3NWBA

Rat comt in complex with a fluorinated desoxyribose-containing bisubstrate inhibitor avoids hydroxyl group
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nwbA00
4LG1A 3KQMA 4M7RA 3ELWA 3I5UA 2P3LA 3GCZA 5EKUA 2HWKA 5DPMA 5T67A 3I53A 3UJ7A 3UJBA 3KQTA 2UYQA 5KYGA 5K01A 2PT6A 3REOA 2QRVB 1INLA 1JG2A 2AOVA 3C6KA 3EMDA 5CVJA 3A7DA 5BP7A 2OYRA 4IV8A 4C4AA 2IBSA 5GP1A 3G89A 5MHTA 1JSXA 5HOQA 3PLAE 4GOOD 5HIJA 1JTEA 3BGVA 3DULA 4OA5A 4P7KA 2XVMA 1ZGJA 4MWZA 5EEGA 2ZWVA 3AY0A 3GRUA 3LSTA 2C7OA 3VSEA 3RODA 4RTNA 3MTEA 3ERCA 1MJFA 2FCAA 4PNEA 3G88A 5EPEA 4YUYA 3AJDA 3OFJA 4E70A 1O9HA 2O57A 1R6AA 4YUWA 1BC5A 3P2EA 2PXCA 3KU1A 3FTEA 3LX6A 1VBFA 4EQZA 1NE2A 5EMKA 3V8VA 5EHGA 2PGXA 3KQWA 5EGSA 5EMLA 3PTAA 5EMJA 5H02A 1Y8CA 4HGYA 4GC5A 5CD1A 1NW7A 1VE3A 1D2CA 4DZRA 3JWJA 3P9CA 3EPPA 2O0LA 3G5TA 4X61A 2CL5A 2EX4A 3M70A 2Z6UA 2PT9A 2QRVA 8MHTA 4RX1A 2VZ9A 2VDUE 1FJXA 4FP9A 4IWNA 3THRA 4EMSA 3CC8A 2IH4A 2XBMA 3MTIA 3LGAA 3T7TA 3BKWA 4GOMD 2ESRA 2O06A 1AQJA 4X60A 2EG5A 4E32A 5DWQA 3FPHA 4OBWA 2IBTA 1L3BA 1L3IA 2PXXA 4BLVA 2BR5A 5BW5A 3OZTA 2JH9A 4PONA 3JWHA 4RV9A 4E2XA 3MCTA 1IY9A 4GUAA 4O29A 4EKIA 3ER8A 4C05A 4RTJA 3O7WA 2PY6A 4WVLA 5IH3A 3MHTA 4RTRA 4GC9A 5FADA 2F8LA 2PJDA 3UZUA 4R8RA 5HZMA 5IKMA 3TKAA 1RI5A 3SR4A 4QDJA 1KYZA 4ER0A 1P1CA 1D2GA 3X0DA 4C07A 1VQ1A 1G8SA 1VPTA 2IP2A 3SSNA 1YF3A 4BLWA 1G38A 2FHPA 3EVZA 2G8NA 3ELDA 4ER3A 2HNKA 5K03A 3AWIA 1KXZA 1RI3A 4L7VA 3HVHA 3ELYA 2A14A 3LBFA 3E23A 4PYOA 2QYOA 4M38A 5BXYA 2AOTB 2HMYB 2FYTA 4X41A 2CMHA 1R18A 3LCCA 1TW2A 1IM8A 3BT7A 3FUVA 1X1CA 3BWMA 1SQFA 3FPEA 3L8DA 1RI2A 3FYCA 1N7IA 3KQYA 3PB3A 3V97A 2ZLBA 3DXZA 5GIOE 4EK9A 3E05A 3GDHA 2BM9A 4FR0A 3R0QA 1QAMA 4Y30A 5EEHA 3EVEA 3GRZA 1JQEA 2E5WA 5DTMA 5F2OA 4FSXA 2PX5A 2NP7A 4IV0A 2I6GA 2YUIA 3RIEA 5DXAA 4BLUA 3SGLA 2NNWB 3FYDA 4E31A 2AVNA 2ZULA 3JWIA 2PWYA 5T6BA 5LQCA 4CKBA 4PINA 4JXJA 1NBHA 4ER6A 4E33A 1N7JA 3LECA 5FTWA 4AX8A 4K6MA 3A4TA 2JG3A 2JHPA 4PYQA 4RVHA 4XUCA 5K0FA 3EEOA 3OU2A 4HTFB 2EJUA 2O05A 3OFKA 4EKGA 2AS0A 5K05A 3THSA 2WK1A 2AOTA 2BH2A 3G5LA 1DUSA 3PFHA 3UFBA 3KQPA 5FHQA 4C06A 2ZW9A 3DP7A 3K0BA 3R6TA 2PLWA 3FPGA 3UJ9A 5BW4A 1G60A 5LQJA 4G56A 4XCXA 4AZTA 4LWOA 1G6Q1 3CBGA 2P8JA 2I7CA 3KQOA 2VDWA 3HVKA 1UFKA 2P7HA 2ZIEA 4FS8A 4KRGA 3P2IA 3CJRA 1P91A 1R8YA 4P7FA 4WXHA 1KHHA 2P40A 2UYOA 5ICCA 5LQRA 1KPGA 2XYVA 4CXMA 3LKZA 2OB1A 1X1AA 4RYLA 3SX0A 3AXSA 3DLCA 3OU6A 5EKXA 3P8ZA 1VL5A 3NVKI 3TM4A 3BZBA 3VYWA 1NW6A 3MQ2A 5FUBA 3K6RA 3PS9A 4FGZA 5E9JA 1XCLA 4OX9Y 9MHTA 4RTLA 3DLIA 3HP7A 5EIWA 4HTFA 1WXWA 4DM3A 4PYLA 3TM5A 5CM2Z 5GM1A 4KDCA 5DX1A 4PGGA 5E9WA 5K0NA 2OO3A 5FA5A 3OE4A 1XDZA 3MGGA 2QE6A 4A6EA 3CVOA 2YX1A 5K0CA 4DMGA 4XUEA 1SUIA 5E2BA 1QANA 1SG9A 2ORED 3T7SA 3KPWA 3FUXA 3GO4A 4RTKA 3IYLW 3DMFA 3B3FA 4C04A 3JWGA 3B7PA 5E1DA 5K0EA 2VS1A 4PWYA 4YV1A 4YMGA 3CCFA 3LDUA 2OB2A 2PX8A 3G2OA 5T64A 2P3OA 5LQAA 3PX3A 4ISCA 5JUWA 1FP1D 2JJQA 1R74A 1NW3A 1H1DA 2P35A 1QAOA 4BP1A 1ORHA 2G1PA 3DXXA 1EAMA 1Z3CA 3CJTA 2GA9A 1RJGA 2BM8A 2CWWA 1PJZA 3ANXA 3FUTA 1BOOA 2AOXA 3Q7EA 5DM2A 2B9EA 2IDKA 3RW9A 2Q41A 3UA4A 3NWEA 3DUWA 5DRTA 4KIFA 2UZ4A 5FULA 1KIAA 2Z6QA 3ID6C 3IEIA 1BKYA 4RVDA 5CIYA 4PYIA 3SMQA 1YZHA 4QTUB 3G8AA 4BP3A 3UJ8A 3P2KA 1D2HA 3UBTA 5FQOA 3R9XB 3EGVA 3HA7A 3UJDA 2GS9A 3LBYA 2ONYA 2ZBPA 3M6XA 5DM0A 3EMBA 5E1BA 5GM2A 3TKYA 4AZVA 4DCGA 4A6DA 2NXJA 1VP3A 4DCMA 2AN3A 4V0QA 4GBED 5EC8A 4RTSA 2PBFA 1JSZA 1L9KA 4QDKA 3VC2A 3A25A 3B5IA 5E8RA 1AV6A 2PVCA 4LECA 5CVVA 3LL7A 4KWCA 3HVJA 1SKMA 4QQKA 4CKEA 3IHTA 4RTOA 5DRYA 2BR3A 1AF7A 4KDRA 2G71A 2R3SA 1NW5A 2UYCA 5FHRA 4B17A 2AZTA 2FK7A 1FPQA 3OE5A 4MIKA 4ATNA 3TOSA 3GRRA 4QQNA 3I64A 2GPYA 3GRVA 1DL5A 3CJQA 3HCBA 3KPYA 3MAGA 2DULA 5KS2A 2OKCA 1EQAA 4Y2HA 3EVDA 2XYRA 4M36A 1FBNA 4AZSA 4R8SA 1KR5A 5CVDA 1JG1A 2PSSA 3GXOA 4CKCA 3EVCA 3G8BA 4R05A 3HM2A 4RTPA 4YV0A 5DM1A 2P7IA 1XCJA 2G70A 4P7JA 3IV6A 1JG4A 5DX8A 3HCDA 3GRYA 1JQ3A 2YQZA 3NDIA 3R3HA 4P7GA 2PKWA 3P97A 5D1NA 3UWPA 3P9IA 1KPHA 4X1OA 5GINE 3LHDA 2B3TA 3M33A 1EIZA 1X1DA 2KW5A 3BUSA 4RWZA 4M37A 5EZQA 4FT4A 4NECA 3KKZA 5K0JA 3CGGA 5GWXA 4HSGA 2ZBRA 1P1BA 4X63A 2R6ZA 1YB2A 4GQBA 3LKDA 3MCZA 2ZZKA 1N2XA 2HV9A 3M6UA 2C7RA 2ZBQA 2BZGA 4IKPA 3TRKA 2FPOA 2CMGA 5HIIA 3BKXA 3LDGA 3QV2A 4P58A 3F4KA 5HIMA 5EVJA 1BHJA 1WG8A 4KW7A 5EIFA 2IH5A 2AN4A 2ZCJA 3C3YA 3OZSA 4UOEA 1XDUA 2IFTA 2ZSUA 3SXJA 1M6EX 3EGEA 1NV8A 3HA3A 4QVKA 1YFLA 3VC1A 3D2LA 1M0EA 4QPNA 1EJ6A 1ZGAA 3G7UA 3MERA 4PCAA 5C0OE 3C6MA 5DX0A 3UA3A 3NJRA 3FPFA 2Y1WA 5C1IA 5P8WA 1G8AA 1TW3A 3GNLA 1NKVA 2P41A 4ER5A 3HCCA 1ORIA 3GWZA 3OPNA 3OZRA 2CKDA 3P71T 3DH0A 4PIMA 2AN5A 4QPPA 5DXJA 3EGIA 5EHIA 3UJCA 4C03A 4DF3A 4R6XA 3OU7A 3FUWA 5E9QA 2YR0A 3CKKA 5FWDA 1WY7A 1F38A 2PX2A 4C08A 3T7RA 2N47A 1PRYA 5F2NA 2OY0A 4QVGA 4YUZA 5LQNA 2P3QA 1WZNA 5GIPE 1M6YA 1SVUA 4MTLA 2OZVA 1L3CA 3G2MA 3LPMA 3U81A 5E1MA 4RVFA 3M4XA 3A27A 3S68A 5K0BA 4POOA 3A7EA 3FTDA 4F86A 3SSOA 3BWCA 4U7PB 3HTXA 4RSRA 2VP3A 3I58A 5HFJA 5M5BA 2YXLA 3BGDA 4PCLA 5ICEA 1VP9A 1NW8A 1RI4A 1NBIA 3KR1A 5EQJB 2H00A 4DKJA 3GIWA 3HCEA 3G2PA 4OBXA 4LWPA 3OCJA 1QZZA 3HCFA 3O31A 3A26A 3DOUA 5CUQA 3KR9A 4KIGA 2FK8A 3EVAA 2NXCA 5KQSA 3DXYA 1JG3A 4ZTBA 3AXTA 5DTRA 1JR4A 10MHA 3FTFA 3EEYA 2JHCA 2ADMA 3B3GA 4EVIA 5DSXA 1JQDA 3GGDA 2PV0A 3FRIA 3BGIA 3NDJA 4FZVA 2NXNA 3TR6A 1R8XA 3EVFA 4YUXA 3KR2A 3NW9A 4PIPA 5LSAA 1RI1A 3GU3A 3KPUA 5F2KA 2AR0A 2ONZA 3ELUA 2B25A 4YV2A 1VIDA 2P1DA 3Q87B 1ZQ9A 3PX2A 3UJAA 5HEKA 4Z2YA 5C9ZA 2ZZMA 1O54A 4FSDA 2OXTA 1NV9A 1XVAA 4CTJA 1R00A 2IH2A 3DMGA 1RJFA 1SUSA 1U2ZA 1YFJA 2IDJA 1I4WA 2DPMA 2FRXA 2ZTHA 3HVIA 3M6VA 2QY6A 3P9KA 5EG5A 3TQSA 1SQGA 3MB5A 1RJDA 5E2AA 5KVAA 4E30A 2NXEA 4HH4A 3KPJA 5FCDA 5K09A 3NMUF 3E7PA 3B3JA 3FUUA 4QTTB 5EOVA 2V74B 1TPYA 1WS6A 3G2QA 2ERCA 2I62A 1KPIA 4U7TB 5E1OA 2EJTA 3FZGA 5EMMA 4KVZA 1JTFA 5KQRA 2IPXA 3BXOA 4OQEA 1P39A 5LR6A 1KYWA 5G02A 2UYHA 1XJ5A 2NYUA 2GAFA 3DMHA 1QYRA 4PYKA 3BWBA 4XUDA 4E2ZA 1DCTA 2Z6AA 2HR1A 2PXAA 2BR4A 4RTMA 4BY9E 3UJ6A 4HRAA 1X1BA 5FWAA 1G55A 1WXXA 3ER9A 3ORHA 2ZVJA 3KQQA 4GEKA 5CVEA 1I1NA 4AUKA 2ZWAA 5FQNA 1RJEA 2ZIFA 5ICFA 3KHKA 3O4FA 4E2WA 1AQIA 1L1EA 2YVLA 1VLMA 4GF5A 1FP2A 1XXLA 5DLYA 3LCUA 5K0LA 1YZ3A 3TLJA 3PT9A 1I9GA 2XYQA 2G72A 2H1RA 4FT2A 2AOUB 5LQUA 2ZIGA 2H11A 3SM3A 3T0IA 5CCBA 5DT2A 5EZSA 5DSTA 4DA4A 4HG2A 1UIRA 2AVDA 2WA1A 1O9GA 3FPJA 4RVGA 3HCAA 5HILA 1F3LA 3QOXA 5E8JA 3NWBA 3M6WA 4PYMA 5FA8A 3NTVA 5CCXA 3E8SA 3H2BA 2HTEA 3GJYA 2JHAA 1HMYA 2B78A 1QAQA 3KQSA 3P9NA 5GOZA 7MHTA 1HNNA 3LCVB 5LQKA 4CWAA 3QOWA 1IXKA 3KR0A 3SSMA 2JH8A 3EVGA 2O07A 5U4XA 2Y1XA 1B42A 3PVCA 1MHTA 4PGHA 3TMAA 2XVAA 4CTKA 1YUBA 1EG2A 2ZFUA 4AZWA 2EFJA 3LDFA 3TFWA 3BWYA 3WSTA 5ICGA 2B2CA 2GB4A 4PYNA 4MQ4A 3C3PA 4YUVA 4MHTA 2ZZNA 3HA5A 1KP9A 3DTNA 5K8VA 2IIPA 2OBFA 4F85A 5K0GA 2NP6A 2WA2A 1XTPA 3KQVA 2AOUA 5JR3A 2YTZA 3C0KA 4DQ0A 2LD4A 3KPVA 3FTCA 5CVUA 4HGZA 1ZG3A 5ERGB 1V39A 3HEMA 2IGTA 1ZHFA 3PFGA 1T43A 3HNRA 4HC4A 5DM4A 1NT2A 4OQDA 4YMHA 2YXDA 1UWVA 4R6WA 4F84A 4H0NA 2QM3A 2PWPA 2VDVE 3FRHA 2C7PA 1Q0SA 4GOND 2C7QA 1Q0TA 2OPBA 4GOLD 3ME5A 4E2YA 4RTQA 3EVBA 5DTQA 5B1SA 1XDSA 3NVMB 2I9KA 2V7EA 2K4MA 2GH1A 3B89A 3I9FA 3SVZA 4OA8A 1ZKDA 1EJ0A 5D1HA 1OR8A 3TPZA 2GLUA 3DR5A 5HIKA 2YXEA 3R24A 4ER7A 4PYJA 2AOWA 4V0RA 2PX4A 1X19A
chains in the Genus database with same CATH superfamily
1P4SA 4B3RB 5JPCA 4FLMA 1S7GA 5B3KA 2I4NA 3WK6A 2Q50A 3PC3A 5EKUA 3TPFA 3CEHA 4RLFA 3BXGA 5LBUA 1JG7A 2O7RA 3LQ4A 1N4AA 4O4JA 4HNAB 3W5IA 4L4XA 4U2BA 1VFNA 4IV8A 1MB0A 2WKQA 3WKCA 5BN1A 2P9QA 3JZIA 1JE1A 1U7TA 1XWWA 1BU8A 2F1OA 1T8TA 2UYGA 3K0AA 3P5SA 4UHFA 3S2FA 1JH8A 3I23A 1NRIA 3SLKA 3VSCA 2YFQA 3QYJA 2ZWVA 1PR2A 1GIAA 1YAHA 1B6TA 1M75A 4YEDA 4BJHB 4WY8A 1B0PA 3DO6A 1QZTA 2FCAA 2KLHA 1CKEA 1Z8HA 2I1WA 4KXNA 1RCTE 1C7ZA 1XL0A 4IJKA 4RA9B 5TIIA 1UK7A 4GH5A 1M8JA 1EFVB 4AJKA 1IEQA 5JVDB 4O1IA 2BEJA 3O73A 1M73E 4KQEA 5KIAA 1ETUA 1GCUA 2HCFA 2D1YA 3WLTA 3B6ZA 1PFYA 5KHLB 4G26A 1BVYF 1T6ZA 2LE0A 5BN5B 1C8KA 3IOMA 2VZ9A 1OLXB 4MW5A 1FJXA 3BMCB 3WL7A 2V97A 1Z12A 5HA5A 2QTHA 4IFTA 1KJYA 4L8WB 1YU6A 1NVAA 4WN9B 5LWHA 5BPHA 1EJ2A 1Y34E 7REQB 1J2YA 4O63O 4AWXA 4XIJA 1YIDA 3JAWA 4G3XA 1FSPA 2Q1XA 2ZYRA 1D6JA 4RKQA 4HWKA 1ZVQA 4N5MA 2BR5A 4F2DA 3JXEA 2EFCB 4OCZA 4P4LA 2BC9A 3HXLA 1RAFA 1U90A 1NVGA 3VPGA 2CNLA 2AX4A 2XTMA 4GUAA 3TCXB 3ER8A 3WSWA 4M89A 4J43A 2IODA 4CMKA 1DKLA 3I61A 3UFXA 1CBUA 1VA5A 4DCPA 3KKPA 4M9RA 3TS1A 4Q3DA 3ZN2A 4C6HA 1A72A 2XD4A 4OQ4A 4X8OA 4YDQA 3SSNA 2DHDA 3HJHA 3QPBA 5JZOA 1U1GA 1W36C 2ECPA 2VDMB 5K3OA 2G8NA 2X23A 3QX8A 4F5WA 4LRTB 4EVSA 5TF4A 5REQA 2Z83A 2VP2A 3Q0EA 4NZPA 5DCYA 1MORA 1OBHA 1BE1A 2IZ6A 1QYXA 1FTQA 2WUDA 3C5EA 3FVQA 5DLPA 3UWKA 1OAOC 1R8QA 4NARA 1QO7A 3BT7A 2CFCA 5ISMA 3L8DA 5G0TA 4Y6GB 5FD8A 2Z4RA 1LKZA 4PSKA 3IBYA 3JWPA 4GYWA 3YASA 1SCUA 3NT4A 1LH0A 2XMQA 1YCFA 3KO8A 3QKTA 3HXOA 4WCFA 2VDQB 4KSCA 5AXAA 1L5NA 1DJLA 5IYZA 4FNAA 4NYMR 4IQ4A 4BWVA 4D56A 4TYNA 1WP4A 1W1IA 2CLSA 4HGRA 2JGRA 4UDXX 3QMVA 1B3RA 1TGVA 3IPLA 4M1EA 3TW8B 3V8QA 1EQ2A 4ER6A 3IQZA 1WPQA 1BWRA 3W2EA 3WBKA 4UUQA 3GEBA 3H86A 1YXMA 2IYRA 2ZRGA 1JKJA 2QI9C 4MV3A 5A62A 4YJGB 1RAAA 4W1SA 5KBYA 3I2KA 1ILEA 2F1KA 4FFMA 3EZLA 3MAAC 3OZEA 3GLFA 3DMNA 2ERXA 2GQ0A 3SYRA 1LW6E 5IP5A 5AJWA 2HIGA 3PFHA 4AYTA 2V96A 8ADHA 2O19A 4HQLA 5D5PA 3QF7A 2TMYA 3MCWA 1CUJA 3VU9A 1SHZA 4ZI2A 2BDTA 3RASA 5E6RA 2XMGA 2XVXA 4J90A 5CH3A 2ZUTA 4EUSA 3W5UA 1QHEA 2SHKA 1E8DA 2QL6A 3EZXA 3HZRA 1EYZA 4XCXA 5AHXA 1WP9A 1NJGA 2EW8A 4WD3A 3D5QA 1GFZA 1JSRA 3E9RA 4NC9A 3WWDA 1VL8A 4IDFA 4ARVA 2UUCB 2VDWA 1GPMA 1RWMA 3OBBA 3MWDB 1JPJA 2CNWD 4QFMA 5KUTA 1X13A 1SZDA 3ETLA 4RYLA 2AWOA 3DLCA 1JDJA 4G5XA 1HO3A 2P27A 4F2GA 1NW6A 4R9VA 2VJOA 3O3CA 1RPAA 2PSJA 4UATA 4D9EA 1QZUA 3H04A 4MROA 9MHTA 2M6SA 3RBAA 4E5NA 1T3SA 3HKDA 4QBIA 4TSFA 1C4WA 2OV1A 4ZC1A 3UV7A 3OQ6A 1TFRA 3ZY2A 1TJPB 1YQTA 2BUCA 2YJ5A 3MJSA 3N8DA 2QAJA 3GEMA 4MR8A 2VQEB 2EBFX 4XUEA 4TWAA 1FUUA 2PKQP 5J43A 1K6XA 4WCFC 2QORA 2H5IA 5ARBA 1L5HA 1DX6A 1ZEJA 3NVAA 3JWGA 1VKZA 4G4JA 2FSIA 3KSBC 3QTLA 2BBSA 2KBFA 4OFWA 3P0JA 2GNOA 4QWWA 2JIRA 3ZV7A 7YASA 2VQ6A 5FR2A 1ONSA 3PE4A 4WLVA 3PX3A 5AVOA 9LDTA 3DV0A 5JUWA 5DT9A 3IIEA 2IXFA 3ZU6A 2X0RA 4IDCA 1UINA 2BFCA 4RULA 3ZBPA 4X1YA 2RAVA 5HKBA 2IVFA 1SB9A 2JS7A 5DM2A 2QVCA 3PWTA 3UA4A 1M7GA 2I4IA 4G1FA 4ABTA 3R8FA 4TL9A 5KCMA 1KSFX 1FU7A 1HLPA 5BQPA 2BFPA 4MVJE 4M7OA 1O89A 3OVMA 1UXJA 4Q03A 2OO7A 3FSGA 5E38A 4PFJA 1MFZA 1UDCA 3O5AA 2BSXA 3OPVA 1Y98A 4Z3KA 2HCTA 2OMEA 4KN8A 1KS9A 4ZOCA 3AW9A 1DIRA 5LA6B 2YV1A 1MU0A 2WLTA 2ZBPA 3K6JA 5E1BA 4JI1B 3WWEA 1UZAA 3PPIA 4MVJD 3IDSA 1SZPA 4KYTA 2VT6A 4OP1A 5CXQA 1GYQA 2AN3A 3DL4A 4GKBA 3KQHA 1YGYA 4G0XA 4EIWA 1L9KA 1KYTA 1SA0B 1F0YA 1OYWA 1TC1A 3DFMA 2HA5A 3I0NA 5CVVA 3PFKA 5LCXA 4JI6B 4AF8A 5EJ8A 4OJNA 3EUEA 2XUZA 1TYCA 2ZRMA 3G5UA 3OTHA 2IPOA 4J0GA 2GD2A 5DRYA 1B14A 1QIFA 2G71A 1D1PA 3O6VA 4J75A 4XWAA 1V6AA 2FK7A 3D81A 3BXXA 5BOVA 4URWR 4FE3A 1KI8A 2ZBVA 3GRVA 3MAGA 2IDMA 3OIDA 4Z9XA 4E4RA 5MF6A 4RABA 1GOTA 1O97C 2VPTA 5ALKA 3WNZA 3FPCA 5T6MA 4E7OA 1BH6A 4WXPA 1KR5A 4D45A 4CDMA 1UBCA 4DA7A 3OJ0A 3MWJA 1VJRA 3CINA 3QFRA 1EFPA 3MMNA 3A1EA 3C8MA 2EZ4A 3NTQA 4AY4A 5THQA 4OQXA 1J22A 1SBZA 3ODGA 4H1HA 2JCXA 1YHZA 1TMGE 3DFIA 4EAQA 1A5AB 2OHJA 4QU8A 5EZQA 2NZ8A 3D5EA 1NAHA 3KCQA 3K70C 4H7JA 4DAEA 3ZLUA 3QP9A 2X6TA 4BFYA 4OG2A 5IM5A 1E0DA 4YAWA 1KQPA 1YB2A 3A4VA 3ZW9A 2CGEA 5AJUA 1GCAA 1NBAA 2DX7A 4M0EA 2YWDA 4UULA 3C74A 4B34A 3WNDA 4O0LA 5FI0B 1MV8A 5DTEA 4GMDA 4FE4A 4E5DA 4KFSA 4E1VA 4YCBA 4HDNB 3VM6A 1GKUB 2Q4TA 3KKEA 3DZHA 4OMFG 2PDAA 3P94A 3CLKA 3JQDA 3N58A 4R8MA 1S4MA 4GDFA 2BTQA 3OZVA 3AIIA 3EGEA 2ZKLA 1YFLA 4PQFA 2J9ZB 1RJ9A 5EWJA 5C0OE 1NDQA 1JKXA 3JZDA 3KCNA 2IC5A 4FW8A 3C6MA 4JWKA 5FWNA 5AOVA 1EFHA 2HA0A 8ATCA 2Z1MA 3R5TA 1OTHA 1VSBA 5G1PA 5FUYA 4R1QA 3ESYA 3CRQA 4DV6B 2BMFA 1W25A 3B5JA 3HCCA 2RG1A 4ZICA 3WGZA 3THXA 3OP1A 4CF7A 1EP3B 5FXMA 1Y1TA 3V6MA 4BEWA 5A4AA 4EJFA 5KSPA 4BUJA 3I4FA 3KWJA 4IVNA 4JLNA 3VRHA 1BGWA 2OXIA 4FKZA 2DSNA 3EPJA 2H29A 1WOMA 2OY0A 1DJMA 2HK9A 2NAFA 1MZVA 3D1LA 2F3TA 6REQB 3UAWA 4LTDA 2A1TR 5ETJA 3D8NA 4IDOA 5TR9A 2J32A 4FXOA 4TTQA 4P36A 1DAEA 2A0XA 2FN8A 3DT9A 3DE2X 4N9WA 3RUEA 4B0PA 1TM4E 2W6IA 3OQJA 4COKA 3D8SA 3HUUA 2QF7A 4BMOB 5JATA 3FOZA 1W44A 2P2SA 1JEJA 3QEMA 3WGJA 3FE2A 1FW6A 2O0MA 1G8MA 2M9MA 4I4NA 3DE0X 3E81A 3IUQA 5C1OA 3TXAA 1SY7A 2MSWA 1NBIA 4FGKA 1H0KA 2XXBA 3LFHA 3T3OA 4JT2A 2HRRA 2O6HA 5JZBA 1KDRA 2NUBA 3E9CA 1XDGA 4LHWA 2B8EA 4PIVA 1ESNA 4IRUB 5CK5A 1WCIA 4QO8A 4KIGA 4MWCA 5MFPA 1NWHA 2NV6A 1ZFNA 2R751 2ZRLA 3RS8A 2IZ0A 4IFBA 4NYMQ 1TJ5A 2I5PO 1OFHA 3D8HA 5KWIA 1I3MA 2X3FA 1DPFA 5A71A 3PXUA 3RAPR 2OCDA 2H3HA 3GGDA 1OAKA 1Q0ZA 5TXGA 2PRIA 3NDJA 4X7BA 5ENVA 1AHHA 1KEZA 4JR2A 4EABA 3DJYA 1R8XA 5FTKA 1JDSA 1I0LA 4RQBA 3KR2A 1KQGA 5DTJA 1QGDA 2W0SA 1JFFB 4ZQGA 3F5DA 4RPKA 2BKLA 3STXA 1VIDA 3L2OB 2C5FA 5HEKA 3L0CA 2P5YA 4M9SA 5D7BA 1QH1B 2ID7A 3NCTA 4FSDA 1Z2EA 5L6LB 4YROA 1D7OA 2HXGA 5IHXA 3E4CA 1HE1C 2YV3A 3SJZA 2YHUA 1R00A 4MS4A 4HH0A 1G9TA 2QRLA 4DXAA 3PWZA 2ZIXA 2AC4A 5HE8A 2FRXA 3M6VA 3MLAA 2IY7A 2ZJ7A 1Y6GA 1M1XB 4NNOA 4H3VA 1IHUA 2P6PA 5K09A 4K8RB 1GR0A 5LLSA 1QB8A 4UE2A 3QW2A 2PUWA 4ZEOA 1QH8A 1Q0QA 4HZIA 1N75A 3VTAA 2B83A 1EWRA 1O94D 4Q4JB 3SYNA 2XWJI 4QEDA 3AZOA 1IQPA 1Z6PA 1KYWA 1XZLA 2BMEA 1DIOB 4PTLA 3U0BA 2IYLD 2ZUWA 3TRFA 3ZQJA 4DUGD 2AKEA 4GP7A 5KNBD 3AEQB 2GVDC 1E2GA 5C46F 2QYHA 1QIDA 3DWFA 4LZAA 4JL6A 3V4SA 3VFDA 2XHEA 3ZZMA 3DZIA 1FDUA 4LDAA 3BHNA 2AK3A 4HNQA 4Q1BA 4DEVA 5F2EA 1SH7A 1XRSB 3VPHA 5T5QA 2WM8A 3I72A 4EFDA 2FKNA 5MGBA 3ZZ1A 4HX5A 3A6JA 5FFMA 4BJ1A 3ST7A 5C8YF 1RYMA 2HU7A 2QQGA 5JCJA 4F1WA 3BB3A 1WHTA 2KLBA 1J0CA 1NHGA 4DAOA 2B5WA 1JEAA 4J7XA 3EZ2A 1U28A 2AX3A 2QN2A 4A2QA 1T13A 3RR2A 1QO0D 5J4KA 4EGSA 3U6KA 3PF9A 1N8NA 2Z56A 1PZFA 2QZSA 4FNGA 2XEXA 1JP7A 3BEDA 2I4TA 4Z49A 3P9NA 3F6BX 1WDKA 3HSSA 3PHHA 1U3VA 3F49S 3MT9A 3QXHA 1MZPA 1UEIA 3T5BA 1W4LA 5KYXA 2JFHA 2F67A 4IIFA 3A06A 3RO7A 3QX3A 2P2GA 1XRPA 1QHYA 3ZU4A 2ZSBA 3QPDA 3WA7A 3A4LA 2AXNA 3ZE8A 4U6SA 1C9JA 2ZZNA 4KV7A 5EJ5A 2OBFA 2GJKA 5C81A 2EQAA 2Y67A 2NP6A 3QLJA 4B83A 4D79A 4N1AA 2EJWA 4J9VA 4UE6A 2AOUA 2WE8A 1SXQA 1SKBA 2VN8A 1Q7EA 4O33A 1L7MA 4PSCA 5BSEA 3LUCA 2YZGA 3LBNA 4BU1A 3RJMA 4MI6A 1XZFA 1W88A 4I6JA 1CEXA 1NN3A 1W4AA 1Y5MA 3ACCA 3F4BA 3G5AA 1Z28A 4GOLD 4ZQBA 2D0DA 3PNYA 1UMKA 2QRJA 1PGNA 1ORWA 4ND7A 2K4MA 4F6CA 3VR5A 3DCYA 4X24A 221PA 2CYAA 4PZUA 3PC8C 3QMPA 1KO4A 3A3PA 3PBKA 5I7AA 4GPIB 4REOA 5EXDA 3SEZA 1UR5A 2G82A 3ZZTA 5CXSA 2CCKA 5AJVB 1XZKA 2HU2A 4KGVA 3ZK8A 4YLYA 3KOXA 2FRDC 2XQIA 1VBKA 3GQBA 1GU0A 4ARZA 3AUAA 4NATA 1KGSA 5B3AA 3O1HB 5AW1A 4B40A 2F8SA 3RU9A 5DGDA 3UJ7A 5DP2A 3C6ZA 2FSVC 5K01A 3DUFA 2R6GA 4C4PA 9ATCA 1MNAA 3PHCA 1GZUA 4F2PA 1C1YA 1PIWA 1SXJA 3K5HA 3L7MA 5AHKA 3G89A 4LXHA 5H81A 4A2PA 3H6HA 4GOOD 3SZRA 2ZE5A 4OA5A 3TTYA 5JSUA 2QLJA 4WERA 1DEHA 2DHRA 4RXMA 1TQDA 3DW3X 3ABQB 2CV1A 3HXKA 2YWEA 1RQXA 4GNKA 4RTNA 4DY4A 3T7KA 3ZCVA 2ODWA 5CB4F 1ENOA 1XALA 1JIQA 4FBGA 1T9KA 3QA9A 5LBIA 1E7RA 4JOBA 4NQRA 2E87A 5TSDA 2O8EB 1EIWA 3QUAA 4Z1MD 1C3JA 2NQTA 3SQMA 4C5AA 3NHFA 4B74A 3EC7A 3V8VA 1Z16A 1F6DA 4G8DA 1V1MA 5HRUA 2X9LA 1HURA 3ECSA 3AZQA 5EMLA 7ADHA 3VQTA 1Y8CA 3W9UA 3SHOA 3GG9A 3P52A 2Z98A 3QA3E 1PWXA 4DQKA 2QRVA 5G4KB 3S6JA 2F7SA 1AC5A 2A9PA 4UZEA 4UCFA 1Y81A 4PN3A 1G63A 1PDOA 1OGJA 3IEXA 4IWNA 4N54A 3TVYA 2ZROA 4O2LA 3MRTA 4EY7A 1C3EA 3FYUC 3LYLA 4WHMA 3I0MA 4TKMA 3R75A 4NTZA 1A2OA 1BEZA 2YC2C 4OHUA 4PZAA 3SYLA 2G77B 2OUIA 2W2TA 3E48A 1H2XA 1U3WA 4OBWA 1ZVJA 3G0BA 3R76A 1QQ6A 5KHOC 2HSJA 2D62A 5KYWA 1X92A 1TZJA 1PZGA 4V1CB 4QGAA 3RWBA 1ECFA 4PPGA 3WI7A 4RTJA 2QPOA 2VJCA 2GJAA 2J9RA 4ODIA 3W8DA 3UGJA 3EJ6A 4I1YA 3OQ1A 4K1LA 4JX9A 5T57A 6AT1A 1XZ8A 5EWMB 4U2GA 9LDBA 1S5PA 1N0WA 1KI4A 1RI5A 1SBCA 2KI5A 2Q7XA 4HYTA 5EWLB 4ER0A 1U5AA 4UHCA 5F9HA 3G0CA 1YF3A 5CH8A 3L05A 3QBVA 3D9QX 3F2VA 4MQ6A 2A33A 3BF8A 1LBIA 3AWIA 4KUGA 1ULAA 4W6QA 5K51A 4GZLA 3W4KA 3C5VA 3E23A 2FWAA 2YN4A 1W75A 4M76B 4M1KA 4H7FA 1GN8A 4MRMA 4QBKA 2RI1A 1NY6A 4BUCA 1L4YA 3AT1A 1FFYA 1S7CA 3MT7A 3FPEA 4P82A 2GVZC 1ISSA 2Q8PA 3A1CA 4EGAA 4MS3B 1KSHA 4UVIA 4PR0A 1ZOSA 4Y2GA 2R4TA 2I4RA 2JBAA 2AMJA 3I9JA 3QPVA 4G0MA 2BONA 4ZZ1A 2NP7A 1NBOA 3N6VA 1ZM3A 4G0QA 4MV5A 3N2LA 5K45A 2GYYA 2XDQA 3BTOA 2A58A 2NNWB 3WLKX 4E14A 2PE5A 1TK2A 1UMDB 3KUXA 3OKCA 4QFDA 4O3FA 2P68A 2QRUA 2AI2A 1IJFA 4L4RA 1N2HA 3SVLA 3URKA 1KFJB 3F6PA 3TE6A 2BFDB 1MB3A 4OQPA 4AX8A 4ZGBA 4BQRA 5A4IS 2OZKA 4G0WA 3JAKB 4FJ1A 4HB3A 2XB2A 2F59A 2CZGA 3TDNA 2AN9A 4WSOA 1U99A 2Q3CA 3IV9A 3C8HA 5G41A 1L6RA 1GQOA 4X93A 4C21A 4HOYA 3EEOA 2BH9A 5AT1A 2FETA 3ADPA 1GCGA 3CR8A 2GJ8A 1EGHA 1IE3A 3EVTA 3OO0A 4AKSA 4ZO7A 4J4HA 4DMCA 1JVBA 1ULHA 2H57A 1M0WA 1SKAA 3NBKA 5EJIA 3BILA 3ZDEA 5I01A 1CJBA 5CLGA 2PRJA 3CFYA 4N47A 4LI0A 3LH5A 2E55A 4B82A 1JA9A 4GGPA 5K6AC 4DNXA 3SJUA 2X9NA 1A8SA 1KZGB 3EC2A 3HCRA 3RT7A 2Y92A 4YWJA 4H17A 4UHJA 3V7FA 1EZ1A 3BXHA 3V7YA 1C3LA 3RYCB 2O3UA 2P7HA 1P33A 1A9QA 4TX1A 5EIXA 5I7UA 3WZMA 2BGGA 2ZYAA 1W85B 3BD8A 2AJBA 4F06A 3LKZA 1LBSA 1KZ6A 1X80B 2OGTA 3OZXA 5BT8A 5KVAA 1H85A 3P8ZA 1T4MA 1FXUA 4D82A 5FUBA 1P1RA 4LJ6A 1B6RA 4FKMA 4MLCA 4FFLA 5FFFA 4G01B 3T7DA 4AY3A 4OX9Y 4V03A 5DNDA 2XZTA 1E1CB 3AF2A 4N5HX 3SDZA 3G8CA 4ENRA 1Y9EA 3CIFA 5CFOA 1T1GA 1LSUA 5HRAA 3O74A 4YR7A 1TAQA 1PJTA 3IA7A 1G6HA 2F1JA 2H4HA 3NATA 1ULTA 2D1SA 2R2GA 1YOBA 3LC0A 1SU8A 1JN0A 2FZ4A 3F6SA 1TQ4A 3ICCA 4NABA 4F72A 3MZ0A 5GONF 1R10A 2NSDA 3KPWA 2OT3B 5CT4A 1ZMRA 1P2VA 2JEZA 4BGEA 1E3SA 4PG8A 2MT9A 3KJQA 1M6HA 4HNGA 4UNIA 5KSYA 1U2GA 2NUTB 5IBRA 4YAUA 4KX3A 3TQOA 4MYTA 3CG0A 3PJRA 3SK0A 4KOAA 1N7HA 2W6OA 1PBTA 1P3JA 4J3NA 1WEHA 3ETEA 4FGSA 4U39A 1ORHA 1MJGM 3X1YA 4BX2A 4EA8A 4F7WA 4NX2A 3ZTTA 3OJOA 1JU9A 3GGGA 4LXGA 4NE9A 4DC9A 1CZNA 1JAZA 1WA5A 3HY3A 4R1MA 1EE9A 1P6QA 1A2BA 1MX5A 2R48A 4QUGA 5EMHA 4X85A 2R7AA 3PQ8A 3QFTA 4K6GA 4C30A 3SOPA 2QW0X 2YASA 4YRQA 2FPGA 3A1UA 2J4CA 3UUGA 4JLVA 3ILYA 1D2HA 4G84A 3HUEA 1FQKA 1NUHA 1G42A 1JBKA 4CMJA 4I36A 4DCGA 3W7VA 1B73A 1YTLA 2TRSB 3BHJA 2AEFA 4HEA6 1ZJJA 2A0YA 1NVUQ 4FGJA 4F21A 1UT6A 3DEZA 4EJ2A 4RTSA 3TOXA 2ZBUA 3PLRA 4FD2A 3RK1A 3ZC3A 3WLLA 3LVBA 3RUCA 4LECA 4GUDA 2ODQA 2XRYA 3D6MA 1DBQA 2XD9A 4QQKA 1KOFA 2HV8A 2OVFA 3IHTA 2IY9A 2NO4A 3RTBA 4CKEA 2HSDA 1NUAA 4AJ2A 3UWDA 2G8LA 3DLHA 3FN4A 4YJKA 2GFHA 3ZHOA 4F4CA 3O82A 5DGCA 1HQKA 3KPYA 5ALIA 4BNZA 3VPBA 3O3MB 3I62A 1NI4A 4AZSA 3JX9A 2G1KA 4HVTA 2NLOA 3KD2A 5KTOA 3ROKA 2PSSA 4IIVA 5KOJB 4P4NA 1FTGA 2PQMA 3QVJA 4Y98A 5A7FA 1E2NA 2P6OA 1S9DA 3OLZA 1ANKA 4LY6A 5BMOA 3MCVA 4Q01A 3C3DA 2XR1A 3QJGA 3ADKA 4JC4A 1JG4A 4BX3A 4D0GA 2NPIA 2YQZA 3BYZA 2GI4A 1MJGA 2AR9A 4BAZA 4BO7A 2PQ0A 1EVIA 5GINE 2ZG6A 5B12A 5HNKA 1UKCA 4N03A 4XWGA 1Y8ZA 4NFLA 2P2CA 4B47A 4FR5A 4GP6A 4L9WA 1YL5A 4IILA 5SZIA 1WDWB 4D4HA 3RB8A 1RCUA 1JHYA 1SGWA 1U4SA 1VMKA 4JD5A 1CJMA 4TV9A 3SC4A 3VU0A 1Z0DA 4GQBA 4ALMA 2D2VA 3RD5A 1WW3A 5LZ5A 3B1KA 2ZBQA 3KE9A 1L5WA 1GP2A 1P3DA 2FPOA 2JIBA 5E6SA 4AP5A 5BMVF 4JJ7A 3OZ7A 1Z22A 5GZ3A 1P7YA 4DRZA 1NPYA 4BGUA 1FZTA 5DMXA 3KXLA 4MQEA 2VPYA 2W37A 4IMJB 4EG3A 2ZCJA 1E2DA 3CRZA 3A4YA 1ISHA 1SEVA 3LFUA 4W7IA 4JDPA 2XMZA 5D5QA 3WGNA 2P62A 4A0HA 1S3FA 1YMUA 2IRWA 3BDVA 2CLKB 3TOVA 5DKFA 3FD8A 4LCBA 3U3KA 4CGZA 1M1YE 4NH0A 4CETA 4MTCA 1I3LA 4V38A 4EYKA 2RI0A 4NPAA 2QDXA 2JAPA 1N9GA 3CU5A 1NKVA 1GUFA 3LLMA 4M0LA 4P3YA 4C5BA 2X7HA 4A9AA 1IK6A 4OYYA 1I7NA 3AI2A 3UV3A 4Q15A 2DPGA 2ZS8A 3FUWA 3COSA 1B74A 2C04A 1QP7A 4KXYA 1D2EA 1TU0A 1EDOA 3F8TA 5F3WB 5LQNA 2AC7A 4OQYA 2YOFA 3QUSA 3V4LA 4LYDA 3BB4A 3DYBA 1E0KA 1TKRA 1H66A 2DJ5A 1YA4A 2OZVA 2FN4A 3DO8A 3EZ9A 1HE5A 2D00A 1H6DA 4F4UA 1R0ZA 4NMWA 1L1FA 4UAJA 3DM5A 4UEJA 4QYWA 3GELA 4TN5A 3P32A 1IB6A 3A3YA 3GHHA 4C01A 1PV2A 4MO9A 3SKXA 2IF2A 2OFOA 3UC9A 2R6JA 2Q6LA 1AUPA 1DMRA 3HWX1 4GMHA 1FFAA 2GEKA 2PH1A 2WV7A 2FW6A 3S2ZA 1VMEA 2C8LA 1T1RA 3X1DA 5I4IA 3QOYA 1CK4A 1VG0B 4JKOA 5B5SA 1O3YA 4V24A 1I3OA 3UC5A 4A0QA 2FSSA 1Q7RA 1H05A 1K06A 4M98A 1YJ8A 3L4JA 2H16A 2OG1A 1NBEA 1R8SA 1XRRA 2MR5A 4KBGA 4P53A 3FF4A 3SE0A 4IZIA 4QARA 1L7RA 3AIMA 4JMPA 3M6LA 4UXIA 1N78A 4HSEA 1Z68A 5SYMA 2ZYIA 2FUNB 3WISA 2FDRA 1HTWA 3DQZA 5AP9A 1Z47A 1HFEL 3V55A 3WYAA 3L7AA 1IBMB 2ZPTX 4Q39A 1KVQA 2PCLA 2QLFA 4FQ5A 5DSXA 4XYGA 1NVEA 1X8LA 2V6FA 1NXVA 2QE7D 4XSGA 2VC2B 3KXDA 3P26A 4WCVA 3L7BA 4ITRC 1ZD2P 4E88A 1XZDA 3DMPA 3OT5A 1RQPA 2BI8A 4IUDS 3H99A 3WK4A 4CEJB 1NRJB 1GLVA 5EP1A 2NTVA 4E5UA 1HNWB 3ELUA 4O8CA 1Z3IX 1T0HB 3H2KA 1P5FA 2VAVA 1GGEA 3DBOB 3EIWA 4UAUA 2O7QA 2RJ3A 1U0GA 3DWGA 4OI2A 4OLBA 4DLNA 4EYGA 2X86A 4TKUB 4F9TA 5JRDS 2VL7A 4AUMA 4LBVA 1V5EA 2W0MA 3IE1A 3L6EA 1G6OA 1JLLB 3KJZA 4RKRA 1RJFA 2ENWA 2D5BA 3DBRB 2IDJA 3DOOA 1SBYA 4EHBA 1OLUB 2W2KB 1Z5PA 5IF3A 2QGZA 2QWXA 2QY6A 3CTMA 1AZWA 1PWZA 2JLUA 1MAHA 4BKOA 1G8KA 2JDID 1NR1A 1RAHA 4HAXA 2FFBA 2FLWA 1LLDA 3B3JA 3VSEA 1KIFA 4MUEA 1WS6A 2WWRA 4FFVA 3WX0A 6ABPA 1CIJA 2J3QA 4TUYF 4B5LA 2BYTA 4JBNA 1U8FO 2VATA 3QTTA 1RWOA 1MQSA 3MJEA 5AW8A 3BXOA 2ILTA 3NHUA 3CO5A 3OTIA 3L4EA 1CV2A 3MELA 1P7VA 5AKGA 4BNKA 1PEAA 3I12A 4JBGA 2DOKA 4TSRA 3R5FA 2ECFA 3TRJA 4MHOA 3U9SA 2FAXA 4BY9E 1P9OA 1GNQA 1PKEA 2AW3A 3OEHA 5C8YA 2ZIVB 3ORHA 1Z5GA 1I3NA 1VYHA 2ZVJA 5EXSA 4B7CA 1ICEA 1R0SA 1WDMA 4GWKA 2W8BB 3IE0A 5A0TA 1T6BY 2YYSA 3KBOA 4TYYA 3MWLA 3SD7A 1N32B 3THOA 1E3WA 5CT8A 5K0LA 1OJ7A 3CIOA 2QTCA 2X6QA 1FY2A 1VGQA 3EOZA 3PT9A 3DLAA 3KIPA 2WM3A 2XQVA 4URHA 5DF1A 5LZ8A 4B2YA 3U7FB 4GPTA 1XGKA 3T0IA 5CCBA 3JZMA 5DT2A 2GM3A 1NJ2A 1HWYA 3MIIA 1N2JA 3M4ZA 1YFJA 2ZQZA 3DKKA 4L5YA 5C52B 4B6EA 1G8GA 2H1CA 4C43A 2XOKA 1EUDA 1X9GA 3JQBC 1GO2A 2OZLA 3GCXA 3LE8A 4RJIA 4TMKA 5E3JA 4F2WA 2C88A 4X8HA 2O07A 4BFWA 2C0QA 1HK7A 3NGMA 4IG4A 4B3DA 1FFCA 1YZFA 2HPAA 2PWZA 2VP4A 1XKLA 3IP7A 3TMAA 4IP0A 4YJHA 2B7LA 2O3JA 1H22A 1HKHA 4Z3DA 1KJNA 2I99A 2B2CA 2GB4A 3ANMA 1RXWA 4X90A 2G6TA 3ETHA 4HQRA 1XTRA 4L5AA 1GR1A 2WT9A 2Z95A 2VAXA 3DHYA 3PD1A 4JEHA 3MJCA 1Z29A 5KYYA 3ZHXA 3IGFA 1JNXX 4RY0A 2HLNA 4AN1A 4CIWA 5JYDA 3ZS8A 2EFHB 4PLCA 1AKTA 1M2VB 4HC4A 3PUYA 3T9FA 1IXYA 2C2XA 1C8BA 3GG2A 1E4EA 4HL6A 5DM4A 4OQDA 3IAXA 3ZS9A 3NV9A 1D3AA 2WF8A 4KQMA 4R6WA 1DQPA 2VDVE 4P54A 4OATA 1K0UA 1RQRA 4KK3A 3UTDA 4YC7A 4ENWA 3CW9A 4KFCA 5CBKA 3EVBA 5LOVA 2WJVA 3PEUA 4JEIA 2D4HA 4FYXA 1YJ5A 2E18A 2GH1A 4OQMA 1F7UA 4Z99A 3FSJX 4B4WA 4JB2A 4LXIA 5GAJA 4BC0A 3EF0A 4XX0A 2AXPA 5CYFA 3SJ7A 1ZKDA 1CR6A 1AV7A 4FD3A 1P6UA 2XCSB 3SZOA 3RAEC 1UKVY 2H0RA 1MEOA 3C3AA 4HDQB 3X43A 3U0VA 1AK9A 1B8OA 2AOWA 3CH5A 1PTJC 1CD5A 1MRNA 2XECA 4Y2UA 1GTZA 4CEIA 1C7RA 1CYEA 2GWRA 2FMIA 3JYNA 3KLPX 1B1CA 1VFPA 1EA7A 3V32A 2OC4A 2XXAB 4MRSA 1X15A 3C70A 1KH1A 4Q4CA 2WWWA 4PX3A 2IA5A 4ZT7A 3UQZA 3GDFA 1QVRA 2JFYA 4WOCA 4E11A 5LN1A 3GLFE 1G0OA 4UHEA 5HOQA 2PJRA 1JLHA 2XV1A 1E2IA 4TTJA 3HXTA 1PJQA 4LQLA 3QWHA 5AOAA 1MJFA 1ZU4A 1ZP6A 1VPDA 3IHLA 5FNVF 4Q1AA 5FPPA 5HBRA 3EFOA 4KMRA 2CF6A 5JQGB 1XPUA 3QZUA 5ES3A 4WEOA 1CUAA 2QRQA 1I8TA 1CY0A 1YCDA 2FJPA 2RC5A 3GEEA 3KU1A 3AFOA 3LOPA 3O1LA 1Y7IA 2WG0A 4O2BB 4RK1A 4P38A 4M1WA 1A71A 3VNQA 3JQ6A 1GAQA 3D43A 3AF5A 5B36A 2WWYA 2JFOA 5TEWA 3WYCA 4R84A 2HA7A 3JWJA 1ZDMA 2IW3A 3MJVA 2O0LA 3SG0A 4EHIA 4L6IA 3ZD8A 4F9GA 1KK0A 4LX8A 2A6PA 3D64A 2Z3WA 1PJ2A 5LP1A 1IVSA 1TZ2A 3K94A 2GK6A 3QVXA 1OTYA 1YVDA 2QG9A 1HV8A 3DDWA 2HIHA 3NZEA 2YBDA 2YHIB 4HNSA 3TVTA 2CXXA 3VSAA 3RFXA 2FWJA 1V5GA 2PHZA 5T3YA 4OQFA 5DWQA 3CWCA 1WU7A 1XLUA 1HUQA 1L3IA 1NNLA 2OFXA 2PNFA 4IJUA 5KPJA 1I14A 1D4OA 4M99A 2QX9A 4FEAA 4TSFD 3PWSA 4HDRA 2PLNA 3W5DA 2O5RA 4IHAA 5DOZA 1JXMA 1U0RA 2WJPA 3B1WA 3DVAA 2XIJA 1WCYA 2PJDA 3GAMA 4QXPA 5ESDA 4R9SA 1TIPA 1I5OA 2W22A 2G28A 5CNMA 1Y6RA 4KFTA 1RBQA 2NPFA 1W0JD 2JFBA 2WIGA 2ZXFA 1K5GA 1VECA 3TG8A 3WDSA 1M1NA 2PUFA 3EVZA 2VRNA 1NGSA 2PLAA 3IVXA 3RYFA 4I8IA 5CFPA 4P1ZA 5JVDF 1Z4OA 3W0LB 2R8EA 2ZUFA 1D07A 3F9IA 4X62B 4OB6A 5IJ9A 1J1UA 1CIPA 4FMBB 1GD1O 4EA6A 3GDOA 4JFRA 3GFQA 2XEDA 4C7OA 3UN1A 1XD2B 5JDIA 1KEEA 3EBLA 3GZJA 3KOYA 4LE0A 3ZD9A 3U7RA 5A4JA 3FOFC 2R66A 2A1UA 2CHUA 1QVZA 4Y30A 3TD9A 4ZYLA 4ZOQI 3ESAA 1T4CA 4LNUB 3RFVA 4QNNA 2VNKA 2I3AA 3DFUA 1P0MA 2HQOA 1NTOA 1P1JA 3WKBA 1C4XA 2X0KA 3DB2A 2OCKA 2DBYA 3ENVA 1W48A 1UBEA 1CERA 3PFFA 4L8GA 4RY9A 2RKBA 3VDQA 2RD2A 2DEUA 4E31A 5CFRA 5AKJA 1YS4A 3HN6A 1IJEA 1RWVA 5G2OA 1FMCA 1C9MA 4JXJA 3TAHA 3OETA 3QUBA 3CHYA 4CV0A 3LW8A 2GZ1A 1AXRA 4IDDA 1FZQA 2XCOA 5THXA 2R00A 4KPGA 2HQ1A 1V41E 2Q2WA 2L42A 2V7QD 1MMFB 1VPLA 3O95A 3UFXB 9ABPA 2YV2A 2HA4A 5DTIA 1KI2A 1U7OA 1VL1A 4OHPA 2YWJA 3DKPA 1QMPA 2FW1A 2HJ9A 2CYCA 4PVDA 4BMZA 3SI7A 2E89A 3A6ZA 4UM9D 5B7PA 3KSAC 5FV7A 3AO0B 4EPVA 5F9FA 1O96A 5JWOA 2CNOA 4BO5A 2Z8YM 3AL2A 2ZM6B 4KR7A 1QG0A 5SICE 4HLUA 4AUEA 4CCYB 5A3JA 1CJTC 2I7CA 4R1NA 4I4LA 1SNYA 1K8RA 4J16A 5IT4A 2ZIEA 1TTTA 5A5VA 4FMDB 4BLOA 5K5EA 4UFPA 4NZNA 4U4AA 1ZH6A 3UMYA 1PR1A 3IMKA 1N6OA 3GL9A 3LY5A 4J6FA 2X4GA 4R2LA 3P0IA 3KVRA 2HMSA 5JS7A 1L5KA 1L8OA 4IJVA 2PMFA 1DWOA 1C3VA 3N76A 3PDWA 4LUCA 5DK6A 3ZXIA 4A7PA 2NAPA 1O6FA 2EYUA 3PS9A 2GEJA 3TG2A 4NENB 4ZYUA 4ZT5A 1KOLA 3HGMA 4MMYB 2CMDA 5M3BA 5GONA 1L5GB 1HRDA 1T6NA 4KDCA 3EIHA 2B61A 5E9WA 3GH3A 3W2HA 1YQXA 3D0RA 3MRSA 4XVUA 1XDZA 1I7LA 3IVAA 5AW0A 4HUQA 2Z0MA 4FGUA 2VF2A 5K0CA 1K6EA 4M6WA 1OXSC 3HJBA 4KWIA 1K89A 5AXDA 5KKAA 1DVRA 3AFIA 1HYEA 1LY1A 2FGJA 4WKPA 3F4LA 1FRFS 3EDCA 3UYKA 3OJWA 3ZK7A 1UJ5A 1W7AA 3ZJVA 2P3OA 5CH5A 4Q3LA 3KLOA 3ZQ4A 1I2CA 1KVUA 2ZGVA 1KYIA 4GI3A 3QBTA 5JAPA 3Q8LA 3Q10A 2WJZB 4F60A 3GBPA 4MAMA 1ZM4A 2A57A 3DXXA 3FFBA 4OHFA 1KMHA 1R0CA 1MIHA 2BM8A 5AVVA 1J7KA 4KQGA 5JIBA 4OREX 1N8KA 3TRHA 1RHQA 2AFVA 1WMFA 4ZVSA 1CUYA 3VYSB 2Z8YA 5L45A 3EOBI 4JC5A 3WKDA 4KN5A 3ZX5A 1F0KA 4LDRA 5BYKA 3DL7A 4U5QA 3NTRA 2PR2A 3KSMA 3K9HA 3L4SO 3OQVA 3PFWO 4MA0A 3R9XB 1E66A 2GS9A 3EW7A 3UJDA 4AZVA 1ISPA 2VLIA 3WGTA 1HG0A 1SHUX 1EM8B 1KSGA 1A97A 5IZ4A 4HLUC 4FYPA 5DCLA 4BJ3A 1HEYA 2G09A 1F1BA 1PJBA 1NNI1 1QIJA 2PBFA 3HWRA 1SBTA 2JK0A 1ZK2A 2W6ID 1TM7E 3O8OA 4J16C 4MRAA 1XZJA 2FPPB 3A3NA 2G9QA 4OQNA 4PAOA 5E8RA 5CDTA 4DLXA 2Z8ZA 2H0AA 2YYYA 4Q4AB 2M6KA 1J24A 4KEAA 1K8XB 4DWWA 5EE9A 4IOLA 5EMNA 1E6MA 4MCAA 2HWUA 5FKJA 3NNSA 4H4DA 2QD2A 2WUVA 4TWZA 2R84A 2EL9A 3H1AA 2PYDA 2CJWA 3IEKA 3HCBA 3FWZA 3RU3A 3BZWA 5CHYA 3D4IA 1P73A 1J6UA 1YCGA 4WJKB 2BHRA 1TCBA 2ZJBA 3IAAA 4PAGA 4AMYA 2FP4B 4XXHA 4EJSA 3E3OA 2CJYA 5LKAA 1N5RA 3OY2A 2IZ7A 1QVVA 3KL2A 4WK0B 4CPDA 1I94B 3B3AA 1P77A 4QA9A 3HKEA 1E62A 1YULA 1MW8X 1Y8RA 1JQ3A 1EVKA 2YW9A 5JAQA 4DILA 3HR7A 4US2R 2ZRAA 4ZPJA 1KPHA 5I7RA 3BC1A 1NC1A 4PLPA 2O2XA 1QGYA 2YVKA 1U3FA 2O7NA 2VJMB 3CX7A 4U2CA 3R0ZA 1LJUA 5JPDA 5LA6F 4E5VA 1IUNA 4FT4A 3AB3A 4GX2A 3KKZA 4P2BA 3UXHA 3CGGA 1JAXA 1JS1X 2BBWA 2I3ZA 2XQKA 1C0KA 1NOJA 5DSZA 5AO9A 3GFPA 4BQOA 1F14A 2ZBRA 2AZ4A 4BB9A 1JR2A 3DCIA 4NHEA 4YP0A 4C4SA 2B4TO 1L1RA 4OQQA 1EXMA 3LKDA 2QA5A 1J1ZA 4DUPA 2FX3A 1Z0SA 1FF9A 2XOEA 4JWTA 4FJ0A 5CVTA 5KOYA 3P2YA 5J1TB 5HIIA 3LDGA 3EXHC 1KL7A 3L7JA 5HIMA 4U00A 3ZJYA 2Y76A 2NUPB 3OHPA 3CZMA 5FB3A 1GTL1 1KTIA 3IMFA 4ND1A 3WHPA 4ZVMA 4RMNA 1AQNA 1XC7A 5BV1A 1VMAA 1GZ6A 4RANA 1N1EA 5F73A 1RXYA 1KQNA 1TO1E 2M1XA 5BSUA 4FZRA 2KSQA 4CQMD 3H2YA 1G8AA 1TW3A 4JLAA 4TRRA 3MFQA 4IL5A 1ZX1A 3PNKA 3V8EA 2ORWA 3PUKA 5DXJA 2FR0A 1R4ZA 3MTBA 4DLWA 4UNSA 4EYEA 2VHVA 4G07A 4UM8B 3Q0TA 1Z08A 3CNNA 2Y8EA 2AH5A 1WCWA 3OLWA 3A9TA 2I2WA 1RS0A 5BR4A 1GPYA 4TKLA 3A2NA 3ZDFA 4F3CA 2NSHA 1ZCFA 2FLVA 2FR8A 3M6MD 4BX9A 2ZUEA 5G1NA 3GUZA 2P0YA 4EJSC 2GHRA 1V9SA 4KBFA 4CG0A 4FOPA 3FTDA 4F86A 4U7PB 1QGUB 4QHTA 5CHEA 5HFJA 3WBJA 3G0IA 1UZMA 3SIWA 4EB6A 3Q4GA 1NX6A 1HZZA 1N9KA 3QMMA 4BCCA 4FNMA 3H9JA 4YREA 3C43A 3RC9A 4HDSA 4DIUA 2MINA 1F1JA 2Z2KA 3A9UA 3VR2A 4MRVA 4CG1A 3KZ1E 4XRGA 3O31A 4LRWA 4AMVA 1LQTA 3PNBA 3DAHA 3KJGA 5LQSA 3EVAA 3SEFA 5KQSA 3PDJA 4QBHA 4H6VA 2QMYA 1IPFA 3EEYA 4HLQB 4Z86A 2ADMA 4YMWA 1L5VA 4K6CA 2YHSA 1OA0A 4PWZA 4YR9A 2X4DA 1EFTA 3AGPA 4PRKA 4RM3A 1G9SA 3ODPA 3OQIB 3L7YA 1H4SA 1UBJS 1ZUWA 2CJFA 2BFFA 3MCAA 1KEVA 3TR6A 3DKVA 3TN7A 4H77A 4PIPA 1ST2A 4NIMA 1XQ6A 4D4KA 2AR0A 4R16A 4J1SA 3C8UA 2Y0BA 3A9CA 3AK4A 3JASA 3RIXA 1L5QA 4MGIR 3GFVA 3T5PA 2XDAA 3VI3B 1G2PA 4KE7A 5DOVA 3UB4A 4ND6A 4NCKA 3AESA 1GA4A 3RS2A 1X7XA 2YCBA 1RP7A 2O2GA 2WJYA 3PEVA 3V42A 1CRLA 5PNTA 4TUYA 2O8VA 3P9KA 2FR8C 4N48A 3VSBA 1VE5A 2JJ1D 1R3UA 4F12A 1L4HA 1SXJE 3C45A 5DN6A 1WAMA 1XZQA 2I62A 4HDKB 1BMFD 1R4NA 4N82A 4L4UA 4ZO4A 1JTFA 3KZXA 3QNWA 3VPFA 4IWYA 4YBRA 1CEEA 1T2EA 1NBMA 3O2QB 2Z1NA 2J31A 3R9IA 3L93A 4YGXB 5DW0A 4Z4GA 1BD4A 3HJFA 4XUDA 3RBZA 5CB6A 1SXJD 2HR1A 3IQWA 4LFAB 2PXAA 4OMCA 1W4ZA 1USGA 1YE3A 5TJHA 2C59A 4MQFB 1C80A 2VKQA 1QUFA 3QHQA 2O2DA 2JLYA 5CVEA 4JJKA 4LZZA 4YHBA 1GRQA 1ZUHA 3A32A 4FE7A 5JRJA 3UIEA 4XDZA 3L8MA 3H4MA 3TSZA 1RTKA 1KORA 1WHSA 2ZU6A 5FI1B 4D9KA 1HX7A 1GGKA 3P96A 1BJTA 3OO1A 1E61A 2YJ6A 4OYRA 3OLVA 1YUNA 4BB6A 4BS9A 2M32A 4J1TA 1KDPA 4M87A 4JBWA 4DDVA 1EK6A 4CT4B 4HG2A 3BIJA 4NFYA 3S2IA 1ADJA 1QGZA 2FPMA 4HQOA 5HILA 1JWLA 1P4AA 3M6WA 5JNUA 4LN1A 2FSFA 3H7AA 4PC7A 2ATCA 4RENA 5L4NA 3MAJA 3QM1A 2R1UA 4LJ9A 3TMYA 5F5LA 2J45A 2IHTA 1NT4A 3ZDYB 3VA7A 4L8YA 4HADA 3NCHA 4DANA 8GPBA 4B85A 5EE3A 4NZYA 3RFUA 3EXFA 3K1AA 3ECCA 4IQ8A 4CTKA 1YUBA 4GP9A 1RM5A 5LQMA 2J0UB 3FJ1A 3WLOA 4QGSA 4G8BA 4L5IA 4HGNA 2J0VA 4OHKA 4Y2SA 4D41A 2JIZD 2XNDA 3S1AA 2EV9A 1PI3A 5K8VA 5JD6A 3HU3A 4OO3A 1U7ZA 4JZKA 4QDOA 4RPLA 2XH8A 4B0OA 3O7MA 4Q3NA 4YCSA 2XGSA 2X3UA 1NMZA 1DJOA 4BX0A 4C87A 4UARA 1E3JA 1E9VA 1ZISA 1NT2A 4YMHA 5AUNB 1XG5A 1MC1A 2IUFA 2JAUA 2IHZA 1IBSA 1C29B 1PNTA 5BQ3A 1PV1A 1J2JA 1WUTA 4EO7A 4ND5A 4ND8A 1PZMA 1NYQA 5FH9A 3ZJTA 2AMLA 3ZDBA 1ZYUA 3B89A 5L4LA 2NU7A 2ZANA 5FOQA 2PCJA 2B3DA 2DR2A 3HXMA 1Q0HA 2BFNA 4ZOLF 3OTQA 2J08A 5CBPB 4BO6A 1KARA 1WV0A 4JLWA 4B31A 2J9XB 3KP1A 3I2GA 3WLRA 4UBMA 4AO7A 5JJBA 3COWA 4KQWA 3K4HA 2EGHA 5JCOA 2MYTA 4F93B 1UBFA 2CLEB 3HJTA 4Z6KA 2HMWA 2RIRA 2VT3A 2HXSA 2Z9DA 4TS9A 5CT5A 5FPTA 3EXIB 2PT6A 3LV8A 5DHTA 3REOA 2PS0A 5K6TA 4A36A 3Q6IA 3PQDA 2H48A 1Y42X 2QTLA 3RYTC 1Y6JA 3GYGA 5KTPA 2B5OA 4MWGA 3AG6A 1THMA 3W2FA 1JTEA 2DUWA 3IHKA 3E5HA 5JBNA 2CDRA 2WAMA 2YRFA 2FZVA 3ZKAA 5EJ9A 1G20B 3EBOA 4W5OA 1EZZA 2C4KA 4R68A 5B1EA 1RC0A 2VBFA 3DE6X 3E7WA 4G5FA 4BBAA 4O5AA 4NY1A 1R6AA 4MO2A 4OGKA 1YJCA 2VA9A 5COQA 4RH0A 5CEJA 3IX7A 1NURA 3IQHX 3FTEA 2W4MA 4DZZA 3KDSE 5AHOA 4MGYR 4ZCQA 3WRXC 4AMUA 1ZJZA 3FX2A 2QLNA 5CD1A 2PNJA 1LRKA 4FYIA 1H2YA 3H9GA 2IUSA 2K6GA 2WPDD 4XFKA 5AUQA 1H8HA 3ZXYA 4B6OA 4TL7A 3M70A 5A9SB 2LP4Y 2POQX 5J4YA 1Y5IA 2PEZA 4PLTA 4HNAA 3THRA 3QVMA 3D3KA 2A5YB 3CC8A 4JLSA 2BUAA 2ANCA 2XE8A 1D2NA 1DRWA 4GL4A 4PX9A 2ZKIA 5COAA 3T15A 2CWDA 4B2PA 1O8CA 1U2QA 1VJGA 3HP4A 3IIKA 3BAZA 1A9OA 1TYZA 1KVSA 3QPUA 4E32A 2LZ0A 4NCIA 1ZSYA 3W8NA 1AMNA 3TNYA 5DN9A 3ZNOA 1V0JA 5LD2B 1KAHA 3QFFA 5EFZA 2UZIR 4AUNA 3OZTA 4INAA 1NNSA 1NUSA 3L07A 4UJ5A 4HNTA 1EFAA 1ZUNB 4H7PA 3KYDB 2BMVA 4HK4A 1TRKA 4YLGA 2ZVPX 3MHTA 4RA9A 1YQWA 3VHRA 4LSWA 4WY2A 3SHWA 4CF5A 1EFVA 2GN8A 2BEKA 1E89A 2OHFA 4LTNA 4XGNA 2IHJA 3UK6A 4G1MB 5JVDA 1GLGA 1BNCA 2FWBA 3OSZA 3OBIA 4BNVA 3EDRA 1XN4A 3H0CA 3ELDA 1P0QA 2HNKA 5HYVA 2FPXA 4A6XA 3OUZA 4JP5A 4LPKA 1OLXA 1MOPA 1H94A 3BMCA 3JARB 4KUHA 2V6GA 5A0FA 3TQFA 3DOIA 1OFIA 3BK1A 3M3HA 3NT2A 3WJ7A 1WZUA 5LZ4A 4LF5B 3EG9A 4WN9A 5SYNA 3DDCA 2NIPA 7REQA 1NTRA 4JC8A 3PB3A 4W8GA 2F1HA 3A28A 2IGBA 4OY3A 2JFQA 1OH5A 2G9RA 4XDHA 2UV8A 4AK9A 3SLGA 1OA1A 1FJGB 1UBKS 4MYUA 2FN7A 4RD6A 4ZAXA 5IVIA 3FNRA 4O4HB 5DXAA 2Y68A 5LC1A 1U65A 3GPDG 3IV7A 4IZ6A 2OG2A 3Q8WA 2AVNA 5A3VA 4R2IA 4JLOA 2JANA 3FW1A 4YGYA 3QBEA 4J4TA 1K92A 1SCDA 1TVMA 1Z4KA 2PWYA 4B7ZA 5HJ5A 4GRDA 2HJWA 5IABA 3IDAA 5CFMA 3NBQA 4RDCA 2AJTA 2JHPA 4XX1A 2DU8A 3LK7A 1ZCBA 1KEPA 2ZE8A 3MT0A 4AG5A 4DIEA 4KE8A 4YP9A 5HMLA 3OZIA 3SQLA 5FL7A 2XYPA 4MW2A 8AT1A 5HG0A 2J9GA 1HT1E 1YC5A 1MVNA 1V3TA 2BAGA 1GFWA 3UFBA 3BIWA 4EBFA 4FDLA 4JLJA 5I7EA 3R6TA 4GMFA 4LQCA 4U6NA 3VJRA 4RHTA 3E1GA 3EASA 3WAKA 4DV0B 3R4CA 3ZDXB 1BVHA 2V7BA 5IT0A 3VAZA 4JI4B 3C3EA 3HYSA 3B2NA 1OJLA 2VP0A 3AF4A 2WYIA 6CHYA 2VSXA 1L5MA 1QKKA 2JA2A 2PZ8A 5JS2A 1F7VA 2DLCX 4B7UA 3AEKB 5DCWA 1P91A 1C2YA 4P7FA 4OGWA 1W87A 3SEQA 2G04A 3LPLA 4IGIA 3TW8A 1M5RA 2YVUA 1GGMA 1ETHA 3UB2A 4ALIA 3TM4A 2CHGA 1DFHA 4DQXA 4YJGA 1IHDA 2VDKB 3EZ7A 3IURA 3LVFO 4Q34A 3TBFA 4IX1A 1T9DA 4IIUA 1N0IA 2NTYC 4RJKA 5EIWA 5IZCA 3RLIA 4E5KA 4DDTA 2QGFA 4BOYA 1YDGA 4FYYA 2LV8A 1L0BA 3MEQA 3NRCA 4D8UA 4ZVKA 4BTVA 3K9FC 1LBHA 3CVOA 1XNHA 4JUIA 1YRBA 4PU0A 3R7NA 2Z4TA 1DTSA 4FONA 1M6NA 4JP3A 3FPBA 2OXRA 3CEPB 4NMLA 4Z3OA 2RONA 1TYDE 2EBHX 1IMOA 3X1XA 3N07A 4YXWD 1ZLXA 2ATIA 2HX1A 5HDBB 2WVHA 2JLRA 4HV4A 1EXDA 4TMWA 1GT6A 3AFHA 3MWDA 4Q7JB 1Z15A 2HUNA 4PO1A 5HGJA 1H5QA 1VLZA 3BN3A 1MC4A 3R1IA 2CBXA 1XF1A 3GVIA 3KC2A 2I6QA 2JKZA 2OFWA 2A5FA 2Q1SA 4O02B 3FZNA 2YIJA 4INPA 3TL6A 5CB8A 2VA8A 3ANXA 1U11A 4KPFC 1XLVA 3BSFA 2OV2A 2ZSHA 1VBMA 3NXSA 3OD1A 3U60B 4GR9A 1NXPA 1JU4A 1U94A 2X1MA 3ZTWA 3I1YA 3PD0A 2ZIZA 4YONB 4AMBA 4EA7A 5ARDA 5CIYA 3WWPA 1K7EB 4FHEA 2TSYB 4Q9LA 3ULKA 4MX8A 4X20B 1NA5A 4ZALA 1SC1A 4BP3A 4EZBA 4X66B 4CM8B 5AKIA 3WNBA 1RPJA 3U09A 3EHEA 4Y9SA 1XTQA 1IBKB 1V9LA 1GRVA 1BAPA 1FYEA 2YBEA 2JAHA 4G0VA 3L8GA 5F4ZA 1F2VA 3CVYA 4DCMA 5AVJA 4FDAA 4PHTA 3TQQA 4EPYA 3JSXA 3G13A 4RKYA 2OGSA 5EESA 3TQCA 4AY2A 4LRXA 1XNRB 1MLDA 3B3QA 4QJ4A 4JENA 1VHTA 5FOSA 5JD5A 1U9IA 2HA6A 3WL3A 2OBYA 4NE2A 1X0XA 4YJDA 3AOGA 3GEPA 4ZANA 2BR3A 1JNYA 2R3SA 4AY5A 4D02A 4HQ0A 4IKEA 4B17A 4Y1FA 3VHLB 3Q3IA 3C85A 3NR2A 4ZT2A 1XTZA 2GPYA 4AD8A 1AO3A 2GKSA 1EQAA 2V0NA 1N2ZA 1UKEA 1TJYA 2ZK7A 3DBVO 4C0JA 4D97A 3WGYA 2OL4A 2CD9A 1I33A 3FNGA 1T91A 2G7MC 4R8SA 2WWGA 3HWSA 3RTDA 3TTTA 4C76A 2ZIWB 3AOEA 4Z4FA 1R9MA 1U0NA 3OH8A 1JQLB 4U1RA 3VBCA 3CKLA 3OM9A 5TPWB 1QRDA 1XTIA 4P92A 4UFOA 1PN3A 3PXAA 3WJ2A 5LA6A 4P7GA 1GAEO 2CKMA 3FJYA 4UNPA 4BZXA 3TQTA 5JSHA 4YJ3F 3P9SA 3LQ1A 3UWPA 4YV7A 3LY8A 1NDUA 4KXWA 3RTCA 2IU4A 2VBIA 4AG3A 2VF4X 4EHHA 2DR3A 4ZU3A 1M2JA 2QLBA 3HYLA 1OY1A 1RJWA 1SA0A 2XA9A 2IX9A 3SC2B 1J25A 1ULSA 4NU6A 4UDNA 2XNKA 3RM3A 4D25A 2P5UA 3BFKA 3OUUA 2QTMA 3D4NA 1SC6A 4E94A 1CUSA 4XLLA 1MB2A 3B1XA 1Z5ZA 4LWQA 4DLLA 1LI5A 1OXXK 3ZEAA 2C7RA 3EULA 3VOAA 4X94A 3TRKA 5C2JB 3GLKA 2CMGA 4UUPA 4BRZA 2P6RA 3NH6A 2D13A 3F4KA 4N49A 5EQTA 4C4YA 5I9NA 3MINA 1QG6A 2B1QA 2HRBA 4KW7A 4X97A 5NLLA 2JLXA 2IH5A 2W6PA 2J07A 4GOXA 5IFLA 2BSAA 1NP7A 1P74A 4IIXA 5AKYA 1ZMTA 5B7NA 4PGAA 4JJ4A 2H18A 1UPTA 4X8LA 3VO9A 2ALJA 5MN4A 4DLRA 1P18A 3QVWA 1M72A 3IPAA 4S1TA 4NBVA 4HEA1 2EJCA 4JP8A 3C24A 3JPYA 3SHQA 3HDQA 4WT7A 4Z8YA 4OUDB 1U9IC 3OM8A 2Q8QA 5JI3E 3VH1A 1QOZA 5DHAA 3C39A 3KJEA 5EHIA 5FORA 2G3YA 4KBYA 4TLAA 4WDQA 3RU2A 4MUFA 5TPZA 4RMIA 5K1ZA 3ZW8A 3OOJA 3T34A 1W36B 3ZGZA 4JL8A 3V1NA 2PZJA 4DYDA 2VEDA 4QJ3A 3EXG2 4OJQA 1F5NA 1TJ3A 5C35A 1CY1A 2EERA 3FTNA 4BATA 3NQ41 5FAKA 1I7QB 1XCBA 1L3CA 2FR1A 2VZ8A 3I39X 3WMWA 3WLHA 2FW0A 1D5CA 3BRCA 3O2SB 4HDNA 4R1LA 4WZZA 2GILA 2HSZA 6ADHA 3EY9A 1DIAA 3DFFA 2QYTA 4D5EA 3UMBA 2GZDA 2REOA 1ZXXA 3QHPA 4R7TA 3MWGA 2NZYA 1I4OA 2FQYA 2WPNA 3IT3A 4O1HA 3IXQA 2XE7A 3PEFA 4WNYA 3QYAA 1X2EA 3VV3A 1I2MA 4LGCA 5JAMA 5AW5A 1T6XA 4NONA 1A7AA 5ILGA 2H17A 3T1NA 4FLEA 5CFLA 1EUYA 4U7JA 1ZA1A 1BXGB 1SIBE 1HE4A 3K9BA 1UDWA 5AVXA 2HL6A 1QP4A 2CUNA 2H4JA 2WKSA 3TTUA 5LDHA 5HUQA 2XJ9A 3X2SA 5A5FA 5H9VA 6REQA 4J76A 5KMGA 1FC0A 3RFCA 5CEEA 4OJYA 1ZL2A 3KWFA 4HXYA 5BWCA 1JFLA 3GFGA 1E7YA 2E21A 1BRTA 3AI7A 3H17A 3MRVA 4KLNA 1WD7A 1M1UA 1E2FA 3GZNB 3TE7A 2BFAA 1Z2CA 3CNHA 4P3XA 4F4HA 2WNHA 4BQQA 1JEEA 2GTPA 2WW8A 1LUAA 2XQGA 5J1SB 2ONZA 2I6FA 1WZIA 3AR5A 4X54A 2IUTA 1F3OA 4IMRA 5ALNA 4ZMBA 2PD6A 2XF8A 3AKYA 4OMUA 3G79A 5I9IA 5JCXA 1YFKA 1JB1A 2YWBA 5DHSA 4CL3A 1FFEA 3L84A 3T54A 4OTZA 1NV9A 2ZT7A 4QWMA 3TZ6A 1D04A 1UAAA 1SD5A 3ZY6A 4YUAA 4CTJA 2JFZA 4WY5A 2IH2A 1LTKA 1TDJA 3X44A 1XMVA 4EZEA 1G18A 5K6RA 4IDEA 4IDQA 3F97A 3VKGA 4GECA 1NM5C 1BMDA 2UUOA 1CCWA 5AKHA 2V74B 2MWMA 4JYCA 1KWGA 1U5BB 4G9EA 5DNEA 3DVQX 5KQRA 5A6VA 5H7XA 5F5NA 1DCMA 1KRWA 1FBTA 2P4HX 1Q50A 5A2QA 3H1TA 4I55B 4WCFB 5G02A 3COJA 3MTDA 1VJCA 1Z38A 2EW2A 3BWBA 3GLSA 4FMCB 1XCPA 3UW1A 1ZJYA 1XUOA 1JFFA 1PGOA 4ZO6A 3W4IA 1YRHA 2WUWE 4NDZA 1GUBA 5G0VA 4KXLA 4LBWA 2CE7A 2LCFA 2PTHA 2VWPA 4PSDA 5ERXA 3E9MA 2IXTA 2B4AA 3N6RA 1XTVA 2XRMA 2H2AA 2VH1A 2PZGA 4GX1A 4J0EA 3X1JA 1C0LA 1PFUA 4A82A 1KNQA 3GR6A 1QIGA 3ZZNA 3DMTC 3BA6A 1P1FA 1VL0A 4DUYB 2FZCA 2EWWA 2H2IA 1C8LA 5T3UA 2EDCA 1DDIA 2E82A 3IAS6 1CLEA 1EHCA 3MW8A 2V7PA 2R6DA 2D74A 4GF5A 4IO0A 3U3DA 4PFKA 1OXMA 4HWOA 4C3OB 2D7JA 2GAIA 4GMGA 1DI0A 1M0SA 1JR6A 1QO9A 3FPSA 3ZWDA 2VPWA 2Z2XA 3PUVA 3CRW1 3L6OO 3TOZA 5IDQA 4I6GA 3TDKA 3DMRA 3HYCA 4JNCA 2R6HA 2CK3D 3S1LA 2C61A 3CSUA 2K7ZA 2Q9AA 1U02A 3KNZA 2PN1A 1I3KA 4GI7A 1V8PA 4JGGA 4Q4JA 3FDZB 2ILVA 3H2BA 4B80A 3AVXA 1XFAA 5IJZA 3E35A 3QBDA 1LJ8A 4JIMA 2C9DA 5KZMB 1DGQA 3HYRA 1A9YA 2B6NA 3L6CA 2FU5C 2L2QA 3AEQA 3UAZA 1K8YB 2R6FA 3T7AA 3LQRA 2P9ZA 1K98A 4KQ1A 2C1ZA 1OWNA 2QOEA 1D4AA 4DJTA 2V5VA 1BHSA 3H5RA 5AK4A 1KMQA 5J2TB 4G5QA 2V65A 1JKIA 2LBPA 1P80A 4JDUA 5ILQA 3SWWA 4YA6A 4DM4A 1RT9A 3VU3A 1GL6A 1BXKA 3KQVA 3QE0A 3RSHA 2O8DB 4DQ0A 4ZDIA 3PWKA 2FPLA 2VJKA 2IOQA 2JEOA 3AVQA 1MC5A 3NHLA 4H7EA 4JQSA 1R37A 1Y1SA 1IOLA 4ZT6A 3OMWA 2WFAA 1T43A 5LQAA 1G4HA 3S70A 1PX2A 1QLWA 1TTPB 2BP7B 1NATA 3H4IA 2JKVA 1VG8A 4QYMA 4ZVPA 2PBLA 4DTIA 6YASA 1L5LA 2VHZA 2OPBA 4PO3X 2BRUA 3FFTA 3GJQA 4MEJA 4F6RB 4O4LA 1WO8A 3TEJA 3B60A 5CIWA 5EE5B 2AQKA 3BJZA 1GL9B 3ADCA 1YR2A 4IJWA 2NQ2C 2GD6A 4DMLA 3LZDA 1OR8A 4KMOA 4NI5A 4DMFA 4MLDA 5C5CA 3K70B 1D2MA 1QHXA 2CLMB 2PRYA 2YXEA 4ML3A 5HIKA 3DPUA 2HMTA 3KAJA 4KZPA 1WD5A 3WWOA 2IEIA 3L01A 3HNOA 5EPUA 5DPMA 2JLZA 2BV3A 3UJBA 3Q7QA 1HZJA 3HJGA 3R3SA 1CNMA 7AT1A 4KPYA 4KXFB 2IPAB 1SCKA 4OHBA 1CE8B 4WKOA 1I1OA 2Q6KA 3A7DA 5B1DA 2OYRA 4YPFA 3OQOA 3DLPX 3PUWA 1XVIA 2UZAA 1JSXA 1NP6A 2XUDA 4FHCA 2W42A 4DLVA 2VJLA 4MRNA 1N0VC 4JJAA 3BGVA 1U2DA 4RXTA 1FNMA 2IHUA 5G1OA 3F74A 3GRUA 2XUFA 3T9AA 3L77A 1WBDA 3ON5A 4N8DA 3RWOA 4NU5A 4O8ZA 4XJXA 3K6SB 2ZRFA 2ECOA 4YUYA 3G88A 1AKNA 2OHGA 4F5ZA 4OJMX 4RD0A 3E58A 9GPBA 1RRGA 3WIDA 1NIPA 3I05A 1I01A 1VBFA 4QECA 1RLOA 4EF6A 1TUEA 3FXAA 3MJTA 2BE9A 3UM9A 4UD6A 2Q5FA 3DLTA 4WK6A 1XJQA 2GPWA 4B7XA 4FYMA 3D8RA 4EG4A 3QE3A 1E5DA 1PHRA 1NR5A 2CL5A 3OF5A 2NXWA 4C4OA 4AQYB 3ND7A 3G7NA 3MF4A 1PDVA 4E09A 4FP9A 5K4AA 4GNRA 2PMEA 1TD1A 4K86A 1CZKA 1EQUA 3LGAA 4PY2A 5EHNA 1KVTA 3T7TA 4DOMA 3GT0A 1GYPA 1IRIA 4Z4QA 1VB5A 4GOMD 4RVUA 4S1WA 2YFKA 2EG5A 3ZGNA 3DQPA 5C4GB 3K73O 4MXDA 3NRJA 2V98A 3NUZA 3RHFA 3ROMA 4JQCA 4HQNA 1P7PA 3L7KA 4QYTA 5FX2A 2BM1A 1NXWA 3A6FA 2B37A 3PGVA 1FVHA 5IH3A 2XA1A 2O8EA 1T8WA 2XB4A 5L53A 4GE3A 4QXRA 1G7RA 2IZZA 4JB0A 4OFXA 5IKMA 5EIBD 3RJ9A 2BHTA 5JQGF 2H52A 1M8PA 1RTTA 3ZBUA 3JVEA 2ZXEA 3HSKA 2X76A 2WIFA 1PD1A 1P9RA 3FNFA 4PW0A 4W5JA 2IXDA 4YVFA 1H23A 3ZDAA 2FHPA 3A2KA 5H1YA 4D8TA 1PS8A 4O2BF 2F8TA 4HGOA 2PJUA 1DJPA 4TQAA 5ALMA 3ZVRA 2WIDA 5G4KA 4F38A 1L4MA 1LS6A 4CG2A 4PYOA 3ROTA 1YZVA 2IYEA 3QKUA 5JXWA 2BTQB 1Y0BA 2F3QA 2WVAA 3MM4A 3MTJA 3KDPA 1XPOA 3PIIA 4S1OA 1JH9A 4TZ6A 1XR3A 1E1QA 4BE4A 4LRSB 1EGVB 4KO4S 3LK6A 2Z2IA 3R0QA 3EZ6A 1UWLA 4D9HA 1IN7A 1V5WA 1HE8B 3NOXA 4ROSA 1M2NA 4Y9TA 2IXGA 4YRKA 5KWSA 1GRCA 4V1CA 4IV0A 1FRNA 1M2OB 1K9SA 2I6GA 4S0ZA 4TXNA 3E0XA 1U0OC 2YWHA 4FNOA 2GX6A 3E4DA 3HU1A 3LYHA 3VJLA 4QDUA 1UT5A 5EWMA 2WTAA 4GR5A 1QDEA 4L51A 4HAWA 4ZD6A 4O3MA 2QZ4A 2WJ4A 5EWLA 4BE7B 5C32A 4NEHB 3TXXA 1AHIA 1NUQA 4H6XA 4WW0A 1DAHA 1UM8A 1XCGB 4Y6LA 3U7GA 3T3NA 4HN4B 4L0QA 2JEYA 3B82A 4GLLA 4H35A 3FMVA 3SJBA 1XDWA 1V1RB 3LT2A 1E94E 1OZFA 2GR9A 3OZWA 2AS0A 1QB7A 2DHEA 4EKGA 3R5SA 1A5BB 3G5LA 1PT6A 2RB5A 2RH9B 3RRYA 4Z7QB 1CF2O 6GPBA 2VTKA 3K0CC 1O6GA 1Q7BA 2HT6A 3MGBA 3JYOA 4UW9A 4MS3A 4A26A 4GL2A 3QYPA 1CPYA 1MR3F 2G1AA 1OLSB 3RGWS 3OCYA 5LQJA 4K6KA 3VH4A 5JDCC 3TNFA 1D09A 1YVEI 1N6RA 1G6Q1 4EKNB 4D98A 5FV4A 2BFBB 3PYMA 3GP3A 1RYDA 1QCDA 3FMPB 1UMDA 4JBLA 3DEIA 4MPPA 3CJRA 2LCQA 4DV1B 4DLYA 3TAXA 3TR0A 2BFDA 4I3FA 1X1AA 3N2YA 4RLHA 2R25B 4IIBA 4U7GA 2O8CB 1A9SA 1VL5A 1XNJA 1YB6A 2GK3A 2M98A 3JAKA 3B8EA 4G4SO 4MKHA 4P32A 2GJSA 3VYWA 5IVPA 2HDHA 1MX1A 3UHJA 3NOOA 4IXDA 4KK4A 4LE2A 5JMPA 2NV0A 4R1TA 4KIWA 821PA 1Q11A 1AGRA 4UBIA 1Y7TA 1E18A 4GZMA 3G0OA 4RCVA 4PE5B 2Q5EA 3GF4A 3KB2A 3ND5A 3GLVA 1UBUS 2DR0A 1RZ3A 3PFCA 1YRWA 3L7LA 3ENZA 3GO4A 4IF4A 5JNTA 4WLNA 4JI7B 1FUIA 5TY0A 2GEFA 4DCSA 1HR0B 2VCHA 1XQVA 4XYBA 4ZYYA 3AQ4A 5HZH