3NWYA

Structure and allosteric regulation of the uridine monophosphate kinase from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
235
structure length
227
Chain Sequence
LSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Uridylate kinase
total genus 73
structure length 227
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3nwyA00
2BUFA 2BMUA 4NDRB 3TVIA 2JJ4A 4NDQB 3QURA 3S6HA 3EK5A 3QUOA 4NDRA 2A1FA 3K4YA 4USJA 2J4KA 2RD5A 2AP9A 2BNEA 2BRXA 3WWNA 3K56A 2J0WA 3AB4A 3T7BA 3NWYA 2J4JA 2WXBA 4NDQA 3U6UA 1OHAA 4F6TB 3C1MA 1GS5A 3S6GA 2AKOA 2HMFA 4A7XA 2J0XA 4JZ7A 1OHBA 3ZZFA 1YBDA 3ZZHA 2OGXA 3WWMA 3KZFA 3C1NA 3L86A 2J4LA 3AB2A 1OH9A 2X2WA 3L76A 2IJ9A 3K4OA 2R8VA 3LKKA 3S6KA 4Q1TA 4KZTA 1B7BA 2E9YA 4A7WA 3LL5A 3QUNA 3B8GA 3EK6A 4NDPB 2CDQA 2WE5A 4AXSA 4JZ8A 2BTYA 3D2MA 3ZZIA 1E19A 2OGXB 2V4YA 4NDOB 3QVHA 2W21A 2BNFA 2J5VA 3AAWA 4OLCA 4I49A 1GSJA 2J5TA 4F6TA 2BNDA 3K52A 3LL9A 4JZ9A 3D40A 3ZZGA 2R98A 2VA1A 2BRIA 2WE4A 3QVFA 2JJXA 4AB7A 4NDOA 1Z9DA 2V5HA 3D2PA 4NDPA 2JI5A 3D41A 3C20A
chains in the Genus database with same CATH superfamily
2BUFA 2BMUA 4NDRB 3TVIA 2JJ4A 4NDQB 3QURA 3S6HA 3EK5A 3QUOA 4NDRA 2A1FA 3K4YA 4USJA 2J4KA 2RD5A 2AP9A 2BNEA 2BRXA 3WWNA 3K56A 2J0WA 3AB4A 3T7BA 3NWYA 2J4JA 2WXBA 4NDQA 3U6UA 1OHAA 4F6TB 3C1MA 1GS5A 3S6GA 2AKOA 2HMFA 4A7XA 2J0XA 4JZ7A 1OHBA 3ZZFA 1YBDA 3ZZHA 2OGXA 3WWMA 3KZFA 3C1NA 3L86A 2J4LA 3AB2A 1OH9A 2X2WA 3L76A 2IJ9A 3K4OA 2R8VA 3LKKA 3S6KA 4Q1TA 4KZTA 1B7BA 2E9YA 4A7WA 3LL5A 3QUNA 3B8GA 3EK6A 4NDPB 2CDQA 2WE5A 4AXSA 4JZ8A 2BTYA 3D2MA 3ZZIA 1E19A 2OGXB 2V4YA 4NDOB 3QVHA 2W21A 2BNFA 2J5VA 3AAWA 4OLCA 4I49A 1GSJA 2J5TA 4F6TA 2BNDA 3K52A 3LL9A 4JZ9A 3D40A 3ZZGA 2R98A 2VA1A 2BRIA 2WE4A 3QVFA 2JJXA 4AB7A 4NDOA 1Z9DA 2V5HA 3D2PA 4NDPA 2JI5A 3D41A 3C20A
chains in the Genus database with same CATH topology
2BUFA 2BMUA 4NDRB 3TVIA 2JJ4A 4NDQB 3QURA 3S6HA 3EK5A 3QUOA 4NDRA 2A1FA 3K4YA 4USJA 2J4KA 2RD5A 2AP9A 2BNEA 2BRXA 3WWNA 3K56A 2J0WA 3AB4A 3T7BA 3NWYA 2J4JA 2WXBA 4NDQA 3U6UA 1OHAA 4F6TB 3C1MA 1GS5A 3S6GA 2AKOA 2HMFA 4A7XA 2J0XA 4JZ7A 1OHBA 3ZZFA 1YBDA 3ZZHA 2OGXA 3WWMA 3KZFA 3C1NA 3L86A 2J4LA 3AB2A 1OH9A 2X2WA 3L76A 2IJ9A 3K4OA 2R8VA 3LKKA 3S6KA 4Q1TA 4KZTA 1B7BA 2E9YA 4A7WA 3LL5A 3QUNA 3B8GA 3EK6A 4NDPB 2CDQA 2WE5A 4AXSA 4JZ8A 2BTYA 3D2MA 3ZZIA 1E19A 2OGXB 2V4YA 4NDOB 3QVHA 2W21A 2BNFA 2J5VA 3AAWA 4OLCA 4I49A 1GSJA 2J5TA 4F6TA 2BNDA 3K52A 3LL9A 4JZ9A 3D40A 3ZZGA 2R98A 2VA1A 2BRIA 2WE4A 3QVFA 2JJXA 4AB7A 4NDOA 1Z9DA 2V5HA 3D2PA 4NDPA 2JI5A 3D41A 3C20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUF A;  2BMU A;  4NDR B;  3TVI A;  2JJ4 A;  4NDQ B;  3QUR A;  3S6H A;  3EK5 A;  3QUO A;  4NDR A;  2A1F A;  3K4Y A;  4USJ A;  2J4K A;  2RD5 A;  2AP9 A;  2BNE A;  2BRX A;  3WWN A;  3K56 A;  2J0W A;  3AB4 A;  3T7B A;  3NWY A;  2J4J A;  2WXB A;  4NDQ A;  3U6U A;  1OHA A;  4F6T B;  3C1M A;  1GS5 A;  3S6G A;  2AKO A;  2HMF A;  4A7X A;  2J0X A;  4JZ7 A;  1OHB A;  3ZZF A;  1YBD A;  3ZZH A;  2OGX A;  3WWM A;  3KZF A;  3C1N A;  3L86 A;  2J4L A;  3AB2 A;  1OH9 A;  2X2W A;  3L76 A;  2IJ9 A;  3K4O A;  2R8V A;  3LKK A;  3S6K A;  4Q1T A;  4KZT A;  1B7B A;  2E9Y A;  4A7W A;  3LL5 A;  3QUN A;  3B8G A;  3EK6 A;  4NDP B;  2CDQ A;  2WE5 A;  4AXS A;  4JZ8 A;  2BTY A;  3D2M A;  3ZZI A;  1E19 A;  2OGX B;  2V4Y A;  4NDO B;  3QVH A;  2W21 A;  2BNF A;  2J5V A;  3AAW A;  4OLC A;  4I49 A;  1GSJ A;  2J5T A;  4F6T A;  2BND A;  3K52 A;  3LL9 A;  4JZ9 A;  3D40 A;  3ZZG A;  2R98 A;  2VA1 A;  2BRI A;  2WE4 A;  3QVF A;  2JJX A;  4AB7 A;  4NDO A;  1Z9D A;  2V5H A;  3D2P A;  4NDP A;  2JI5 A;  3D41 A;  3C20 A; 
#chains in the Genus database with same CATH topology
 2BUF A;  2BMU A;  4NDR B;  3TVI A;  2JJ4 A;  4NDQ B;  3QUR A;  3S6H A;  3EK5 A;  3QUO A;  4NDR A;  2A1F A;  3K4Y A;  4USJ A;  2J4K A;  2RD5 A;  2AP9 A;  2BNE A;  2BRX A;  3WWN A;  3K56 A;  2J0W A;  3AB4 A;  3T7B A;  3NWY A;  2J4J A;  2WXB A;  4NDQ A;  3U6U A;  1OHA A;  4F6T B;  3C1M A;  1GS5 A;  3S6G A;  2AKO A;  2HMF A;  4A7X A;  2J0X A;  4JZ7 A;  1OHB A;  3ZZF A;  1YBD A;  3ZZH A;  2OGX A;  3WWM A;  3KZF A;  3C1N A;  3L86 A;  2J4L A;  3AB2 A;  1OH9 A;  2X2W A;  3L76 A;  2IJ9 A;  3K4O A;  2R8V A;  3LKK A;  3S6K A;  4Q1T A;  4KZT A;  1B7B A;  2E9Y A;  4A7W A;  3LL5 A;  3QUN A;  3B8G A;  3EK6 A;  4NDP B;  2CDQ A;  2WE5 A;  4AXS A;  4JZ8 A;  2BTY A;  3D2M A;  3ZZI A;  1E19 A;  2OGX B;  2V4Y A;  4NDO B;  3QVH A;  2W21 A;  2BNF A;  2J5V A;  3AAW A;  4OLC A;  4I49 A;  1GSJ A;  2J5T A;  4F6T A;  2BND A;  3K52 A;  3LL9 A;  4JZ9 A;  3D40 A;  3ZZG A;  2R98 A;  2VA1 A;  2BRI A;  2WE4 A;  3QVF A;  2JJX A;  4AB7 A;  4NDO A;  1Z9D A;  2V5H A;  3D2P A;  4NDP A;  2JI5 A;  3D41 A;  3C20 A; 
#chains in the Genus database with same CATH homology
 2BUF A;  2BMU A;  4NDR B;  3TVI A;  2JJ4 A;  4NDQ B;  3QUR A;  3S6H A;  3EK5 A;  3QUO A;  4NDR A;  2A1F A;  3K4Y A;  4USJ A;  2J4K A;  2RD5 A;  2AP9 A;  2BNE A;  2BRX A;  3WWN A;  3K56 A;  2J0W A;  3AB4 A;  3T7B A;  3NWY A;  2J4J A;  2WXB A;  4NDQ A;  3U6U A;  1OHA A;  4F6T B;  3C1M A;  1GS5 A;  3S6G A;  2AKO A;  2HMF A;  4A7X A;  2J0X A;  4JZ7 A;  1OHB A;  3ZZF A;  1YBD A;  3ZZH A;  2OGX A;  3WWM A;  3KZF A;  3C1N A;  3L86 A;  2J4L A;  3AB2 A;  1OH9 A;  2X2W A;  3L76 A;  2IJ9 A;  3K4O A;  2R8V A;  3LKK A;  3S6K A;  4Q1T A;  4KZT A;  1B7B A;  2E9Y A;  4A7W A;  3LL5 A;  3QUN A;  3B8G A;  3EK6 A;  4NDP B;  2CDQ A;  2WE5 A;  4AXS A;  4JZ8 A;  2BTY A;  3D2M A;  3ZZI A;  1E19 A;  2OGX B;  2V4Y A;  4NDO B;  3QVH A;  2W21 A;  2BNF A;  2J5V A;  3AAW A;  4OLC A;  4I49 A;  1GSJ A;  2J5T A;  4F6T A;  2BND A;  3K52 A;  3LL9 A;  4JZ9 A;  3D40 A;  3ZZG A;  2R98 A;  2VA1 A;  2BRI A;  2WE4 A;  3QVF A;  2JJX A;  4AB7 A;  4NDO A;  1Z9D A;  2V5H A;  3D2P A;  4NDP A;  2JI5 A;  3D41 A;  3C20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...