3NWJA

Crystal structure of shikimate kinase from arabidopsis thaliana (atsk2)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
210
structure length
194
Chain Sequence
QQILKKKAEEVKPYLNGRSMYLVGMMGSGKTTVGKIMARSLGYTFFDCDTLIEQAMKGTSVAEIFEHFGESVFREKETEALKKLSLMYHQVVVSTGGGAVIRPINWKYMHKGISIWLDVPLEALAHRIAATYTAALNRLSTIWDARGEAYTKASARVSLENITLKLGYRSVSDLTPAEIAIEAFEQVQSYLEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical investigation of two Arabidopsis shikimate kinases: The heat-inducible isoform is thermostable.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords AtSK2
total genus 69
structure length 194
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3nwjA00
5FTNA 2A78A 5LBIA 3TUJC 1J70A 4QGGA 3A8TA 3LVRE 1NY5A 3V9PA 5LB2A 1Q12A 3AF2A 3I4LA 3TSOA 4MDEA 1E0SA 2NPIA 2IXGA 2OE2A 1G8FA 1J8MF 4IVPA 1ZM4A 3QG5A 4YXWA 2GZAA 3ZIAD 2ZR0A 2BV3A 2YVUA 4DCVA 3B1VA 4ZIRB 2ASEA 3DO6A 3NBFA 2W6IA 2FFBA 4V0OA 1SULA 2IF2A 3BGWA 4WA7A 4QJ3A 5P21A 3L0SA 4MYHA 4PFSA 5CYPA 2BBOA 3ZZTA 5LPNA 3AF0A 4M1WA 3TSZA 4LI0A 5JEEA 1TAGA 1HE1C 4Q7KA 2R2AA 1ZUIA 3Q72A 3SYLA 2QP9X 1WDTA 4H9GA 2CE2X 1YZNA 2FGKA 3EXAA 3GLHE 2Z6VA 4JKYA 4Q66C 4AC9A 3OHMA 4XWOA 2RGGA 4JVNA 1IJFA 1DAHA 2ZREA 2ODEA 3CNNA 1IOZA 3PEYA 2IXEA 4HZIA 4MKFA 1B0UA 3B78A 5JWHA 1E2NA 2FGJA 4LYJA 3W5IA 4EQ6B 3C7KA 4PC7A 2VP2A 3EZ2A 4C0QC 2VO1A 4M1TA 5DISB 4G5QA 5BQ5A 1H8HA 4LC0A 1G4UR 1LB1B 5JZVA 4A0FA 1G291 3DVLA 2OFOA 1VTKA 4JLDA 4CT4B 1U81A 2BC9A 2NO7A 5H8WA 5HCNA 3QIAA 4FWTA 1M7GA 3EAQA 2D06A 2ZYWX 1W5SA 2X8AA 3LV8A 4TT3A 2OLKA 1JQJC 2O8DA 4IVQA 3EWAA 2ATXA 2IS4A 4P33A 2BMFA 4FI3C 4TMKA 3KDSE 1A5TA 4JYCA 4XOIA 3X1YA 2O8FA 4MKIA 3GQBA 1KZ7B 2ODBA 1ZVQA 5E3HA 5AUQA 4TTPA 3QEJA 4I99A 2H17A 4R2HA 3FWYA 4D25A 3IPXA 4XWKA 3A4MA 1I2DA 2ZRNA 3LD9A 4LJ9A 4BUJA 2RGXA 1UFQA 2BMJA 1SKYB 2YWHA 1XBTA 4ASUD 1DG1G 4HLQB 3AUYA 2NO9A 4F38A 4O3MA 3WP1B 1J2JA 3GLHA 5J4LA 1NG1A 3K09A 3KQNA 1G16A 2IWHA 5C18A 2BJVA 3KXIA 4BLQA 2PMDA 3FHTA 4PZYA 5FL7D 3CX6A 3D7MA 3I8XA 3MWJA 4GRAA 2FX3A 1COWD 2J0UA 3AQ4A 1W2GA 3KB1A 4A4DA 1G3QA 4IDNA 4PSVA 2NOAA 3AVVA 4LV5B 1KOFA 2CHVA 3I1FA 1CR2A 5UKDA 2V8OA 3CUEF 4QM6A 4BZQA 1QHHB 1T3SA 2FE4A 3F3YA 1RYHA 5KPDA 1G41A 2R6CA 1R0YA 1EESA 2MMCA 2V55B 1KZGB 1E2KA 1MR3F 4KBFA 4DIDA 5EE1A 2AD5A 1ZIPA 1AS3A 4WZ6A 3VR3A 3SU8A 1EFHA 2ZJBA 2C9CA 5F2EA 3THWB 1V5WA 5JS8A 1MT0A 2YWEA 1CRPA 4OI4A 5CLQA 1YZKA 1Z47A 221PA 5BWMA 1VCNA 2ZRCA 5J5CA 3WMEA 4JVSB 4PC1A 3W9YA 4M53A 2YINC 1Z2CA 2GCOB 5H1YA 1A82A 1OFHA 1OT3A 1UKYA 4HUQA 4UXJA 3FHCB 1NI3A 1LS1A 2FPLA 4L9WA 121PA 4JZKA 1Z28A 5E95A 5DNYB 2PZGA 2ZI6A 2FU5C 2J9RA 1II8B 2HXYA 3GLIA 4PZZA 3LDAA 1T3HA 3KJIA 4A8JB 4XVUA 2OV2A 2ZR9A 2V6JA 4DWJA 1OB2A 4MITA 1JQLB 2QGNA 4PQFA 3U5ZB 1E3MA 2FN4A 3TR5A 4BEBA 3OEHA 4P0TA 3FPAA 2VIIA 1U98A 3DM9B 4W5WA 3SYNA 3RC8A 3E2IA 3IBYA 4GL2A 5FOUA 1SXJC 3B9QA 2ZR7A 4RZXA 1KDTA 1US8B 3DKPA 3AVXA 4ARZA 5DN6A 5FBVB 1OHHD 3CKLA 3THXB 5D3MB 3PENA 3RS3A 4XIGS 2ZSFA 4ZCIA 3NWJA 1OHHA 1FMJA 1E99A 2QI9C 2GVZC 4KU4A 4C2TA 2ZSDA 5SZJA 1Z6TA 2N46A 1W5TA 3W8RA 4MRRA 2CNWA 3C14C 1WP9A 3IHWA 2AXPA 4BFWA 4DSNA 1GITA 4POAA 2D74A 5K8LA 2WJJA 1L8QA 1UBCA 2J0VA 4Q7MB 5CDFA 1HT2E 2C96A 2RGBA 2XOKD 3DDCA 4PX9A 1W7AA 1FTNA 3QNUA 5KOYA 1U9IA 4O2LA 3B1WA 1IQPA 1GSIA 5FUWA 2Q6TA 2P2LA 3B9PA 3I3SR 1IM2A 3G0HA 1VG0B 1OPXA 4QBFA 4QKQA 3W90A 3LBHA 1MO5A 1EX6A 1JPNA 1SVIA 1N6LA 4MGZR 2X2EA 4Q9JA 1G7TA 1OXUA 1KY3A 2R9VA 5HTKA 2OZEA 1GL9B 2CHGA 3PUZA 2GF0A 1IN7A 2NZ8A 3AEZA 4GMXA 2IA5A 2MSDB 3FE2A 4P4TA 1UEIA 1RRGA 4C0SA 4KJZA 3OF5A 4D0NA 5AR1A 2RGCA 1RRFA 1W46A 1K6MA 3GLIB 2ODNA 2ZVPX 5M04A 3OEED 4AKIA 3AKYA 2FEOA 1JR6A 2HUPA 4TYNA 3QSYA 3BORA 3TVTA 4MH0R 2DB3A 4I1OA 2W2TA 4YMVA 4PAQA 4TLBA 1E9FA 4BZPA 4TZ0A 1N6OA 1MOZA 2VBCA 1KI6B 3PEUA 4DEYA 5TMPA 2W58A 2YOGA 2WWWA 1Z0FA 1CJVC 1X3SA 4V0NA 2ZI7A 4EFLA 3SE0A 1Z29A 1OXVA 4GZLA 4DSTA 3KKPA 3BAFA 1OH8A 2IUSA 1XZPA 1T5IA 4B75A 4O25A 4I1VA 4B73A 1ZAKA 4NONA 2XITA 2PZEA 4PSKA 2WHXA 4LHVA 3U7FB 4LBZA 1NG9A 2Z4SA 1NVVR 3ND8A 2YKGA 3U4QB 1G3RA 2JIZD 2AD1A 1RC8A 2ZUCA 4IOLA 1S9HA 1N0VC 2EFEB 1M34E 2BM1A 3DOFA 6Q21A 3VKWA 4DLYA 3EIHA 5HKKA 3LLUA 4C0JA 1ESNA 1NF3A 2BEJA 4FW9A 5JFGA 1DBSA 1G18A 3IIMA 3AVQA 5FL3A 2VHJA 2PH1A 1HE8B 1YE8A 2CCGA 4Z51A 1VCOA 2VEDA 3IEVA 3T06B 2GAOA 2ZRMA 2VP6A 2PT5A 5KDLA 1X8JA 2V9PA 5A5GA 4JLPA 4DT1A 4CW7A 1NN3A 1X1SA 3TVDA 3V4RA 3TQFA 3GLHB 4ZDKA 4TT3D 2KE5A 4NCJA 4CRWB 2QM8A 2NTYC 2NO1A 2ZJYA 3VX3A 2J46A 1XJQA 3NIBA 4JBYA 4UJ3A 3RRMA 3GCGA 2WMOB 1HQCA 1LTQA 2QNRA 2ZRGA 3BB1A 2OXRA 3O8BA 2OHFA 4KFTA 1BIFA 4A6XA 1HTWA 1PLLA 3FMFA 1OYWA 1II9A 2QAGA 4JSYA 4CT5A 4HLUC 1NLFA 4US2R 5DHAA 3BFXA 1S9DA 5C4GB 2QUZA 4AG5A 4JLVA 2G1KA 1NKSA 3QKRB 3U3KA 4Z1MD 4EJSC 3D6TB 4XSHA 1FL9A 2D7CA 4URXR 2IL1A 2QGZA 3ASYA 3GLGB 1UADA 4LV8B 5AJVB 4C9BA 3JZAA 1YU9A 4EPRA 5FOVA 1U0HC 4HAXA 4KITB 1M74A 2GBLA 1UKEA 2ANCA 3WBJA 1DAMA 4WOPA 2BCGY 2ZI4A 5F9FA 4OHVA 2V3CC 2IYWA 4OQFA 2O52A 5J4KA 1ZNXA 1Z08A 1KI8A 2IYSA 4QGFA 5KSOA 3BBPA 4Q4JB 3TAHA 2XJ9A 3TSWA 2O8CB 2QT0A 1RFLA 1SKYE 4P4SA 1O87A 5AWFC 5KNCA 1CXZA 4R9UC 4F91B 4I1UA 2WJGA 4DCTA 2ZYTX 5JCPA 5DHFA 3W6NA 3U44B 1NJGA 2IYVA 1P73A 3WY9A 1SVMA 5JECA 4IFBA 4MRPA 2I3BA 2QRNA 2FPMA 2QPAA 4Q9HA 4LJ8A 3OESA 1R0ZA 1XCGB 2V4ZA 2YNMA 1KSFX 1F5NA 1TQDA 3RDPA 2IYRA 3HYTA 3PUYA 4GFDA 3SZRA 1Y3AA 2CHQA 3HYRA 4WZAE 4D4LA 1NBMA 1AQYA 2J7PA 2FDCA 3QXCA 4MGYR 4D6PA 3I72A 1FW6A 1XTRA 1KNXA 1VIYA 1W44A 3EX7C 2G83A 3AP2A 5L3RA 1W4BA 3SYKA 3TKLA 2WWYA 3GJXC 4LPSA 5EE0A 1ZM7A 5EP3A 3OIUA 1KO7A 3GFPA 2A5DA 4URWR 2Q3HA 5SZIA 1GG2A 2QEQA 1KK3A 3A37A 3WXMA 2CVHA 3PQCA 3OE7D 5DI3B 1MRNA 4RKFA 3OAAD 2IXFA 1OIXA 4PC3A 4A6PA 1E4VA 1KKMA 2F3TA 4C0AC 3WRXC 3HP1A 1D6JA 2G77B 2XAUA 1LV7A 1SXJA 3WNCA 1DAKA 1XX6A 4IEIA 4US1R 3QPWA 3QI2A 5AK0A 3T12A 4M1SA 1W36C 1JJ7A 3HU1A 4Z8YA 5L3QA 1G7CA 1YZQA 3OEHD 4A15A 3KB2A 1E2PA 1JXOA 4YDSA 3GD7A 2J7PD 2W6JD 3P4YA 3H4MA 4FMBB 4F93B 1B23P 1N6RA 4C7OB 1JECA 3CPHA 3UPUA 3K09C 4EPXA 4DLZA 1OLOA 1E1QD 4YMWA 3VR2A 1R7RA 3GFTA 2NZJA 3CR8A 2FFHA 5E7IA 2C95A 3QKRA 2XX3A 4B32A 1YQTA 4IXNA 5K8IA 1Y63A 3TIFA 4HAYA 3ZS8A 1P61B 2RKOA 3QF4A 4PAMA 4JLOA 4A0HA 1Z0DA 2OXCA 4MKHA 4FXPA 5AJXA 2EWWA 5JS7A 2GEVA 1MH1A 3LVQE 3TNFA 3X1DA 4RY2A 1R6BX 1AZTA 3S1AA 1XNJA 1HV8A 3RAPR 3QPUA 1W4CA 2DCUA 4HB4A 5EXXA 3RYTC 4GOKA 4BLOA 1TQ6A 4D81A 2IYZA 1VPLA 5JSZA 5KPJA 4C7OA 1XMIA 2HCBA 4GOXA 2GCPA 2V6IA 1XD2B 3QXJA 4NCNA 3GLGE 4B6EA 2GZDA 1G7SA 2CL0X 3RSLA 5EUMA 1FX0B 3A1WA 4QHSA 1DVRA 1R0XA 3NBYC 1FMLA 3AGPA 5IT5A 2NGRA 3AVUA 2IYXA 2L0XA 2CNWD 1TU4A 3MJHA 1SXJD 4DLVA 4JIMA 4DKXA 2HYDA 1KTVA 3MWKA 4QNMA 3LX8A 4E07A 3M6AA 4EPYA 2P6NA 3C8UA 2NPFA 1G3IA 4IXMA 4DLWA 5EQTA 3WBKA 1IXSB 4PPQA 4B3XA 1NSFA 1QBKC 3K0FB 1TPZA 5JLJA 5TV2A 3TE6A 5LDDC 4B48A 5H68A 1RKBA 3A1UA 3WNDA 1KDRA 1XTKA 5FTJA 2KSQA 1NLZA 5AJYA 2AFIE 3SN6A 2JDID 3PIRA 1R8SA 4HYYA 1SVSA 3NDBB 1E0KA 4DDVA 2VQSA 1TEXA 3SHWA 4G0NA 1Z8FA 2K5UA 1LF0A 2C04A 2ZRBA 5FI0B 2A9KA 3I62A 1W47A 4BFVA 4PPGA 4K46A 3TW8B 3DHWC 2FPKA 3HU3A 2G9NA 2OM2A 5HPYB 3NHBA 5AUNB 3EIQA 5HZHA 1Q3HA 4G5RA 1W0JA 3CB4A 3NBXX 5TY0A 1P62B 4EJSB 3DM5A 1E9SA 1ZNZA 2HT1A 2GRJA 1ZD9A 1XDBA 3AF4A 4HDQB 3VQTA 3AM1A 1E1RA 2AK2A 5DO9A 5FBLB 2V1UA 2O8CA 1ZP6A 4LYHA 2P3SA 2PX0A 1KO1A 3T1TA 4XD7A 4KHZA 2IYLD 3C5HA 4KV9A 4NHOA 2D62A 4LHYA 4BLRA 1E1RD 1I2MA 3KJEA 4DLXA 2QMUA 3OFNA 4Q9IA 1N6IA 1DADA 5KU1A 1AJEA 4B47A 2V54A 1E9AA 1OIWA 4N0EA 5CIWA 5CYOA 4DHEA 2HXSA 4JVMA 3U7HB 2C77A 3SNHA 1US8A 4TWZA 2PCJA 1OIVA 3GMTA 4EIWA 4BLPA 1NMYA 1FOEB 3KKQA 4U02A 3U3RA 2WAYA 3CRMA 4CGZA 3IEUA 3BH6A 3WYAA 1P60A 5TB5A 1PJRA 1XEFA 2QORA 3ADCA 1T0JB 4E03A 1BMFD 3SJAA 4XH9B 3K0SA 1L2TA 2OCAA 4Q1AA 3K53A 1KI7A 1XP8A 1E32A 2HJVA 3ADBA 1DG3A 1OKKD 4M21A 4IHQA 4P3YA 3PFIA 4JLMA 2IX3A 1XTJA 2VHQA 4MKGA 3MFYA 3HWSA 2IBMA 3VU9A 4AWXA 3RS7A 1SXJE 4LHZA 1AIPA 4C3ZA 1O3YA 1CR0A 1TU3A 3THOA 2RGNA 4WBSA 2QU8A 4Q4HA 2FSIA 2RCNA 4R98A 2C9OA 4OJQA 4OHWA 4XVRA 5FL7A 5AUPB 3R9WA 5CB8A 5JWOA 3AVOA 4D82A 4EPTA 4MRVA 2C2HA 3QXHA 4CEHB 1QG4A 3A1SA 2FOLA 2O8BA 4GI7A 4W5JA 3I92A 1GVNB 2G1JA 1W4RA 2PJZA 4M0LA 5FI1B 1YVDA 1P6XA 3QXSA 2FV8A 4IDPA 3LNCA 3D8BA 2ORVA 4ZI3A 3LBNA 4F4IA 2PEYA 3GJ3A 2AXNA 1A7JA 3OEEA 4JYBA 3RABA 3UMSA 2QROA 1R0WA 1P2VA 1IN6A 5CJ2A 2NO6A 2Z4RA 4MGKR 5FUVA 3U6KA 3F5FA 5FPYA 4B43A 5D3QA 2NO0A 4NYIR 4J0QA 4UNNA 1HH4A 2WKRA 2GJ8A 1R5OA 1GRRA 2QMOA 3MGCA 1R2QA 3K9GA 3QENA 4GNKA 3HJNA 4QNRA 5EP1A 4UNQA 2YZ2A 2VP5A 4Q4AB 3T35A 721PA 1Z63A 4MRSA 2P6RA 4RD3A 2QMHA 1XB2A 3Q85A 4C30A 2AFHE 4DBLC 5F9HA 3KQLA 1KI6A 3UATA 1ZUNB 2OLJA 4CVNA 2ZSBA 3UKDA 3TGPA 2WZQA 4WIAA 1M6NA 1UM8A 3U4QA 1N0UA 4DLRA 1GZSA 2ZS9A 1PUIA 2ODWA 1IAQA 4ITRC 1TUEA 1V43A 2ZETA 4KYIB 2A5GA 2O0JA 1II0A 1NY6A 1T0HB 4KCGA 4PO9A 2ZRKA 3LW8A 4IVRA 4OHXA 4D80A 3AKEA 1G19A 3GLFA 3U7GA 2OT3B 2ZE7A 4AKEA 621PA 1KO8A 1TQ4A 4EKDA 1CJTC 1JAIA 2Z43A 3QKSA 1UBGA 2GDJA 2ZRFA 1EFRD 2V1XA 3AKDA 1JEEA 3CNLA 3PVSA 2JLYA 5FR1A 4ACBA 1JI0A 2O8DB 1GRQA 2J3EA 2B8WA 4DDWA 5DN6D 1SVKA 4U5XA 3BB4A 3OIYA 4LY6A 2OBNA 3W8NA 1CJKC 3CZPA 2O8EB 2BCJQ 1AS2A 821PA 1E9CA 4ZKDA 2BKEA 2CL7X 1Z6XA 4TQ9A 2VA8A 1QHYA 3RANA 4B44A 3DMDA 3PG5A 3QVVA 3QOFA 3U44A 4ZKEA 2PZFA 2OEPA 2DHRA 4B71A 3OIWA 4GP7A 2ZUDA 4LBWA 3N2IA 5JRZA 1FTSA 2MSEB 5TXGA 3K70C 3AF1A 4JT2A 4V0MA 2O8FB 3ZGXA 5J40A 5FUXA 1KI3A 4TYYA 2ZE5A 4B74A 5D3MA 3ZD7A 4JKIA 2FSGA 4MYTA 1EGAA 3F8TA 2CK3A 2X1VA 4BZXA 2F7SA 2QSYA 3ZVLA 1AA9A 3E70C 4G5OA 1ZJ6A 2FNAA 1FNMA 3B13B 4EAQA 4FCVA 2GXSA 1Z6YA 3GFOA 1MABA 2DFTA 4Q48A 1HUQA 4DUGD 4LX0A 1SVOA 3P27A 1BKDR 1F6BA 2RHDA 3QKTA 3P1JA 3AP1A 3VNUA 2BM0A 2HCJB 1VHTA 4Q5IA 1S1CA 4HI0E 3KL4A 3CZQA 1PLJA 4IJMA 2RGDA 3BE4A 2WSSA 1N6KA 3NVAA 1NRJB 3D31A 3QY0A 4QFMA 1BYUA 3T61A 2QP4A 5F98A 5KHOC 2NG1A 4JL8A 2VSOA 2A5YB 3CF2A 3CRVA 3N5CA 4IDOA 3RC3A 1CRQA 4MYCA 1PZNA 4YONB 3K0AB 4RD4A 4NL4H 4CEIB 1CBUA 2EQBA 4GOJA 3IIJA 4NPHA 1UDWA 3IQWA 2CLCX 2IYQA 2C99A 2XNDA 3DKVA 2F1IA 2W83A 4NCIA 2QSZA 2JCSA 1G3UA 3CONA 3RRYA 4BFYA 4OQMA 2A5FA 1Z0IA 2QQEA 1ZC3A 4Q1DA 1UKVY 4LYFA 1Z0AA 2OUKA 4QHYA 1E2JA 2JJ8A 2XNDD 3UG6A 1JPJA 2PL3A 1KJYA 4D0LB 2IYTA 2XZOA 3GP8A 3THWA 4Q7JB 1W4AA 1QDEA 3MMPA 1KSGA 2YV5A 5EE3A 1UKZA 3WMGA 4ABYA 2F43A 3QVUA 4MUAA 2H16A 5AUOB 3CR7A 3TR0A 2FA9A 1W0JD 1CKEA 1E2DA 4L15A 3SOPA 2ZAMA 5KO2A 4RKEA 4M2LA 2IS6A 2IK8A 4V0KA 3GLFB 5HKKD 2XNSA 3AV0B 4C4PA 4BGDA 1LFDB 4LK2A 1FP7A 1QZXA 2ECKA 2PEZA 5GVRA 1A1VA 2JDIA 1ZM3A 2ZI3A 5J4YA 2ZQ5A 3FFBA 4EPVA 2JLZA 1IN8A 1UEJA 2J0QA 1PVOA 1KSHA 1XTQA 1HYQA 3A58B 3ECCA 1ZYUA 2XB4A 3MCAA 5JI2E 4D4JA 1GNRA 4Q4AA 2WM9B 1G6HA 3U3OA 1ESMA 1U94A 4YDHB 3GJ7A 2ZJ2A 3H86A 4KFRA 1A2BA 4Q4HB 4B2LA 2YHSA 5G3ZA 1GTVA 3PJRA 2HF9A 2VP4A 4IKEA 3VHLB 4HATA 5KSYA 1E0JA 2C78A 2ZE6A 2P5SA 2OFWA 2WSMA 5AJWA 1WF3A 2KBEA 1OSNA 2QTVB 4DLSA 1S0UA 1NIPA 2ZJ5A 2VRWA 4GT1A 2ZU6A 1W0KD 4L16A 1EFTA 3EZFA 1YZLA 1ZRHA 4NBSA 4A36A 3NEJA 2IHYA 4CDGA 2JJ2A 2FFQA 2YWFA 1YKSA 1JNYA 3T1QA 4UNRA 4AYTA 3U3MA 3VX4A 4RZ2A 1BS1A 4LOAA 2KWIA 2V7QA 2X19A 3FB4A 3KX2A 2EFHB 2AR7A 4O0MA 2QENA 3CX8A 1E2HA 1VYVA 3CRQA 4CEHA 1Z3IX 2C5LA 3CH5A 1AKEA 4BLTA 1P4SA 3KQKA 3B82A 3HR7A 2N42A 5B30A 1WBDA 3EARA 4HAZA 2ONJA 3EWSA 3KFXA 4I4LA 5LD2C 1P7CA 1BMFA 1KYIA 4CEJA 1Z22A 1LNZA 5CK4A 1T91A 3TUZC 4PO8A 1DAIA 4N1AA 4EDHA 1SXJB 5EE5B 4EQ6A 2R8RA 1RE0A 1XD8A 3A1TA 1N6NA 3LH5A 2ZRPA 2XSZD 4NYJQ 1JR3D 1G7RA 4QL3A 3AGQA 5JBQA 3PEWA 1IN4A 2EFCB 1XEWX 2F9LA 5EP4A 5JJKA 1S4QA 2JJ2D 1P75A 4E22A 5EXPA 1GL7A 1CR4A 4HB3A 4WXRA 2QBYA 2VSXA 4JL6A 4Q1EA 4KSBA 3CRW1 4Z1MA 3TUIC 2YC2C 2OCPA 4MQBA 4YLGA 2GF9A 2UZ3A 1VYUA 3O47A 2ZRHA 2GAAA 2LCFA 4QRHA 1D2MA 2IS2A 1J90A 1XJCA 5KDDA 2PLFA 5BXQC 1E2QA 2GHIA 2VHTA 3ICEA 4I1SA 3PXGA 2I4IA 2O0KA 3BWDD 1QHXA 4DCNA 1YHNA 2F1HA 1J8YF 3SBEA 3ZVNA 2CLSA 3B6EA 5FH9A 2BBSA 3CPEA 3X2SA 3K0FA 1IONA 4V02A 4WW0A 1P3JA 1W36B 4ZV4A 2WJIA 3A4NA 1KKLA 3Q5DA 4ACAA 1KAGA 3HR8A 1OF1A 2D4HA 4E5UA 4AI6A 4QXAA 4A2PA 3LWNA 1RJ9A 2CE7A 2KB0A 4BQSA 5IF9A 1ONBA 1NKTA 4QBIA 4KXFB 1SHKA 3LXRA 1WBBA 4XVQA 1CULC 2RB4A 2ZRDA 1Z83A 1LW7A 4MDFA 2LKCA 4YMUA 1GIAA 4URVR 2H18A 4KVGA 1WMSA 1EK0A 5B57C 2P67A 1Q1BA 1KJZA 2EVWX 4L4UA 3ZYCA 4BEJA 2H57A 1EFCA 3KKMA 2PX3A 1NN0A 4KYUA 1NJFA 1WXQA 2VH5R 2ORWA 4XWAA 5AJZA 1LVGA 3MWYW 2AK3A 1G8PA 1CS4C 5ELXA 4PAOA 4WVFA 2R62A 2HJGA 3EZ7A 3ZZUA 1JALA 2P0EA 2F3RA 2WMNB 2GXQA 4LBVA 3NC1C 3BC1A 3AB3A 2VP0A 1XEWY 1RRPA 1H8ED 5BYKA 1XWIA 1XJ0A 2E1RA 3L0OA 4B3CA 2BEKA 5BN4A 3RS0A 3ICQB 1XZQA 1Q1EA 3W5JA 2AL7A 2VF8A 2KJQA 5JHHB 4Q21A 2QAJA 3THYB 3K70B 2ZJ8A 4LHXA 1U8ZA 3NKVA 4B3GA 2YOFA 2J45A 3NG1A 2VHUA 2ZM5A 2WSSD 5JSZB 2XGJA 4QGHA 1DOAA 2TMKA 3ND9A 1E2IA 3B1XA 3EPKA 4TYWA 4EPWA 5C1BA 1RW4A 4HDOB 3FVQA 3RHFA 2D2EA 4DZZA 5KTYA 2D7DA 2R6FA 2KBFA 3OFND 4UXHA 4OJKA 2P6UA 2GETA 3AVYA 1ZMXA 2J5XA 2JJ1D 3AUXA 3EPLA 3QE0A 1VHLA 3K1JA 4RD6A 1HT1E 4TMTA 1QVAA 1C1YA 1H8HD 2VF7A 1JXMA 2DYKA 4C0KA 3VU9B 2QZ4A 2I1QA 1VKJA 1XCPA 4MRNA 1DAGA 1KMHB 1SKQA 1YR8A 3MJRA 4X8LA 4L9SA 3O8RA 5TARA 3THYA 5FPHA 3UWOA 4MGIR 1TUIA 4N0DA 4Q18A 4AK9A 5B58C 3UIEA 1ZM9A 4AY2A 5JWRA 2RAPA 4AKHA 3FFAA 5IK2A 2WJHA 4DRZA 2XXAA 1T6NA 5FBQB 3SR0A 1GM5A 2HEIA 1CLUA 2IYYA 1KDOA 1NSTA 1UBEA 1Z06A 1NL3A 1KJWA 3AKCA 4H1UA 1N5JA 4NYMQ 4TN1A 1OH7A 5JJIA 4RFSA 2EYQA 1HY3A 1IBRA 2AHOA 2KI5A 2MMGA 3K9LA 1E4YA 3EA5A 4JL5A 3B60A 3IUYA 4HAUA 3L8ZA 4C0LA 1TNDA 1G5PA 2X77A 3AF3A 3KJHA 2OCYC 4PPNA 2FF7A 2B7CA 3TQCA 4TL6A 3VR5A 3ZZ0A 4B6FA 2W6ID 5GJWC 1GOTA 4ESHA 4FMDB 3OZXA 4LGMA 3CF6R 4D4KA 2BIFA 2J7KA 1G8YA 1ZNYA 3LQQA 4ZO4A 3U61B 4QHTA 3KUCA 5DI3A 1DTSA 4HZUA 1PLKA 2GZHA 3NEYA 1NVXQ 3DZ8A 4H1VA 1EFUA 4EJSA 2PMKA 3Q8XB 1S3GA 4WZBE 3EC2A 3SEAA 3LY5A 4M9SA 2ZANA 1T3LA 1UAAA 1AQUA 4HLUA 1WA5A 4ZIRA 1D2NA 2BVNA 3K0CA 3PUWA 3QBVA 4IDHA 1S1MA 4NCKA 1NN5A 2ANBA 2C03A 3ZVRA 1A2KC 4L8GA 5FTMA 1QRAA 1OXXK 2H5EA 3DMNA 4B3DA 2J0SA 2ZYUX 1TMKA 2CEAA 5L3SB 5FOTA 3A4LA 3VAAA 3RWMB 1VIAA 3P32A 2IEYA 4B34A 5KYKA 5KDOA 3KXKA 3Q9LA 3U2QA 3L2OB 4FD2A 1JB1A 2GBLC 2ORIA 3C41J 4NZYA 1ZM2A 1DS6A 1KSJA 2REOA 2IUUA 1XCMA 2NQ2C 3VR1A 2ZYVX 5J4VA 5KSZA 2IWRA 3VFDA 1ZCBA 3EW9A 1BOFA 1OFUX 3JVVA 3EASA 4QGAA 3GJ0A 1KMQA 3L0IB 2NIPA 2ZSEA 2ZEJA 3RWOA 2JATA 2ZS7A 1DAFA 4M9QA 4Q02A 3K70D 4KVAA 1VDZA 3CO5A 3RS2A 3KJGA 4P4SB 2ZRIA 4LJYA 1XD2A 2OO7A 1GKUB 1QHIA 3R8CA 4B3BA 5FTLA 2QPOA 4ZDJA 3Q3JB 1NBMD 3BJIC 5E7MA 3ADDA 4NYIQ 2XEXA 1RIFA 1E2GA 1R10A 1ELOA 2REBA 4HAWA 2BJWA 3DZDA 4F7WA 2R6DA 2EWVA 1MO6A 1I4TD 3LLMA 4BFUA 1TADA 1M7HA 1ZCAA 1XMSA 2HLDA 5HZKA 5G3YA 1AGPA 2JGNA 1E2MA 4M1OA 4JSTA 4PPFA 4G3XA 1VG1A 3T5DA 3DEFA 4PXAA 1NVVQ 3CBQA 4URYR 4OQXA 2W00A 2ZRJA 2ZUBA 4QC2A 4IEEA 2XXAB 2QMEA 4RD2A 4URZR 5DGXA 1GP2A 1N5LA 4DJTA 3QF4B 2J87A 3EIEA 2ZIAA 4KSCA 4XTRA 4V0ME 2ONKA 3G5UA 3IILA 1EX7A 1G1MA 2QP3A 3OAAA 2DFLA 2QA5A 2VPPA 2WV9A 1CTQA 4PHFA 4A2QA 3FGNA 1II8A 4G5SA 4B35A 3LBIA 3REGA 4DT1B 3SJBA 1EWQA 4Q9KA 4LJ4A 3TJZA 3WNBA 3TK1A 1R5NA 3FTQA 1E98A 2A3RA 1DEKA 2GJAA 3K0CC 2BOVA 1XEXB 1FUUA 1FNNA 1SZPA 3VKHA 1VG9B 1KO4A 2QRZA 4LJ6A 1X86B 4NKRA 4O2RA 4RCYA 1G6OA 3I5XA 2R65A 1GILA 2O0HA 3RRZA 1VECA 3LQRA 3DOEA 1WRBA 1S8FA 5CB6A 4NDZA 4BWYA 2DR3A 4TZ6A 1P5ZB 3H0KA 4Q7LA 2JLUA 4AG6A 1ETUA 5EXSA 3AVWA 3MUFA 3GPLA 2IYUA 3CF0A 2GKSA 3O8DA 2OBMA 4RFSB 2QAGC 2W0SA 3F0TA 1Q0UA 4M1YA 5G41A 2UZIR 1XMJA 1FP6A 2FSFA 4DCSA 1UF9A 3R7WB 1MO4A 1W49A 1SVWA 2JLWA 4ZCLA 1X8KA 3SS8A 1UPTA 2LWIA 2EFGA 2F1RA 1XU4A 3KUDA 2WPDA 3KFVA 4JLAA 1ZU5A 3W6PA 5JCZA 2LKDA 4F4JA 1N6PA 1VCIA 4OI0A 3MG9A 1NVWQ 3IBGA 4TL8A 2BDTA 1JR3E 3LAWA 3FMIA 4JLJA 5DYIA 3U3JA 3W3AA 2HYIC 5HE8A 1N25A 2HDNB 5IK2D 1KK0A 1IXZA 5KNBA 4PSAA 1NBME 3AVPA 4ON9A 4A9AA 5KUTA 4ZCMA 3K0AA 1P2TA 4G01B 2Z0MA 4NYJR 2FZ4A 1L7VC 4IW3B 1XF9A 2OILA 4GP6A 1PUJA 1L4UA 3LXXA 1ZC4A 2GESA 2WOOA 5B64A 3I61A 2B6HA 4BFSA 2BWJA 2WAXA 1IJEA 3I73A 3GJ6A 3KXLA 4CIDA 2C98A 3NTUA 3FKSD 3NXSA 5IDVA 4JT4A 4G1UC 1E2LA 2SHKA 1ANKA 3MWLA 1NP6A 4MYUA 5EZ6B 2CDNA 2CK3D 2DWOA 1WCV1 1EWRA 3GEIA 1Q20A 4OI1A 1MABB 4ZI2A 3DPUA 1YZGA 2Z83A 5CIQA 2F1JA 4PQRA 3THXA 5KSPA 2QTFA 1NNEA 2PBRA 4BFTA 1U99A 4UNSA 3B5JA 1U90A 3FYHA 1CEEA 2QY9A 1CR1A 1GAJA 1E79A 3LW7A 1AK2A 1P72A 3RLFA 5G53C 2ZTSA 1GDDA 3RS4A 3SJZA 3M1IA 1H65A 1CP2A 3K9HA 4AYXA 1G64A 3IPYA 1ZD1A 1OH5A 5CITA 2QT1A 2QBYB 3N2EA 1U2RA 3KKOA 4M22A 3H2YA 2UVQA 4PZLA 3SC3A 2XTNA 5EJEA 2VYFA 2P65A 1E9EA 4NE2A 2YC4C 2H7VA 3UWKA 4A8JA 1Z6AA 2B7BA 5A0FA 1EG7A 2G3YA 1DO0A 1GNPA 4Q03A 3T1OA 4DUGA 3LO5A 2QAGB 4KFSA 1I4LD 2QE7D 1E69A 3X1XA 1Q57A 2DPXA 4TMWA 2OCBA 4JLKA 2WIAA 1KI9A 2WWHA 3IO5A 4JS0A 2RGEA 3GEHA 3CRRA 2IC5A 2IEZA 1F2UA 2JLSA 1N5IA 1A4RA 3NHAA 2PJRA 4R71A 1G8HA 4HAVA 1SQ5A 1LS6A 1NN1A 4S35A 3SFVA 4BFXA 1WQ1R 2CCKA 5GJVC 2O8EA 4MUBA 4HDCA 2EFDB 1YR9A 4N3NA 5FBRB 1UJ2A 2VP9A 3EPHA 521PA 2G0NA 4TMXA 2XOKA 3W3ZB 1Q1QA 3QKSB 3CX7A 2EYUA 2JA1A 4RFVA 3U6BA 4D26A 1U8AA 4RD0A 4HSEA 2FMXA 5DIFA 1E6CA 3BXZA 2FJUA 2WKQA 1S2MA 1X6VA 1OE0A 2WWGA 4YC7A 4TYQA 4YQFA 4BECA 2FFAA 1GWNA 1QHHA 3FKQA 1S3SA 4Q4LA 2YOHA 4AKGA 1EFRA 2ZI5A 1ODFA 3U60B 1AZSC 3EC1A 2Q0HA 1NMZA 1GRNA 1ZUHA 421PA 4A82A 5KNDA 1YJ5A 3R9IA 1TL7C 3AH8A 4OQLA 4U7DA 1I4DD 1BH2A 2Z5FA 4HUQB 2I1VB 4HB0A 4B2IA 3T15A 3H1TA 3PUXA 2Q9CA 5FPTA 2IT1A 1WE2A 3GJ5A 4RCZA 4P32A 2WJYA 3IHLA 2VHCA 2ERYA 5JEDA 4TSFA 3Q5EA 1K5DA 2UKDA 4NP6A 3EG5A 2YYZA 4JLBA 4HUTA 2Q3MA 1R8QA 1F48A 2C9YA 2YJTD 5A4JA 4Q1FA 4EFMA 2RH5A 3LA6A 4OK5A 4E09A 4LBYA 3R8FA 1KHTA 4NTZA 4DLUA 4QBGB 2JLRA 3UG7A 3T5GA 5K8TA 5FUYA 2EU8A 3ZH9B 2GJKA 3BFKA 1VCMA 5E4FA 2H8KA 3WYFA 3OIVA 2D2FA 1QG2A 3P20A 1G3MA 1N6HA 4A1FA 4UJ5A 4NCHA 4F4CA 4Q19A 2ZITA 1NLYA 4F92B 5CDFE 4A92A 2Q9AA 1FUKA 1HURA 2G6BA 1Z0KA 2XTMA 2GNOA 2JASA 2GJ9A 2J0UB 4GSYA 3QKUA 2XJ4A 3HDTA 4ZPXA 5J4HA 4Q47A 4DCUA 5J47A 4KLNA 4EFNA 4UQOA 5FFMA 4IOMA 4LYAA 4YMSA 3PUVA 3FHOA 1NMXA 4K8OA 3B2EA 3MLEA 4X8MA 5LB4A 1P2UA 2QL6A 4IOJA 5GJCA 2V7QD 4M4SA 1YR6A 2DFNA 4TTQA 2ZU0C 2H92A 1T8UA 2GVDC 1WB9A 2DWQA 3B8HA 1OV4A 4NH0A 2GJSA 4LJ7A 4DB2A 2ZPTX 4PANA 1MRSA 2WKPA 4GBMA 5SZKB 2W2VA 3CWZA 1ZNWA 1OFIA 1LY1A 1T5LA 1ZD8A 3FKSA 4XJXA 2R6AA 4JMPA 2G0TA 4DDUA 5C2JB 3E5HA 3LRPA 1XXHB 2GTPA 1M1YE 4TMVA 4WXPA 5JJLA 3IIKA 2CLDX 3RNLA 3MD0A 2VSFA 1FPMA 3H84A 3CNOA 4FIDA 1YZUA 4OQNA 1D2EA 2NMVA 1CIPA 4TQUS 1D5CA 4FCTA 4GDFA 1P9NA 4JBXA 5EZ5A 4DIEA 1G5RA 2CVFA 5DI9A 5L3VA 2IW3A 4LV6A 5EXTA 3PITA 4OI2A 5FPKA 2YWGA 4QM7A 2ZROA 2EW1A 2OESA 2REXB 1U8YA 4KO8A 4PR0A 3T34A 1OJLA 1OFTA 1AS0A 4DSOA 1KK2A 1SGWA 4AIIA 4BASA 2GEDA 2D3WA 4OL0A 4RZUA 4W7SA 2JLVA 4PHTA 5IHPA 3A6PC 2R44A 3RRNA 4ILEA 1H8EA 4Z8XA 4Q1BA 2XZLA 1E79D 1ZU4A 2C8VA 4LUCA 5BN3A 1G17A 3MSXA 1D9XA 3GJ8A 5BYJA 3HU2A 4A0GA 3O8CA 4ARZB 2CJWB 2DWPA 5TDHA 5IRCD 2GCOA 1DARA 1OYYA 2E9SA 2J1LA 1KI2A 5JI3E 3UXMA 1XPRA 3BD9A 1VG8A 3A36A 4ERNA 3PEVA 5G40A 1QVRA 2ZSAA 3BK7A 1OW3B 5CJPA 4RVCA 4TLAA 2FH5B 2BMEA 4TL9A 3SQXA 4II7A 2ZRAA 1JAHA 4M8NE 1W2HA 3ZDQA 3SBDA 3R20A 4LHWA 4FWIB 1L4YA 3PCRB 1EXMA 1AGRA 4A2WA 1DELA 2BHRA 2ZI9A 3QQ5A 3TLXA 2W0MA 4RZ3A 3BERA 1YRBA 2DFKB 1KI4A 1DAEA 2QPTA 3BH7A 2XSZA 4FMCF 3WP0A 1Q22A 4JVLA 4UKDA 1F2UB 4LSGA 3I5YA 4NU0A 4W5HA 3L0PA 2N1BA 4GPTA 2QM7A 3KTAB 1XTIA 5EE9A 5JHGB 1D9ZA 1DO2A 3BOSA 4DLTA 2GEUA 3SDZA 5F3WB 1OB5A 2BBWA 1LF5A 3I8SA 3BFVA 2ZVQX 2ZJAA 4QOSA 1BO6A 4Q00A 2DY1A 4DDTA 1KI1A 4PTLA 2RGAA 5HE9A 1P9WA 3SQWA 4FN5A 4LJAA 4OYHA 4QJ4A 1U0LA 1AKYA 4DXAA 4OBEA 1W36D 4C2UA 1TF2A 2AKYA 4P31A 1IY0A 1W1WA 4LWZA 3UMFA 4FMDF 3C5CA 2F55A 1IXRC 1CJUC 1D8TA 1Z2AA 4IRUB 5HR5A 3I32A 1W48A 3QF7A 4LDJA 1Q21A 3SHFA 2ZJZA 3FDIA 1OH6A 1QF9A 1F2TA 4I81A 4EUNA 1Z0JA 4LJ5A 1ZW6A 3ZD6A 1VYTA 2ZE8A 3VMFA 4GZMA 3ZLJA 2W6JA 2PCLA 1KAOA 4XSGA 3REFA 4US0R 1XPOA 4YMTA 1IN5A 3QPVA 4TSFD 3R7WA 3KQHA 1KO5A 3BH0A 4CZ2A 3JVUA 4Q9LA 2HT6A 2B92A 2P5TB 2W2XA 4HZUB 4BPBA 1XXHE 3R9XA 2QE7A 2OBLA 2O8BB 3JZMA 3NDPA 5EUQB 1E2EA 2O5VA 4OHZA 3CW2A 5FR2A 3VR4A 2JLQA 2AWOA 5K8UA 1KIMA 1R5BA 3D3QA 4HLDA 2AX4A 5FTKA 1ZBDA 2F9MA 4D0GA 2GXAA 4DC9A 1CJMA 3X1ZA 4PO1A 1Z07A 2OAP1 2OG2A 2WVJA 3K9NA 3U7EB 2B8TA 4BRUA 2A7QA 4W9MC 3EZ9A 1Z5ZA 4LPKA 1E9BA 1FQKA 1OXSC 4PHHA 4DB4A 2RMKA 1E9DA 1T4GA 3B1ZA 1TF5A 2JEOA 3S1AB 3MAAC 1NVUQ 2ZJOA 1E94E 1XEXA 4M1KA 3K0EA 4PC2A 1CF4A 3BB3A 3QEOA 3W34A 3EA0A 1KGDA 4C0HA 2IF0A 4A0RA 1KK1A 4PHGA 1HEIA 3FMOB 1DE0A 1M7BA 2ATVA 4PQYA 4HEJA 5CM8B 1COWA 1JEDA 1NIJA 3EZ6A 3P4XA 3ZJYA 2WWIA 4Q01A 3HPRA 1G9XA 4QJ5A 4CF7A 1YR7A 1OKKA 4RSGA 5ANRB 5EP2A 1QHSA 4LZZA 2OSBA 3M0EA 1S96A 2FEMA 2ZRLA 1TF7A 3KKNA 2CXXA 1Z6GA 2WJVA 3ZS9A 4WAUA 1TQ2A 4UXIA 5CLLA 1E0AA 4A8JC 2Q3FA 4BLSA 1F2TB 4ASUA 3IDQA 4AURA 1JBKA 4RD1A 2QG6A 4TMZA 2FG5A 1XFAA 3UK6A 1IY1A 3WYGA 1N0WA 2Y8EA 2G88A 1T8TA 4LC1A 3SFZA 4Q1CA 4IDQA 4TTRA 3VKGA 2F6RA 3QUSA 2WWXA 2JLXA 2OAQ1 4URUR 3TAUA 5DYGA 1X8LA 1TEVA 2JIZA 3NBZC 1FQJA 1MO3A 3ZVMA 1E2FA 4Q4JA 1XTSA 4FCWA 2QN6A 3UANA 4IFEA 4AYWA 1JR3A 3IO3A 2RGNC 3V00A 2XB2A 5JMTA 3AVTA 2ERXA 1U9IC 1K5GA 4M1MA 3ASZA 4XD7D 4BE7B 3KZ1E 1C4OA 2GILA 3B1YA 4JLNA 3WMFA 2GWHA 4G5GA 4KLZA 4X8HA 4IOKA 2FZLA 1AN0A 3T1VA 1KDPA 1GNQA 1CU1A 1G8GA 5DSZA 4QG7A 5GVSA 5DLQC 4NMMA 3GLGA 4ZDIA 4PC6A 4LRWA 3CPJB 1MKYA 4HB2A 3M4YA 3Q7PA 4ZDWA 3EPJA 3V4FA 3C4JA 1RVDA 1SVLA 3ETLA 5TVKA 1XPUA 4XTCS 5FOWA 3P26A 3ONWA 4M9XA 4JJKA 3SJCA 1F60A 1FX0A 3NH6A 3BIFA 3E1SA 3UMRA 2FSHA 1Q1ZA 3QXXA 2VTKA 4TLDA 4X8OA 1MV5A 2GK6A 3N70A 3PR1A 3FOZA 2J41A 1RJ9B 2IUTA 3BRWD 4GMDA 1DPFA 4JBWA 1HQYE 1IHUA 2AWNA 1RPZA 4D4MA 1AM4D 1UBFA 2HF8A 3BS4A 4TQAA 3WHKA 5CK5A 4YXWD 5L3SA 2R6GA 4LCBA 4DSUA 1TTTA 2IS1A 1X1RA 3NC0C 3SI7A 3TW4A 4KI0A 3LFUA 2CBZA 4B3FX 2E87A 2WWFA 2CMKA 4L5BA 4TL7A 4CEJB 2HV8A 2JJ1A 1YRAA 3IQXA 4JJZA 4OHYA 2WBLC 4Y0AA 4ESVA 3GJ4A 3CLVA 1ZINA 2AN9A 5FBWB 2QQ0A 3G82C 2B21A 3QG1A 2WIBA 1G21E 2GCNA 3RSOA 5FOXA 2OFXA 3IGFA 3A1VA 1RYFA 4D2IA 1FZQA 4KODA 1XXHA 1IY2A 2ZS8A 4KAXA 3L8YA 2WPDD 4B2PA 1P2SA 4B76A 4CYMA 1JJVA 3PV0A 1KMHA 4C0BA 4Z54A 1Q44A 2H1LA 5FPSA 1U0JA 5H70A 2IHBA 3HPQA 4UNPA 1T9HA 3OE7A 1RRCA 1M8PA 3TH5A 1QHGA 3CWQA 5BN5A 1G4AE 4OKSA 5L3QB 4KBGA 2WOJA 4M9ZA 2BMDA 3X1WA 5JRJA 3B85A 4S2EA 2WICA 1GL6A 1E96A 5DH9A 4TLEA 3FMPB 3ADKA 2CL6X 2ZAOA 3QJYA 4V0LA 3C15C 2JAQA 4DVGA 3TBKA 3TRFA 1ZIOA 3WRYC 3B7GA 1F3OA 2A2ZA 2PLRA 1XD9A 3KQUA 2VLIA 1KNQA 1PV4A 5GJBA 2A30A 1OXTA 4QBHA 1E1QA 4R7ZA 3Q7QA 4HLCA 3DL0A 5C4MA 1GUAA 1N3BA 3WHLA 1P9RA 1K8RA 2BKUA 4Y0VA 3MRSA 1KY2A 1E9RA 4P4UA 4NYMR 1Q3TA 4TYPA 4KFUA 1VMAA 1SHZA 1M2OB 2DBYA 4RJLA 4OK6A 4U00A 3NH9A 1N5KA 1QHNA 1TX4B 5FOSA 3CH4B 4AD8A 3VR6A 1YZTA 3GEEA 3W6OA 3ZQ6A 4OK3A 2F43B 2GXUA 4MA4A 3L82B 3RVBA 4BFZA 5SZHB 8OHMA 5E7JA 3TMKA 4R2IA 4FINA 2BBTA 3ZIAA 3GLIE 2ZXUA 1GKIA 4V03A 4DEXA 2XTZA 1XMVA 4BRWA 2GK7A 1G5TA 2RHMA 5DE3A 2FWRA 3CIOA 3IKJA 5HCIA 1GKYA 2Q21A 3L43A 5B2ZA 3VHXA 1G20E 4B33A 2HLDD 4K81B 1J7KA 5CM9C 2J59A 3C16C 2PT7A 2A5JA 2VL7A 3VTKA 3GLFE 1HA3A 5GADl 2CJWA 2GA8A 3K8YA 3LX5A 4CEIA 2QTHA 5BW8A 3AP3A 4TLCA 1FFHA 2X2FA 1N2CE 1R4AA 3QBTA 2XZPA 1GFIA 2AKAB 5C46F 3J81k 2MSCB 3ZQJA 2WTUA 3RS5A 1RZ3A 1UDXA 3CM0A 2CCJA 5L8VA 5LD2B 2Q9BA 1C9KA 4FMCB 3KTAA 1BYIA 3VNVA 1W0KA 1XRJA 1J99A
chains in the Genus database with same CATH superfamily
5FTNA 4KQHA 2A78A 5CFZA 3TFWA 5LBIA 2PVPA 2I4MA 2Z9BA 4MP3A 4QGGA 2X6TA 3A8TA 1OC4A 3V9PA 4E1BA 5LB2A 1Q12A 4F2WA 3E53A 2BFBB 5DLEA 4D8YA 4UTPA 3T99A 5IT4A 4BVGA 5IZCC 1UKCA 1SJ9A 3FR8A 4Q05A 3WOVA 2H7YA 5D1NA 1G8FA 3D7LA 2PXHA 4UEKA 2JI7A 4E7PA 1ZM4A 4RLSA 5HFAA 1SUDA 3U4DA 4AWAA 3ZIAD 1G9SA 3KP1A 2QV0A 2YVUA 5HNKA 2RD2A 4LRSB 3KLPX 4ZIRB 3DO6A 2W6IA 1ZH0A 1ZR4A 2FFBA 2IF2A 3BGWA 3PEFA 4IO1A 4Q4CA 5DCYA 4QJ3A 5I47A 1SUPA 2XUDA 4PFSA 5CYPA 3QE2A 1CUIA 1MB2A 1Q91A 3RLIA 3M4ZA 3TQSA 5BV8A 3TMYA 4RENA 2HHLA 4M1WA 4O2AF 2YIMA 1IUKA 1TRKA 1D5WA 1M5TA 4NS1A 3GDFA 4YAFA 2VH2A 4EA8A 3SYLA 2QP9X 4HL6A 3X1MA 1WDTA 3CN9A 4H9GA 5GOZA 2CE2X 3L07A 3F7NA 4RK7A 4ENRA 4PXSA 3WLAA 4AC9A 4ISBA 3WTBA 2I22A 3UMGA 5AVZA 3BXFA 3E5NA 4C7XA 5JVDF 3ANSA 3CYFA 4HZIA 2WM2A 1DNPA 1QGYA 3FNHA 2BN4A 3Q7SA 5JWHA 2X0KA 1Q7GA 3EPPA 1E2NA 1ECJA 2PFSA 2D1SA 5IZCA 4BO9A 3C7KA 3HY6A 2VP2A 3EZ2A 5EKXA 4C6TA 2HMAA 3TLGA 4C0QC 4UTNA 1YE5A 3DR3A 5DISB 1K9VF 1X42A 2HRQA 2I2XB 3D0KA 3LM8A 3DVLA 2G67A 3D8NA 1NLUA 2OFOA 5KOHA 5FHQA 4AF8A 1QKJA 2D13A 1T0BA 1MOPA 4ZGGA 5H8WA 3BRWA 5HCNA 5JZMA 3EXHB 1XQ1A 4Y1GA 3STYA 5JE8A 1HXHA 2D06A 4TT3A 2P3LA 3LV8A 2XCLA 5H59A 3TRJA 3WLMA 3RI3A 3UMBA 4DV2B 1G6Q1 3KJZA 4C7BA 4IVQA 3ESXA 1YV9A 4ND3A 1ENYA 2IS4A 4N5MA 2WZBA 2BMFA 4MYSA 2C2KA 4GRIA 1KAHA 4EENA 3V80A 4Y9RA 3FPSA 4NE7A 1C3LA 3DF7A 2JFFA 1YB7A 2RG1A 2EKZA 2FMIA 1GEEA 2WYWA 2X5NA 3ONFA 4MKIA 3RUDA 2IITA 5E3HA 1Z7GA 3WWCA 7AT1A 4O1IA 1ZBQA 4EY5A 4HQ0A 1E3LA 4ZVPA 1K4MA 1JJFA 2XYHA 3FWYA 3C8HA 1VHWA 3TLZA 5AKKA 1ZUD1 3WIUA 3LGXA 2A92A 1CQJA 2BMJA 4ZHQB 2YWHA 1XBTA 1N2GA 2V74B 3HB1A 4HLQB 4OFZA 3HRHA 4C03A 4YRCA 1OROA 1V11B 1I5EA 3GLHA 5C8ZA 1DIOB 3A9RA 3A6JA 5CTJA 5BXYA 1NG1A 2V7BA 3MMZA 2IWHA 4ND6A 2PVSA 4EMSA 3KPJA 3O0TA 2AI3A 5JQGB 3WMWA 5L95A 1KBZA 2XZTA 5E4YA 3I8XA 7ABPA 2IXTA 1CY7A 5CHEA 5CFOA 4M7WA 4ZYLA 3FTCA 2JHGA 4QQNA 1NP3A 3FI0A 4OV6B 1CY1A 2LPMA 4PNPA 1NM5C 1SMKA 1DBQA 1M2GA 1X1BA 3CZCA 1ES9A 3KB1A 3Q3IA 2X0DA 1QOQB 2ZIFA 3I6YA 3A6LA 4B84A 1V5EA 2NOAA 5LP1A 2H4WA 4WWHA 3ZHXA 2B6NA 1EQAA 3A4YA 5DNDA 5ERXA 3I1FA 4TKMA 5UKDA 3H16A 3LWBA 5AK3A 4JYZA 4HVCA 1Z2NX 3BXEA 1I4OA 3IAAA 3CLUD 4BUCA 1EI9A 2V55B 1FUYB 1MR3F 4MQ4A 4KBFA 3VVBA 3BA1A 3D64A 3NANA 2V7XA 2DT8A 2AD5A 1ZIPA 1YS2X 3DT9A 3EIWA 4WZ6A 3ZIDA 4TOIA 1ZN7A 2C9CA 4IMPA 5F2EA 1I32A 5JS8A 1HR0B 4PCAA 2I3DA 5D86A 4A3SA 1LBHA 1DDIA 2IPMA 1IATA 1XWFA 3W9UA 221PA 1VI5A 4WN3A 2CN1A 4V3CA 1QTRA 1VCNA 1A9ZA 3F98A 3MBOA 4I7EA 3I6IA 1JG6A 4QYIB 2WHEA 4E5VA 4GZ3A 4DJ5X 3HFRA 1F0KA 1XKLA 3HB9A 4FBMA 4LRUA 1XTUA 3F8SA 5H1YA 4EUEA 1OFHA 1FLDA 1OT3A 1UKYA 1PCXA 4DIKA 3DOCA 4PYQA 4R40A 4L9WA 4QTXA 1PS9A 4E5SA 1W94A 2AE2A 3GZNA 2PZGA 3ZKAA 3IAS6 4QTUB 5KNBH 1BVHA 1TRHA 3L4JA 1RSZA 2QX4A 2P9GA 4ZO7A 2F67A 2PH5A 3GLIA 4I46A 1U8EA 5EERA 2FW8A 3NNDA 2A0UA 1T2FA 3KJIA 4A8JB 5ER6A 5FFFA 1SCUA 3RC2A 1G59A 1GG5A 4WH0A 5EMHA 4PU0A 2ZR9A 4DWJA 4OJYA 1FFCA 4MITA 4XWGA 4FKMA 3RIXA 1IJBA 4PQFA 5LA6A 4AZ0B 4R0MA 2Y4NA 2VK1A 3UCXA 1E3MA 3QP9A 2DHEA 3PI6A 4XX1A 3SYNA 4RESA 1HSOA 3ZH2A 3PHJA 3KG2A 3VZQA 3RUIA 1VOTA 4GL2A 1NFQA 5FOUA 2K2QB 1XAJA 4RELA 2BUCA 4AFNA 4MP8A 1GGHA 2DUMA 2HJWA 4MLCA 1FK8A 4RZXA 3CY6A 4H3HB 1P19A 4UASA 4X93A 4ARZA 3QTBA 3CKLA 3ZWBA 2Q2NA 4P4LA 4PG7A 5D3MB 1BS2A 3ZCQA 1R5JA 3PENA 5IVKA 1O6GA 1PGNA 1TZ2A 4Q37A 1KEEB 3GX1A 2H2HA 3O83A 4YN3A 1D4OA 2ZSIA 2YMPA 1OHHA 3OY7A 1BS9A 2P2YA 1FTQA 1XZLA 2GVZC 2QI9C 2YWXA 4WRRA 3UV3A 1QRRA 2CKDA 5HUJA 4IP0A 1SZCA 2DC1A 2Z1MA 1M9NA 3BCRA 2N46A 1W5TA 1I3CA 4JEMA 2CNWA 4MRRA 5HW0A 1R12A 1WPQA 2ZUUA 3ZE7A 2AXPA 4BFWA 4MCAA 5CTAA 4C5AA 5K3EA 1GITA 3RVLA 5K8LA 1SO8A 2C5EA 2J0VA 4Q7MB 5CDFA 2JD0A 1PFYA 2PD4A 3BYZA 3D02A 2XOKD 1UK9A 2B5OA 4ZCSA 1FE8A 2AFIA 3EVZA 2ZYIA 4GQIA 1XZJA 4Y6PA 2OHGA 3QNUA 2D8AA 3GNSA 3L7KA 5B53A 4G1EB 2DJIA 2P2LA 3AFGA 2ISQA 2G80A 1I1NA 3P71T 1VG0B 1HQKA 1OPXA 3DYIA 1E1CA 3G2IA 1MB9A 3S28A 3HEBA 3LBHA 4MIEA 3W4KA 1JPNA 2EARA 1H3NA 1SVIA 3FBWA 2ZUEA 4JGIA 5DM0A 2X2EA 4QVGA 3UGKA 3GG2A 5IJWA 2AB0A 1F8UA 2NXCA 2XUIA 4I66A 2EG5A 1GL9B 1KY5A 2VPTA 3ZW8A 1QF7A 4Z0PA 1DMSA 4PWYA 4QQRA 3HYSA 4FGJA 2MSDB 3N8IA 2IOHA 2DH6A 4LG1A 1JWLA 5C4IA 3RYCA 2YL2A 1XLWA 5TQ2A 3ESRA 5JAMA 5BT9A 1W46A 1N5MA 2ZVPX 3AKYA 1SOAA 2FEOA 3BGIA 2I7CA 3P94A 5DCWA 4YRMA 3DB2A 3OCYA 4IH1A 1X1TA 1GZHB 1TO6A 4MH0R 2XNKA 4FQ8A 5ILOA 3MM4A 3M6XA 1HNNA 1E20A 1VRVA 4TLBA 2WUVA 4ZARA 1W59A 1DCFA 2W2LA 4FDLA 3TW8A 1AX9A 2EDAA 4BZPA 4W5TA 3OJLA 3OWHA 5DLPA 1GCIA 4KOEC 2VBCA 4Z9BA 1Q1AA 4WOJA 3WDKA 1NQ5A 5AICA 4A2CA 4HTFB 1GCUA 3DMTA 5SYNA 2N75A 4KZKA 2FMUA 2FUCA 2XH8A 3NHUA 4OG2A 1CJVC 1JLLA 5ARCA 4CIYA 1X3SA 5L6LB 5KVCA 2OO3A 1GLGA 4EFLA 3SE0A 3U7EB 3ONDA 3KYDB 1Z29A 5E7QA 4GZLA 4XJTA 3KKPA 1GAQA 4L8FA 2ZBEA 4EHDA 1OH8A 3NOQA 3LDFA 1HTBA 2IUSA 2G8NA 2OSVA 1AKRA 3PJEA 4Z3OA 3RBXA 4B73A 2O5CA 4F5YA 4G1FA 4E0BA 1N2BA 1BU8A 3HEAA 4ZOBA 1XHFA 3R6DA 1HTTA 1EWKA 2AG1A 1T9GR 3VPSA 2QL9A 3U3ZA 3ILYA 5JNLA 2Z2XA 1CDZA 3NHLA 2YQ5A 2YKGA 1T5DX 4BPRA 4CM4A 4WXYB 3ICOA 3NCHA 3OQIB 4C5CA 1R74A 5M2QA 1TE2A 4W5NA 2AD1A 1RC8A 3U56A 4BL5A 2VNJA 2BM1A 2E4AA 1YUNA 3VKWA 4HBZA 1H1DA 3ZDYB 5HKKA 1ESNA 3IPAA 4ZTBA 4D3ZA 1NBAA 5JFGA 1V39A 4ZK6A 1G18A 4HGZA 5FL3A 5LZ4A 3V42A 1HE8B 2EJBA 2CCGA 2VDPB 2VEDA 3O3MB 3SBXA 1NW3A 4RZIA 4JBGA 2ZRMA 2VP6A 1BQ4A 2R4UA 5A5GA 1PTJC 1RXUA 2IXBA 2G70A 5C1DA 4M49A 1VKOA 3TVDA 4CDMA 3V4RA 4AUNA 4TT3D 3HH8A 4NCJA 2ZXEA 3H99A 4JYPA 3V2HA 2AJLI 2Y68A 4JBYA 4A5SA 1ZCJA 2YHAA 2HSJA 3Q7EA 5KTMA 1QHFA 3OF3A 4JGGA 3ZK9A 5CH3A 1T35A 2W6ZA 2H1HA 3P2MA 4A6XA 4EARA 1OYWA 2GPTA 3AHCA 4JSYA 1YB5A 4RMJA 4DXDA 2XGSA 1GCAA 4B4VA 1LI7A 3BFXA 5C4GB 2E85A 1P1HA 2VXBA 2XQGA 4AG5A 1NKSA 1I30A 1K97A 1VKZA 3O91A 1IUNA 4V38A 4KTVE 4BNLA 4GOND 4WQMA 1FL9A 1RKUA 2NSYA 2QGZA 4HMQA 5AKYA 1JSZA 2RHCA 4EB0A 1I0LA 4B80A 1SCKA 2KMLA 1LPBB 2C2XA 3ZNPA 4XGQA 4EPRA 1C41A 4HAXA 4JC5A 3GA7A 2I6QA 1LSUA 3DW3X 2ILVA 3OX4A 4Q39A 1UKEA 4WKCA 3F3SA 2CHEA 4PZPA 1CZRA 1PR9A 1QE3A 5FEMA 1R4ZA 4QASA 2E2WA 3CN7A 4YRAA 3ASVA 3SC4A 1Z4LA 4OA5A 4JUAA 4WNAA 5CFRA 1U63A 3O8LA 3TNJA 2E82A 4G2TA 4L6CA 4HSGA 4P5DA 4MW6A 3WGNA 2V3CC 4W63A 3L8GA 4KQMA 2IYSA 3N0XA 4C2AA 5KSOA 2PVCA 3OCUA 5EIFA 3TAHA 2XJ9A 3TSWA 2HHAA 3P0JA 4MAFA 1XLUA 1N2HA 4BNYA 3COVA 1DDOA 1SKYE 1KQNA 5ITWA 1EUYA 1P91A 1QX3A 3LDUA 5C5CA 4HNGA 3UWMA 4DCTA 1BE6A 1WUTA 2XF2A 3GV0A 2BGTA 3NFRA 4IDFA 1ZZEA 4OP2A 3W6NA 3U4CA 1L7NA 3ZWCA 3TKAA 1CY4A 1U0NA 4HDSB 4D4IA 1R66A 2WLSA 5JECA 3E48A 4IFBA 5CXXA 2WY2D 3DJFA 3VGJA 5CD1A 1K5PA 2BM9A 2X1HA 1FS4A 2HGSA 1R0ZA 2FZKA 2QTLA 4EW6A 2JD1A 2X3FA 3FPHA 4KI7A 2E6UX 4L8LA 3RVJA 4E70A 4KXNA 3O26A 1F5NA 1M2EA 3C85A 3CEHA 2BGKA 3ED1A 2QTAA 4ZHSA 4GX2A 5B3JC 1CLEA 1CEQA 2Y0CA 4P2BA 3ZWVA 3D7KA 2BEVB 2CHQA 5DXJA 4I3GA 2XA9A 4QJBA 4BO2A 8AT1A 3DT6A 2B4QA 2CFCA 1QG0A 3QXCA 1AK9A 1SBZA 2WVHA 5M7EA 4RHTA 1RWNA 3ZQUA 1ZI8A 1VIYA 3WYBA 2CJPA 2PS9A 2E21A 2DUNA 5FAXA 5JZOA 2W6MA 3C8DA 2NUAB 5H3CA 1PDWA 3NWEA 4W1SA 3EOAI 2UUOA 4WLUA 3UK1A 1W4BA 2QXYA 3TKLA 1Q77A 2OBBA 1HC7A 4BIIA 2JGAA 4M6WB 2B2CA 2UZAA 5SZIA 2A0XA 3RRJA 3C6XA 1DQPA 4A7PA 2QEQA 1KK3A 4WZBA 2RHRA 1QTNA 4DHWA 1O95D 1N1EA 4KQEA 2M1XA 4RKFA 5AKZA 2GAJA 4PC3A 1ZIYA 5F52A 4A6PA 2VWGA 1KKMA 1XG5A 3I45A 2P1RA 3HP1A 1SOMA 1L6RA 3WRXC 1NJ6A 2G77B 2R8ZA 3R44A 4M37A 4UC0A 3GDWA 3SEFA 3WOHA 3WNCA 3P5SA 1DAKA 1PUXA 1RM5A 4LE1A 2ECOA 3R41A 4M1SA 4D9BA 3E1KA 1W36C 2EEPA 5IKOA 3V1LA 3WL6A 1YZQA 5TQJA 3E5RA 5IARA 4BNMA 1UM9A 5BNZA 1ZICA 2WG2A 3KB2A 1E2PA 3QNWA 3PLAE 2LUOA 1N9GB 3ROZA 1MX9A 2J7PD 3P4YA 3H4MA 3RC3A 4F93B 2PS1A 3MT9A 4MO2A 4D43A 3GN1A 4RK5A 2W2KA 2AW5A 3CLUC 3WLEA 3K09C 5J59A 2QTBA 1OLOA 1WVMA 3FZQA 1DT5A 5TLSA 4TS1A 4W99A 4IWYA 4G63A 2PE5A 2EXXA 2X3YA 3L1KA 5GY7A 2IH5A 3F9RA 2C3YA 2PMFA 1HE2A 2FFHA 3QVGA 2C95A 3QKRA 5IVIA 4D9CA 2XX3A 4QU8A 5CH8A 5A1TA 3TGLA 1YQTA 3PC6A 3D3KA 5IXSA 2XA1A 5BUZA 1Y63A 3OZSA 2O48X 3K1YA 3TZ6A 1WU8A 2WYHA 3QF4A 4PAMA 1QBGA 1QE5A 3FYUC 4GM0A 4IRMA 4MVWA 3ZXUB 2DGDA 5EMNA 1ZONA 1TM2A 2MYUA 4DDKA 4V1CB 1N0IA 2HA0A 3F6PA 3DL4A 4BVEA 4TS3A 1PR4A 5ENZA 1NKVA 4E1AA 2ZBUA 3TG8A 4JJEA 4I5EA 5A2GA 2WUFA 2W43A 1AZTA 4IM7A 3NIDB 5K0EA 1UFOA 4CFZA 2ADOA 4MV5A 4OH7A 2FPSA 1JFVA 1KYWA 1W4CA 2K6GA 3FAZA 4JJAA 4OHBA 4HB4A 3UMVA 2IOFA 2XD4A 3RYTC 5A4FS 3G5AA 4OQPA 4QARA 5J1TB 5JSZA 3RAFC 4C7OA 2VRBA 4YP1A 1XMIA 1IPFA 2HPHA 1IZZA 2BGMA 3X0DA 5AW1A 4RTRA 4C4TA 3IJEB 5KBYA 1EPUA 1NBHA 2CL0X 1FYXA 3M82A 3QWHA 3OPMA 1AKTA 2FI1A 4MWTA 4O29A 1DBWA 1FX0B 1LWNA 1O0SA 2HAEA 3HLTA 3UFXA 1XROA 1UIRA 3A1WA 3M7IA 3R6GA 1ZI6A 4IQ8A 3W5SA 5KTKA 1Q0TA 4ARBA 2PSSA 4ES6A 4KX3A 1FMLA 5BQ3A 1Z36A 2PKXA 2NGRA 3QOYA 4G9EA 4KGZA 1I5OA 2R8OA 2PH7A 8LDHA 2C88A 2L0XA 2CNWD 1ZQ9A 2RK3A 2A6PA 3MJHA 4IJVA 4DLVA 4JIMA 4F56A 3WHIA 1KTVA 4KGVA 4YS6A 1P39A 3LKDA 3IRVA 5J2UB 3Q6MA 3Q2OA 1V2GA 2NPFA 1K7CA 1RBQA 3S5JA 4IXMA 3W5BA 1FDRA 1MC4A 5B3LA 1R0LA 4B3XA 2PGAA 1QBKC 1WDWB 2HPVA 1V16A 1VLMA 5KKCA 4BO6A 1ENZA 1PVDA 4QOJA 2PX5A 5TV2A 1DMRA 3RSQA 4HLNA 3TE6A 5H68A 1RKBA 3A1UA 4EOGA 4JLWA 2DWCA 4PLFA 4H15A 1A9RA 2KSQA 2W37A 3LC2O 3QFCA 1NLZA 1F38A 2QD2A 5B36A 2AFIE 3ACDA 4J76A 3QJGA 1JYSA 1VPWA 2BF4A 2JDID 2OQIA 2FUG1 4DDVA 5AXDA 3QX8A 4EW1A 3S8YA 1EJBA 1Z8FA 2C04A 1E1YA 4PICA 5FI0B 4NHEA 4YBZA 2CHFA 4W8GA 2C5HA 4PPGA 5KSWB 2XWJI 1FRVA 4QRDA 3HU3A 2OYRA 2ZCJA 3ZJVA 2NSDA 1T34A 3IQZA 4KIGA 3CB4A 3NBXX 2IOYA 1P62B 3QUQA 4EJSB 1ML4A 1QQTA 2YWRA 1CZOA 3IVXA 5LFAA 2HT1A 3OT4A 4N5NA 3F3KA 3GLSA 2OLEA 2GRJA 3AFHA 3ML1A 3HFGA 4R9SA 3NUZA 3IXQA 2V5VA 3AR7A 2Q49A 5LMZA 3UMMA 2DP4E 1DDGA 1Z7EA 4YJ2F 4BGEA 2O8CA 2AK2A 1TM7E 4KR2A 1ZP6A 4CQNA 2P75A 2VG8A 1BDIA 3T1TA 2A88A 1Q95A 2HU2A 5C3MA 4KHZA 5E2AA 3C5HA 4KV9A 5DGDA 3P2KA 2NT4A 2DX7A 4CG1A 2QMUA 5C35A 3OFNA 4CI0B 4UBMA 3Q40A 3F2VA 5KU1A 4XGRA 1AJEA 8MHTA 3O74A 1E9AA 1QJ4A 5CIWA 2LNDA 4DNXA 3T3NA 4A36A 3WRXA 1FDVA 4I1IA 2HXSA 2FXIA 4RDIA 1N4AA 1OASA 1UOEA 4KVZA 1J2YA 2C77A 4EIWA 5F73A 2I6XA 1MG0A 3KHUA 1O8CA 3KKQA 2WABA 4QPZA 4U02A 3RODA 5IKPA 4QFDA 4MPRA 3STUA 1ECCA 2CBXA 4JAVC 3U3RA 1BWQA 4KWTA 1DC6A 1VB3A 1YZVA 2DM6A 3DUFA 4E4YA 4LW8A 1XALA 5ES3A 2DZDA 5TB5A 3X3HA 4S04A 4DFDA 4DM7A 3ADCA 1BMFD 3DFZA 3SJ7A 2Z09A 1TT7A 1V95A 4J0HA 5F7OA 4Q1AA 2JLXA 4R68A 2OCIA 1XP8A 4OFBA 3TCKA 3RHZA 3JQRA 3ZV7A 4HN4B 4M21A 1USIA 5ALFA 1VSUA 5G0VA 5IDQA 5I6DA 4D9KA 3VAYA 3LE8A 3MFYA 2WF9A 1AKQA 1PQUA 1N8TA 1XHLA 1YTLA 4L08A 3RS7A 3VC1A 4LHZA 3ZV3A 2ST1A 4AKTA 3A3OA 3GU3A 4CBVA 4L5YA 2VQEB 4GI2A 2V7PA 2WK1A 4WBNB 5B6PA 4LDPA 4WBSA 2XRMA 2RHLA 4UPVA 1QCZA 4R98A 5D85A 1ATIA 1XP5A 4XVRA 5IM4A 3PVZA 1PSDA 2Y1CA 2WT8A 3AVOA 4D82A 5HF8A 4EPTA 3QXHA 1Y33E 3JQBC 4KE7A 3G89A 3AM4A 1X87A 2GTIA 2V96A 4LGYA 4Y2XA 4W5JA 1V8ZA 1EE1A 3L7JA 2G1JA 5FI1B 4INOA 1YQDA 4M0LA 4MR7A 4W1PA 1A4IA 1RAHA 2FV8A 4AJ9A 4BVLA 2HSZA 2OV4A 2I65A 4D0RA 1KU6A 3K96A 1AGYA 3KQYA 1MX1A 2PEYA 4I1PA 2BT4A 1A7JA 4JYBA 3UMSA 3PE3A 3JAWA 4X20B 1NW4A 1RS0A 2QROA 3CG4A 3FR7A 1R0WA 4Y2SA 3ZVKA 4H0CA 2Z4RA 3S1SA 2X42A 5FUVA 5FPYA 3RFCA 3JATB 5FWYB 3ZDEA 1JHVA 1ST2A 2NO0A 4MINA 4GR5A 4RIIA 4F86A 2F2TA 1U80A 3FCOA 4J0QA 1NASA 4L5IA 4UNNA 1AXEA 4C0WA 5BPFA 3KALA 4LEIA 1F14A 4M7OA 1O95A 3KAKA 1YMQA 3FYSA 2AMVA 2D1TA 3KVOA 2GPSA 3U48A 3FVTA 3K9GA 1KEPA 1SD2A 3KCNA 3LCUA 4GNKA 4MWCA 4WE3A 4MW4A 3QMWA 4BGVA 4IFTA 4Q4AB 2IZZA 4C7MA 3T35A 1M5RA 3D43A 1QGAA 1N7GA 2HK7A 2I4TA 3T7JA 3FRHA 2II6A 1V4NA 1VPEA 1FFYA 1EZ1A 4OM8A 5TC4A 4FYJA 4C30A 1JKXA 1M6EX 1P7YA 2IE8A 4KTTE 4BP8A 5A9SA 4DR1B 1YI0A 1RQ7A 1DJPA 2D1FA 4IBOA 4WD3A 4CVNA 2ZSBA 4KE9A 4ZAVA 4D45A 4P4NA 4WIAA 1PQ4A 3LT2A 4MWSA 4TXHA 4B2YA 1N2SA 1UT8A 2FFJA 4MRMB 4B3SB 1UBNA 1V7QA 2QTCA 1T9BA 5LLTA 2Z3WA 3GGPA 2P4HX 2ODWA 4ITRC 1ZH4A 4J2TA 1V7ZA 2ZETA 3WL4A 3HA3A 2A5GA 1C29B 4B9EA 1NY6A 1T0HB 2E37A 4IVRA 3ORRA 4OHXA 5EC8A 1LLQA 1EVJA 3QUBA 1RHKA 1U0OC 3U7GA 2EL7A 1Y1RA 1DHRA 2ZE7A 3QV2A 1KO8A 4UAGA 1E1NA 4AKEA 5CDSA 2V03A 3P2EA 4NCAA 1CJTC 3P9SA 2R3SA 2FQQA 3DOHA 3IT1A 4HFJA 4RSHA 3UF0A 4MR7B 3KVYA 4ZK2A 1PNRA 2YJNA 3ONVA 4WEQA 1UBGA 2ZRFA 3AKDA 4RVNA 2YJ6A 1H9BA 3K8OE 2PX2A 1BD4A 2XDQA 4HMPA 3C39A 3C7TA 2O8DB 4HDNA 4IG9A 4DDWA 5AW2A 4C08A 5TE9A 3BB4A 3H6KA 3W8NA 2OBNA 2DRIA 4XDZA 5F64A 1MV8A 3W4JA 1AS2A 1L8OA 4FX2A 3ZQ4A 1EGMB 2BKEA 4S24A 1UMBA 3D3NA 1Z6XA 4TWIA 3LCJA 3CR3C 5ES4B 2VA8A 3OJXA 1QHYA 4WXMA 3DTTA 3KWFA 4TV9F 3NM4A 1L5ZA 1VP3A 3LI2A 3QVVA 3U44A 5IYZB 1L5OA 1UANA 2DHRA 2H52A 4IJKA 4MJ7A 1IZ9A 1MIOA 2ZUDA 4LBWA 3H3XA 4YH1A 3F6YA 3AF1A 3QYJA 4V0MA 1TUBA 1V1RB 3L8MA 5H9WA 2O8FB 3ZGXA 2VQDA 2YN2A 1V25A 4YJHB 2IQ5A 4EY3A 5FUXA 4CLOB 7GPBA 4RTJA 1FBNA 1PJAA 5BYBA 1AA6A 4FB4A 4YASA 3UJ8A 2Q4RA 3VAZA 3B89A 1EE2A 2EEZA 2X0FA 4A8TA 4MQEB 1T0UA 1T5OA 4BZXA 4RORA 4HNTA 2JGJA 1AA9A 2BLLA 4O8CA 4M7RA 2OGTA 2CXQA 4G5OA 4JC0A 3B13B 1AHNA 3MGAA 1QV9A 2RHOA 3LO8A 4KQJA 1L8AA 4I50B 4IVNA 5KKNB 4MQFA 4LI3X 3NP7A 5K7SA 1BJRE 4PG6A 5TPZD 7MHTA 3KB6A 4DUGD 2J85A 1B0PA 1TK9A 1UBKS 1WMBA 3LPMA 3JCZA 1YIAA 4LX0A 2ID8A 1XNHA 4ATNA 5HOQA 4OLAA 2AV6A 1BFUA 2RHDA 3P8ZA 3WR5A 1DRWA 1NVKA 1V37A 4E94A 2P7IA 3VNUA 2BM0A 3DAPA 4YRDA 3RH0A 4N5DA 3T7EA 1EVQA 4U7GA 3C24A 5CA0B 2F90A 4HI0E 4ITVA 3RG2A 1W5EA 2POQX 3CZQA 4IJMA 4K9NA 4XE5A 5LXTB 1KL7A 2F48A 2WSSA 3QA3E 1N6KA 1P0IA 5GV7A 3LMKA 3D31A 3TTTA 5F98A 4DCOA 1MIOB 1SBHA 3UAWA 5B6JA 1ISGA 4O2BB 4ZYVA 1W87A 1CRQA 3DXZA 2FPWA 1TYZA 4FHDA 1IVYA 4O4JB 3CS3A 2PU7A 4RD4A 5IH3A 4FGZA 4IIVA 5CP8A 3PFCA 1JEQA 3LBAA 3DKRA 4CEIB 1T1JA 2JZNA 1UDWA 3IQWA 3B1KA 3EGDB 3IEXA 2P8SA 3PQ5A 4J16A 5HOEA 2A0FA 2C7GA 1TZKA 2ID7A 2XV1A 1K7SN 5DF1A 3SQDA 3ZWDA 4NCIA 3MCVA 2F1IA 1JU3A 1QVZA 2W83A 3LJKA 3G5MA 2QSZA 1KRWA 1Y8CA 3T5BA 1VLJA 1DG9A 2PUCA 4LOLA 4N01A 4OL9A 1Z0AA 3R6WA 4QHYA 4EY8A 4FYXA 3I5AA 1U3UA 3AUJB 4D6XA 2I67A 2NV2B 3L1HA 4N5IX 5FWAA 4WFQA 2NX2A 2O59A 2IYTA 4Q7JB 4YV7A 2R6R1 3RVOA 3MMPA 5EMMA 2C4NA 3TTYA 2V98A 2F43A 1OLUA 5AUOB 2HTEA 5ELLA 1A8IA 1W0JD 6AT1A 1FP2A 1E2DA 2C07A 1EHYA 3UJ6A 4UPEA 2QZPA 4DLPA 1KZ1A 1U3WA 5F33A 1NW6A 1KARA 3L8HA 3U9SA 1CG6A 5AHOA 5HGXA 3AV0B 4C4PA 3K71B 1LFDB 3MTJA 4LK2A 5ALZA 4ND1A 1B93A 2XKJE 5HIMA 5GVRA 4X92A 1GGEA 2I91A 4LZAA 2ZI3A 3RS9A 2ZQ5A 1U6IA 1O58A 1J9GA 2QB5A 4R5HA 3FFBA 3VPFA 1XI2A 4OGGA 3F7MA 4G26A 2JLZA 3HJCA 5HZGA 4HJRA 5EY5B 3UH0A 1OYVA 4CG3A 4ZZ1A 2J0QA 3IVRA 2RARA 4C4RA 4JNKA 3BJRA 1YS1X 1ZYUA 4UAUA 1XZEA 5JI2E 1J5XA 2WM9B 3ESQA 4RGVA 2QYOA 4Q4HB 3H86A 4Q3DA 1CQJB 2B1QA 3NHPA 4B2LA 1GTVA 4QUAA 4GOLD 3VSAA 1WAMA 5IT9A 4OEHA 4HGNA 4XX0B 1KEVA 2B25A 2D1RA 1HM5A 2ZE6A 4S12A 4EVSA 4BTVA 2WSMA 4MGHA 2PSJA 2G17A 3WADA 5BMVB 5JG7A 1IVNA 4E3ZA 4PQGA 1MMFB 2DBVO 4BFCA 4Y9SA 3QVJA 4GT1A 2XUKA 4OSPA 2ZU6A 5CX1A 4C7JA 3EXIB 1EFTA 1YZLA 1ZRHA 4OXYA 4BVKA 4FNOA 4F72A 3HJFA 5DWVA 1CQPA 2FFQA 1L0BA 2PUJA 3GRPA 1KKUA 3IAS1 5CB4B 4AYTA 4CF5A 4RZ2A 5IMBA 3EBOA 3TECE 1S7CA 2XWPA 4RV5A 1X7YB 3SS7X 2EFHB 4YCLA 1GEGA 2QENA 3BWCA 4W6QA 3KEFA 5LLDA 1V8OA 1E2HA 3QWIA 2DR2A 3BGDA 4I9GA 3CRQA 3CVWA 1FS5A 5B6IA 1AK1A 4CEHA 5F2KA 3CH5A 5CG1A 1FU4A 3T3PB 2VPIA 3B82A 3EVNA 4NBNA 2WTMA 2A4KA 2N42A 4C01A 1SU6A 1WBDA 1VPTA 1C9MA 3EWSA 4I4LA 3TEFA 1I9GA 4HRXA 4G25A 4O2BF 3K15A 5E1OA 5COBA 4UEOA 4CEJA 1TA9A 1YJQA 1Z22A 3HJGA 4H7FA 5J5VA 5HTOA 1XE3A 4D4HA 1UPXA 2QUBA 5FKJA 1U3CA 3L1UA 4L07A 4N1AA 1SXJB 5EE5B 1T9ZA 2V7WA 4NYJQ 4ZN6A 1JBQA 2B61A 1C0LA 2WNIA 3GDGA 3WQRA 3DO8A 3EGIA 3TTUA 1H2EA 1XEWX 4S1TA 3TLMA 4R8SA 3AJAA 1TEZA 5KYUB 5BNIA 1RIIA 2XVXA 4HB3A 1PT9A 2VSXA 1SCQA 4F4DA 3DBRA 5TJHA 1QDUA 3FMVA 3AB7A 4EG7A 3GWZA 2YC2C 2OCPA 4K6MA 3RTAA 3S2ZA 2I29A 4M7PA 4DCCA 2UZ3A 2NYUA 3AM3A 4HNQA 4Q16A 3OQ1A 5EI5A 1OU4A 4RIEA 5KDDA 5JXJA 5G2OA 3JALA 2RH9B 3ICEA 3ZTTA 4X7BA 3ZX4A 2WA2A 3QU4A 4DCNA 3GUVA 1IB6A 1QTIA 2CL5A 2AG5A 4N49A 3EGEA 4ZVQA 3DQPA 3HCRA 1XT6A 2BBSA 3UMJA 1WZNA 1TUBB 1V1RA 1WB4A 3R77A 1H3FA 1IONA 3DHVA 3K0FA 1OILA 1P3JA 4JCOA 3KYIB 1KKLA 5B55A 3NIGB 4ACAA 3OLZA 1OF1A 2WA1A 4P0PB 4A2PA 1K6EA 1RPTA 3HN7A 3N86A 5IF9A 1RPAA 1ONBA 4LISA 1CHNA 3IP7A 2XMBA 1P80A 1NW7A 4W9NA 2ZRDA 4IHJB 4MAMA 3TSYA 1GZVA 3SEQA 3ZTYA 3RIMA 3KU4A 1W93A 1ZK1A 4BNGA 2H18A 4EO7A 3TLKA 3NNSA 3FOEC 5CPBA 4KH0A 5FD8A 1EU1A 1Q1BA 1KJZA 4DLAA 4L4UA 3CA8A 4UOZA 5TF4A 4G1CA 3QEMB 2RI1A 2SICE 4L02A 4NOLA 4WFKA 2ODTX 2C3PA 2VH5R 4KLCA 3EVAA 3PBKA 5GPBA 3MWYW 3CG0A 3TX6A 4P92A 1JZTA 2MSKA 1DIGA 1EUDB 2A58A 1G8PA 3I2YX 2YHUA 3M33A 2C3OA 3N8DA 3RJ9A 2H08A 1QZUA 1T8SA 2R62A 3PVCA 4LYEA 5K1ZA 2AI1A 5A4MS 5EQJB 1T2EA 2P0EA 2PXXA 2WMNB 2IGBA 1P7VA 1E60A 3MTAA 1Y8AA 1VE5A 1G8AA 1KR2A 4LBVA 1OZGA 4GR4A 2XZDA 2GJ4A 1HQDA 2C1ZA 2H4XA 1XZDA 4R9VA 1H8ED 5CFQA 5J2UF 1O0BA 3BRCA 4YGYA 3ZI0A 1XJ0A 4ZOCA 5JQGF 2QUKA 2HMSA 1KERA 1I24A 5MFPA 1QU2A 3GT3A 1BMDA 3KXPA 3ICQB 1GADO 1R9GA 1EWYA 2EJCA 3FCCA 2KJQA 3ZY2A 3IDSA 5D6NA 4ZREA 1SC4A 2H3HA 3FUUA 1M6HA 3ZV4A 1NR7A 3L40A 3PKZA 4BIMA 3LLSA 4RTNA 5H16A 2QZ9A 4B3GA 4JI6B 3C3CA 1GA1A 4G41A 2ZB4A 2WSSD 1O08A 5JZBA 1WV0A 2XGJA 1Q7CA 3IAEA 4OFWA 4P4GA 2BH2A 1E2IA 1TVKB 2B0JA 2HSEA 2RGYA 4UARA 3RR2A 4POOA 2M6LA 1RW4A 2WYOA 2XE6A 3TNYA 3RHFA 4F46A 5A4KA 5BNTA 5ITZA 4GWGA 1MPTA 4OXKA 4BMPB 5DT2A 4LMAA 3RSGA 2P6UA 5G1OA 3TAXA 3JAKB 5IC6A 3O4IA 2H00A 2JJ1D 1HYHA 3AUXA 4X00A 3T7IA 3QE0A 4XYBA 1L6IA 1X2BA 2J3LA 3IUQA 3E8SA 4U2BA 4YRJA 5KZMB 2GN2A 1UXOA 4YPVA 5JNUA 2QZZA 4Z5XA 2DYKA 4C0KA 4YFVA 2I2FA 3UA3A 3VU9B 3P97A 1DAGA 1KMHB 3DEKA 4X8LA 5SY9A 2PNFA 4BKMA 1M2JA 4AMZA 4L9SA 1YBVA 4YCCA 5AVKA 1AMOA 1W2WB 3THYA 5CNJA 3UWOA 1I6KA 1T5HX 3KYJB 3ZUPA 3SPXA 3QGMA 2ZZNA 3ZU5A 4AY2A 4DRZA 2O8NA 1IAVA 1CLUA 3RVKA 1KDOA 3SJUA 2AXQA 4UHDA 4TN1A 3H8VA 4KL8S 3V1NA 4ZJUA 4CV3A 2EYQA 1HY3A 2SKCA 3CH6A 3D6JA 4JP2A 4DZTA 1F8GA 4XASA 1QO0D 1SCBA 5BVHB 1E4YA 4JL5A 4UBNA 3VNSA 2FK7A 3A6FA 3Q88A 3IUYA 4HAUA 5HDQA 1ZCFA 3OUZA 4BJHB 3ICPA 2OP1A 4O2AB 2ZIXA 4YXFA 4NJMA 4E5MA 1LSSA 1WB6A 3KJHA 3O2NA