3NWYA

Structure and allosteric regulation of the uridine monophosphate kinase from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
235
structure length
227
Chain Sequence
LSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Uridylate kinase
total genus 73
structure length 227
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3nwyA00
2BNFA 3LL5A 2BRXA 3AB4A 2CDQA 3EK5A 4OLCA 2J5TA 3D2PA 4A7XA 2BTYA 2HMFA 3QVHA 2R98A 4A7WA 4NDPA 2OGXB 2BRIA 2V4YA 4JZ8A 2OGXA 3LKKA 2BNDA 2E9YA 2RD5A 4NDRB 1OHBA 4Q1TA 2V5HA 4AB7A 3S6GA 2J4JA 3AAWA 1E19A 4JZ7A 4F6TB 4NDPB 2JI5A 3B8GA 1B7BA 3D2MA 3EK6A 2R8VA 4I49A 1OH9A 3U6UA 3ZZFA 1OHAA 3K56A 3LL9A 3NWYA 2WE4A 3QUOA 4AXSA 2IJ9A 3WWNA 3C1NA 3C1MA 2J4LA 2AKOA 4NDRA 3K52A 3WWMA 3ZZIA 2J0XA 3L76A 4NDOB 2VA1A 4NDOA 3S6KA 3D40A 2BUFA 1GS5A 2AP9A 2J0WA 2JJXA 3KZFA 2X2WA 4USJA 1YBDA 3S6HA 1GSJA 2BMUA 4JZ9A 2J5VA 3T7BA 3QUNA 4NDQA 3C20A 3ZZGA 2BNEA 2W21A 4F6TA 2WE5A 2A1FA 3QURA 3K4YA 4NDQB 2JJ4A 2J4KA 3D41A 2WXBA 4KZTA 3L86A 3AB2A 3ZZHA 1Z9DA 3QVFA 3TVIA 3K4OA
chains in the Genus database with same CATH superfamily
2BNFA 3LL5A 2BRXA 3AB4A 2CDQA 3EK5A 4OLCA 2J5TA 3D2PA 4A7XA 2BTYA 2HMFA 3QVHA 2R98A 4A7WA 4NDPA 2OGXB 2BRIA 2V4YA 4JZ8A 2OGXA 3LKKA 2BNDA 2E9YA 2RD5A 4NDRB 1OHBA 4Q1TA 2V5HA 4AB7A 3S6GA 2J4JA 3AAWA 1E19A 4JZ7A 4F6TB 4NDPB 2JI5A 3B8GA 1B7BA 3D2MA 3EK6A 2R8VA 4I49A 1OH9A 3U6UA 3ZZFA 1OHAA 3K56A 3LL9A 3NWYA 2WE4A 3QUOA 4AXSA 2IJ9A 3WWNA 3C1NA 3C1MA 2J4LA 2AKOA 4NDRA 3K52A 3WWMA 3ZZIA 2J0XA 3L76A 4NDOB 2VA1A 4NDOA 3S6KA 3D40A 2BUFA 1GS5A 2AP9A 2J0WA 2JJXA 3KZFA 2X2WA 4USJA 1YBDA 3S6HA 1GSJA 2BMUA 4JZ9A 2J5VA 3T7BA 3QUNA 4NDQA 3C20A 3ZZGA 2BNEA 2W21A 4F6TA 2WE5A 2A1FA 3QURA 3K4YA 4NDQB 2JJ4A 2J4KA 3D41A 2WXBA 4KZTA 3L86A 3AB2A 3ZZHA 1Z9DA 3QVFA 3TVIA 3K4OA
chains in the Genus database with same CATH topology
2BNFA 3LL5A 2BRXA 3AB4A 2CDQA 3EK5A 4OLCA 2J5TA 3D2PA 4A7XA 2BTYA 2HMFA 3QVHA 2R98A 4A7WA 4NDPA 2OGXB 2BRIA 2V4YA 4JZ8A 2OGXA 3LKKA 2BNDA 2E9YA 2RD5A 4NDRB 1OHBA 4Q1TA 2V5HA 4AB7A 3S6GA 2J4JA 3AAWA 1E19A 4JZ7A 4F6TB 4NDPB 2JI5A 3B8GA 1B7BA 3D2MA 3EK6A 2R8VA 4I49A 1OH9A 3U6UA 3ZZFA 1OHAA 3K56A 3LL9A 3NWYA 2WE4A 3QUOA 4AXSA 2IJ9A 3WWNA 3C1NA 3C1MA 2J4LA 2AKOA 4NDRA 3K52A 3WWMA 3ZZIA 2J0XA 3L76A 4NDOB 2VA1A 4NDOA 3S6KA 3D40A 2BUFA 1GS5A 2AP9A 2J0WA 2JJXA 3KZFA 2X2WA 4USJA 1YBDA 3S6HA 1GSJA 2BMUA 4JZ9A 2J5VA 3T7BA 3QUNA 4NDQA 3C20A 3ZZGA 2BNEA 2W21A 4F6TA 2WE5A 2A1FA 3QURA 3K4YA 4NDQB 2JJ4A 2J4KA 3D41A 2WXBA 4KZTA 3L86A 3AB2A 3ZZHA 1Z9DA 3QVFA 3TVIA 3K4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNF A;  3LL5 A;  2BRX A;  3AB4 A;  2CDQ A;  3EK5 A;  4OLC A;  2J5T A;  3D2P A;  4A7X A;  2BTY A;  2HMF A;  3QVH A;  2R98 A;  4A7W A;  4NDP A;  2OGX B;  2BRI A;  2V4Y A;  4JZ8 A;  2OGX A;  3LKK A;  2BND A;  2E9Y A;  2RD5 A;  4NDR B;  1OHB A;  4Q1T A;  2V5H A;  4AB7 A;  3S6G A;  2J4J A;  3AAW A;  1E19 A;  4JZ7 A;  4F6T B;  4NDP B;  2JI5 A;  3B8G A;  1B7B A;  3D2M A;  3EK6 A;  2R8V A;  4I49 A;  1OH9 A;  3U6U A;  3ZZF A;  1OHA A;  3K56 A;  3LL9 A;  3NWY A;  2WE4 A;  3QUO A;  4AXS A;  2IJ9 A;  3WWN A;  3C1N A;  3C1M A;  2J4L A;  2AKO A;  4NDR A;  3K52 A;  3WWM A;  3ZZI A;  2J0X A;  3L76 A;  4NDO B;  2VA1 A;  4NDO A;  3S6K A;  3D40 A;  2BUF A;  1GS5 A;  2AP9 A;  2J0W A;  2JJX A;  3KZF A;  2X2W A;  4USJ A;  1YBD A;  3S6H A;  1GSJ A;  2BMU A;  4JZ9 A;  2J5V A;  3T7B A;  3QUN A;  4NDQ A;  3C20 A;  3ZZG A;  2BNE A;  2W21 A;  4F6T A;  2WE5 A;  2A1F A;  3QUR A;  3K4Y A;  4NDQ B;  2JJ4 A;  2J4K A;  3D41 A;  2WXB A;  4KZT A;  3L86 A;  3AB2 A;  3ZZH A;  1Z9D A;  3QVF A;  3TVI A;  3K4O A; 
#chains in the Genus database with same CATH topology
 2BNF A;  3LL5 A;  2BRX A;  3AB4 A;  2CDQ A;  3EK5 A;  4OLC A;  2J5T A;  3D2P A;  4A7X A;  2BTY A;  2HMF A;  3QVH A;  2R98 A;  4A7W A;  4NDP A;  2OGX B;  2BRI A;  2V4Y A;  4JZ8 A;  2OGX A;  3LKK A;  2BND A;  2E9Y A;  2RD5 A;  4NDR B;  1OHB A;  4Q1T A;  2V5H A;  4AB7 A;  3S6G A;  2J4J A;  3AAW A;  1E19 A;  4JZ7 A;  4F6T B;  4NDP B;  2JI5 A;  3B8G A;  1B7B A;  3D2M A;  3EK6 A;  2R8V A;  4I49 A;  1OH9 A;  3U6U A;  3ZZF A;  1OHA A;  3K56 A;  3LL9 A;  3NWY A;  2WE4 A;  3QUO A;  4AXS A;  2IJ9 A;  3WWN A;  3C1N A;  3C1M A;  2J4L A;  2AKO A;  4NDR A;  3K52 A;  3WWM A;  3ZZI A;  2J0X A;  3L76 A;  4NDO B;  2VA1 A;  4NDO A;  3S6K A;  3D40 A;  2BUF A;  1GS5 A;  2AP9 A;  2J0W A;  2JJX A;  3KZF A;  2X2W A;  4USJ A;  1YBD A;  3S6H A;  1GSJ A;  2BMU A;  4JZ9 A;  2J5V A;  3T7B A;  3QUN A;  4NDQ A;  3C20 A;  3ZZG A;  2BNE A;  2W21 A;  4F6T A;  2WE5 A;  2A1F A;  3QUR A;  3K4Y A;  4NDQ B;  2JJ4 A;  2J4K A;  3D41 A;  2WXB A;  4KZT A;  3L86 A;  3AB2 A;  3ZZH A;  1Z9D A;  3QVF A;  3TVI A;  3K4O A; 
#chains in the Genus database with same CATH homology
 2BNF A;  3LL5 A;  2BRX A;  3AB4 A;  2CDQ A;  3EK5 A;  4OLC A;  2J5T A;  3D2P A;  4A7X A;  2BTY A;  2HMF A;  3QVH A;  2R98 A;  4A7W A;  4NDP A;  2OGX B;  2BRI A;  2V4Y A;  4JZ8 A;  2OGX A;  3LKK A;  2BND A;  2E9Y A;  2RD5 A;  4NDR B;  1OHB A;  4Q1T A;  2V5H A;  4AB7 A;  3S6G A;  2J4J A;  3AAW A;  1E19 A;  4JZ7 A;  4F6T B;  4NDP B;  2JI5 A;  3B8G A;  1B7B A;  3D2M A;  3EK6 A;  2R8V A;  4I49 A;  1OH9 A;  3U6U A;  3ZZF A;  1OHA A;  3K56 A;  3LL9 A;  3NWY A;  2WE4 A;  3QUO A;  4AXS A;  2IJ9 A;  3WWN A;  3C1N A;  3C1M A;  2J4L A;  2AKO A;  4NDR A;  3K52 A;  3WWM A;  3ZZI A;  2J0X A;  3L76 A;  4NDO B;  2VA1 A;  4NDO A;  3S6K A;  3D40 A;  2BUF A;  1GS5 A;  2AP9 A;  2J0W A;  2JJX A;  3KZF A;  2X2W A;  4USJ A;  1YBD A;  3S6H A;  1GSJ A;  2BMU A;  4JZ9 A;  2J5V A;  3T7B A;  3QUN A;  4NDQ A;  3C20 A;  3ZZG A;  2BNE A;  2W21 A;  4F6T A;  2WE5 A;  2A1F A;  3QUR A;  3K4Y A;  4NDQ B;  2JJ4 A;  2J4K A;  3D41 A;  2WXB A;  4KZT A;  3L86 A;  3AB2 A;  3ZZH A;  1Z9D A;  3QVF A;  3TVI A;  3K4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...