3NWYA

Structure and allosteric regulation of the uridine monophosphate kinase from mycobacterium tuberculosis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
235
structure length
227
Chain Sequence
b'LSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQIADVVRGGVQIAVVIGGGNFAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAVRGEKIGTLVTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate kinase
publication title Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 73
structure length 227
sequence length 235
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 3nwyA00
2BRIA 2J0XA 4F6TB 3QUOA 2JI5A 3B8GA 2J4JA 3EK5A 3ZZIA 4Q1TA 4NDRA 4NDQA 2V4YA 3WWNA 1Z9DA 4AXSA 3K4YA 2R8VA 3LL9A 4F6TA 2V5HA 1GS5A 2BRXA 4NDRB 3ZZHA 2R98A 2BNFA 3K4OA 4A7XA 3QVHA 4I49A 3KZFA 3L86A 4NDOB 2J4KA 3C1NA 2J5VA 2CDQA 3ZZFA 1GSJA 2BNEA 3WWMA 3C20A 3LL5A 3D41A 3U6UA 2WE4A 2W21A 4NDOA 3EK6A 2WE5A 1OHAA 3S6KA 1OHBA 3AB2A 4A7WA 3LKKA 4OLCA 4NDPB 3C1MA 3TVIA 2WXBA 4AB7A 2HMFA 3NWYA 2AP9A 2J5TA 2JJXA 3K52A 2BMUA 2AKOA 3AAWA 2OGXB 4KZTA 2X2WA 1E19A 4NDPA 2J4LA 2JJ4A 2RD5A 2J0WA 2E9YA 2VA1A 2BUFA 2BTYA 1YBDA 3S6HA 3AB4A 3ZZGA 1OH9A 4USJA 3QUNA 1B7BA 3D2MA 2OGXA 3QVFA 4JZ7A 3D2PA 3K56A 4JZ8A 3D40A 3T7BA 2BNDA 2IJ9A 2A1FA 4NDQB 4JZ9A 3QURA 3S6GA 3L76A
chains in the Genus database with same CATH superfamily
2BRIA 2J0XA 4F6TB 3QUOA 2JI5A 3B8GA 2J4JA 3EK5A 3ZZIA 4Q1TA 4NDRA 4NDQA 2V4YA 3WWNA 1Z9DA 4AXSA 3K4YA 2R8VA 3LL9A 4F6TA 2V5HA 1GS5A 2BRXA 4NDRB 3ZZHA 2R98A 2BNFA 3K4OA 4A7XA 3QVHA 4I49A 3KZFA 3L86A 4NDOB 2J4KA 3C1NA 2J5VA 2CDQA 3ZZFA 1GSJA 2BNEA 3WWMA 3C20A 3LL5A 3D41A 3U6UA 2WE4A 2W21A 4NDOA 3EK6A 2WE5A 1OHAA 3S6KA 1OHBA 3AB2A 4A7WA 3LKKA 4OLCA 4NDPB 3C1MA 3TVIA 2WXBA 4AB7A 2HMFA 3NWYA 2AP9A 2J5TA 2JJXA 3K52A 2BMUA 2AKOA 3AAWA 2OGXB 4KZTA 2X2WA 1E19A 4NDPA 2J4LA 2JJ4A 2RD5A 2J0WA 2E9YA 2VA1A 2BUFA 2BTYA 1YBDA 3S6HA 3AB4A 3ZZGA 1OH9A 4USJA 3QUNA 1B7BA 3D2MA 2OGXA 3QVFA 4JZ7A 3D2PA 3K56A 4JZ8A 3D40A 3T7BA 2BNDA 2IJ9A 2A1FA 4NDQB 4JZ9A 3QURA 3S6GA 3L76A
chains in the Genus database with same CATH topology
2BRIA 2J0XA 4F6TB 3QUOA 2JI5A 3B8GA 2J4JA 3EK5A 3ZZIA 4Q1TA 4NDRA 4NDQA 2V4YA 3WWNA 1Z9DA 4AXSA 3K4YA 2R8VA 3LL9A 4F6TA 2V5HA 1GS5A 2BRXA 4NDRB 3ZZHA 2R98A 2BNFA 3K4OA 4A7XA 3QVHA 4I49A 3KZFA 3L86A 4NDOB 2J4KA 3C1NA 2J5VA 2CDQA 3ZZFA 1GSJA 2BNEA 3WWMA 3C20A 3LL5A 3D41A 3U6UA 2WE4A 2W21A 4NDOA 3EK6A 2WE5A 1OHAA 3S6KA 1OHBA 3AB2A 4A7WA 3LKKA 4OLCA 4NDPB 3C1MA 3TVIA 2WXBA 4AB7A 2HMFA 3NWYA 2AP9A 2J5TA 2JJXA 3K52A 2BMUA 2AKOA 3AAWA 2OGXB 4KZTA 2X2WA 1E19A 4NDPA 2J4LA 2JJ4A 2RD5A 2J0WA 2E9YA 2VA1A 2BUFA 2BTYA 1YBDA 3S6HA 3AB4A 3ZZGA 1OH9A 4USJA 3QUNA 1B7BA 3D2MA 2OGXA 3QVFA 4JZ7A 3D2PA 3K56A 4JZ8A 3D40A 3T7BA 2BNDA 2IJ9A 2A1FA 4NDQB 4JZ9A 3QURA 3S6GA 3L76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRI A;  2J0X A;  4F6T B;  3QUO A;  2JI5 A;  3B8G A;  2J4J A;  3EK5 A;  3ZZI A;  4Q1T A;  4NDR A;  4NDQ A;  2V4Y A;  3WWN A;  1Z9D A;  4AXS A;  3K4Y A;  2R8V A;  3LL9 A;  4F6T A;  2V5H A;  1GS5 A;  2BRX A;  4NDR B;  3ZZH A;  2R98 A;  2BNF A;  3K4O A;  4A7X A;  3QVH A;  4I49 A;  3KZF A;  3L86 A;  4NDO B;  2J4K A;  3C1N A;  2J5V A;  2CDQ A;  3ZZF A;  1GSJ A;  2BNE A;  3WWM A;  3C20 A;  3LL5 A;  3D41 A;  3U6U A;  2WE4 A;  2W21 A;  4NDO A;  3EK6 A;  2WE5 A;  1OHA A;  3S6K A;  1OHB A;  3AB2 A;  4A7W A;  3LKK A;  4OLC A;  4NDP B;  3C1M A;  3TVI A;  2WXB A;  4AB7 A;  2HMF A;  3NWY A;  2AP9 A;  2J5T A;  2JJX A;  3K52 A;  2BMU A;  2AKO A;  3AAW A;  2OGX B;  4KZT A;  2X2W A;  1E19 A;  4NDP A;  2J4L A;  2JJ4 A;  2RD5 A;  2J0W A;  2E9Y A;  2VA1 A;  2BUF A;  2BTY A;  1YBD A;  3S6H A;  3AB4 A;  3ZZG A;  1OH9 A;  4USJ A;  3QUN A;  1B7B A;  3D2M A;  2OGX A;  3QVF A;  4JZ7 A;  3D2P A;  3K56 A;  4JZ8 A;  3D40 A;  3T7B A;  2BND A;  2IJ9 A;  2A1F A;  4NDQ B;  4JZ9 A;  3QUR A;  3S6G A;  3L76 A; 
#chains in the Genus database with same CATH topology
 2BRI A;  2J0X A;  4F6T B;  3QUO A;  2JI5 A;  3B8G A;  2J4J A;  3EK5 A;  3ZZI A;  4Q1T A;  4NDR A;  4NDQ A;  2V4Y A;  3WWN A;  1Z9D A;  4AXS A;  3K4Y A;  2R8V A;  3LL9 A;  4F6T A;  2V5H A;  1GS5 A;  2BRX A;  4NDR B;  3ZZH A;  2R98 A;  2BNF A;  3K4O A;  4A7X A;  3QVH A;  4I49 A;  3KZF A;  3L86 A;  4NDO B;  2J4K A;  3C1N A;  2J5V A;  2CDQ A;  3ZZF A;  1GSJ A;  2BNE A;  3WWM A;  3C20 A;  3LL5 A;  3D41 A;  3U6U A;  2WE4 A;  2W21 A;  4NDO A;  3EK6 A;  2WE5 A;  1OHA A;  3S6K A;  1OHB A;  3AB2 A;  4A7W A;  3LKK A;  4OLC A;  4NDP B;  3C1M A;  3TVI A;  2WXB A;  4AB7 A;  2HMF A;  3NWY A;  2AP9 A;  2J5T A;  2JJX A;  3K52 A;  2BMU A;  2AKO A;  3AAW A;  2OGX B;  4KZT A;  2X2W A;  1E19 A;  4NDP A;  2J4L A;  2JJ4 A;  2RD5 A;  2J0W A;  2E9Y A;  2VA1 A;  2BUF A;  2BTY A;  1YBD A;  3S6H A;  3AB4 A;  3ZZG A;  1OH9 A;  4USJ A;  3QUN A;  1B7B A;  3D2M A;  2OGX A;  3QVF A;  4JZ7 A;  3D2P A;  3K56 A;  4JZ8 A;  3D40 A;  3T7B A;  2BND A;  2IJ9 A;  2A1F A;  4NDQ B;  4JZ9 A;  3QUR A;  3S6G A;  3L76 A; 
#chains in the Genus database with same CATH homology
 2BRI A;  2J0X A;  4F6T B;  3QUO A;  2JI5 A;  3B8G A;  2J4J A;  3EK5 A;  3ZZI A;  4Q1T A;  4NDR A;  4NDQ A;  2V4Y A;  3WWN A;  1Z9D A;  4AXS A;  3K4Y A;  2R8V A;  3LL9 A;  4F6T A;  2V5H A;  1GS5 A;  2BRX A;  4NDR B;  3ZZH A;  2R98 A;  2BNF A;  3K4O A;  4A7X A;  3QVH A;  4I49 A;  3KZF A;  3L86 A;  4NDO B;  2J4K A;  3C1N A;  2J5V A;  2CDQ A;  3ZZF A;  1GSJ A;  2BNE A;  3WWM A;  3C20 A;  3LL5 A;  3D41 A;  3U6U A;  2WE4 A;  2W21 A;  4NDO A;  3EK6 A;  2WE5 A;  1OHA A;  3S6K A;  1OHB A;  3AB2 A;  4A7W A;  3LKK A;  4OLC A;  4NDP B;  3C1M A;  3TVI A;  2WXB A;  4AB7 A;  2HMF A;  3NWY A;  2AP9 A;  2J5T A;  2JJX A;  3K52 A;  2BMU A;  2AKO A;  3AAW A;  2OGX B;  4KZT A;  2X2W A;  1E19 A;  4NDP A;  2J4L A;  2JJ4 A;  2RD5 A;  2J0W A;  2E9Y A;  2VA1 A;  2BUF A;  2BTY A;  1YBD A;  3S6H A;  3AB4 A;  3ZZG A;  1OH9 A;  4USJ A;  3QUN A;  1B7B A;  3D2M A;  2OGX A;  3QVF A;  4JZ7 A;  3D2P A;  3K56 A;  4JZ8 A;  3D40 A;  3T7B A;  2BND A;  2IJ9 A;  2A1F A;  4NDQ B;  4JZ9 A;  3QUR A;  3S6G A;  3L76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...