JUWA 3A7DA 4ISCA 2IDJA 3OPNA 3B7PA 1O9GA 2YX1A 4FS8A 4ER3A 3TKAA 3DULA 2NXNA 3G2PA 1V39A 5CM2Z 5FQNA 1HNNA 5CD1A 2JG3A 3BWCA 1I4WA 2BR3A 2QM3A 4A6DA 1JTFA 3FYDA 5EQJB 5IH3A 2OO3A 2ZW9A 1KXZA 3EVCA 4GUAA 1G8AA 1WG8A 2PSSA 2ORED 5DM1A 5ICFA 5EKUA 5K09A 2I6GA 5EVJA 3BT7A 5DWQA 2PXAA 5DXAA 3E23A 1OR8A 1RJDA 2DPMA 4E32A 5C9ZA 1KIAA 5LQUA 5EOVA 1KPGA 5ICGA 2K4MA 1KHHA 4RTQA 4PIMA 1P1CA 1IM8A 2ZBRA 5FTWA 4OX9Y 1KYZA 3ANXA 4PIPA 1NW8A 4E31A 3A27A 1VP9A 3HNRA 3EEYA 1SQGA 2UYOA 1FP1D 1P91A 4OBXA 4KVZA 1QZZA 2O07A 4KWCA 3LCCA 3KQVA 2VP3A 3LECA 3T7TA 5BP7A 5LQNA 2ZZMA 2AZTA 2VDVE 1YUBA 3OE4A 3B3FA 4O29A 4QQKA 5H02A 1IY9A 2NXEA 3UJDA 1QYRA 3KPJA 1H1DA 1WS6A 2PBFA 4KDCA 2H1RA 3DP7A 2C7QA 1R00A 3HEMA 3B3JA 5KS2A 2NXJA 4AZVA 5GP1A 3SSMA 4QTTB 4F84A 5GM1A 4F85A 1JTEA 2AN4A 3FTDA 2IFTA 3KQWA 3P8ZA 5E1MA 3ME5A 5P8WA 4C04A 5EZSA 10MHA 3SR4A 3OCJA 3QOXA 5HFJA 5EHGA 3KPUA 4KRGA 5EC8A 3ER8A 3MCTA 2AVNA 2NXCA 3CCFA 1R8XA 4KW7A 4RTKA 5BW4A 2NP7A 2NNWB 2IBTA 1JG2A 3BGIA 1NKVA 2HNKA 2ZIEA 2NP6A 1JQEA 2VZ9A 4QDKA 1I9GA 3A26A 2PX2A 5E9QA 4C08A 1BHJA 3CJRA 4HGZA 3GRUA 3BWMA 3CJQA 4R6XA 4AX8A 5MHTA 4PYNA 1ZGAA 2AOUA 3DH0A 2ZBPA 3RIEA 2GA9A 2ONZA 2LD4A 4OQDA 3PTAA 3DMHA 4QPPA 5EGSA 1YB2A 2AR0A 3KPVA 5LQKA 3BGVA 3FUWA 2ZZNA 1B42A 4DCGA 2B78A 3NWBA 3ELWA 3A4TA 2P1DA 3E7PA 4ZTBA 3REOA 2OZVA 3LPMA 4GOMD 3G5TA 4AZWA 3SMQA 3TKYA 4DF3A 4PYJA 2R6ZA 2PXCA 4ER7A 3EVBA 1O9HA 4P7JA 1RI4A 5EHIA 5ICCA 3M6XA 1DUSA 3UBTA 5E1DA 3I5UA 1KPHA 1AV6A 3HVJA 2PLWA 4E2ZA 1XCLA 4DA4A 1JSZA 5EPEA 3P9CA 5FWDA 1G60A 3GXOA 2EX4A 4V0QA 5T6BA 2ZULA 3CJTA 1EAMA 4PWYA 1JQ3A 5FHQA 3DMGA 2F8LA 4PINA 4R8SA 3R9XB 3THRA 3B89A 4A6EA 1NT2A 3FRHA 4DCMA 4V0RA 5FQOA 2WA2A 3KQOA 5GWXA 3GRYA 3LDGA 1FBNA 1EJ0A 1EQAA 4XCXA 3M6WA 3WSTA 4RTLA 4RTSA 3R0QA 4JXJA 4KIGA 3SM3A 3V97A 3PLAE 2IBSA 2N47A 5CCXA 5LQCA 2PY6A 2BR5A 2PX8A 1X1DA 3EGIA 4YMHA 4RV9A 4E2YA 3MHTA 1SUSA 3TM5A 3LGAA 4CTKA 3MTIA 3LDFA 1PJZA 1M6YA 4KDRA 4X61A 3HM2A 2YXLA 3KPWA 3EGEA 5K0NA 3MB5A 1RI1A 2EJTA 3B3GA 3H2BA 2ZTHA 4FP9A 4GOOD 4MQ4A 4PONA 5DTMA 1VLMA 3G7UA 5F2OA 3BWBA 4IV0A 4U7PB 4EVIA 2GS9A 5D1NA 5C0OE 1QANA 5FA5A 2FK8A 3EPPA 5HEKA 4H0NA 1JG1A 1WY7A 2HMYB 2NYUA 3CVOA 1M6EX 3DXYA 4QPNA 2CL5A 4RSRA 5DTRA 5K0EA 1ORIA 2GAFA 2I62A 3D2LA 1VIDA 3LKDA 4X63A 2UYCA 5B1SA 1X1AA 2ZFUA 3LCVB 3KHKA 3O7WA 4P7GA 2E5WA 2FYTA 3I53A 2GB4A 4QVGA 2EJUA 5E8RA 3TOSA 2O0LA 3KQPA 2YXDA 2G71A 3K6RA 3HA7A 3GIWA 2PX4A 1U2ZA 3IV6A 2IH2A 1XTPA 1IXKA 3TFWA 1VL5A 2UZ4A 1XXLA 1AQJA 3L8DA 1F3LA 1QAMA 3HVHA 4CKBA 1L1EA 4P7KA 3KQYA 4HTFA 2WK1A 1ZQ9A 8MHTA 1KP9A 1G55A 1XJ5A 2AOTA 5DX0A 1KPIA 3BKXA 3DTNA 1XDSA 3FUXA 5IKMA 4RTRA 2I9KA 3HCDA 3QOWA 1XDZA 4IKPA 3UZUA 4CWAA 1MJFA 3CBGA 2ZBQA 4BLUA 5K03A 3AJDA 3FPFA 2G1PA 2CMGA 5DX8A 2IP2A 3I64A 3NDIA 3MERA 5HZMA 4RVGA 3ORHA 3EVGA 4OA5A 3TPZA 3UJ8A 4DM3A 2OKCA 4DKJA 5DM2A 4E33A 5EEGA 1R74A 2EG5A 2FHPA 4WXHA 4DMGA 2AOUB 1HMYA 2JJQA 3E05A 3P9NA 1JQDA 3THSA 3UA4A 5GINE 3BGDA 5T64A 2IPXA 1YF3A 3P97A 1YFLA 1TW3A 3EVFA 3KR0A 3TLJA 5GM2A 3B5IA 2C7RA 1JG3A 1FPQA 3P2EA 5K8VA 5DM4A 5K05A 1RI3A 3BWYA 2O05A 3OZSA 3C6KA 3NMUF 5F2NA 2XYQA 4DQ0A 2HTEA 3F4KA 1NV8A 5DRTA 2FRXA 2B9EA 3LCUA 3P9IA 1RI2A 5E2AA 2ZCJA 3ELUA 3GRRA 3VC1A 1DCTA 4AUKA 3VC2A 2Z6QA 1YFJA 3AXTA 4R8RA 3RW9A 3UWPA 5BW5A 3LBYA 4EK9A 5JR3A 1DL5A 1R6AA 2PT9A 4EMSA 4E70A 3GO4A 4YUVA 1MHTA 4HH4A 3HCFA 2A14A 4C06A 4C07A 4IV8A 3PT9A 2JHPA 3GNLA 1G6Q1 2P8JA 2ZWVA 4Y30A 3O4FA 3UJ9A 5EMJA 2JH8A 5FWAA 3Q87B 4YMGA 1RJGA 2P40A 3DXZA 4BLWA 2BZGA 3OE5A 5DX1A 1WXWA 2H00A 1TW2A 3G88A 3KKZA 3DXXA 3OU7A 5CVEA 3HCBA 1X19A 2OBFA 3CGGA 2ZIGA 3EVAA 3OZTA 1UFKA 4QDJA 3OU6A 2OYRA 2C7PA 2AN5A 3FZGA 4P7FA 3HCCA 4CTJA 4ER0A 2PWYA 2BR4A 1F38A 1XCJA 1XDUA 4RWZA 2Y1WA 5E2BA 1ORHA 3SGLA 4ATNA 3FRIA 1BC5A 3ID6C 5CVUA 5HILA 3VYWA 4M37A 5E1BA 2EFJA 2AOVA 2CMHA 2QRVA 2ZZKA 3FPGA 2OB2A 3KQSA 3PS9A 3PFHA 4FT4A 3SX0A 4BLVA 2BM9A 3NWEA 5KYGA 4RTPA 4QVKA 1NW3A 3QV2A 4RX1A 4RVFA 3NVMB 3IEIA 2WA1A 2AOXA 4LECA 2YVLA 4X60A 1QAQA 3ER9A 1WZNA 3KQQA 4HSGA 4FZVA 2ZWAA 5GIOE 5U4XA 4BY9E 3NVKI 4GQBA 3LL7A 3CC8A 4RTOA 1UWVA 2I7CA 3NJRA 4C4AA 2CKDA 3GJYA 4HC4A 5DM0A 1QAOA 3UJBA 1AF7A 3JWHA 2Y1XA 4RYLA 2UYHA 2P41A 2P7IA 3UFBA 4RTJA 1SQFA 3KR9A 3JWJA 4OQEA 3V8VA 1VQ1A 2C7OA 3X0DA 3LBFA 2XVMA 3IYLW 3LSTA 4XUDA 3O31A 3M6VA 5DLYA 1UIRA 1RJFA 4HTFB 2PX5A 2P3QA 2GPYA 3AXSA 3KR2A 3SVZA 2AOTB 2HV9A 3R24A 5FCDA 3TQSA 4AZTA 1N7IA 1EIZA 3LHDA 1JR4A 1SVUA 5FULA 2V7EA 5EG5A 4BP1A 1NW6A 3P2IA 1P1BA 3G2OA 2G8NA 2JHAA 4HG2A 5EMKA 4DZRA 5DSXA 3UA3A 3JWGA 4WVLA 5FADA 5K0BA 1NV9A 2B3TA 5CCBA 2GLUA 4B17A 3HVKA 5DTQA 5HOQA 4GC9A 3EMDA 1I1NA 2IIPA 3FPHA 2AN3A 5HIMA 3GCZA 5HIJA 5K0GA 2VDWA 2YTZA 1ZHFA 3FPJA 3HVIA 3R3HA 3PVCA 2UYQA 3G89A 1L9KA 1NE2A 1WXXA 3GRZA 1NBIA 2AOWA 3DMFA 1SUIA 2ERCA 3GWZA 3C0KA 3MAGA 4F86A 4FSXA 1YZ3A 4PYKA 2O57A 3FUVA 4OA8A 3UJ6A 2ESRA 1L3IA 1NW7A 1VPTA 3U81A 4E2XA 7MHTA 2PKWA 4PCLA 3FUTA 4UOEA 2YQZA 2P3LA 4RTNA 5T67A 5LQJA 3LKZA 4FSDA 4GOND 1T43A 5ERGB 4E2WA 1NBHA 2OB1A 3EVDA 4IWNA 4EKGA 5KQRA 1N2XA 5KVAA 3EEOA 4NECA 3MTEA 2P35A 4XUEA 4PYQA 3T7RA 3GGDA 2PGXA 2V74B 3KQTA 2AVDA 3DLIA 3HCEA 5DPMA 2OXTA 2OPBA 2JHCA 2YXEA 3HP7A 4U7TB 3FTFA 5D1HA 1N7JA 2CWWA 1BKYA 5CVJA 2ZIFA 4OBWA 1M0EA 3HCAA 4C03A 4QQNA 5GIPE 2G70A 2IDKA 2IGTA 4GF5A 4GC5A 3OFKA 2QYOA 4BP3A 3HTXA 2YR0A 5EZQA 1EG2A 3G8BA 1X1BA 4EKIA 4G56A 2PJDA 2QY6A 3DLCA 3FUUA 5E8JA 3SSOA 2H11A 4YV2A 3BXOA 3E8SA 4YUXA 3OU2A 3CKKA 3OFJA 3PX2A 2BH2A 3EMBA 3TM4A 1INLA 3DOUA 4RVHA 5DRYA 4C05A 4MIKA 5CVVA 3I9FA 1ZKDA 3AWIA 3HA5A 5F2KA 3LDUA 5HIIA 2VDUE 3IHTA 4GOLD 5EMLA 4CKCA 5M5BA 1KYWA 3A25A 4LG1A 3GU3A 1NW5A 2G72A 2ZSUA 1JG4A 3A7EA 3P71T 4YV0A 1O54A 3Q7EA 1VP3A 1BOOA 4KIFA 1Q0TA 2IH5A 1Z3CA 2OY0A 2PT6A 1RI5A 3LX6A 4AZSA 2KW5A 2QRVB 3P9KA 3C6MA 5CVDA 5LSAA 4YUWA 4PCAA 2FCAA 5E1OA 4MHTA 3M33A 4POOA 1R18A 3KR1A 4MTLA 5FHRA 2GH1A 5CUQA 3EVZA 1XVAA 4M38A 3G2MA 4M7RA 4RTMA 9MHTA 5LQAA 3BZBA 3M70A 1D2CA 4M36A 2PWPA 4PGGA 4X41A 1VBFA 3DUWA 3T0IA 3HA3A 5K01A 3BKWA 5GOZA 4X1OA 2R3SA 3OZRA 3DR5A 1YZHA 2IH4A 4GEKA 4HRAA 2FK7A 4MWZA 1G38A 1ZG3A 4PYIA 2JH9A 5DSTA 5EIWA 5DT2A 4PYOA 5G02A 2O06A 4Z2YA 5K0FA 2XYVA 5EEHA 1G8SA 1AQIA 3M6UA 4YV1A 5K0LA 1L3BA 1Q0SA 3NTVA 2HR1A 5KQSA 3BUSA 3T7SA 3PB3A 3FPEA 4R6WA 3G8AA 1SG9A 5C1IA 5EIFA 4CKEA 3C3PA 3KU1A 3R6TA 4L7VA 4YUZA 1SKMA 1FJXA 3GRVA 3TR6A 5ICEA 5CIYA 3ELDA 4LWOA 3RODA 3UJ7A 1X1CA 5LR6A 3G2QA 2DULA 1D2GA 1RJEA 1D2HA 2VS1A 5E9JA 4XUCA 2BM8A 3ELYA 4PYMA 2AS0A 2Z6UA 2B2CA 1FP2A 2ONYA 3SSNA 3K0BA 5K0JA 4GBED 3NDJA 4FR0A 5BXYA 1P39A 4RVDA 3MCZA 2PXXA 4FT2A 2PVCA 3I58A 1JSXA 2ADMA 3KPYA 3MGGA 2XBMA 2FPOA 4ER5A
chains in the Genus database with same CATH superfamily
4AO6A 3EQ6A 1M6WA 2REXB 2CJPA 3KLNA 3PYMA 5FXMA 5JAMA 2YUIA 2ZVJA 2FPMA 1XQVA 2XVAA 1MC4A 1KBZA 1JH8A 2LDXA 2MMCA 1MU0A 1AN0A 5ENDA 3LY8A 4MS4B 4YONB 5J3JA 3STYA 1AUVA 3LX8A 4BO9A 5FOWA 2JLZA 2WSSA 1GIAA 3PDCA 3AY0A 4YYEA 2NUTB 4J1SA 4L0DA 4ZPJA 2CLMB 2ST1A 1JHYA 2YBEA 3UJAA 2D7JA 1NQVA 3ZKWB 1NRJB 4MQMA 3UGTA 4BLTA 2RHGB 3H0CA 3MJRA 1J2RA 2XT9A 1SB8A 2B0CA 3BIOA 1EFVA 3A1DA 3TKAA 3MS2A 3W2GA 5IBPA 2IF0A 3HCRA 4O08A 1RAIA 2YHAA 1DOZA 4EDFA 1VE9A 3CF4G 4YJ3A 1QCZA 3FD8A 4A6DA 4CE6A 3H13A 1QV6A 1OKKD 5KNDD 1R6BX 5K09A 2CLFB 2G4VA 5AOAA 2C5AA 1OX5A 5DYTA 2IEIA 3R9WA 1JFLA 2FWMX 2CNWD 2RIRA 4UJ3A 4IX9A 3E23A 4HATA 4GYJA 2A33A 1K6XA 3EWIA 1I2ZA 4ZT4A 1DEHA 2WMNB 3CVJA 4DUGD 4XDZA 3WYEA 1U3TA 2F43A 4Z3DA 2X0IA 1YAJA 2B6HA 3ZWCA 5JSZB 2CXRA 2OXCA 2W4MA 5FTWA 2QR3A 4EA7A 3L8YA 4X8MA 5FR2A 3HN6A 4REQB 4YASA 5B3AA 2A9KA 2H9AA 1NW8A 3D3KA 3WDSA 4O2LA 2P2SA 4PYRA 5J1SB 3EEYA 4WY8A 3JS5A 4HWPA 5CDUA 1FP1D 1D03A 2Q4RA 4OBXA 1W4BA 2O07A 3ZY6A 4C6TA 3RCBA 3RFTA 4UAJA 3RS3A 5CAEA 1UMCA 2R5WA 1EFPB 1U31A 1YUBA 1R8SA 3ZX4A 2C4KA 3TFQA 4TTTS 1XZLA 4MROA 5BN5B 5HK8A 1LFDB 1WS6A 3LS2A 1TZCA 1MJGM 4MVJM 1XL1A 3E4DA 4EB6B 4R71A 4RPIA 5DFAA 2OM6A 1GXSB 1Z62A 3B3JA 4L4XA 1NXTA 4AP5A 4AZVA 2AG6A 2PBRA 1G20E 3EGXB 3J7TA 4N54A 1UAAA 4L0CA 5GM1A 4EFLA 3SZOA 1X3SA 1Z7GA 1KP2A 5EHGA 2PRJA 3ZDCA 2H1WA 3H7AA 1LC0A 1QRAA 2O7RA 5M7EA 4BWGA 3OIDA 3NS7A 1ESZA 1UDAA 2JFVA 1DJQA 2QYHA 3A8TA 5THKA 1T3SA 3SOZA 4KG7A 2BBWA 1PT8A 4F2GA 1GPAA 2BE9A 4YCSA 5JISA 4QDKA 1GARA 3AP1A 1XLUA 1KYVA 4HEA1 4WRRA 4C08A 1N75A 1QQ6A 4WXYB 2WTXA 1BX0A 1KEKA 2O2CA 4YAEA 2GN2A 2OD2A 1PJAA 2JEYA 1H6AA 3KBBA 4M76B 2HM7A 4QPZA 3I73A 5G1NA 3I5AA 4KJZA 4QOEA 1DAEA 2WG2A 4Q82A 1VRVA 4OQDA 4P9NA 4MQBA 4QXPA 4AJ9A 4YHHB 2FDCA 4AY6A 5E2IA 1Q0ZA 3KPVA 2VP9A 3K4HA 5EIBD 3HY6A 4QREA 2FUKA 1D9XA 4DCGA 1HLFA 2PGAA 2HIAA 1CZRA 3CLKA 5SYNA 3LM8A 4PS0A 3EFHA 3ODPA 3BOSA 3CUTA 3HDHA 6GPBA 2WJZB 2WU3A 1F2UB 3PC8C 2R6ZA 3JVEA 3PRYA 5IVDA 3RHZA 3CGWA 3ZHTA 3TLMA 3F7NA 5CHEA 5IVIA 5JJCA 1OAAA 4HQKA 5JH7A 1SXQA 3OUZA 2JZOA 4GOJA 3OZEA 4B8YA 4UTPA 1XCLA 1H1LA 3VAAA 2B34A 4I1IA 4L15A 5K3FA 3MWJA 4ZCLA 4NFSA 2JIDA 1XC7A 2XJ9A 3B1JA 1N34B 2IE8A 1ETHA 1ZJ4A 4LZZA 2J7PD 3O8QA 5T6BA 3GZNB 3VNVA 2C9CA 1EAMA 1E2FA 2NVOA 2Q8NA 4D0NA 4LMBA 4R8SA 2WF5A 2GZDA 3CW8X 2BDTA 3NFRA 5DCUA 2Q7OE 4FQ7A 4WQMA 2Z9DA 1SVSA 2ALJA 3BXPA 3G1UA 1RRGA 3ADCA 4BNVA 3LDGA 2WFZA 1W5FA 3FLEA 2PLFA 1YRYE 3N75A 3MRSA 4IZIA 3V46A 3DDNA 3MZ0A 1T0JB 4DWVA 1CIVA 1U0OC 2WJAA 3H5VA 4D4JA 4IS3A 3OCZA 2RH5A 4KWEA 3RRFA 4Q3BA 1IM2A 3PWZA 4S04A 5K0NA 3MB5A 4G8JA 3B3GA 3HKEA 3KB2A 5EWLB 1P29A 3FHJA 4WZAA 1E5DA 5F2OA 2PA3A 4FMBB 1KL7A 3OPVA 1K27A 3B53X 3PD1A 1NP3A 4EX6A 1K1EA 2XUGA 3HB9A 2VOEA 1RXIA 3GPDG 1XR3A 3WLFA 2OWEA 1H85A 1VJ0A 3OCCA 3AI2A 1M66A 3A05A 4CMCA 4EHFA 4KHPB 1XCBA 2D13A 1KDZA 3BSYA 1T5BA 2E55A 4QBGB 2ZI5A 3LLMA 3EVNA 4NJMA 1BXGA 2GYYA 4R8KA 1ZFNA 4Z3KA 3HZHA 1GCIA 1ZM9A 4HZGA 4YP5A 4B81A 4IICA 5J40A 4EF6A 5A6VA 2J5BA 3H19A 4M60A 1L7NA 4B2YA 1JT9A 1W0KA 3DKIA 5JXGA 1WB9A 1K4YA 2ZEJA 4JXZA 1FS6A 1GQOA 2MMGA 3L7KA 2VATA 3NAGA 4Y67A 2I4OA 1G7RA 4MRSA 4RV4A 4ZQCB 3WLEA 3TLCA 2FSPA 3VFDA 3VPFA 2B8EA 5HCIA 1XTIA 1I51A 2GBCA 4ZYZA 5BR8B 4NNJA 1EUCA 4RESA 4CRWB 1ZQ9A 2AIRA 1UKEA 4HNSA 4P98A 1B6GA 1H4VB 6NULA 4M9UA 4X1KB 2R0QC 3BKXA 2MR6A 2ZR9A 3DTNA 1VG8A 4NHOA 3O8CA 1A9YA 1F4LA 3QSYA 1M8PA 2FFAA 3JQCA 3QY0A 3CB4A 1JFSA 2H7CA 4FU0A 4LJ6A 4TQUS 1MXHA 1TB4A 3ZLUA 5BNTA 4DIUA 3OE1A 5TGTA 2AEMA 3JRWA 3M2TA 3ORHA 3K7EA 5AKYA 4IHAA 5LD2C 3O9MA 3QFTA 2VWGA 3U17A 5BSWA 4FMCF 4NJEB 2ZTUA 2QUBA 1SXJB 1T10A 3W8RA 1U02A 1SBCA 3MMNA 4MUAA 2WSIA 3HXOA 2P11A 1OWMA 3M9XA 3NBUA 4L3OA 4QUAA 4XEHA 5HFNA 4CQNA 2B1JA 4KRXA 1T4DA 1FQOA 4HH0A 2GK4A 3W1VA 1ND6A 5ABPA 5DTEA 4LJKA 1YFLA 4DV2B 2VJCA 4DREA 2AFIA 4NBRA 1MC5A 1ZX1A 1VJ1A 3N70A 4FOTA 2C7RA 4WLVA 1YS6A 1Z4MA 2AW5A 3N2NA 4ESOA 4N5LA 5E95A 2QLNA 4YP7A 4N5MA 5HJ5A 3E2MA 2Q3CA 5HE9A 5DRTA 3AETA 3BL5A 3FCUB 3VX4A 3FZQA 4AMGA 1X1RA 1W4LA 2BTEA 2CNLA 3HR8A 1QKJA 1FYVA 4JUFA 4BUCA 1BRTA 2FU5C 4OUDB 3VR5H 3THXB 3I04M 3PQ7A 4OKNA 4TTJA 3S2IA 3R4CA 1FRZA 3OECA 4XRRA 3EG5A 4HH4A 4MKGA 4OCZA 4QARA 2A14A 5HJ2A 5BUCA 2GNOA 3DVLA 4LJSA 1DIOB 3DB1A 1BYIA 1R5OA 2KMLA 1CFJA 3DXZA 3MW8A 4J0JA 3PENA 2KM1A 4EIWA 4KE9A 4DSTA 1PQ4A 2O2GA 1DHRA 4S24A 2JFYA 1QM5A 1SHZA 3CWQA 1DG3A 3KSUA 3OU6A 3OZTA 4RCVA 2W2PA 4P7FA 3HCCA 1MOSA 1IPFA 1DAMA 2WM2A 4LEIA 4F3YA 4Z51A 2IW3A 5KOHB 3BEOA 1IWPB 2HU5A 1Z12A 1I5OA 3DONA 1VRCA 1II9A 1LI4A 2DPLA 2IU3A 2V9PA 3P0FA 3PUIA 4BE4A 5BNZA 4B3CA 4OIFA 2W93A 2Q6VA 3SX0A 4AWAA 3Q72A 4D9EA 3TL6A 4P3YA 4KXYA 1Z08A 1JAXA 7REQB 2XZOA 3KXPA 4F21A 1C9DB 2I2XB 3LUHA 1YACA 3ZWWA 3W8DA 3K0KA 2IVZA 1HDXA 1FDSA 1CWUA 2Q0HA 3IEIA 2TS1A 5LP1A 1N5KA 2AOXA 3F2IA 3LYAA 1F7UA 4D42A 2H1SA 5JH7F 2IYEA 3KQQA 4FZVA 3FVRA 4MMXB 5BV7A 5GIOE 3HBMA 4JUCA 4RF3A 1LXCA 3TRHA 4ZCPA 3ORSA 4BU1A 5K3OA 5IKPA 2ZVDA 1TIBA 2O2EA 2V8BA 4MUBA 2V4UA 3K31A 3Q5GA 4LA4A 4IJKA 1QB8A 3KVNA 3NO4A 3QPAA 4N5HX 3K0AB 4XZ3A 1I0IA 3VU0A 4TTVA 5HA5A 2UYHA 3WP1B 3MJ4A 1QX3A 5ECGC 3RV4A 5KTSA 3C3DA 4HWOA 2ZRIA 2O7QA 4NBLA 4YN3A 1KVRA 1KMHB 2P2YA 5FO1A 4B73A 2YVKA 3KR2A 3AXSA 4UU0A 3SVZA 5FCDA 3AJ9A 2XGSA 3DBHB 5CDFA 1J24A 2X0EA 1YS9A 4MJ3A 2MYUA 4RD6A 1Y5MA 4KQFA 5EG5A 4QKQA 4E0BA 2W2QA 3BWVA 4UAUA 2J1LA 4Q7LA 5IAGA 2LBPA 1BMQA 1SHUX 2HXSA 1UR5A 2GO7A 3B2NA 1W7AA 3D6UA 1RYYA 1E18A 2QTTA 3MXTA 4DLWA 4LF7B 3K6KA 3O9VA 1BWQA 1PHPA 3L6OO 1NBAA 1P2BA 2VDKB 4MXDA 3TRJA 3DEZA 4DR5B 1RRMA 2F9FA 3QM1A 4M0FA 3WYFA 1E4YA 1GITA 3PUKA 5FTLA 2UXBB 2PWBA 1H9BA 1PTJA 3DQPA 3L7YA 5BMVA 3G89A 1WXXA 3GVCA 3GRZA 5DISB 2QJTA 3PFKA 1D2EA 4W5QA 4IXTA 4MDYA 4FSXA 1Z45A 2CXOA 4AZ3B 5DBOA 3SN6A 4B09A 3Q85A 1LK5A 4A0SA 5BSTA 2ZUTA 2AG0A 1L5HB 2RGNC 4FYYA 3W6NA 1KI6A 1GR0A 2WYIA 3PV0A 3C97A 2HUNA 5T67A 2ZSHA 2V1UA 3EPHA 4V39A 3EB9A 3D64A 2O8VA 3I39X 4Z7JA 2F1JA 1N2XA 2GUGA 4E3WA 3NOXA 4J3JA 2IOFA 1UINA 2HMUA 2XKJE 3PWSA 1HTTA 4F9TA 3S8EA 3VTZA 4RVUA 1NN3A 2R8OA 4Q4LA 2YWRA 1ZCBA 1M0WA 1D4OA 2FUG1 1BGXT 1X7ZA 3O83A 3OTIA 4ZRMA 3F6RA 3F1LA 4D97A 4D6XA 4PHCA 4Z3OA 4OBWA 4BO0A 4DLPA 3D54D 2GFHA 5KAPA 3PNOA 3UAXA 1DUVG 2QLTA 1U3WA 1VHTA 2YR0A 4EKIA 3G8BA 4A8PA 5C51B 1GPDG 1Z2NX 3FM9A 3A6HA 3ZWOA 2ECQA 1KWGA 3FUUA 2J3MA 4BNUA 2HWUA 2JKYA 4E5SA 1YJBA 2O23A 3KAPA 3IUBA 2VQFB 3D1LA 3G0HA 1R1DA 4GMHA 4O25A 1KA9H 1A71A 1LW6E 2QDKA 4AC9A 4BU0A 4C05A 2YHBA 3BF8A 4EPWA 3BMCB 1CUIA 4NS4A 5AVVA 1H5QA 2C2OA 1WDKA 2Q45A 3N2GA 3QFFA 2X0RA 2YKGA 4P92A 4GXTA 4TLEA 2DERA 4MR7B 4IUCS 3CRMA 4OO3A 3P45A 3OPMA 3HXKA 4S1NA 3KYBA 4KIFA 2JGJA 3KS9A 3E6AA 3UAVA 3HJNA 4R1SA 1J00A 2NVWA 1FTYA 3A28A 3Q0EA 4IRMA 1ZVVA 2O2ZA 4V24A 1AO3A 4Q6WA 3MWDA 5DHQA 4L2IB 1JJAA 1MJ5A 1R18A 1JHMA 1S0UA 3ACBA 1MB9A 5TSDA 4ZJYA 2XLBA 1ZH6A 1RWQA 1RZRA 5AKXA 1DJNA 4GYWA 3ST7A 1E2LA 1U8UA 1YRBA 2UUAB 4MQLA 3EULA 4IWYA 2PV7A 3IPXA 2JFUA 2ZB8A 4OY3A 2P6UA 1KAHA 2I76A 2Y0CA 2PMDA 3D8TA 2R3SA 3E4CA 2D2EA 3GYGA 3OZRA 3QUQA 3TUJC 4GEKA 2Q21A 1AQLA 1G38A 5G02A 1EMDA 2LIVA 3GUCA 1L5QA 5LP6A 1H0SA 2NVUA 1UKVY 1E1RD 2PYZA 5KI6A 5BUQA 3VR2D 5C37A 1CUGA 1MJNA 4QGHA 2J09A 3MS7A 1U0FA 4QOIA 4B74A 5FA6A 2WABA 1EA7A 1EZ4A 1OIWA 2FCRA 2NTVA 2O6LA 3B6KA 3DL0A 3HZZA 4G1EB 4IOLA 4YRRA 1FFXB 5GOTA 5L95A 2O8CB 4L7VA 2ZS8A 2C61A 1Q44A 3KCQA 2CL6X 4PNZA 1K06A 2XITA 4ZREA 3F9RA 1Y1RA 3ZWXA 4CLEA 2WQZA 3RODA 5EQTA 3SS9X 4TYWA 4TMYA 2ORVA 4Q7QA 2NXWA 1E1CA 2F3TA 3ICPA 5BWBA 2IYQA 1YBFA 2C54A 1A69A 1ELOA 2WSSD 3ELYA 5E9JA 2B2CA 2ZJ7A 3EFBA 4CMHA 5I8WA 1R4MA 5EIXA 1WPXA 3NKVA 1E69A 3TE6A 4C01A 4HXGA 1K7YA 1H42A 3CA8A 3RPEA 1GRRA 3M0EA 3U4IA 4KACA 3WI7A 3U19A 1B4DA 3WNQA 1E9RA 2Y9PB 4FONA 1XEWY 3RUDA 4B8WA 3WGHA 2DBRA 4UDXX 2IX9A 1I7QB 5K0CA 1JDBC 4IIDA 1II8B 1Y37A 1TZ2A 2OLEA 3QGMA 4FLMA 1MZPA 1PRYA 1N78A 2GJSA 4F2DA 1QQ5A 4CLOB 2BFDB 2YHIB 1N2JA 5DI3A 1ZP6A 3ICQB 5KAMA 2Q1UA 1NNI1 5FA8A 1H1TA 1N6HA 4ARBA 1JHVA 5L51A 3TD9A 4MB0A 1NVEA 1H2FA 4BMVA 2Z6AA 3A10A 1OOEA 2VP4A 3H97A 5CBPB 3H9QA 1Q0RA 2PZBA 2OEPA 1ADJA 3PA8A 2J3KA 5HRUA 2PLNA 1JFFB 1Q3HA 1M76A 3MINA 4LWPA 1GG5A 2XLCA 4NZMA 1U0EA 1R0CA 2HK6A 2YXBA 3PG5A 4EEZA 2GBPA 2XCQA 2ZIUB 2ZAMA 2ZRQA 2JG3A 1HNNA 1DXOA 2HA3A 1KY5A 5FUVA 1YB1A 1LFAA 4OH1A 1T29A 2YYZA 1G42A 4MS3B 5ALOA 2H29A 4G01B 4MUHA 3WB1A 3ZK8A 4DPMA 1WG8A 2PSSA 5GMOA 5AKKA 1SU7A 3KNZA 1TQ2A 2VF4X 2DBZA 1SGWA 2B0JA 3AQIA 4KKXB 4ZV9A 5C31A 2DB3A 1DARA 1E92A 1TM4E 2Q9CA 3PNQA 3RTEA 3GT0A 3L8FA 3LLVA 4ILKA 3ESCA 1ZR2A 5T3UA 4FNAA 3EDCA 1R37A 3SXPA 2C1EA 3HXQA 2O8BB 2NTEA 5JAOA 1X8LA 2PLRA 2XH8A 1J1UA 4EJSA 2H16A 2PVPA 4A6PA 3I0NA 4CKCB 5JAHA 3PGJA 3W5DA 1IDN1 1XAIA 1Z7EA 1TFRA 2NLOA 4K8RB 5FUWA 1FFYA 4FFVA 3SJ7A 4E12A 2XVYA 1XMSA 3G9UA 4HH1A 1UZAA 1XZFA 3ZE8A 3ZVMA 2AZTA 1NVVQ 4HN9A 1ZEMA 4QQKA 5JTTA 1X1TA 1K8ZB 1GTRA 2V4ZA 1WXEA 1T0PA 1WHTA 1XXHA 3GGPA 2VUUA 3L7NA 4UBIA 4B6OA 3IL2A 3NC0C 3PPWA 1C7JA 1FLVA 2CCGA 1DV1A 2X6TA 1YRAA 3H5WA 4UUBA 3HEMA 4FX2A 4A0QA 2CUTA 2IITA 3KFVA 4OHKA 2F00A 1U1GA 4F84A 3AEYA 1SK9A 3RIXA 3P8ZA 1S89A 5IVPA 1GKUB 2OR3A 3KJEA 3QOXA 2C9DA 1PV4A 2JI4A 3QVWA 4ZGBA 3WWCA 1J56A 5AM2A 4C2BA 4RTKA 4FJ2A 3IURA 3K9FC 3TN7A 1AK1A 1DINA 3D81A 2ZSEA 4BZPA 3EQ7A 2X9NA 1BEEA 3C3KA 4JLUA 1Y4AE 1K8QA 4RGYA 4Z9YA 3BWMA 1G3MA 2W6PA 3JD2A 1ZGAA 2AOUA 4KQCA 4OXQA 3BSWA 4DXHA 2ZBPA 4FFDA 4F8YA 2YN0A 3PDIB 3W3ZB 3QVXA 4GAEA 4J7XA 3KUUA 2VK4A 1SCUB 3OUUA 5IWAB 2W6QA 3D0RA 4Y6OA 1I4OA 4RPKA 1CY6A 4LNHA 2XPCA 3MCAA 3SIPA 4ZYTA 4OAQA 1QE0A 2ZSKA 5JE8A 4DDKA 2H07A 4W6ZA 2WIDA 3CZCA 2NU7A 3WA7A 3LBHA 4KAFA 5ALMA 3Q10A 5CT6A 2O5RA 3TLBA 4TWAA 1B16A 4BAGA 1KO8A 2V03A 4HH3C 4JI3B 3EJ6A 1D2AA 3L7OA 4Z8XA 4J16C 1DBQA 1QO7A 4G5FA 2RHBA 1BWRA 1L6IA 2AFHB 2CLDX 4KGVA 5LNK6 2ACEA 1AV6A 3AGPA 1UP6A 5EWMA 2A9QA 1OX4A 1MFZA 3FCAA 3WL6A 1N2SA 2W43A 2NYRA 3AUJB 3DFMA 1Q7EA 4FKZA 4JSYA 4RADA 4Z9XA 2F9LA 4PWYA 4Z0HO 3AB3A 1T5OA 1MAVA 1U9ZA 3DMTC 3RVJA 4LFBB 3PQ3A 3ECCA 1Q84A 4AVYA 5A0TA 1NT2A 4PSAA 1S7CA 3EFEA 3W9BA 1CEEA 2YS6A 1XNRB 1EDDA 3IP5A 3UW3A 2XE6A 1TLFA 2CCKA 4G36A 2VWQA 2XMDA 4FLEA 1GHTA 2NU8A 4CEJA 3FWPA 5U1PA 2E4WA 2JIMA 2QRMA 2ZANA 3A6LA 3EZ9A 3L6RA 4W1RA 5CX1A 4B7XA 4X85A 3IV7A 1ORTA 2J6BA 1RRCA 4LBWA 3LGAA 4YP0A 3ONFA 4A8TA 4CTKA 8GPBA 3MTIA 1PJZA 1W0KD 4R2LA 5GVSA 3C87A 1E60A 3Q41A 2Z58A 2AUMA 1RXYA 3F8WA 4G0YA 1YR6A 2C2YA 2WHPB 1DOAA 4TRRA 1NWCA 2ZT7A 5F52A 3ZCTA 1SQ6A 4I4TB 4AIRA 1R9GA 4NXMB 5T4HA 4HMOA 2BYTA 2XTNA 4X7PA 1PX0A 3Q12A 4RSGA 1JG1A 1ULZA 2W48A 4OPMA 2JCBA 1EGVB 2GEBA 1WDMA 3VR3A 2WF9A 2GAFA 2ZIZA 1SHTX 2QRKA 1Z2AA 1OC4A 1BN6A 3Q7IA 5IAKA 1MAUA 3T5MA 3LCVB 1MPXA 1ZMTA 3NH9A 5FWNA 4KR7A 2HU7A 1ZY2A 4PQYA 5F77A 3FH0A 3STWA 2CB9A 2EJUA 3EXHC 3F6CA 4YUAA 2QX4A 2DR0A 2CDCA 1CUVA 3GIWA 4K6CA 4R1TA 4MWOA 5CYFA 5FV4A 1IXKA 1KI1A 3BD7A 3DUFA 2M2IA 1NQXA 4MR8B 1F3LA 4Y2YA 4YMWA 4UNQA 1AURA 1IEQA 2HJWA 3U3JA 3PUXA 2PVSA 4M83A 4KV9A 1TI7A 2J4FA 2XNDA 3DG9A 3V4OA 4BNJA 5K9ZA 2XKKA 3RJ5A 1C4XA 5IX8A 3GNQA 4K5QA 1JIXA 4P5EA 5C5IA 3CH4B 2OGSA 1JMKC 4NG5A 4TL8A 1O97C 2CD9A 4YT8A 3NZEA 1MH9A 4PV7A 1UPAA 2VDMB 4IGAA 4CFYA 1LRJA 3TTWA 1R0SA 2ASVA 3GEMA 2JAOA 3NDIA 4INJA 3WWOA 1G20A 2WMDA 2H4FA 2QP4A 1GL6A 4IILA 4YFYA 2J0SA 5C8YA 1L2TA 4K2HA 1SULA 2VTEA 3AOEC 2GZ3A 3PC8A 2QT1A 3QKIA 3R9KA 1AZTA 1ZH4A 3C3MA 3T5DA 1JHUA 1RPAA 4DG9A 3OY7A 3LY7A 3LDAA 1QHHB 1TYDE 3PLNA 2QGZA 2R1ZA 2VNAA 1TJYA 3Q2OA 1E2HA 2E89A 2ZRKA 3B51X 2QT0A 2R7LA 3P9NA 3G59A 4MV0A 4UMFA 3UA4A 3WHKA 3TSCA 1FCJA 3SYTA 3A9VA 3IMCA 3RD5A 4AG5A 1D7OA 1ENPA 1FSSA 4U0KA 2HDOA 1VL2A 3HG7A 1LLCA 2VJQA 4L4SA 4U9HS 4F9EA 4RDXA 3A6KA 2NX2A 3VO8A 1I36A 4AO8A 3QU4A 3M6AA 1F8XA 4WBNB 3MK31 2QNIA 4GPTA 4QBKA 3NMUF 5BPFA 3M5DA 1HFWA 1N0UA 1G7SA 1RLTA 2GN8A 4J1NA 5DNDA 3VHXA 2DTDA 1R8QA 2FRXA 2X9VA 4BOYA 3NOOA 2YRXA 3O2NA 4C7JA 3A1VA 2N9UA 3B9BA 3P9SA 3P9RA 4NV3A 3RW9A 5C8VA 1OJLA 1VPDA 4BV2A 1PG5A 1RS0A 1TM2A 1QR6A 4J7CA 2QS9A 1IVNA 2XNKA 2O3TA 5K1ZA 1CY8A 4YHBA 4IDFA 3E5NA 2TYSB 3UJ9A 5C32A 1VMDA 3D8UA 4D25A 4NQZA 4HV4A 4BLWA 1VL0A 3OE5A 4EO9A 2HH9A 3L7DA 3PA6A 3LSYA 1SUDA 1UADA 1GKYA 3THOA 1Z29A 4G1FA 4Y9RA 4NE7A 4PZUA 4KPUB 2ZTSA 3CGGA 4TQAA 1ZNYA 3BFJA 3OEWA 3I12A 4H1HA 2OYRA 1PJ3A 2WV7A 1ZK3A 3FZGA 4KNWA 1U9IC 2I67A 3TR0A 4CTJA 2ZJYA 1Z16A 1QPGA 2G9VA 4URUR 1AGPA 2X0NA 5TJHA 3NKFA 4YWJA 4Y1RA 2WIAA 3CRNA 2VHEA 3DR3A 3AHJA 4KEAA 5E1BA 1UBRS 3JZDA 1U0TA 4L4YA 3RGGA 3PYXA 3RYIA 4RTPA 2HXGA 4MHSA 1GPMA 1UKZA 2XMSA 1KO7A 5NLLA 7ABPA 4NHEA 2FWAA 5ESWA 3NVMB 1JKFA 4EPXA 4O4HA 3THWA 1E4EA 3PLRA 4ZZ3A 4X60A 1Z74A 3AB8A 3MUFA 5ILOA 4R5HA 3BD8A 1MX9A 2WB4A 1B6TA 2VYNA 1KYQA 1SHKA 1U1DA 3O8BA 3E5HA 1KH2A 1M1YB 2C3MA 1RSZA 5E4JA 2GCOB 5B1HA 1SPBS 2A6PA 5CH5A 2QPAA 2H2HA 2I7CA 3AEUA 3NJRA 3R7DA 4C4AA 5I7EA 3V4LA 2ODEA 3BULA 4DCNA 4TTPA 3DE1X 3MMZA 1VMKA 4MR9A 1NASA 3DL2A 5EMNA 3UO8B 4G0ZA 3V8VA 1I7DA 1JEDA 3C4VA 3KJZA 5KNBD 4M9RA 1FS4A 5ITZA 3FVTA 5D3MA 2P3QA 3CKLA 2PA0A 5AJYA 5G0SA 5DIZA 2HV9A 2F55A 4ALNA 3GUUA 2H4WA 4H4CA 4A73A 4MVYA 4DPKA 5ITVA 3HR4A 1EP9A 1EWTA 1WKBA 4Q48A 1U7DA 4I1VA 1NW6A 3P2IA 4GO1A 2X2EA 2WWHA 5IK2A 5I7WA 4OFXA 3WA6A 2H18A 2YFKA 1Q5PA 1WU8A 1BFKA 2YJZA 2PRSA 3ADPA 4MYTA 4CF7A 1L1FA 3U60B 1U5BB 2O20A 5FBRB 2C9BA 5AOVA 4TXJA 3UV6A 5I4IA 5AI4A 5DK4A 5HIJA 2HW8A 1AHHA 1GFZA 5BRAA 1RIFA 3MLAA 3R8FA 4J75A 4L9WA 3RUCA 4NCNA 2EJWA 5A6SA 4QLBA 4G1MB 4HMQA 4HWGA 4RGVA 1HDIA 2CZGA 1CUYA 4F9FA 5JQGA 3ORYA 2JIQA 1HE4A 4KO3S 4FSHA 1MV8A 1QG6A 1Y0BA 3JCZA 4RK1A 3R2JA 5IRCD 5BWNA 4GD3Q 2DHRA 1W9HA 4HDKB 4PTYA 1N6OA 2OGZA 1GUDA 3L79A 2IXGA 2PQ0A 4M1SA 3T1VA 3V4SA 3WAKA 1YTUA 5KNDH 3EAFA 2OTCA 1ZSVA 1XWWA 2PYDA 3P7MA 1LZLA 1QV9A 4P08A 4F7WA 2ZT5A 3C3XA 2QORA 3NB0A 1M83A 3TMYA 4NYJQ 2VQ3A 3D5EA 3DWIA 1T26A 2YXEA 3HP7A 3U49A 1VLQA 3ND8A 1QZXA 5JDIC 1XIVA 1DX4A 3QEMA 3WL5A 4YT2A 1M0EA 4Z1OA 3IMEA 4XEUA 5AHKA 1I33A 3QLVC 1WHSA 4EB6A 5TVGA 4J1TC 2H2AA 4UM9B 2FMTA 3BHNA 3JYNA 1FJ2A 4AXBA 1FB5A 3V7UA 4N5NA 3UKJA 2QN2A 3I2JA 3LO8A 2P1RA 2C5FA 3L0SA 2XI4A 2H4XA 2ZITA 4PLTA 3TZ6A 5C8YF 2B7LA 5CB8A 2O1EA 2XXAA 1RZRD 2J45A 4UEOA 5D51S 3T3DA 4P0PB 3I2HA 1LTKA 3N0XA 3Q98A 3FF1A 1FDTA 3WWPA 3AWIA 1C5KA 4MRVA 1FS5A 4BXOB 4RF5A 2A9PA 5I9SA 4OB8A 4QODA 1ONBA 4GOLD 5EE1A 1KYWA 4D46A 1EP1B 1EX7A 1CCWA 2WDPA 3GHYA 5K7SA 3Q7EA 3I5XA 1LPNA 1QLJA 2QJOA 2O9JA 1HDYA 2ZSJA 3ICOA 2FN9A 4M9CA 4PZCA 3VU3A 2ZUWA 1GFWA 2GEVA 3GH3A 2HWYA 5DP2A 2Q46A 3RT1A 1YQTA 2ZDQA 1FFHA 3AVVA 3M33A 3EH2A 1UZMA 3RK0A 3RV3A 5BURA 4CF6A 1UC5B 3HB5X 2G40A 1GADO 1KU0A 3JQDA 1K08A 4JXKA 1J0AA 1XU4A 4WI1A 2JLYA 1ZPDA 2PMFA 1IOVA 1THTA 2HSZA 2WKPA 3DVAA 2ZTLA 4X1OA 5E7IA 4BN5A 1JIQA 2YOHA 2Z2JA 1UMBB 3U3MA 1W34A 1Y4ZA 5JVDA 2DTEA 2JH9A 2XB4A 5E3HA 4MVJF 1PD1A 2EW8A 1SU8A 4K9NA 4LRUA 1G8SA 4UNPA 1VBMA 3AM5A 2FUNB 3I04A 4K9QA 4ND8B 2CYAA 2IKSA 4HPWA 4DB2A 2AC4A 3UG7A 5KYUA 2OSBA 3SQNA 2R6DA 2I7DA 1JR3E 3GVXA 4AM8A 1GU1A 1PAUA 2PWAA 2RI1A 2YY7A 3GA7A 2R8EA 1AUXA 3BJZA 1Z6PA 3SYLA 1YU6A 4I5EA 1CF2O 3G2QA 3HP4A 3NJ8A 4RANA 1G18A 3GLFB 1MOPA 3C45A 4TVSA 3ESYA 1PT9A 5KIAA 2X23A 1N1MA 3TCNA 2D7CA 1CUBA 4MLZA 3NDJA 3GLGB 3F74A 1EVLA 2HK7A 2BFPA 3U7QB 1Y3IA 3AF2A 2BI4A 3W2IA 4CDMA 3DSRA 5D3QA 5KSYA 1LF5A 1IJBA 2GM5A 2K7ZA 2GPBA 3S2ZA 1P5FA 2C5LA 2EHDA 3ZWMA 1OXTA 1YXMA 2V0CA 2DFLA 2O2JA 4JI1B 5KU1A 1YK1A 2QE6A 2QVZX 1UQTA 2XMGA 3EGVA 1Z34A 3S2SA 5EZ6B 3H2IA 2PH7A 3ZY2A 3TNLA 4TV9A 4WBSA 1N9GA 1X0XA 3FWHA 3ZE1B 1VI6A 2JA2A 1ZD8A 3ZV7A 5B64A 1V5WA 3FDZB 4U5QA 1DIHA 3UMBA 4DIEA 3KAQA 5JI2E 5LYJF 3F6PA 5K2MA 2F1IA 1BIFA 3H4IA 2RGXA 3K2QA 3F5QA 4MV8A 2YNMD 4DDHA 3VSEA 2O2HA 3TXXA 3V4ZA 3W8EA 1GDDA 2Q3LA 1XRSB 4FBLA 1CNEA 2HT6A 2V7QA 1IU9A 3A7DA 3DCNA 1UPFA 4OJMX 2VQSA 3RVKA 4FS8A 4JLNA 3WFJA 5AVUA 5JZMA 2C42A 4RIEA 3IIMA 1V39A 3ODGA 5FQNA 5DNUA 1NT4A 4TTSA 3W8FA 4CLHA 2WU0A 3PC3A 1VYVA 3B78A 3FYDA 4FC7A 3CR7A 1YJAA 3RQIA 4U7JA 4XQ9A 2FPXA 1JAZA 1CLUA 4LRXA 3QW2A 1IIRA 1N5LA 3FRJA 4BB6A 1ZJWA 3TB4A 5A4FS 5FLXA 5EOVA 2FSSA 4B3TB 1CUCA 3U9LA 1KHHA 1FDRA 1TO6A 2OMEA 3EEQA 1LNQA 1Z5GA 4G89A 3VMFA 1ECJA 3B20A 3BK7A 3HLYA 4QEZA 2OG1A 3A11A 3MILA 4OAPA 5EJFA 5FYQA 1VJTA 1O5OA 1NE7A 1UBKS 2WJGA 4N41A 4TLLB 4K9KA 3MTGA 1IHPA 4RZIA 1DDOA 1X42A 4I50A 1NF3A 1V1RA 2WJPA 1YL7A 2OENG 3HYCA 3L02A 3ZE0B 2ZB3A 2M1XA 4XH9B 4OI4A 4EMBA 3UJDA 3A6PC 2D0DA 4CLRA 3HBJA 4BZXA 1DX6A 3PE3A 1DU4A 1T9BA 2X15A 2Z2YA 4BO1A 2YWDA 3FTNA 4J94A 1ZD3A 4QTTB 1Z7YA 3WGOA 2WYWA 4XYEA 2AN4A 5P8WA 5IDWA 5EZSA 1FYWA 1UZUA 3ZHRA 2I3GA 1PFGA 3I6YA 3T5GA 3G0GA 5F2EA 1ZJZA 4C7MA 1UT8A 2P9TA 3IE1A 1N8SA 1GR1A 1D0IA 1QLWA 4POAA 4MKHA 1YVPA 1H9AA 1Y3FE 3HMQA 4NONA 5AKJA 5AW5A 4KRFA 4XIJA 2JGKA 3WGZA 1FSZA 2FGJA 3RVSA 1IN8A 4AX8A 4RHXA 2YMMA 5HJ7A 2GF9A 1DAHA 4US0R 1W2WB 3L84A 3TIGA 4D9MA 3R7LA 3TLGB 1ML3A 2FZ5A 4LZAA 5AM1A 1U9CA 3H8VA 1D6NA 4B6RA 1QVAA 4OK6A 5JJ5A 4RDCA 3FUWA 2ZYGA 2IPNA 4WNYA 4OI1A 2VWPA 5B2EA 1ADGA 1JSCA 3B3AA 5D3KA 4DNFA 5KOIA 4D9FA 1DP4A 1YA6A 3DDUA 1OBCA 3TG2A 2B36A 5JECA 3OH8A 1L5KA 2C2WA 3CZRA 1JYFA 2ZWPA 1GQ2A 2BCEA 4MA5A 5D8DA 4KQ1A 4FYMA 4X6LA 3GP8A 2R85A 4RPCA 4FR5A 4D7AA 1RPZA 3W78A 2UZ3A 4EYQA 3CLRC 3AU8A 3MB8A 5ALZA 3VO2A 4CUKA 4EHBA 1GZUA 3MD0A 2J0UA 5LZ7A 1JHOA 2HJ9A 3PVSA 4GP7A 5ALRA 4AUNA 1M2WA 3D2CA 1J90A 3MELA 3G7SA 2C77A 1YBMA 2EX4A 4F4UA 4ROTA 3T5BA 4D9BA 1KI7A 1POWA 4YJ2F 1JQ3A 2QLMA 5DT9A 4LDZA 3P9XA 4JL6A 4OYRA 1IRXA 3THRA 3DZJA 4F5DA 1SVOA 4H6PA 1I6WA 1U7HA 2CCJA 4JCCA 4RZHA 4A6EA 4BNXA 1KZGB 1B14A 5E9AA 3L4JA 3EWSA 2D00A 1CR1A 3Q4GA 2OOSA 2WDZA 3VR3D 4UOEA 1G66A 1CW2B 1XK6A 5B2ZA 3UWKA 4IP0A 2NZWA 1JPVA 2YC4C 1ZAKA 1RQ7A 1USIA 1W5BA 1X77A 3GARA 3OCUA 3PR3A 1FTNA 5CCXA 2PY6A 2RKOA 1RYFA 2XCOA 3U7GA 2F7SA 2B5OA 1P7VA 4WTOA 3Q9UA 4A36A 4X61A 4LNUA 2NZYA 1AM4D 1YZKA 1X7WB 3FGOA 5JMWA 4Q9DA 2C83A 4GXNA 1T2AA 3G7UA 3HSSA 3KB8A 5T4FA 3T12A 2DF8A 1JJ7A 2Z04A 3D6FA 1IL0A 5C0OE 3AEKB 1QANA 2O14A 4B3DA 1Z35A 1NYLA 2V0NA 3NV9A 4KXMA 4Y2GA 4BMDA 1V2HE 3KOWA 4H0NA 3WLOA 3CVOA 5DTRA 2C3UA 2FWJA 4Q01A 4WVFA 3D2LA 3RRYA 5JWHA 4TV9F 2YV4A 1KJIA 5C35A 1P81A 3G2JA 3KHKA 3KL4A 4FQ8A 4L28A 4UM5A 3I45A 3G8DA 3IOCA 1PE0A 2E87A 2PS9A 2XTMA 2ZE5A 2PTHA 3A2NA 5BT8A 4ARCA 3WGLA 2X76A 1DAFA 2HD4A 2PZLA 3DO5A 1IUPA 1ZD1A 1YCDA 5B1IA 2R751 2G08A 2Z95A 2FX3A 4B3JA 2DXIA 1AD2A 3OQHA 4AJ4A 3BXFA 2I1WA 2HJVA 2NUPB 1JEQA 1XGKA 4HTFA 5I48A 4IH4A 3AIMA 1CDDA 5LZ5A 2OZLA 1G55A 3A1UA 1CE8A 3MJEA 4KR0A 4WADA 4ADSG 4YAUA 1IQRA 1E8NA 1HDRA 5J2TB 3HCDA 4DVGA 2WT8A 4LYYA 4MVXA 4BLUA 4P4SB 5M04A 3TGLA 4QNRA 1SCKA 1C1XB 3FLMA 1U99A 2XWSA 2YWGA 1U7UA 3DEAA 3QA9A 4RVCA 1GL7A 5DEOA 1GOTA 1YJ8A 3SF0A 1JHRA 4RJTA 3ZHZA 3F9CA 3VPBA 1SEVA 1XP8A 4WD3A 3UMGA 3GNTA 1I5EA 1SIOA 2C5SA 1YA8A 4WXHA 1LBSA 4XGQA 2KYRA 4UKDA 1ZNXA 4GZ5A 3VKVA 1HMYA 4CEIA 1IN7A 1PR4A 5E6UA 2YJTD 4EEXA 5T41A 1O95A 1TW3A 3B2QA 1RHMA 4G0MA 4CYMA 5AUQA 2VXYA 3FR8A 8AT1A 2OO7A 1QS0A 2VRBA 1RZ3A 3D6VA 3UJ3X 5D86A 1G7CA 1SFRA 4EELA 5KTKA 4DDMA 3L0OA 5CLHA 4H2DA 1S01A 1W94A 1A5AB 2QG4A 3DMTA 3LRTA 4BE9A 4BVAA 1K3TA 4EZBA 2XYQA 4YCMA 5F2NA 5IZ4A 4LX0A 121PA 1IJFA 2CFTA 4O1HA 2GNAA 1YIOA 1VHJA 1T1SA 2JKVA 2QTMA 2OT3B 3LCUA 4LHXA 3V34A 2ZCJA 4GI5A 5KKAA 1Y89A 4AJIA 3VC2A 2HZ7A 1YFJA 1W4RA 4NZNA 2AUNA 4MKIA 2JHGA 1M54A 1W4AA 4FZ3A 4MPPA 2JDID 4ZU3A 3T1HB 1J39A 2P0YA 3ZTWA 4RXUA 5A03A 5B6PA 3QF4A 1PNOA 1VYTA 2CC2A 4TKLA 3KOXA 2BLLA 4Q1BA 4RNDB 1ZISA 1Z2OX 3SF8A 4BC1A 4HKTA 1QYXA 4G2TA 3V7WA 4EUEA 2JS7A 3FA2A 4JGIA 4CM9A 2Y2UA 5AJHA 4IZOA 3ZZMA 1IUKA 4KIWA 2C7PA 1WSBA 1ZMBA 3EXIB 3H8WA 4O2BB 1WOMA 4YROA 1KZHA 3VC3A 2VYND 5IABA 2OESA 3BXGA 5CT8A 3HGQA 2ZRPA 3IESA 3K09A 3KDSE 3M3HA 4Q24A 2OAQ1 4Y98A 2BEJA 1VXRA 4Y6GB 3CTMA 4BKQA 5KTTA 2PBLA 1DKRA 2GYWA 3U31A 1R6UA 1NN0A 3V6LA 2QRVA 1N2IA 3IO5A 5BV0A 2HGZA 4DT1A 4F3RA 4MRMA 1NW3A 2FWNA 1OIXA 1SUPA 4DYVA 2D59A 2GCGA 1ICIA 2A5FA 3RIYA 2AZDA 2R6FA 1TXGA 5E0KB 4B85A 2XDWA 4OL9A 4LRYA 5JD6A 1Y48E 1LX7A 2V5VA 1G63A 1E3MA 3L6EA 2QL9A 1D07A 3V55A 4M87A 4P36A 4QO7A 3EZ7A 3RUPA 2WJWA 4ZQEA 1IDOA 2XCTB 4DGQA 3DEIA 2A0KA 1J07A 1QAOA 1LI5A 2PL5A 1QHSA 3L6BA 3W3AH 1J2UA 1L5FA 3K5HA 4FPXA 3AOEA 3HFGA 3EFOA 4LSMA 1LPSA 1NVXQ 2PEYA 2XVMA 3LSTA 4BMZA 3I32A 2XNJA 2ZCVA 4DMRA 1YR3A 2JGRA 2GPYA 3NKLA 3ZZTA 1U8ZA 5BRJA 2DJ5A 1R0KA 1EBUA 1YZYA 5TARA 2BM1A 5M34A 3VR6A 4HAIA 4QYIA 3ZKAA 4AKGA 4G81A 4YB8A 2P5SA 3Q6NA 1E32A 4HD8A 4RD2A 3I34X 1CK4A 1G1AA 5GQSA 4F6RB 4ZEWA 2EARA 3H8SA 4BMCA 5LXTB 5DTQA 2Q6KA 3VBEA 4YXWA 3J81k 4JJGA 3R7AA 2WKWA 3PVZA 1UP4A 5CU7A 2A30A 2E4XA 4ID9A 4BNWA 1B74A 2EBWA 3A3NA 3ONVA 1DWPA 3P2OA 4BX3A 1GPKA 2XEDA 1YD7A 2YWEA 1XEFA 2HNAA 2J4DA 3GG2A 4X8LA 2JASA 4X94A 2HFKA 1KGDA 2GXUA 1CRZA 3NEYA 3IR5A 4U00A 4F86A 1YZ3A 1QUFA 4TYNA 3FUVA 3ICCA 1PNRA 3AUSA 2EXXA 1G64A 3LPCA 3QELA 4LK2A 3AY6A 3CSDA 4MEBA 3AYZB 2MSKA 1VKOA 3MCUA 4RZSA 3PUJA 4X1YA 4YDRA 1TAHA 3LKZA 4QXOA 4FHZA 3AERB 1U6KA 3JQ9C 3ZBPA 3ASUA 4DQUA 1ODSA 5IKEA 4ZXFA 4DLRA 4DLSA 4OQ4A 1GA4A 2GFQA 2Q50A 2PZFA 1FRFS 2QR2A 4OHRA 5ALFA 1PGJA 3NIWA 5TQ0B 1EJ2A 4WNIA 3V42A 5FKJA 2JHCA 3ZCXA 1ULHA 3IBTA 1U9IA 1ZIPA 3IEKA 2M9MA 3NDRA 2C3OA 4GHWA 4M9QA 5EP1A 4XWWA 3GDOA 2I2DA 2QN6A 5H3CA 4TKZA 5HF8A 3K71B 2ZM5A 3SI7A 3WBBA 5EE5B 3ET4A 3HDGA 2FUCA 1GA6A 3WLNA 3ZCSA 1P7YA 2BHRA 2GEJA 4UHKA 2P5YA 1XALA 2F9MA 3O95A 3IB3A 4E1VA 3KT0A 3PNYA 5LNK1 1MPTA 1INLA 2FXVA 3DOUA 4KZKA 1M0TA 1AA6A 3UWDA 4CU2A 3ZJTA 4DCOA 2YY6A 4LCEA 1D4ZA 3I9V1 4F6CA 1V8DA 4ALIA 1Z75A 4D9KA 3DWEX 3H3FA 1K86A 5CJPA 4KXLA 2AT1A 4NLLA 3OIYA 1O54A 4ISBA 1ZICA 4EG3A 2BFEA 1I0ZA 2H5IA 1BX3A 3M4JA 3MOSA 2IBMA 3PD7A 4JMPA 1PZGA 1V16B 3GLRA 1N0HA 1E77A 4CG2A 4EPVA 5KB3A 2RB4A 2IOQA 2QM8A 4KLNA 3W1WA 1QVZA 3ZLTA 1HSOA 3KOYA 5FFNA 4CQMB 4I81A 1PF7E 3ZPXA 4X41A 2Y8EA 2AZMA 4R98A 1XTUA 2UDPA 3OX2A 4EHDA 3WIOA 3JQAB 2YWJA 4RENA 4XWAA 3ZU4A 4MDEA 2CHVA 2Q1WA 4RORA 5T6MA 3GFRA 5AK6A 4Z2YA 4XR9A 3JARB 2QTNA 3HKDB 4MVWA 4MB6A 2BONA 4FWIB 5K0LA 4DDUA 2QN8A 1IH8A 2XF8A 3WRXA 2X1HA 1SELA 1IK6A 4H77A 4PHGA 1GQSA 4RJJA 5HZGA 1I1OA 1OI3A 1KS9A 5C1IA 1ZM7A 1TRKA 2G0NA 3FTPA 4W7IA 1CZHA 4XARA 3AK4A 1B26A 5IAEA 3FSEA 3QUTA 4BVJA 1TTTA 1SA0B 3SFZA 3KLPX 5EIOA 5LZ8A 3ZWQA 4ZHQA 5AW8A 1MORA 1X1CA 2AJDA 3BMNB 5LR6A 2G4CA 1J8DA 1GFIA 1S96A 2NUAB 2X0KA 3ZJYA 5JMPA 1GTJ1 1E66A 1EWKA 3QU9A 3B60A 3OPYA 1CRLA 1XK7A 5K0JA 1N5IA 2DY0A 5FWXB 3E9CA 1OB5A 3OZDA 2GI4A 1P1IA 3C5HA 2JAWA 4IO0A 4RMJA 1P39A 1KRHA 4OXNA 3IAUA 2QQGA 4FFNA 2VDWB 1VYUA 2P77A 2VAMA 4TS4A 1JSXA 1T4CB 2BFAA 3VSDA 4DR2B 2V7QD 1O6GA 2WINI 1YOVA 4ER5A 1W73A 5LKAA 3EOZA 3U13A 5BORA 3E3MA 4NENB 3FKSD 3AF0A 3M1LA 4WJZA 4PG7A 2FN8A 5BSFA 4IAOA 5AW6A 3FTEA 1EK5A 4UFPA 3D5TA 1IZYA 1MT3A 3BCSA 4PZ9A 5BSHA 4IQ0A 1SUWA 1XDDA 2EL7A 2HWKA 2R8BA 5EKXA 3RRBA 4YRAA 4YRGA 1ES9A 1NQTA 1U3UA 2ZXEA 2QTCA 4GZ6A 1RHKA 2DHQA 2W2KB 4I1PA 1J70A 2A0FA 2FSHA 2YIVX 5ALHA 3WLSA 4OQXA 4XIGS 1GZVA 1SAYA 3H5IA 4PAGA 4L8FA 2OCYC 4AJ1A 2G8LA 4M21A 2Y6VA 1DXQA 1CQIB 3KLBA 5CW2A 1LH0A 5F12A 4E30A 3BMXA 2JFFA 4ISCA 5BYBA 2IDJA 3OPNA 1B00A 1I3LA 1TC2A 3AFOA 3BFVA 4HGRA 3UMFA 4CMIB 4CF4A 1ESNA 1NZJA 2DUUA 1BHQ1 3A32A 3I0ZA 3ROXA 1FNMA 1EZ1A 5LDGA 2C04A 2DBYA 2J9GA 4O63O 5IH3A 5K3AA 5LL6P 5G4KA 5ICFA 2FKAA 3UGKA 1U7XA 4W63A 2GPWA 2MYTA 2PXAA 3LHIA 5DXAA 4DAEA 4Y3UA 1BCRA 4CTMA 5HKAA 4E32A 1Q1BA 1DI0A 3IIEA 1QO0A 1P1KA 1TLLA 2DPGA 3MYYA 3JVDA 3EPJA 2XBLA 2CHGA 1A2QA 3OESA 4JWKA 1GL3A 1P1CA 1U7OA 4RL4A 4H7PA 1IM8A 4LXIA 3DT9A 4EJMA 5JCOC 1T4MA 1GN9A 3MWFA 4EAQA 3LPDA 3OEHA 4C2TA 1FDUA 4PIPA 4GW3A 1JLSA 3JXEA 1PDWA 3D5QA 3K05A 5K3BA 4GLJA 4K8OA 3KM0A 4CGZA 1EK0A 1SQGA 3BBPA 3JZAA 2OFFA 2FOLA 5I7UA 4KWCA 1N5MA 1N6KA 3KQVA 4UPDA 3SICE 4G5GA 3C7TA 4JI6B 4NBTA 2J08A 1JA0A 2E3JA 4O0MA 4D6PA 3KUXA 5JSFA 3RYTC 3FXAA 4F4DA 4GDMA 2Y1GA 1P1FA 4QBFA 1XMIA 1RADA 4ARAA 2QMYA 5CYOA 1GCAA 4OH7A 4PC1A 4Y6SA 3IUNA 2O0HA 3LUJA 3ZTTA 1EVIA 1T9DA 4NZZA 4B80A 5JSHA 2OV2A 3O8NA 4MV6A 1EFCA 5D7BA 5B53A 4D8YA 4R7GA 2QBYB 1O87A 2G1AA 3A9UA 1Y98A 1YE3A 1XTSA 3B36A 4I1UA 4JQZA 3CCBA 5EP2A 4NZOA 2VJPA 2XKBA 3AIOA 3CCFA 4WK2B 4LFAB 5KCZA 2PJZA 1S02A 2IGBA 3BGIA 1CR0A 2HNKA 3DO8A 3GLQA 4KYVA 4UUMA 3VBCA 3M81A 3IKTA 1RR6A 3KQLA 4DTIA 1K5HA 4RXMA 3ZLJA 3LGSA 1THMA 4I3FA 2AMJA 2IK8A 1ACLA 1CTQA 3DT6A 3ENKA 3A6GA 4XR4A 4IDAA 1QC5A 3A4VA 4NU0A 5A4KA 1W0CA 1OLXA 1SRRA 4HAOA 3QH4A 3PICA 3CUEF 2XMZA 1YWGO 1JR3A 1YB2A 3OD1A 3OFSA 4UU1A 5IM5A 1LJUA 3FZNA 5KSPA 3VOAA 3K9WA 2VTBA 1GWNA 3LP5A 5FAKA 2GZSA 4R16A 4BJ1A 3GH1A 5DO9A 4JX8A 1KEEA 3TR5A 4NBNA 4NDZA 4G23A 3ZK7A 2COEA 2QTZA 2J9RA 2ZRDA 5LWQA 3NNSA 1FF9A 2EDCA 4ER7A 1WEHA 4K03A 4IOJA 4BRUA 4UBLA 1VJDA 2P1ZA 3CLUC 3IAHA 3OO0A 4ZKEA 3ZS8A 4BFYA 1T9GR 4HNAA 5E1DA 4US2R 1TGVA 3G9TA 1ZVMA 1FBTA 1RFLA 2C4MA 3QI7A 3K0CC 4IOKA 5FUYA 5JRZA 2F3PA 3R3YA 1CQZA 1AHIA 1QH0A 1JHDA 1JLKA 4OLJA 3WL3A 1CSEE 1KJJA 5C3UA 4GSLA 3TCXB 1EKXA 1WMEA 4E94A 3GXOA 1G5HA 3K9HA 4JR0A 1P0MA 3HYTA 5I9NA 1G291 2MSLA 3CRVA 1CF9A 4GXRA 3S8MA 2QLFA 1D5CA 2KX7A 3D6NB 5IAOA 1EBFA 1LCIA 4R1QA 2V7XA 5AKZA 4CBVA 4B44A 1BS9A 4M8LA 4I3HA 1A4XA 3HBNA 3F7OA 2FWBA 4CHTA 2RGAA 4OQMA 1RMYA 4O4LB 3H2YA 4INZA 4EF4A 1GVHA 4LJ9A 4H6WA 5H59A 5CFMA 3IEMA 4CM5A 5IJWA 1J0XO 3MGAA 4D8TA 1G41A 1U7WA 5IWCA 4W9RA 3CVVA 3PFIA 3MHTA 1OY1A 3MFYA 3WMWA 3QMPA 1YRWA 1NVTA 2CL0X 1ONOA 1SUSA 3FDXA 1HYEA 1XVTA 3SBXA 5CEJA 4QZVA 1IXSB 5BWLA 2G17A 2HBQA 2Y3IA 4E6PA 1OFIA 5JADA 2MHCA 5DTMA 3EW9A 3L0YA 3OBBA 3WK4A 1XJCA 2NVBA 4YV0A 5DZSA 5F7XA 4PZ0A 4KQ9A 1QUEA 4XPIA 5D1NA 3WBJA 2X40A 4IFTA 4RVNA 2UXCB 4YV1A 1HV8A 2VUIB 3BF7A 4HLUC 1N4DA 5KNBH 1FDVA 3HRIA 5C3MA 1EK6A 3JVUA 3W4KA 4U3JB 2OHVA 5AQEA 1VE6A 4H17A 3LRPA 3QXGA 3ETLA 2ZFUA 1NXVA 2ISQA 4INAA 5EJAA 1VDMA 4RCZA 3U7IA 5E7JA 2QGNA 4TUYF 1NOJA 3UHOA 2FFHA 4FFBA 2Q1TA 2G3YA 1KJZA 1AKYA 1FFEA 4B3XA 3FAKA 2PX4A 4RD3A 1LWOA 2ZI9A 1YR7A 3U3XA 3IIJA 1WUHS 1EFUA 1Y3AA 4FN5A 3RAGA 2C1XA 1NA5A 1OWNA 2Q2QA 3RC9A 3KWMA 1QKKA 2HHLA 1MMFB 1P0IA 2PQ2A 2WNSA 4JJ6A 4AYWA 1BMDA 4LCBA 3BMQA 1ARZA 4RHTA 5EI5A 1SIWA 3FUXA 4LOKA 3PC2A 4U8GA 1CDZA 4WESA 1QG2A 1Y5IA 5SV2A 3VI3B 4HUQB 3HSYA 4J3NA 3J80A 5IDVA 1E7RA 1N6NA 2ZUDA 3OZCA 4GSYA 1XKTA 2I5PO 3KSRA 4KU4A 4RUKA 4Q9IA 4L3WA 3TPZA 3OMWA 4RAOA 1GNQA 3RRJA 1GZ5A 5ALNA 1RWMA 4JYZA 3JQ7A 3WKAA 1QYIA 3UTDA 4Z4IA 2Z1MA 1YASA 1W1UA 2OGUA 1DCFA 2HSEA 3JATB 3WGGA 5KDLA 1Y6ZA 3BMOA 1I5RA 3M1AA 1CEXA 2HI0A 3JQ8A 3PUZA 3TZQA 4GVLA 4RJLA 4JY7A 1EDBA 3GGJA 4HQLA 1DQRA 5FF9A 5CA1B 3FMPB 3I9LA 2GZ1A 5EKSA 2IQ5A 3UGQA 1A8HA 1BDHA 1QYCA 3L7BA 3UK2A 3GAMA 4IXMA 4K0KB 3QLTA 2ZRHA 1JG3A 1HNZB 1FPQA 2KSQA 1P6QA 1BVHA 3LZDA 1Z3IX 3UWOA 1QKIA 3PGVA 2QJFA 4YR7A 3IUEA 3B1ZA 1E89A 2J85A 5JLAA 1Y8RA 5JXJA 3RJTA 2ZYDA 2HLHA 1DRVA 1RI2A 4EO7A 1OI2A 3CR8A 1KKUA 4QT0A 2E21A 3EXFA 2YOFA 3F6SA 2XXJA 2VK8A 3GEHA 2VCYA 3QFCA 4FYPA 2ECKA 2UV8A 1AX9A 3KOOA 1E1KA 1PJCA 1TF7A 1ZN8A 1EWQA 4AUEA 1VMAA 1NI4A 4EMSA 1KI9A 1T1JA 1Y4UA 1X9HA 1Z8HA 1XQ9A 2I6QA 2JKZA 3MWYW 4YUVA 1UC4B 3ESDA 2EATA 3HCFA 1TVKA 3TDMA 1AGXA 1JWAB 2FRVA 1NJFA 3EDMA 3Q87B 3WQHA 5MF6A 1XRMA 1B76A 5FLYA 5FI1B 1NZFA 2Q3BA 5IAAA 3NHJA 1CXZA 3HCBA 5IT0A 3WGUA 1XPOA 1BJTA 1WVGA 2AJBA 1XVLA 3BJIC 1TQ6A 1Y1KE 2Q6IA 1HNWB 2BMEA 1OFUA 3U5ZB 1LQUA 1XCJA 6CHYA 1D2RA 1V7QA 1O97D 4NS1A 2A7QA 3DYVA 3GQBB 3SQMA 5JNUA 1UBNA 2Q5CA 3AR5A 3FRIA 1WR8A 1Z4JA 1TK9A 5DULA 1PNVA 5B4TA 4P5PA 1N1GA 2DZDA 3NV7A 2V65A 1CQWA 1M34E 4UFOA 4BLRA 1PWXA 1XL0A 5C52B 1OLSB 1JNYA 5AK0A 3KB6A 1ECLA 3M34A 1RXSA 1J09A 1EE1A 4DJDC 3KTAB 4QGBA 4JSTA 3WLAA 4W6QA 2AHRA 1FFDA 3JAKB 4FEEA 4HGPA 3HCOA 4HSGA 2ZWAA 3C6BA 3NBZC 4JT4A 4M1ZA 3DE6X 4IBOA 3CZ9A 3VH2A 3ZZ0A 1T9KA 2C8VA 2B4KA 3K1AB 3ZNPA 3E03A 3ZW7A 4HC4A 4G63A 1MR3F 3UAYA 4YXWD 1ZJJA 4RYLA 5K4AA 4OOFA 1WXQA 2YY5A 5GONA 3GL9A 5BSUA 2KHZA 4M99A 1GGFA 2MYPA 4IGKA 3ZDZB 1V71A 1L7OA 1J0DA 1PGOA 1P4RA 1LC3A 2W6NA 3HGMA 3AUTA 3IBFA 1WVMA 2R47A 3EZNA 5EJ4A 2MSWA 4HNQA 4KH1A 4RJIA 4A8JC 1SZCA 2BH9A 1EB9A 3PQ5A 1OBFO 2A1UB 5F1YA 4HB4A 5TXGA 4AP6A 1RJ9B 1CUZA 1H5UA 3MWEB 1DIAA 2IDMA 1U2GC 3D8RA 3NOQA 4MINA 4KAXA 5EMKA 2C7BA 3RNLA 2HB6A 2MOKA 2OQIA 2W6OA 2PD4A 4EKEA 1NV9A 3CNHA 4UW9A 4X3CA 4Z9AA 1SC4A 1VB3A 2F62A 2EZ4A 1GZ6A 3LNTA 1LPPA 3ZZNA 1NJSA 4BMXA 2ZBEA 2A0WA 2YTZA 1V4VA 4H7EA 4RAQA 4XRGA 1HNXB 4RFSB 1TAGA 5JSUA 5LWHA 2AHOA 3IP9A 1RKVA 2JBAB 2XAAA 2F3SA 3E58A 3SVTA 3SC6A 1SUIA 1USWA 4IFIA 2O8EA 5CBKA 1B8OA 3IVAA 2VJAA 4OG2A 4F9GA 4ZO8A 3EGDB 4BWFB 1K6MA 1LX6A 4EEKA 7MHTA 4QQRA 3ESZA 1K3FA 1XELA 3DCJA 3L6DA 5SY9A 2XDQA 1K8RA 2P3LA 2C2KA 4EKGA 4H35A 5ALYA 1Q16A 2M98A 3OJLA 3EEOA 3FWYA 4BQFA 5A7FA 2FNAA 3VH4A 1EAYA 3LF2A 3P94A 4MQ6A 3KQTA 1NUQA 1H3NA 3H04A 3A58B 1BDIA 4MLPA 3REQA 1VMIA 5G53C 3GAFA 3RVPA 3PUHA 1NUHA 1G9SA 5ETJA 3UEOA 3QITA 3W7BA 2QUAA 3I6QA 3DMPA 4WN3A 3FBGA 4AXXA 1DZ3A 1W8IA 1Y8ZA 1YVUA 3V2IA 1T8SA 2QYOA 4ARZA 3BJMA 3H5LA 4G56A 1T6NA 2HNBA 3IEXA 1UM9B 2H11A 1RE1A 4OB7A 3TOZA 3S1AB 1U28C 3TQCA 3SR0A 1WZUA 2FP4B 4ILEA 2NQ2C 4N65A 5JFTA 1XQXA 3ZUPA 4AULA 1MB0A 4DGSA 5FPTA 2CVZA 2H1OA 3HUTA 2COUA 4RY8A 2PT7A 3BAZA 2OWDA 3E3AA 5ED0A 2FEOA 3LDUA 1Z4OA 3JPYA 1GZHB 1JUDA 1JWBB 1OU4A 3BL6A 1H2EA 2RDMA 1J0CA 3PXUA 4YCJA 4YAJA 3C39A 4JI2B 3KZKA 1ULUA 4R8MA 2ZR0A 3B1XA 3SDZA 1Q0LA 2QTRA 2Q62A 3E5RA 3KWLA 4PZYA 5A5VA 3B5JA 3QXSA 2ZRBA 1T5HX 2F4NA 3HKBB 3EIOA 4JELA 3KG2A 3ZXXA 1VLZA 3QRWA 3P9KA 5IN5A 4EHHA 5LSAA 3W5CA 4R83A 3N2LA 4GR9A 3H4VA 2PAFA 2Y77A 3TDNA 1W49A 3BGSA 2M6RA 5FHRA 3NQ41 4ZC8A 3GX1A 5MGNA 5C18A 3ZNOA 1XZPA 2GDJA 3LBAA 5LQAA 4ND5A 2VZLA 1D2CA 2VF2A 1XZHA 1Y4DE 1AO0A 1V8OA 4XB1A 3WS7A 4Q9HA 2CLKB 4DB4A 2YC2C 4JLMA 1N2EA 3M1YA 1F06A 4FBGA 3T4XA 4DLTA 2NNLD 1Q19A 1OBOA 5DB4A 4D0GA 2ZUUA 1SM4A 1T3TA 2H59A 4XSVA 3WYAA 3T1TA 3DTTA 4C3OB 4MH0R 1EU1A 7GPBA 2XE8A 4CF5A 4JOQA 2ZI4A 4TKVB 2PX3A 1ZKMA 4OHYA 5HKKD 2VIIA 2X3FA 4OF4A 4RETA 3C6QA 5FT9A 4IMJB 4TMFA 3QW4B 2R8XA 4E88A 4LJLA 2QUZA 3WL7A 4S1VA 5T7BA 2WZQA 3EYAA 5CIYA 3GT4A 4LWOA 3M4YA 5LDDC 3GLHE 3KSBC 4QFMA 3VPSA 1R5BA 2FSGA 2P9ZA 1BH2A 1AQYA 1ULSA 2DQKA 2J3HA 1W52X 3L77A 2BM8A 1E3QA 4AICA 3CFYA 1ZI9A 1QFSA 2HSDA 3CEHA 4GBED 4ZI7A 3ONNA 3OA0A 2IU0A 1JXMA 1R4ZA 4K9PA 2RH9B 3RIMA 3T7IA 5JHGB 4PRLA 4G0WA 3OOYA 2E4VA 3CM0A 3SQDA 1K7FB 3OQ1A 4OXIA 2ZR7A 2ZR8A 3T38A 4ALMA 1QHEA 1N25A 4W9NA 4KFRA 4EHIA 3QPVA 4QTUB 5DGIA 4Z4FA 1ISMA 5COAA 2H57A 1J25A 1MA3A 2DM6A 3B1VA 1DLJA 3FTCA 3LUCA 3SXJA 5KVVA 2ZIAA 1TPYA 1KR5A 1NYRA 1QTIA 1Z88A 1KMCA 1EHIA 2LVBA 2BUCA 2QSZA 5CYPA 1GEGA 4ETMA 3ASVA 1Z0SA 2SICE 4X3PA 3LDHA 1H65A 3P4UA 4NJOA 2NIPA 3ZGZA 3ZEIA 5EMMA 1EE9A 2HA2A 1TJ3A 2B5WA 3GLUA 5A3JA 1GPYA 2WJVA 2Q41A 4C4RA 3QPCA 4ZCRA 1S1MA 5ECDA 1GA1A 3EK2A 2HSGA 3QKSA 4JEMA 1VECA 1YRLA 1DEKA 4HCJA 1RPNA 1GFSA 3S5UA 2BDEA 2R25B 2CF5A 3FNBA 1Y8CA 3VZQA 4O4IF 1QQBA 5A7GA 4MWEA 4HK4A 4WCFC 4CM8B 4ER3A 2X9QA 1GNPA 2WJYA 1AMNA 4BVHA 4TRJA 1YQGA 4ZVKA 2Q7XA 1KO4A 3EDYA 3WLLA 3QV1A 2ZQ5A 5TGDA 2WTEA 1P0QA 2JGFA 2QM3A 5FX2A 4MS4A 1KXZA 2NZVG 2FEXA 3K8QA 5JDCC 3ZNNA 4H7KA 3X1DA 2A4MA 4RW0A 2HA4A 1N8NA 1ZVQA 2G5GX 3QIVA 2BP7A 4FGLA 3RVQA 1CG6A 1BE0A 4GX0A 1ULAA 1S4QA 2P69A 4L78A 2EKQA 2W9XA 4IJQA 1QRSA 2BV3A 4YIHA 3IJEB 1RMQA 4PZZA 1S1CA 1MW8X 1H4SA 2QQ5A 3T9FA 4KLCA 3S28A 5FL3A 1GNTA 2ZBRA 4CDNA 1IHXA 4EVQA 5J2UB 2OHFA 1PZHA 3IE2A 1CJSA 2EFEB 2VAVA 1F60A 4MQFA 2LV8A 2O2DA 3A27A 4EPYA 1TYBE 4YO7A 3RIHA 5CXUA 3JYHA 2WWXA 4K1XA 4QTXA 4E11A 1ACJA 1P91A 1UBJS 2NUBA 3R7WA 4F04A 1SIBE 4QOJA 4CT0A 2F6RA 1G9TA 3QFHA 1E6EA 2VH1A 2YICA 1Z8FA 4M1YA 5JNRA 3G02A 1O3YA 3GN1A 3H0EA 3R74A 4EI9A 3M5PA 4IHJB 2PBFA 3L40A 1SD5A 1P2VA 2V45A 1GSAA 1F9EA 4LY3A 1TAUA 1Q74A 2NAFA 2BT4A 3HVRA 4JFRA 1PP4A 2R7AA 1YR8A 3QVGB 4PTLA 2HO5A 2Q2WA 1QK5A 3CLSC 1JR3D 5ECYA 3LRXA 5HF6A 4Z1MA 5TDHA 1GCGA 4UXHA 1MD9A 1QH8B 1US8A 1VCHA 2AG1A 3MSCA 3KPUA 3QWBA 4YBRA 2LNDA 2DR3A 3RYHA 4Z4HA 1U8TA 2F3RA 4XVRA 4E4RA 4HQ0A 5D00A 3L46A 5GV7A 2IBTA 1KJYA 4HZUA 3UMMA 2ZIEA 1WF6A 2Z30A 5CXSA 3O4HA 3ZYZA 5BN5A 5LA6F 1A97A 2JAPA 2ICAA 4HGZA 4O5AA 4TV8F 1VGQA 3CJQA 4CKEB 4FB5A 3PF9A 2PJRA 1GXSA 4RCYA 5EJ6A 4P0QB 1O5IA 4N82A 2ONZA 2OM2A 3PNKA 4ZO9A 3RK1A 1USVA 1QPZA 1BG6A 1PJLA 1XJWA 4RK4A 1DB3A 2KB0A 4HGOA 3C8HA 5CB4A 4RY9A 1A7UA 5TNXA 2R9VA 1F6DA 3BGVA 3ENZA 3HABA 3BWDD 4HEJA 4ED9A 2ZZNA 3TZHA 2AEFA 4B4WA 1Z0UA 2B78A 4WN9B 3BRWA 3UTCA 1GTG1 1YRQA 3FX2A 3T7DA 4WH0A 2YJ6A 3M6IA 4IF4A 1E2GA 2NO1A 2QN1A 2GERA 3JR3A 4PG6A 4TVBA 2C8KA 2XCRB 1M73E 3FLAA 3S7ZA 2FJ0A 5L7YA 3V1YA 1N2CE 1RAGA 2IELA 1OUMA 1J8MF 3T15A 2XWBF 4FBMA 3NANA 3JAMA 1DUSA 4QECA 4OQYA 3ZHQA 1NF9A 4B48A 2CMDA 2QI9C 1KQOA 1UKCA 4AS1A 2AN9A 2XMRA 1OE0A 2EQAA 4G3XA 4L4UA 4D3ZA 2RGRA 1ID8A 3PWTA 3C5WP 1B0UA 1CD5A 3GZTB 3MT7A 1WM1A 2DFPA 5KX5B 1XU7A 2NACA 5JBNA 4GLOA 1MO5A 4OKSA 3GUZA 3QY9A 3WNCA 4V3CA 3KP1A 3QVLA 1YZLA 4LE2A 1F2UA 1WA5A 4YRLA 5EZYB 1XUOA 5L45A 3IDZA 5JBQA 1Q7TA 2Q3FA 3V8EA 4R2XA 4V0RA 5FQOA 3I9KA 2WA2A 3Q7SA 4PF1A 3Q2IA 3GRYA 1O03A 3KEMA 3AR4A 4AFNA 5DHFA 2XB8A 1GYRA 5JCOA 4RMGA 1RCUA 3BHIA 3E1SA 4B2PA 3SM3A 4N3CA 3LJKA 5LQCA 4U02A 1IONA 4Z6KA 4P33A 2J3QA 5BUSA 2V3CC 2O4CA 4OAOA 5DGDA 4CM4A 1MEOA 3TNYA 3UQYS 2GRAA 2Z8YA 4DR6B 2WFMA 4DC0A 2NO4A 5IYZA 2NU6A 4OMFG 1TECE 4MGEA 4MQ4A 4PONA 1RJWA 4B5LA 2ZAI