3NWYA

Structure and allosteric regulation of the uridine monophosphate kinase from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
235
structure length
227
Chain Sequence
LSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate kinase
publication title Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 73
structure length 227
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3nwyA00
3C1MA 1OHAA 3K52A 2JJ4A 2R8VA 2A1FA 2J4JA 3S6GA 3L86A 3LL5A 2OGXA 4F6TA 4KZTA 2J0WA 3B8GA 3ZZFA 1E19A 2BNFA 2BRXA 3T7BA 3U6UA 2J5TA 2BUFA 2VA1A 2BNDA 4Q1TA 2BNEA 3QUOA 3AB4A 4NDOA 3ZZGA 3K56A 2AKOA 1B7BA 4NDRA 2RD5A 3C1NA 1OHBA 3D41A 4USJA 2OGXB 4F6TB 3D40A 3D2PA 3NWYA 1GS5A 2W21A 2HMFA 3K4YA 3EK6A 2AP9A 4NDPB 3AAWA 3LKKA 2V4YA 4A7WA 3WWNA 4NDQB 2BTYA 2E9YA 3ZZIA 2J4KA 2WE4A 2BRIA 2V5HA 4JZ7A 3S6HA 1GSJA 4AB7A 2X2WA 2WXBA 4AXSA 4OLCA 3K4OA 3C20A 2CDQA 3L76A 4NDOB 2R98A 3EK5A 4I49A 1Z9DA 3S6KA 3AB2A 3TVIA 4NDRB 2BMUA 3LL9A 2JI5A 3QUNA 3QVHA 2IJ9A 3D2MA 2J0XA 4JZ9A 1OH9A 3QVFA 2J4LA 3KZFA 2WE5A 1YBDA 4NDPA 4A7XA 3QURA 2J5VA 3ZZHA 2JJXA 4JZ8A 3WWMA 4NDQA
chains in the Genus database with same CATH superfamily
3C1MA 1OHAA 3K52A 2JJ4A 2R8VA 2A1FA 2J4JA 3S6GA 3L86A 3LL5A 2OGXA 4F6TA 4KZTA 2J0WA 3B8GA 3ZZFA 1E19A 2BNFA 2BRXA 3T7BA 3U6UA 2J5TA 2BUFA 2VA1A 2BNDA 4Q1TA 2BNEA 3QUOA 3AB4A 4NDOA 3ZZGA 3K56A 2AKOA 1B7BA 4NDRA 2RD5A 3C1NA 1OHBA 3D41A 4USJA 2OGXB 4F6TB 3D40A 3D2PA 3NWYA 1GS5A 2W21A 2HMFA 3K4YA 3EK6A 2AP9A 4NDPB 3AAWA 3LKKA 2V4YA 4A7WA 3WWNA 4NDQB 2BTYA 2E9YA 3ZZIA 2J4KA 2WE4A 2BRIA 2V5HA 4JZ7A 3S6HA 1GSJA 4AB7A 2X2WA 2WXBA 4AXSA 4OLCA 3K4OA 3C20A 2CDQA 3L76A 4NDOB 2R98A 3EK5A 4I49A 1Z9DA 3S6KA 3AB2A 3TVIA 4NDRB 2BMUA 3LL9A 2JI5A 3QUNA 3QVHA 2IJ9A 3D2MA 2J0XA 4JZ9A 1OH9A 3QVFA 2J4LA 3KZFA 2WE5A 1YBDA 4NDPA 4A7XA 3QURA 2J5VA 3ZZHA 2JJXA 4JZ8A 3WWMA 4NDQA
chains in the Genus database with same CATH topology
3C1MA 1OHAA 3K52A 2JJ4A 2R8VA 2A1FA 2J4JA 3S6GA 3L86A 3LL5A 2OGXA 4F6TA 4KZTA 2J0WA 3B8GA 3ZZFA 1E19A 2BNFA 2BRXA 3T7BA 3U6UA 2J5TA 2BUFA 2VA1A 2BNDA 4Q1TA 2BNEA 3QUOA 3AB4A 4NDOA 3ZZGA 3K56A 2AKOA 1B7BA 4NDRA 2RD5A 3C1NA 1OHBA 3D41A 4USJA 2OGXB 4F6TB 3D40A 3D2PA 3NWYA 1GS5A 2W21A 2HMFA 3K4YA 3EK6A 2AP9A 4NDPB 3AAWA 3LKKA 2V4YA 4A7WA 3WWNA 4NDQB 2BTYA 2E9YA 3ZZIA 2J4KA 2WE4A 2BRIA 2V5HA 4JZ7A 3S6HA 1GSJA 4AB7A 2X2WA 2WXBA 4AXSA 4OLCA 3K4OA 3C20A 2CDQA 3L76A 4NDOB 2R98A 3EK5A 4I49A 1Z9DA 3S6KA 3AB2A 3TVIA 4NDRB 2BMUA 3LL9A 2JI5A 3QUNA 3QVHA 2IJ9A 3D2MA 2J0XA 4JZ9A 1OH9A 3QVFA 2J4LA 3KZFA 2WE5A 1YBDA 4NDPA 4A7XA 3QURA 2J5VA 3ZZHA 2JJXA 4JZ8A 3WWMA 4NDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1M A;  1OHA A;  3K52 A;  2JJ4 A;  2R8V A;  2A1F A;  2J4J A;  3S6G A;  3L86 A;  3LL5 A;  2OGX A;  4F6T A;  4KZT A;  2J0W A;  3B8G A;  3ZZF A;  1E19 A;  2BNF A;  2BRX A;  3T7B A;  3U6U A;  2J5T A;  2BUF A;  2VA1 A;  2BND A;  4Q1T A;  2BNE A;  3QUO A;  3AB4 A;  4NDO A;  3ZZG A;  3K56 A;  2AKO A;  1B7B A;  4NDR A;  2RD5 A;  3C1N A;  1OHB A;  3D41 A;  4USJ A;  2OGX B;  4F6T B;  3D40 A;  3D2P A;  3NWY A;  1GS5 A;  2W21 A;  2HMF A;  3K4Y A;  3EK6 A;  2AP9 A;  4NDP B;  3AAW A;  3LKK A;  2V4Y A;  4A7W A;  3WWN A;  4NDQ B;  2BTY A;  2E9Y A;  3ZZI A;  2J4K A;  2WE4 A;  2BRI A;  2V5H A;  4JZ7 A;  3S6H A;  1GSJ A;  4AB7 A;  2X2W A;  2WXB A;  4AXS A;  4OLC A;  3K4O A;  3C20 A;  2CDQ A;  3L76 A;  4NDO B;  2R98 A;  3EK5 A;  4I49 A;  1Z9D A;  3S6K A;  3AB2 A;  3TVI A;  4NDR B;  2BMU A;  3LL9 A;  2JI5 A;  3QUN A;  3QVH A;  2IJ9 A;  3D2M A;  2J0X A;  4JZ9 A;  1OH9 A;  3QVF A;  2J4L A;  3KZF A;  2WE5 A;  1YBD A;  4NDP A;  4A7X A;  3QUR A;  2J5V A;  3ZZH A;  2JJX A;  4JZ8 A;  3WWM A;  4NDQ A; 
#chains in the Genus database with same CATH topology
 3C1M A;  1OHA A;  3K52 A;  2JJ4 A;  2R8V A;  2A1F A;  2J4J A;  3S6G A;  3L86 A;  3LL5 A;  2OGX A;  4F6T A;  4KZT A;  2J0W A;  3B8G A;  3ZZF A;  1E19 A;  2BNF A;  2BRX A;  3T7B A;  3U6U A;  2J5T A;  2BUF A;  2VA1 A;  2BND A;  4Q1T A;  2BNE A;  3QUO A;  3AB4 A;  4NDO A;  3ZZG A;  3K56 A;  2AKO A;  1B7B A;  4NDR A;  2RD5 A;  3C1N A;  1OHB A;  3D41 A;  4USJ A;  2OGX B;  4F6T B;  3D40 A;  3D2P A;  3NWY A;  1GS5 A;  2W21 A;  2HMF A;  3K4Y A;  3EK6 A;  2AP9 A;  4NDP B;  3AAW A;  3LKK A;  2V4Y A;  4A7W A;  3WWN A;  4NDQ B;  2BTY A;  2E9Y A;  3ZZI A;  2J4K A;  2WE4 A;  2BRI A;  2V5H A;  4JZ7 A;  3S6H A;  1GSJ A;  4AB7 A;  2X2W A;  2WXB A;  4AXS A;  4OLC A;  3K4O A;  3C20 A;  2CDQ A;  3L76 A;  4NDO B;  2R98 A;  3EK5 A;  4I49 A;  1Z9D A;  3S6K A;  3AB2 A;  3TVI A;  4NDR B;  2BMU A;  3LL9 A;  2JI5 A;  3QUN A;  3QVH A;  2IJ9 A;  3D2M A;  2J0X A;  4JZ9 A;  1OH9 A;  3QVF A;  2J4L A;  3KZF A;  2WE5 A;  1YBD A;  4NDP A;  4A7X A;  3QUR A;  2J5V A;  3ZZH A;  2JJX A;  4JZ8 A;  3WWM A;  4NDQ A; 
#chains in the Genus database with same CATH homology
 3C1M A;  1OHA A;  3K52 A;  2JJ4 A;  2R8V A;  2A1F A;  2J4J A;  3S6G A;  3L86 A;  3LL5 A;  2OGX A;  4F6T A;  4KZT A;  2J0W A;  3B8G A;  3ZZF A;  1E19 A;  2BNF A;  2BRX A;  3T7B A;  3U6U A;  2J5T A;  2BUF A;  2VA1 A;  2BND A;  4Q1T A;  2BNE A;  3QUO A;  3AB4 A;  4NDO A;  3ZZG A;  3K56 A;  2AKO A;  1B7B A;  4NDR A;  2RD5 A;  3C1N A;  1OHB A;  3D41 A;  4USJ A;  2OGX B;  4F6T B;  3D40 A;  3D2P A;  3NWY A;  1GS5 A;  2W21 A;  2HMF A;  3K4Y A;  3EK6 A;  2AP9 A;  4NDP B;  3AAW A;  3LKK A;  2V4Y A;  4A7W A;  3WWN A;  4NDQ B;  2BTY A;  2E9Y A;  3ZZI A;  2J4K A;  2WE4 A;  2BRI A;  2V5H A;  4JZ7 A;  3S6H A;  1GSJ A;  4AB7 A;  2X2W A;  2WXB A;  4AXS A;  4OLC A;  3K4O A;  3C20 A;  2CDQ A;  3L76 A;  4NDO B;  2R98 A;  3EK5 A;  4I49 A;  1Z9D A;  3S6K A;  3AB2 A;  3TVI A;  4NDR B;  2BMU A;  3LL9 A;  2JI5 A;  3QUN A;  3QVH A;  2IJ9 A;  3D2M A;  2J0X A;  4JZ9 A;  1OH9 A;  3QVF A;  2J4L A;  3KZF A;  2WE5 A;  1YBD A;  4NDP A;  4A7X A;  3QUR A;  2J5V A;  3ZZH A;  2JJX A;  4JZ8 A;  3WWM A;  4NDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...