3NYDA

Crystal structure of kemp eliminase hg-2 complexed with transition state analog 5-nitro benzotriazole
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
303
structure length
303
Chain Sequence
AAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQADFGMVWPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGISVFGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Hydrolase
total genus 121
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nydA00
1EXPA 5A95A 1GZJA 5A6BA 2BXZA 3TA9A 1EHAA 1WB0A 1WZAA 2OSXA 3VILA 2ZUVA 1V0NA 3PZQA 1JZ8A 4PYSA 1F4AA 1JZ5A 4M56A 3ZJ6A 5JBFA 1YHTA 3U7BA 3AJ7A 1C8YA 2PBOA 2DSVA 2ZXAA 4HMEA 3CZJA 4CD7A 3WDPP 4LX4A 3PBGA 1F4HA 5ABHA 2XFFA 4W5UA 1E6ZA 1VFMA 4H8VA 1XCXA 3LPFA 2D3LA 2QLYA 1ZS2A 3GBEA 4W86A 3HJEA 1OGGA 1UQZA 3CHDA 3ECQA 3BAXA 4CVWA 3ARSA 4B9ZA 2XJ7A 2J7CA 5CZKA 2X05A 5CPTA 4HA3A 1FFQA 2Y8VA 1B9ZA 1FH7A 4TOQA 3WDHA 4D6FA 3PZTA 5A1AA 1WDPA 4Z2GA 1QHPA 1FH9A 1W3KA 2CYGA 4D1IA 4GZEA 2J8FA 6TAAA 4ML4A 1XD1A 1PJ9A 3WDQA 3BCFA 3WNNA 3ZT7A 1HJXA 4ZXOA 1J12A 2ESCA 1XD0A 3VD4A 3AIUA 4PUEA 2YA0A 5C8BB 1ISYA 1VJSA 2UY4A 4NI3A 1VBUA 4JZ5A 3WH7A 1XSJA 1M53A 5GNXA 1XH2A 2EPMX 5C70A 2F2HA 1JG9A 1GW1A 2X0YA 3T0AA 3MV11 3EDFA 1C93A 3VGEA 1W9PA 1J11A 4LYQA 3MUIA 1V08A 3WDIA 3PTMA 1W91A 2WVSA 2J7EA 3ZIZA 4PMRA 4JKMA 4WIWA 4E8CA 3A4WA 2UY5A 1WKYA 1V6UA 4UOJA 3WL1A 4BQ5A 2OSWA 4M8UA 4QCFA 3FW6A 3ARTA 2BHYA 4MB1A 1K9DA 1BLIA 1FA2A 1NP0A 1ZBCA 4DM1A 4CKQA 2YLAA 3A6OA 1V03A 2ZX9A 1BG9A 3WUBA 2QF8A 1D3CA 2BHUA 2VZSA 4IISA 3K1DA 3WELA 5CJ5A 1GJWA 4AEEA 3G6LA 4NSBA 5IHSA 2PF0A 2A3EA 5A2BA 4YN5A 1W9BM 1H11A 3IJ7A 1IT0A 1UKTA 1E1FA 3TTOA 4MTVA 3AYSA 2OYMA 1UWRA 3KL5A 1RD6A 4P7OA 1BHGA 1TCMA 1V0MA 1XYZA 4WSJA 2GJPA 3EMZA 3GNOA 3W82A 2WSKA 3EYPA 4DWSB 4CGTA 3VIMA 5IXEA 3I3EA 5I6SA 2ZX8A 1KQZA 3WMBA 3K4DA 4AD3A 4AWEA 1ZJAA 3WF3A 5JUVA 1QNOA 1CGUA 4M24A 5IHRA 3FHQA 3ZM8A 1BYDA 1HVXA 2WYSA 3CIVA 2J4GA 5HPCA 1HKMA 2VVSA 2WB5A 1CGXA 1E6SM 4Z2JA 3WH9A 1JD7A 3K4AA 3SUUA 4WF7A 1OT2A 3IAQA 1V0LA 4L4PA 5M03A 2WMKA 1PEZA 2NT1A 5HXMA 1E3XA 4YHEA 3N1AA 1MQPA 3L4WA 5AYBA 1AQHA 4TX6A 1E43A 1C7TA 3N11A 2DDXA 2WK2A 3WUEA 1VFFA 3VOCA 3ZJ7A 3WQVA 3VD5A 1MQRA 3VMNA 3CGTA 1LG2A 3VIKA 3LPOA 1UKOA 3AHZA 1UA7A 2WLYA 2W67A 3GXDA 4H2CA 4N42A 2IUZA 1ODUA 4MNMA 1HX0A 3ZR6A 2VURA 2WC4A 5A2CA 2FGLA 4UOQA 1DEDA 1JGIA 3W0KA 2ZWYA 4MDOA 4JAWA 2PC8A 1X1NA 3KEHA 1W1VA 1DWHM 2XIIA 4XZBA 2G3JA 5M3WA 5GQBA 4V27A 3PN8A 4DUXA 1JD9A 4P7NA 3NSXA 4ZEPA 3B9AA 5CXPA 2RGMA 1WCGA 2VX5A 3F5JA 2J74A 1GNXA 2DT0A 4WJXA 4RE2A 2D1ZA 1JZ4A 4W7UA 3E1F1 2PWGA 1PBGA 3T08A 5A6JA 1B3WA 1UG6A 5A8QA 2OWWA 4TVCA 2PWDA 2XUCA 5E6ZA 2VZVA 3LPGA 1PX3A 3VTRA 2VOTA 3MMDA 5IFPA 1K9FA 2NT0A 1H09A 2C8NA 3CLWA 1KR0A 2A3HA 2V3DA 1HN1A 3VM7A 5A6SA 4NF7A 1KFWA 5HOSA 3FAXA 4W5ZA 2W62A 1CZ1A 4CD4A 3WF1A 2EJ1A 3WDRA 1OM0A 2UY3A 3I3DA 2YBTA 1UZ1A 2CBJA 4A4AA 2X2YA 1GHRA 3WDJA 3UG5A 4P8XA 2CEQA 1UR8A 3BAJA 3T2QA 3QR3A 1CWYA 3L2LA 1Q6EA 2YJQA 5BWFA 3AOFA 1KWGA 5EFFA 1MWOA 1L8NA 1WP6A 3CTTA 4W7VA 3UEQA 1E0XA 4AZ6A 4UQEA 3GM8A 3VKKA 4S3KA 1Q4NX 3SUTA 3WEMA 3W38A 2WWDA 3S6TA 1JXJA 1VAHA 1LQ0A 1QI3A 3UCQA 5D9NA 2VQUA 4H7VA 1R86A 3OZPA 1RP9A 4BQ4A 1UUQA 4HZ7A 2CITA 3WNOA 2O9OA 3A4AA 1VEPA 2OWCA 1JI1A 1ISWA 2DQXA 2XVNA 2J75A 2BFGA 1VENA 2DH2A 3PZGA 1MW0A 3BH4A 5FKYA 3PZMA 4GI6A 1IZJA 3UG3A 1WZKA 3WENA 3F5LA 2WKGA 2D22A 3GH7A 4D6CA 5D8ZA 3WNMA 4DWSA 1K6AA 2J62A 2V5CA 3FHAA 4WKHA 1LWJA 1CECA 5ABGA 4AIEA 5CLWA 2VR4A 1V3IA 2WHKA 1C8QA 3WKZA 2A3AA 4F9DA 1B30A 5TD4A 1WO2A 1C3FA 4LXFA 1V0KA 2ZOXA 2WBGA 1JI2A 3NJ3A 4Z2LA 4IPLA 3WNKA 5GNYA 4HPGA 2W92A 1AQ0A 1QHOA 4CN6A 1WNOA 5I3DA 1NOWA 3FAWA 2GJXA 2A3BA 4BQ2A 3WH5A 4BS0A 2VO5A 2Z1SA 4UFMA 5E0FA 2W63A 1V6VA 3ARYA 2FHCA 1W9DM 1E6XM 3K8KA 1NWRA 3W28A 4GXPA 1M7XA 2J7FA 3AROA 4JHOA 3TONA 4JKKA 1XV8A 3KZSA 3VIIA 3II1A 4HA1A 4HTYA 1HKKA 1G94A 2E8ZA 4PMNA 2YL6A 4UFKA 1G9HA 4U2YA 4AZHA 4ZE4A 2J7DA 1GHSA 3L4XA 1V3JA 2GFTA 2XSBA 3W24A 5BCAA 3DECA 4P8WA 3K8MA 3AMCA 2WSPA 3F5KA 3KL3A 1W1TA 4FLRA 2GUYA 5E6YA 2DSKA 3FN9A 3SUWA 4FLQA 1MFUA 3N13A 1DTUA 4GQQA 1QPKA 1BG4A 1J10A 5CGTA 5AY7A 3MUZ1 3SCTA 4Z2IA 1UH3A 1E0VA 3WBAA 3N12A 1JZ6A 3WD3A 1DWIM 3AQUA 4PMXA 4ZE5A 1OB0A 3ARPA 3WBEA 3K8LA 1OIMA 3ZR5A 2FDMA 3WNPA 5BXRA 1UH4A 1HVQA 3CUJA 3CUHA 4M1RA 3HU7A 5JBEA 3CO4A 1PPIA 4WSKA 3WNLA 3AIEA 2YA2A 5E0CA 5IDIA 4C7DA 4CN1A 1W9XA 3WN6A 5I0DA 4ATWA 1H41A 1QI2A 1J0IA 3ARXA 4CCCA 3WF0A 5BXPA 2J8GA 3SCPA 4D6IA 4MJ4A 2WMHA 2ZX5A 2VRQA 1PZ2A 1GORA 1XHGA 4HZ6A 3U5UA 3IANA 4JCMA 3FNDA 4P7QA 3VMPA 2ZUSA 1CNVA 2VTFA 3MMUA 3VDCA 1OBAA 1W2VA 3VX1A 4PMDA 4AZ7A 1A3HA 4B3KA 4J7RA 5GNZA 1ZBWA 3N9KA 1UR0A 1CXEA 1OD0A 5I79A 3VIOA 1UWIA 1GOQA 5BROA 1JYWA 1CXIA 1UD6A 3MSDA 1FFRA 4JFUA 1OGSA 4PMQA 1E71M 3GH5A 3N18A 3NCOA 5D8WA 3VMOA 3WMSA 2JE8A 1HJWA 1UH2A 3APGA 3SCVA 2YLLA 4PBGA 5BXSA 3WH8A 1JXKA 1PAMA 2WHLA 2B31A 3OIHA 1K9TA 2CIPA 1HNYA 3EMCA 1CPUA 1H0GA 4KMQA 4B15A 4PCSA 1B2YA 1I1XA 1KCLA 1RH9A 2BVYA 1B3YA 1LJYA 2QPUA 1TMQA 4U5KA 1WPCA 4K68A 6A3HA 2X09A 3WMCA 2V3GA 3UETA 1BF2A 1QBBA 3BAWA 3UESA 1GOWA 3OG2A 1DWGM 4MADA 4PCTA 1WZMA 2XVPA 5I24A 2CKSA 2GVYA 1J0JA 4PSRA 1UWQA 3AI0A 2D24A 4YHGA 3VU2A 2WC7A 2VCBA 3PTQA 3WQ5A 3VGDA 1PIGA 4F79A 3WD0A 3MMWA 1AVAA 2WNWA 1TFVA 2E9MA 2VL4A 3PZIA 5EMYA 4OBRA 3ARUA 2XVKA 5AYIA 4MDPA 1XH1A 1ZL1A 3DYPA 3PZUA 3WEOA 1MQQA 3SCOA 3GYCA 1W3JA 1JL8A 4PMUA 4MJ2A 4UQ9A 5D9OA 3RIKA 3WD4A 1ESWA 5BYWA 1U2YA 2JIEA 2AAAA 2D23A 2XSAA 5AC4A 2VZOA 1MW1A 3W26A 4CD5A 4R5EA 4CCDA 1GQLA 2CCRA 4D6GA 3ZT5A 9CGTA 2YOCA 1E4NA 1EH9A 1PX8A 1HKJA 3G6MA 3UR8A 4WKFA 4UOZA 4TX8A 2BHZA 2ZX6A 4UQBA 4FF5A 4OOUA 3WFLA 5IFTA 3D5HA 2Y2WA 3CZKA 1EIBA 4D1JA 1V3KA 1JZ7A 3A4XA 1MW2A 3ARZA 3OBAA 5A8NA 8CGTA 3U7VA 3ALGA 2MANA 4Z2KA 2WVUA 2WVTA 4UFHA 1DWFM 2BY0A 1NOFA 3B8SA 1EGZA 3M07A 3IAPA 3BXWA 2G3MA 3VVGA 3GNRA 1H1NA 2VC9A 3WIJA 3MU7A 2XM2A 4D6EA 2TAAA 4PMOA 1KXTA 2Z1KA 1FP9A 2CESA 2WZEA 3VGFA 4QLKA 3EDJA 1QNSA 2XVGA 4IM4A 1P6WA 2E3ZA 1HIZA 2J47A 3CMGA 4F66A 4ZENA 2BV9A 2J7GA 4FLSA 1XGZA 2Y24A 3VDBA 2XWDA 1ISZA 4ZFMA 1W3LA 4PN2A 3NSMA 4P8VA 1MXDA 3OLIA 2O9TA 4PMVA 4H8UA 1BGGA 3WH6A 4XB3A 1O7AA 2W5FA 1B31A 1EQCA 5A69A 4MB3A 4TTGA 1TZ7A 3O2LA 4PTMA 4TTUA 4TXEA 1UYQA 1TA3A 3OLDA 4D71A 3BMVA 3BLKA 4UQDA 4OZOA 2GJXB 1E3ZA 1OINA 1PZ3A 1UOKA 1GUVA 1MW3A 3GZAA 1GQIA 3VIJA 4W8LA 2CERA 2GDVA 4OBSA 1HXJA 2X1IA 2V38A 2JEPA 1CLXA 2J77A 4H04A 1V6YA 1JNEA 1XC6A 2VNCA 1HT6A 2WC3A 1QNQA 1W3HA 4MPKA 4PTVA 3DYMA 4QCEA 3VX0A 4GKLA 3PZOA 1JZ2A 2VRJA 4P7RA 3SCNA 5JIWA 4GZIA 1I1WA 3W81A 4CU8A 2DEPA 1ISVA 1UR2A 2RGLA 1MFVA 4KRUA 4NRRA 2J78A 4PRWA 4UQAA 1J18A 4JKLA 1TG7A 2DPEA 4AW7A 2D20A 1QI4A 1XH0A 1ODZA 1B3ZA 1UD8A 3GNPA 3AZSA 2CNCA 4BZYA 3RJYA 1SMDA 1JAKA 1R8LA 4E2OA 4Q7NA 1EDGA 1LF1A 3I3BA 4NZCA 2J79A 1R85A 3T2PA 1FOBA 1ZU8A 4YPJA 1CGVA 4AEFA 4UQCA 3AS0A 5BXTA 3T09A 3NUKA 1OWQA 2OSYA 3KWXA 3U5YA 4AISA 2YIHA 1KCKA 4U33A 2E9LA 1BTCA 2DIJA 3LPPA 3VDAA 2JF6A 1VEOA 4AD1A 1FP8A 2WAGA 3WQWA 3SCSA 2W61A 4JL2A 3VO0A 5CPQA 1CGTA 3AS3A 1UZ4A 3W6LA 3VNZA 5ECUA 1E4LA 1KBBA 2WMIB 1AQMA 4KRTA 1SMAA 2BY1A 4GO9A 5A3HA 1JDCA 2ZUNA 1BFNA 3AMLA 2O9PA 4J28A 2WCAA 2E8YA 4UFLA 1H5VA 1E6PA 1BAGA 1KGWA 5A8MA 2GK1B 4PMYA 3FXYA 1V02A 2WMGA 3SCWA 1X6LA 4XX6A 1NM9A 4ACZB 3W25A 4BCEA 2D0GA 2EPNA 1LLOA 2WW5A 2ZICA 3MKKA 1TVPA 4CCEA 2VQTA 4AZGA 5EBAA 2ZUUA 1KXQA 1GVYA 1D2KA 3NIYA 1CXKA 1G01A 2EQDA 2OYLA 3RILA 1HKIA 1LL6A 2WLZA 1IZKA 5CGMA 4GIAA 3OB8A 1ZBKA 4TVDA 2PWEA 3AIQA 3QOMA 1HF6A 4BA0A 5DF0A 1NH6A 2WMFA 3AIVA 3AZRA 4PSPA 4X0NA 1CIUA 4W7WA 2QPSA 1EA9C 1ZJBA 1HJVA 4MAZA 1DP0A 5M5DA 4Q22A 1FH8A 4JFSA 4Z2HA 1NQ6A 5BRPA 2C7FA 1E40A 5DT7A 4J3XA 4WLCA 1JF6A 1E5JA 5D4YA 4V2XA 2E0PA 2WM0A 3SCRA 3W29A 1JYVA 1US2A 1FHDA 1M01A 4HU8A 3CZEA 3VUPA 1CGYA 1QW9A 4U3CA 2VZTA 2IXVA 1V3MA 3WF4A 5I5RA 4DWSD 3B9DA 4J3UA 5HBFA 3TTQA 2CXGA 4LPCA 4EK7A 4B16A 2WCGA 3SURA 2WANA 1Q6CA 1GOMA 2XGBA 5JIPA 1E72M 4RE3A 4UTFA 2W66A 2CBVA 4JIEA 2NW0A 3SIMA 4F9JA 3NSNA 3VD7A 4DM2A 3AHYA 2J7BA 3QHMA 4TUFA 2VUYA 4AYSA 3WUFA 1H4PA 3IJ9A 4CN4A 2VCCA 3OGSA 4D72A 5FIPA 1A47A 1CXFA 1ZB5A 2HVMA 1CDGA 4RE4A 2A3CA 4AZCB 4AC1X 4J3VA 1EDQA 2DSWA 1BVNP 3WY1A 3VGGA 2WPGA 3U57A 1U33A 4DWSC 3O6AA 3WD2A 3T2OA 2FHBA 3VIPA 4AXNA 2OWXA 3ZOAA 4PMZA 4E4PA 3AHTA 1KXHA 5D9MA 3THCA 4QFUA 1E6QM 4Y7EA 4AD2A 1W32A 4QAWA 2XGIA 4W88A 1R87A 4HA4A 3RM9A 5A8OA 2EEXA 1TUXA 1KR1A 3QOKA 4R27A 2VCAA 4HMDA 3TP4A 2WXDM 2Q8XA 5A6LA 5A6KA 1KGXA 5HNNA 4M82A 4AZBA 2WVVB 1JNDA 4U5IA 4CVUA 3GH4A 5E09A 3RJXA 3MV01 4UZUA 1B3XA 2GJRA 3VPLA 1GQJA 3L2MA 5FOOA 3L4UA 2XYLA 2BNJA 5CG0A 2DH3A 3VIFA 5A6MA 4W89A 4MB5A 2WMIA 3KL0A 1CXLA 2DT3A 1VB9A 2QMJA 1BGAA 4OIFA 3RO8A 3OLGA 3QHOA 4L4OA 3CHEA 1CGWA 1DWJM 1C7SA 3EDKA 1E70M 2ZUWA 2VVNA 1VIWA 2VRKA 2GK1A 1B90A 2JEQA 4MAVA 3OZOA 1GJUA 1TA3B 1UKPA 2PWHA 3WQ6A 4ACZA 1BSIA 1J01A 1KBKA 2XFYA 4URIA 3WFZA 3SEPA 1OT1A 2QV4A 1ITXA 2V3FA 1EO7A 5ABEA 3AICA 3CH9A 1UWUA 5LYRA 4AZIA 4UFJA 4W85A 1UD2A 5A94A 4TVUA 4HMCA 3BMWA 4AZ5A 2V5DA 3NDYA 1J0YA 1JAEA 1Y7VA 1OGBA 5A6BD 2Y5EA 2QMKA 4UNIA 2IXUA 1HJQA 1GOKA 3OA5A 1H2JA 3SUVA 2EPLX 3GXMA 5ABFB 2WHJA 4HOZA 1W1YA 3BAYA 3EMQA 5BRQA 1KGUA 1RPKA 4EAMA 4GI9A 3PZVA 4HOWA 1KWKA 1EOMA 4AY1A 5I77A 5I23A 4M81A 3CUIA 4QDMA 4J3TA 1SYTA 1NWSA 2AMGA 1B0IA 1ISXA 1GOIA 1TR1A 1XYFA 3CPUA 4J3SA 3VD9A 3VIGA 2XFRA 4J3WA 4PTXA 1L0PA 1US3A 5LA0A 3L4TA 4OUEA 4EKJA 1N82A 1J9YA 2G3IA 1QVBA 4QLJA 1NOUA 2WCSA 3MS8A 4CUCA 2WZIA 2VI0A 4JCLA 2YDQA 2O92A 4LQ1A 4WK9A 1VBRA 2O9RA 2YKKA 1E9LA 4DUVA 1WZLA 3VD3A 3CZLA 5DO8A 3VIHA 3WF2A 4AZCA 1C90A 3AS1A 1VEMA 2XM1A 3ARVA 2JF7A 1UD4A 2YA1A 2PB1A 3BCDA 3M46A 3AHXA 1CYGA 2WHMA 3ZO9A 1QOXA 1JFXA 2XVLA 3WL0A 1GPFA 1QI0A 1XSIA 2UY2A 1VRXA 3THDA 2XWEA 2DT1A 1NP2A 1JZ3A 3ZMRA 4AD4A 2F8QA 4E8DA 2VX7A 1UA3A 4PEEA 4AMCA 2CKRA 1HL9A 3W4RA 3RDKA 2Y4SA 2VX4A 2WVVA 1MVYA 5FCZA 3RM4A 4HOXA 3WQ4A 2F61A 1D7FA 3DC0A 1H0IA 4A3YA 5I2UA 3W6MA 1O6IA 3PHAA 1WAWA 5F7UA 2EPKX 1GOOA 2VMFA 3N04A 3WSUA 1JFHA 1EO5A 2BY2A 2YDSA 1EQPA 5DT5A 3W53A 4UR9A 4B3LA 4WKAA 1G5AA 3AFBA 1JF5A 5DMYA 4F8XA 3VM5A 3RM8A 2XIBA 3F4VA 1E73M 1J0HA 7CGTA 1V6WA 3AMGA 3O9NA 4U3AA 1VFOA 3L4ZA 3N15A 5CSYA 3BGAA 4JFVA 1Q6GA 1U30A 3WD1A 1TVNA 3ZSTA 1V6XA 1EHNA 3AMKA 1C92A 5E70A 7TAAA 1R7OA 1W1PA 3BSHA 3CUGA 1VJZA 4BF7A 1QI5A 2VR5A 4XZWA 2BVTA 1UR9A 5A8PA 4EE9A 2W91A 1EDTA 4PUDA 2NSXA 4CD6A 2JFEX 1DWAM 1UHVA 1LL4A 1V02E 1QHZA 1CTNA 5E9AA 1CEOA 4GI8A 2CHOA 2G4FA 1UD5A 2FH6A 2XTKA 3OGRA 1E1EA 3ZJ8A 3MO4A 1UR4A 3W37A 1PIFA 3CBWA 4ACYA 1E55A 4GPNA 2VJXA 3MANA 4LGXA 5GPRA 4MNKA 4H8HA 3UERA 1Z32X 5ABFA 5KZ6A 3W27A 4IPNB 4ZXLA 2G3NA 6CGTA 5I78A 3AIWA 2X8RA 3CUFA 1K9EA 1MXGA 1CLVA 3QHNA 3GTNA 1G1YA 2G41A 1HJSA 1E6RA 5D9PA 4X0VA 3UG4A 1DHKA 2EXOA 1E56A 1YQ2A 4GO8A 2E4TA 1LWHA 1BPLB 4NRSA 1Q6DA 4FMVA 4W87A 2WWCA 2CPUA 2ZXQA 4ATDA 4B9YA 1E0WA 4KWUA 4N0RA 5A6AA 4HZ8A 1OCQA 3SCUA 3TTYA 5JBDA 3J7HA 2E9BA 4MNJA 3AXHA 2UWFA 3BLPX 3B9EA 5LA2A 1BYAA 1CXHA 2ZUTA 1GCYA 5HDRA 1XCWA 1WDRA 4P7LA 2D3NA 2C0HA 4D6JA 3RMEA 3NDZA 2ZX7A 4KH2A 2AOSA 4W84A 2VX6A 1CBGA 3CZGA 2YL5A 4EANA 4LYRA 1AMYA 3L4YA 1IV8A 4OOZA 1VFUA 1JYNA 1ZBVA 3PZ9A 2VZUA 3SUSA 1SR0A 3VDHA 3GXIA 3WUGA 1BVZA 4QLLA 1UR1A 1I75A 2ZXBA 4GINA 2X0HA 3PTKA 1W2PA 4AD0A 1UKSA 1R7AA 5CPSA 3TOPA 3TTSA 1OD8A 5M17A 3AS2A 1GQKA 2D0HA 2D0FA 3AXIA 3A3HA 3UR7A 1C91A 4W8AA 1X6NA 4MB4A 4U31A 3HMCA 1VF8A 4P8UA 1UKQA 3ZJKA 1C8XA 4A3HA 4FK9A 1UWTA 2GSJA 2YBUA 1JYXA 4J27A 2DIEA 3DHUA 3GBDA 3MUY1 1SFSA 8A3HA 4DUWA 2WMJA 3CMJA 3QGVA 1CENA 1M03A 4HPHA 4FLOA 1QBAA 1E4IA 4RL3A 5EFDA 2OYKA 3S2CA 4XV0A 3K46A 4D6DA 3CHFA 3RPMA 4C7GA 4OKDA 3AYRA 2J25A 2JALA 4D6HA 3ZSSA 3CZ8A 2WZHA 5FL0A 3M7SA 3SCQA 1TE1A 3VNYA 3EDEA 4GQRA 4AIUA 2V3EA 1ECEA 3IK2A 5CSUA 3NYDA 4IUGA 2PI6A 3MSGA 1HP5A 5EB8A 3JUGA 3T0DA 3VGHA 1E6NA 2ZIDA 5DEZA 3AIRA 1J0ZA 2XG9A 3ZQ9A 3KE0A 2BY3A 1GVIA 1WDSA 1BYBA 3OLEA 4JL1A 5HPOA 5AC5A 2DT2A 1NARA 2GDUA 1JIBA 2OLHA 1FHLA 1V3LA 1UD3A 2FHFA 2HISA 3OGVA 1HJUA 2J7HA 2WKLA 2DSUA 3BSGA 1BYCA 2W4XA 2WBKA 3AISA 3AIBA 2BS9A 2BVDA 4HP5A 5FD0A 3BAIA 1W9VA 2BXYA 3ARRA 1JDDA 4V28A 2FGZA 4JHZA 1Q6FA 4ATLA 1KB3A 1UWSA 3BAKA 4HU0A 3POCA 4CU6A 1GONA 2EO7A 3EBVA 4XUYA 2DSZA 2ZWZA 2PWFA 1OIFA 2EPOA 3L4VA 3VINA 3DHPA 1KXVA 3IJ8A 4LYPA 1NWTA 3CHCA 4CD8A 2CHNA 2XPKA 2ZUMA 5KEZA 4MNLA 1M04A 1WE5A 4X9YA 4W8BA 4OJYA 1ITCA 4UCFA 2CETA 2CBIA 4CU7A 1W9UA 5CQ1A 4PTWA 1HL8A 1PX4A 4JFWA 1J0KA 1E15A 1JDAA 2JIWA 1XRVA 3DYOA 4JFTA 2FH8A 1BQCA 3WEZA 4AD5A 1LG1A 4UFIA 1OSEA 1QW8A 3N17A 3M6DA 5FL1A 3FY1A 1KQYA 5A2AA 2YL8A 2XHYA 3AZTA 1HP4A 3HN3A 3GDBA 7A3HA 5LA1A 1UQYA 1RP8A 3RCNA 1EOKA 1S46A 2ZE0A 1QNPA 4W93A 3VGBA 2DGAA 4KGLA 3WQ8A 1LL7A 3AMDA 3A47A 5CLTA 3AXXA 2PBGA 4M29A 1E4MM 5C71A 1H3GA 4S3JA 4QP0A 1NWUA 2CBUA 2D2OA 3GXFA 1QNRA 4KGJA 1E5NA 4C7FA 1H49A 2EBNA 1WDQA 2QHAA 2YL9A 1B3VA 3LMYA 1B1YA 3ARQA 4M80A 3ZT6A 2YDRA 3EDDA 2VT0A 4U2ZA 4UZSA 3AHVA 3BC9A 4GZJA 1XSKA 3PZNA 1V3HA 2E40A 4H41A 3ALFA 3D3AA 3MUAA 4BQ3A 3T0BA 4AIOA 2ZXDA 5DFAA 1MYRA 1G0CA 2G8ZA 3ARWA 2Y8KA 3POHA
chains in the Genus database with same CATH superfamily
1EXPA 3PPGA 4Q4RA 2CLIA 1ICSA 4LV4A 2PTDA 2J9YA 3W07A 1GEQA 4Q32A 3OZYA 3VILA 1JZ8A 3PZQA 3M41A 1F4AA 1JZ5A 3SDOA 4MVAA 1XPGA 4OFCA 3LHYA 1ADOA 2PP1A 3ABSA 3GW0A 3U7BA 4N6FA 3AJ7A 1C8YA 4L1WA 2ZXAA 4DZHA 2QUNA 4LSBA 4CD7A 4W5UA 1XIBA 1PO9A 2XIJA 1OC5A 2QLYA 3LOTA 5AHLA 3VFCA 4QE5A 1HKVA 3R4IA 2F2KA 1KM4A 1OGGA 4S38A 1UQZA 1XJBA 3UU0A 1LBLA 2VGGA 3QEZA 1R5YA 4B5SA 4TX9A 4I9JA 1NDWA 2DZAA 2Y8VA 5CC6A 1UJPA 1B9ZA 1LLZA 5CCZA 5CBBA 2B7NA 4MHBA 3WDHA 1LCOA 4JQ4A 3ERPA 1WDPA 4Z2GA 1QHPA 1W3KA 2CYGA 4D1IA 2CZEA 4OTKA 5DXXA 3UJFA 4GCAA 3UYCA 4ML4A 4R53A 1PJ9A 4MFDA 3WLQA 3ZT7A 4ZXOA 2MNRA 3OA3A 5CC5A 3R94A 2ESCA 4XK2A 4PL2A 3H4XA 3VD4A 3AIUA 3U9IA 1ZQ5A 1BXBA 2HRWA 4ZQPA 4ICMA 4U28A 4JZ5A 3WH7A 5G2WA 3WLHA 3L7RA 1VPQA 4DBWA 3VFLA 3BICA 1I4NA 5T26A 4C6KA 4CEXC 3VGEA 4NAFB 4B4FA 2YFNA 1XX1A 3MUIA 4PUJA 1RSCA 4JD4A 3QN3A 2QJGA 4ZOAA 4E8CA 1L6FA 1WOBA 4UOJA 3WL1A 4BQ5A 1E51A 3TIMA 3ARTA 4MB1A 4WOZA 1NP0A 4FXJA 3VE7A 3LQGA 3R79A 1BWLA 2BHUA 4IISA 2Y0FA 3CV1A 1L2UA 3FEMA 2DUXA 2QV5A 5LNUA 3CV7A 4KS0A 5K4XA 1JEZA 2A3EA 5A2BA 1DORA 1KM5A 1E1FA 4MTVA 2X41A 2E6AA 1RD6A 1GKRA 4BY3A 3RR1A 3N29A 4IL0A 3QMSA 2GJPA 1P1XA 3A9IA 5MF5A 3KW3A 3VOHA 1E9YB 3I3EA 3CEUA 3W7PA 3BGJA 3IUHA 3ANUA 5JUVA 1OYBA 2OO0A 5IHRA 3VI2A 1HVXA 3LHTA 4H8NA 4GVGA 4GG9A 1PVNA 3HO8A 4QGCA 3INPA 2R6OA 3RPDA 3FDKA 3WH9A 3R0KA 1V0LA 1M1BA 3EZ4A 2GGIA 1GYMA 4MWAA 2ZA1A 1MQPA 3L4WA 2ACUA 4LAOA 2C19A 3N11A 5BNKA 2ZDSA 3VOCA 1RLDA 3EGJA 3WQVA 2YX0A 3HM7A 3N2MA 3RG6A 3B8WA 3VMNA 3GUWA 3LPOA 2P0OA 1UKOA 3R8RA 3AHZA 2WLYA 5G1MA 2W67A 1YDVA 2IUZA 4MPQA 3M5YA 2PA6A 3MSYA 4FX7A 3ZR6A 4CNPA 3E96A 4UOQA 4H00A 3BJSA 4IMCA 1W1VA 1VQTA 4ZL1A 5M3WA 3CL6A 1SFLA 2Z27A 4V27A 4DUXA 3E9AA 4P7NA 1V4YA 2HBVA 3OG3A 4I6VA 1VCGA 5A6JA 1B3WA 4MSSA 4A05A 1U1UA 5A8QA 4MYAA 4PMJA 1TO3A 2PLJA 4TVCA 3AWNA 2FZBA 4N9BA 3OHMB 1M65A 1PX3A 4PC8A 3MMDA 3O63A 2NT0A 3H53A 3PB0A 3MCOA 4ERGA 3UWYA 1QCWA 3VM7A 3N2TA 3TR2A 2PDJA 4RPQA 4GC3A 1RVKA 1TSIA 4FF7A 1S2UA 2W62A 4JTIA 3W7GA 4CD4A 3WDRA 3TQ0A 4REQA 2A85A 1T7LA 3DUGA 1UZ1A 1GHRA 3DG6A 1KRBC 3WDJA 4K39A 3URNA 4WGHA 4ZBCA 3SGUA 1UR8A 2B0MA 5EGRA 3SJNA 3QR3A 1CWYA 5EMUA 1GGOA 2CHRA 1SSGA 1PXGA 3M0XA 2NX3A 3TTEA 4UQEA 1J6PA 1Q4NX 2FPYA 3ITVA 3BANA 3UCQA 4CQCA 3FSUA 2F6KA 1KLYA 1R86A 1R3SA 4J2PA 1KTCA 1ZALA 3A4AA 4PFMA 1VEPA 2BG5A 2HVOA 3LCWA 4DJFA 1ISWA 1FWEC 5HMSA 2J75A 2BFGA 1VENA 2DH2A 1LBMA 4E6MA 1DXEA 3FYOA 3RCYA 4ZTXA 2FTPA 1LRTA 1U5JA 3G3MA 3S42A 3WENA 2WKGA 4ZGYA 4UNLA 1DV7A 4EXQA 3TE9A 2HVNA 4B5UA 2RAGA 5ABGA 3RK8A 2VR4A 4RCXA 3QQ0A 3WKZA 4I6KA 4OU1A 4UTIA 1B30A 1WO2A 3GZ3A 3B97A 1F9CA 1HO4A 3H2OA 3BLDA 1Z69A 3VK5A 5GNYA 4HPGA 3L21A 4FSAA 1QHOA 1TJRA 2E1DA 3MUXA 2GWNA 4UWMA 5I3DA 1ONRA 3SQMA 2A3BA 4UFMA 3PPHA 2FHCA 3M5ZA 2C6QA 1YE4A 1W9DM 2YXOA 4GXPA 2J7FA 5DRCA 4JKKA 3VIIA 4JY9A 1SUXA 4WX2A 3T7VA 3H26A 2V6AA 3MKVA 3IIXA 4LRSA 4YJ5A 3M43A 5LGZA 1G94A 4GVIA 2YL6A 3HPSA 2J6XA 4JX4A 3BZJA 3TLLA 8XIMA 2PPGA 1G9HA 3CL7A 5L6UA 3WO8A 1KM2A 3BLFA 4NILA 1GHSA 5IRPA 5BCAA 4S2BA 4P8WA 1YBQA 4FLRA 1P6CA 4GQGA 5E6YA 1PKLA 3N13A 2QUTA 2GJNA 4GQQA 3P6LA 3TQVA 3HIJA 1W3IA 1UH3A 3TNBA 2C71A 2AKZA 1DWIM 1Q7ZA 3AQUA 4KBXA 3ARPA 3WBEA 3K8LA 4GE8A 2ZRZA 2P76A 4KETA 4C1LA 3CUJA 3CUHA 5MKGB 5JBEA 2OQYA 2AMXA 1X1ZA 2GOUA 3TKFA 3CXOA 1B54A 2ACRA 1UB3A 3WN6A 4ATWA 5I06A 1R3VA 1KTBA 4KFOA 3V5CA 4EIVA 2IW0A 3GVRA 5BXPA 2J8GA 1G67A 3SCPA 3JS3A 4D6IA 4MJ4A 1XHGA 3DFQA 2YW4A 4JCMA 4K37A 1R3YA 4P7QA 3VOGA 1MNZA 2QCLA 4J7RA 3ZVHB 4JTDA 1TPEA 1CXEA 1UMYA 5DRIA 3H55A 5BROA 1XIEA 2XN1A 1CXIA 3I68A 4ML9A 2V2DA 1CCWB 4N6EA 4BWLA 5D8WA 4HHPA 4IGMA 1AL7A 1IEQA 3E12A 5K7JA 4PBGA 3WH8A 3VNKA 1QO2A 1PAMA 2WHLA 3D46A 3EKGA 3W9ZA 1RY8A 4XTDA 1W17A 4C1KA 1XICA 1I1XA 1KCLA 4DPQA 3D47A 4KW2A 3P0WA 4DJEA 4X9SA 1LJYA 3E38A 1LP6A 3USZA 2ONEA 1WPCA 3G0XA 3PS7A 4EPDC 3N73A 3BAWA 1JUKA 1Z6KA 4ZO8A 4PCTA 1WZMA 2XVPA 1NDYA 1Y5XA 3BPWA 2NXHA 4YHGA 2WC7A 3ITOA 2VCBA 3PTQA 4F79A 3DX5A 4GJ1A 1TFVA 2E9MA 2VL4A 1MEIA 3ARUA 4YS1A 4MDPA 1XH1A 1ZL1A 5JH2A 1WXYA 3SGGA 1W3JA 5HAOA 3EWXA 4NL1A 5BYWA 2OX4A 4R7JA 3WYZA 3C0SA 3W26A 4R5EA 4CCDA 3CUZA 3ZT5A 3O15A 3P74A 1EH9A 1KRMA 2GZXA 3RGTA 1ZPTA 3OVRA 1AFSA 1HKJA 3K2GA 4WKFA 1Z42A 4UOZA 2BHZA 2CLHA 1B3OA 2DY3A 3Q37A 4FOUA 4HTBA 3CZKA 2FMNA 5DCEA 1V3KA 3A4XA 4B5VA 3W1QA 3OBAA 8CGTA 4JTQA 5LHEA 3ALGA 1WKDA 3V35A 4IX2A 3LTPA 2FB2A 1DJHA 4DF0A 3BXWA 3BG5A 3ORWA 2UBPC 2ZBTA 1QWKA 2DUZA 3RXZA 4JTHA 1H1NA 3WIJA 5D2WA 5L9FA 4HMNA 2I16A 3MU7A 3BSMA 4D6EA 3Q65A 4PMOA 4MJZA 3HGJA 1ZAHA 1KXTA 2WZEA 3B8TA 3EDJA 3H2CA 2XVGA 4IM4A 1AA1B 4LB3A 1HIZA 3W6YA 4ICNA 2V5BA 4US5D 4FLSA 4OWGA 1OFEA 5AYYA 4KWVA 3ZWSA 2XWDA 1ISZA 1Q65A 3I4KA 4ORIA 4P8VA 3T4CA 3KVMA 4H8UA 1BGGA 3TU9A 3OQEA 4IMFA 2HV5A 1RZMA 3R1ZA 3C4UA 3UJEA 4PTMA 2ALDA 3UZXA 4WSHA 2A2IA 4UQDA 2QS8A 4OZOA 3MP3A 2GJXB 5EL1A 1R0MA 3G8EA 2W0UA 3KTSA 4HCLA 1DE6A 3K13A 3BDKA 4NHVA 4GVFA 4N4QA 2ZYFA 3RX4A 1UOKA 3R8GA 2QULA 1IEXA 1TREA 1N8WA 1VYSX 1YTDA 1HXJA 3MBDA 4NZJA 3FYPA 2HXUA 5IDZA 1V6YA 3PG9A 2VNCA 4QDWA 1HT6A 2Q8ZA 3CEPA 2CLPA 4GKLA 1NDZA 1Z8AA 3AUJA 1KFKA 1MZHA 1HGYA 2Y7EA 1E9IA 4D8AA 2VFIA 4GZIA 3L9CA 1XYCA 4I9TA 2PE4A 1I1WA 4NY2A 4CU8A 3BOLA 3STCA 3B8UA 1JRCA 1QAPA 1QI4A 1XH0A 1B3ZA 1UUMA 4HNTA 1XLKA 3AZSA 2O7QA 5M1TA 4JTCA 3RJYA 4JTSA 1R8LA 4E2OA 1RALA 5G4WA 2C1GA 3FXGA 2J79A 4MM1A 2BX7A 3T2PA 3QR0A 1UBSA 4ROQA 5HMFA 4YPJA 4AEFA 4PUKA 4UQCA 3CV2A 3T09A 5F1UA 2RHGA 3NUKA 2OSYA 3FK4A 1RUSA 4PB5A 4MWAC 5AZ1A 2OODA 4V1YA 1KTNA 1R47A 2AAMA 1VHNA 3UT0A 4FNRA 2REQA 1VGAA 3PJTA 4O52A 4DB7A 3SCSA 2W61A 3UFYA 1PV8A 1IXNA 3EXSA 3FA3A 3W6LA 3TZNA 1GPWA 2WMIB 4X63A 1AQMA 5BZAA 3SN4A 4QJ4B 3AMLA 4CQ8A 2FVKA 1TR9A 2O9PA 4J28A 4H2HA 4UFLA 1H5VA 4HN8A 1IEVA 5A8MA 2X0SA 3EX4A 2ZTKA 4IZGA 2E6DA 1LLOA 3WLNA 5K3VA 1NF7A 1OX4A 1SJBA 4ZO7A 3NNTA 4AZGA 2VC6A 4AEOA 3KDNA 3CM4A 4FAMA 1GVYA 1W31A 2Y6ZA 1G01A 2EQDA 1MUCA 3TJXA 4LUTA 3NQGA 3PJXA 5CBIA 3QC3A 3QOMA 1JPDX 3CS2A 3SRDA 2O4QA 5FEPA 1F5ZA 1CIUA 2FJUB 4O19A 2QPSA 2BASA 5KETA 1YDYA 3CYVA 1NEYA 4E2VA 1ZCCA 2I5GA 2XH0A 2OCZA 4AX6A 6REQB 1VPYA 3OIXA 4JFSA 1J4EA 3E0IA 4Q4SA 1TKKA 5BRPA 4WLCA 4GIYA 2NQ5A 3TVAA 1ZNNA 5LNSA 4V2XA 2HNHA 1US2A 5CAKA 3WMLA 1FHDA 1XPYA 3V7PA 4WEVX 1UZDA 4QS5A 1V3MA 1W56A 2OTDA 1EYWA 3T8LA 3B9DA 4HIBA 4LPCA 1BWVA 1V6TA 1EF3A 5HNUA 2YXGA 2XGBA 1GOMA 1E72M 1K8YA 3ABXA 3B0YA 3QHMA 3FIGA 2VUYA 3WUFA 1H4PA 3S4TA 2GLKA 4GXMA 2GVEA 1CXFA 1YLVA 1THFD 4DJFC 3E5BA 1CDGA 4RE4A 2A3CA 4AC1X 3W75A 4MUPA 3GDTA 1UR3M 4TMCA 4NNAA 4IFOA 1BVNP 4RXGA 1SM9A 2FZ8A 3NM1A 5EMMA 4DWDA 1A5AA 4PMZA 2LLEA 4GJIA 1P7TB 2GQ8A 4C91A 3THCA 4YYCA 3S0CA 4QFUA 3GG7A 1XI3A 1PE1A 1OFOA 2XGIA 3TW9A 3RM9A 2EAWA 3V3WA 3WJZA 2FYMA 3OU8A 2JKAA 1F3XA 3QOKA 3LCFA 3E74A 1KGXA 3EWUA 2RDWA 5E09A 3F4NA 2QZRA 4UZUA 1OX6A 4QBXA 3L0KA 3L4UA 4QIUA 4JTAA 3MPGA 2WOQA 2Q6ZA 3RU6A 1CXLA 1T0OA 1ZHAA 1TX2A 3LHWA 3CQIA 3DGBA 3TFCA 2QCCA 3RO8A 3QMTA 2BVWA 5E93A 1J79A 1C7SA 3EDKA 1F2JA 3DENA 5XIAA 1VBHA 2CLFA 4LS0A 1Q45A 2GK1A 1B90A 3SY1A 1WBHA 3S8HA 3R89A 5PTDA 4ALDA 4ORMA 1ONEA 3NL5A 3WFZA 4CEUC 3OVQA 2QV4A 1ITXA 1M7PA 2YCEA 3AICA 3DI1A 2J13A 3M4HA 3ANVA 1A3XA 3QBUA 3GRIA 5BW6A 1RXOB 3L12A 5EKYA 3BMWA 2KAUC 4CQDA 3QPEA 2V5DA 2WPBA 5D33A 1Q66A 4UB9A 1Y7VA 5A6BD 3QZ6A 2BOGX 3RUBL 2IXUA 3WLRA 1EWDA 1IR2A 4DLFA 3DOPA 4W9TA 4J2MA 1RBAA 2EPLX 1IIHA 4HNUA 4NYYA 5BRQA 1KGUA 4A22A 2V5LA 2QYGA 2V81A 3LS9A 3GFZA 2QCFA 3H4GA 5I23A 4M81A 1NWSA 1B0IA 1ISXA 1XYFA 1AH3A 3V36A 3DKLA 3GHSA 3VD9A 1F07A 3VIGA 3C52A 4PTXA 4OUEA 1BVWA 5AYXA 1A4MA 1PKNA 1Q63A 4DYKA 3DESA 1GYLA 2WCSA 3W1AA 2WZIA 9RUBA 2VI0A 3IIOA 1YNQA 2F6UA 1EJXC 5LKYA 4WK9A 2PWUA 1VBRA 2O9RA 3A22A 2GGEA 5I3IA 1IWAA 2QDHA 4BWLC 4UR7A 3VD3A 2WSRA 3CZLA 1DIOA 4RXFA 3VIHA 3PAJA 3WF2A 2DVUA 4L1GA 2A0NA 3BVJA 3T81A 2Z1BA 1VEMA 1I2NA 4IQJA 3BCDA 2DZSA 3AHXA 1Q6QA 3QZEA 3TAOA 4WRHA 4HYVA 1QNVA 4AF0B 2WHMA 4DXKA 3ZO9A 1QOXA 1JFXA 3WL0A 3O6CA 3VOFA 1TTJA 1DIEA 3GS6A 4DJEC 4E3TA 2XWEA 1LBFA 2BBFA 3QR1A 2F8QA 4KCTA 2DQWA 3UP8A 2HBXA 3FV9A 3JVAA 4AMCA 4LNCA 1QK0A 1HL9A 3W4RA 1REQA 5KTLA 4R7OA 1U1JA 2WVVA 1MRAA 3L67A 2GWGA 4WDWA 4HOXA 1Z3NA 1WA3A 4QQ3A 3BCJA 3W6MA 3PHAA 2ANUA 1WAWA 1JQXA 1RHCA 3M0YA 1OFQA 2EPKX 4Y9OA 1GOOA 3WSUA 1EQPA 1X39A 1KFCA 1G5AA 2YZRA 4LY8A 3RM8A 4O28A 1J0HA 1V6WA 2QDDA 3O9NA 3N15A 2ZZ5A 2CZ5A 1SW3A 3BGAA 4JFVA 1FQ0A 2V2HA 3IVSA 3AXKA 3DFSA 7TAAA 3IVUA 3BSHA 4IJRA 4BF7A 1UOZA 3L5AA 5F4XA 2NWRA 1QJWA 4BEQA 1LROA 4RV3A 4EE9A 1XYMA 2W91A 2XH4A 4PUDA 2NSXA 4CLMA 1PB0A 5HR6A 1Y5VA 3URBA 1UD5A 4WVXA 4K7VA 4RNHA 3OGRA 1POKA 1E1EA 1PIFA 1FY6A 4JN6A 4R9OA 1TPDA 4XZ9A 4KKXA 4M7SA 1L6WA 3VE9A 4F2TA 1JVNA 5KZ6A 3TWBA 4DVOA 1V79A 2B7QA 1DIDA 5C55A 3CUFA 1K9EA 3GTFA 3GTNA 4M51A 3W23A 2G41A 1E6RA 5D9PA 2ZRWA 4C6MA 2YZ5A 1DHKA 2EXOA 1E56A 3LV5A 4Q4KA 1BPLB 1M3UA 4NNCA 3TJIA 3WLOA 4OT7A 3P8IA 4OE7A 1E0WA 4KFPA 2V69A 3SCUA 3TTYA 5JBDA 1YPXA 2V67A 2E9BA 4DN1A 5LA2A 5HDRA 1WDRA 3UZYA 4ILSA 1A0CA 2C0HA 1ZY9A 2FGBA 3NDZA 1EFZA 3JW7A 3EEZA 5AVNA 4KH2A 5JMUA 2AOSA 4W84A 1FX6A 4LYRA 2R14A 1D3HA 2VWSA 1SJCA 1JYNA 2DIKA 4Y9PA 4WCJA 1ZBVA 2I7GA 3ITYA 4M5PA 1SR0A 1FWDC 1BVZA 2HMCA 1XDJA 2EGZA 3O1NA 5GJPA 4AD0A 1UKSA 1R7AA 5CPSA 3SSZA 1K7XA 3H7UA 3DERA 3IJIA 4UC5A 4B2DD 3RMJA 1GQKA 5H8MA 2EKCA 1YW1A 3A3HA 3UR7A 4W8AA 1X6NA 4MB4A 2D2GA 1J96A 4BJHA 1VF8A 2G0WA 3URQA 1W1IE 4HKPA 4XSLA 1V5XA 3MKCA 1RBLA 4RDZA 4LU0A 1TWDA 2FZDA 3MP5A 4Z1AA 3SRHA 1S3TC 2WMJA 3CMJA 1EJTC 1SU5A 1M03A 4PB4A 4FLOA 3QH2A 1QBAA 1K7EA 3P93A 1CT5A 4DYJA 1ALDA 2E6FA 4D6DA 4GLEA 3CHFA 3TC7A 3MJYA 2R82A 4C7GA 3M16A 1I2PA 2JALA 4IGSA 1BF6A 4WY0B 3ZSSA 2VR2A 1G7VA 4F0KA 1BKSA 4HHMA 3SCQA 4LY4A 3NDOA 4BI7A 3E6EA 4AIUA 4NJIA 3IK2A 4S3FA 3IEBA 5CSUA 3AYVA 1VBGA 4DBUA 5FSDC 1YPFA 3MSGA 3SJ3A 4DF2A 4DPPA 1B57A 1G6CA 4BEUA 3P81A 1O95A 3KE0A 3GK0A 2DT2A 1IZCA 7PTDA 3HFYA 4Q4MA 1Z48A 2I17A 2XZ7A 2ZRVA 1HJUA 5SWUA 1BYCA 3AIBA 3W1LA 2BVDA 4AQLA 2C13A 1UCWA 1P48A 4LFYA 4J9JA 1W9VA 2E6YA 2BXYA 3ARRA 1F3EA 2QCHA 1JDDA 2Y89A 4CNSA 2FGZA 3IRDA 1XIFA 3BAKA 2AL1A 3EPNA 3IGSA 3HMJG 4X60A 5AHIA 1LT7A 1RLCL 1OIFA 3FGCB 3VINA 3HF3A 4M3PA 3BL3A 4DIAA 4MNLA 2Z4GA 1IT7A 5AKQA 1ITCA 3R25A 2JBMA 2PGWA 1FWJC 4ZFCA 3NA8A 3G1HA 2RUSA 4CU7A 5CQ1A 1NFBA 2WNNA 1L9WA 4KIRA 2QUVA 5FESA 1KBJA 2XSXA 1TV3A 3NO1A 4H7ZA 3B0XA 4BHYA 2NLIA 4GD0A 4UFIA 1K02A 4BI6A 4BI5A 4RNIA 5LIUX 3LM7A 4M19A 3N17A 4G9PA 4CNTA 3ITGA 2QCGA 5FL1A 3EXTA 3FY1A 1PUDA 5A2AA 3ENLA 1RY0A 2A4AA 3NPUA 4XAYA 4DXVA 3FJLA 3HN3A 4JIHA 1JCTA 2PU1A 3EWCA 3CL8A 5LA1A 3DFTA 3TXZA 3CIWA 1S46A 2B81A 1QNPA 1TQJA 1IT8A 4FX8A 2DGAA 4PB3A 3AXXA 2PBGA 3S47A 4M29A 1E4MM 3W7KA 4QP0A 1ME9A 1QNRA 1OZMA 4KGJA 1E5NA 1IXPA 2QCEA 2QHAA 5HWNA 3KLLA 1TPB1 2VDGA 1VFTA 4G56A 3SIZA 3QLDA 1B1YA 3OO2A 1W5NA 3EDDA 2V2CA 3WBWA 4UZSA 1KBLA 5AHNA 3ALFA 2GJLA 2WKJA 3ISIX 2ZXDA 2G8ZA 2P8BA 2PTYA 2ZE3A 3B8IA 3SY8A 1KFBA 3QW3A 3MCMA 5GVJA 3HURA 3TA9A 1EHAA 2YYTA 1KFJA 1WZAA 4PRRA 4JXCA 2OSXA 2ZUVA 3QGAC 1DVJA 2OT1A 1XKYA 2D2HA 1P0KA 2HTMA 1YHTA 1AW5A 4F0SA 2P53A 4IFKA 3KOZA 2Z1XA 4OHQA 2I56A 2OQLA 3VZYA 3WDPP 4LX4A 3PBGA 1F4HA 2PTXA 2PDFA 5ABHA 1TELA 1E6ZA 1T6MA 4H8VA 2VOMA 1BD0A 3F2CA 2Z00A 1ZS2A 2PS2A 4G5DA 4W86A 5KMYA 4HT3A 2CWXA 1EZWA 4PRTA 4HSHA 3A5FA 1FKWA 3LNPA 4CVWA 4O0QA 4AXKA 3BLOA 2HSAA 5F2MA 2X40A 2J7CA 5CZKA 2X05A 3UZ5A 4HA3A 1FFQA 2Z6JA 3IV8A 3WZ0E 3C2YA 2Z1WA 3PZTA 5A1AA 4IGNA 1FHUA 1X96A 6TAAA 3LLFA 2Y88A 4XZIA 1MMFA 3BCFA 3TYAA 1HJXA 1B4EA 4UTWA 1OEPA 2BOFX 1XD0A 4QEHA 1I0BA 4LH8A 1ISYA 4IQEA 1UUOA 1TMHA 2B7PA 4H9YA 5H8PA 4NI3A 4NJJA 1M53A 5GNXA 5HUOA 5C70A 1JG9A 2X0YA 1DQUA 2V9DA 4C6OA 2E28A 3MV11 1J11A 2OO6A 4O50A 4L1XA 3PTMA 4CNOA 2J7EA 3W7NA 2XIQA 4Z1DA 5BMXA 3A4WA 2UY5A 3EX3A 2OEMA 4MKSA 2OSWA 2BHYA 3NG3A 3PUEA 1BLIA 3P7YA 1FA2A 1ZBCA 3R0UA 2B7OA 2W3ZA 1Q7MA 1D3CA 2VZSA 4QDPA 4Y90A 3L5LA 3G6LA 4YN5A 5FSEC 1UKTA 3EOLA 5HR7A 4HN4A 4DI8A 2VD8A 2NXIA 4JTGA 4P7OA 2PP0A 3GG8A 1TCMA 1LUCA 4Y9MA 4LUSB 3W7IA 1XYZA 4WSJA 1WKEA 3H24A 3LM3A 3V5OA 4DWSB 4U10A 3FDGA 4CGTA 5LIKX 5IXEA 2A7NA 2ZX8A 3WMBA 4Y6GA 5DCDA 4ZQNA 5H8UA 4AWEA 9XIAA 3CQKA 3OTRA 4BF5A 2J88A 2CC0A 4M24A 3EOUA 3FHQA 3ZM8A 1BYDA 2WYSA 3CIVA 2J4GA 1JQVA 2WB5A 3R7MA 1E6SM 4Z2JA 1JD7A 2DORA 3K4AA 5J5DA 2GGHA 1S2WA 1BWKA 2AGKA 4NQ1A 3UWWA 3TCSA 1PEZA 5LZLA 2F38A 3A23A 1FCQA 5AYBA 1AQHA 1MO0A 1IEIA 4JTRA 1C7TA 1EEXA 3CO8A 1O5QA 3ZJ7A 3DKJA 1XRTA 5HJLA 1QMLA 2QJIA 3VIKA 3QY8A 4O13A 1UA7A 4H2CA 3W7MA 1QR7A 3S1XA 4PTNA 1JGIA 2OZTA 3W0KA 3W76A 1X1NA 1YDOA 4F0LA 1ZUAX 3BW3A 3CB8A 2PFHA 4Q8VA 5CXPA 1TTIA 3N9SA 3F5JA 2J74A 5J8LA 1LOLA 4KF1A 1GVSA 3KDOA 4WJXA 3CWHA 4W7UA 4ZODA 4M7TA 3T08A 3MVTA 2OWWA 4F0HA 4GQ0A 3DFHA 2PWDA 4QEEA 3VNIA 2E5BA 2VOTA 5IFPA 4AHQA 3EX6A 1KNWA 1QK2A 3CLWA 1KFEA 2A3HA 2V3DA 1HN1A 2X7VA 4N9CA 3NFUA 4US6A 5HOSA 2POZA 3FAXA 2O4MA 4XBJA 3TLQA 1I8JA 1S1PA 5CAHA 4JYEA 3M6YA 1OM0A 1GVOA 4FXRA 5K9XA 3U3HA 1GVRA 2YBTA 1QPRA 4L56A 4NAFA 3V4BA 1NAL1 5BMWA 4JEJA 1LOQA 5FJJA 2ZADA 3CQHA 1AH4A 1HZYA 3IPWA 1A50A 2CLMA 3WLKX 4LUIA 3L2LA 1XLIA 1KWGA 3JZEA 5I3JA 1L8NA 3GKAA 1ENUA 2P0IA 2HS6A 4W7VA 3GM8A 4S3KA 3SUTA 1Z89A 3WEMA 1WBJA 2ZZ3A 3B9NA 3S6TA 3WLLA 4QAIA 1F7BA 1VAHA 5HINA 1Y65A 3V0UA 3FLUA 1Y5WA 3KBWA 2CITA 4YNGA 2PWVA 4KERA 2YXXA 4QSHA 2OWCA 3G22A 4GMEA 3AU2A 3C6CA 2XVNA 4GA8A 3IJQA 3PZGA 3TH6A 3BGGA 1EP1A 1IZJA 2HROA 3NPXA 2D22A 4AVNA 3E5PA 2V5CA 3FHAA 4IFRA 4XIAA 1XQKA 4NYUA 2XDFA 5CLWA 2PD5A 4S3AA 1V3IA 1C8QA 2CFFA 4MMWA 4MZ8A 2NUYA 4E38A 2A3AA 3MP4A 4RKAA 1OYCA 4ES4A 3S9YA 3MJMA 1H60A 5T8GA 3NJ3A 1JI2A 4IPLA 3WNKA 3RO6A 2W9MA 5D38A 1EB3A 2CZDA 4MY1A 4U4MA 3WH5A 1TPC1 1VFSA 2W63A 1A0EA 1E6XM 1FWHC 3K8KA 2EF9A 4QG8A 1NWRA 4AVOA 3W28A 1LRQA 4MOZA 4S3BA 4ZSUA 4EX4A 1HKKA 3EX1A 2QF7A 2E8ZA 4PMNA 3M0MA 2BOEX 3FS2A 3IK4A 2Q71A 3EKLA 5FEZA 2QEZA 4ZE4A 4A6GA 3SB0A 2XSBA 3DECA 5C5YA 3AMCA 3L68A 2WSPA 3KL3A 2DSKA 3FN9A 3PWIA 4FLQA 4GH3A 5CPOA 3B04A 1QPKA 2PLKA 4YCOA 4H9ZA 4DAFA 1J10A 5AY7A 4Q8NA 3EWYA 3WBAA 3DCPA 3NL6A 3UWQA 1JZ6A 3WD3A 3N6QA 3I4EA 2HNEA 4GWEA 4RK8A 3QTGA 3ZR5A 2FDMA 3REQB 3WNPA 4AFYA 2C15A 3HQNA 3HU7A 3TQPA 3CO4A 3LRKA 1PPIA 4WSKA 5LIWX 3WNLA 4UTHA 2P3EA 4UTMA 5E0CA 4K6AA 1W9XA 2WZTA 2YFOA 3LENA 1H41A 2NUXA 4F0MA 1J0IA 3WF0A 1W1ZA 2ZX5A 2VRQA 4EOUA 1N55A 3U5UA 1MEHA 1XLJA 2D73A 4HCDA 4KWSA 3VMPA 3VOIA 3V18A 5G1YA 5G4HC 1OBAA 1VLIA 3CC1A 1GZGA 4B3KA 3OOQA 2TRSA 4HNOA 3SGZA 2PDMA 1H62A 5I79A 1W5MA 4LF1A 1JYWA 3SM0A 1VD6A 3NOEA 1R2TA 1FFRA 1UIOA 3UXIA 4JTFA 3JR2A 4XAZA 2ATMA 2JE8A 2ATSA 3VA8A 1HJWA 3SCVA 5BXSA 4Q8OA 2Z25A 4ADTA 1C9WA 3G1DA 1H51A 1PL9A 1TCDA 1S2AA 4FX6M 3IS4A 1J8VA 1YXDA 4NZ3A 1K9TA 2JGYA 1HNYA 3EMCA 4KMQA 2B4GA 4B15A 2XINA 3M7WA 4V15A 4L9ZA 1B2YA 2QGYA 4AWSA 1V51A 3S1GA 1EKOA 3FSTA 3GG0A 2WZMA 3WMCA 1I45A 1EA0A 4A3QA 3H23A 4N9EA 4R88A 3FJNA 2CWNA 1GTEA 2Z7GA 1UWQA 3EXRA 4E3VA 1W5QA 1DQWA 1WYIA 1S5VA 1S38A 3NL3A 3VGDA 1PIGA 4FR6A 3WD0A 3MMWA 4JTJA 1XFCA 2QUMA 3PZIA 5EMYA 4OBRA 4FNQA 3DYPA 3PZUA 1MQQA 3BO9A 2YW3A 3C3UA 3ES7A 1F73A 2BSLA 3PF3A 4UQ9A 2F6XA 4H1ZA 5D9OA 1XM3A 1ESWA 4IMAA 3GFXA 1FDJA 1MW1A 1UZHA 4CD5A 5C54A 5D09A 3PAOA 5LIXX 4D6GA 3MWAA 1E4NA 3OW1A 3G6MA 3UR8A 3KOYA 5BOEA 4TX8A 4WD0A 4X22A 5IFTA 1PDYA 3D5HA 3TFXA 1ZENA 1VS1A 1MDLA 5C9RA 3LTYA 2IPJA 3N2XA 3U7VA 1LTDA 1YE6A 2MANA 2WVUA 5K9DA 3NL2A 4UFHA 3W7LA 4Q8MA 4LWWA 3FX4A 4HBKA 1XLEA 1QWGA 4LAMA 2VWTA 2V8ZA 5MKGA 3VVGA 3T40A 2OKOA 5REQB 1CLKA 2TAAA 1M41A 1UW9A 2VEFA 4EF9A 5DANA 1FP9A 2FTWA 3NPWA 4UTWC 4QLKA 1QNSA 2E3ZA 2Y24A 4PN2A 1AJ0A 3NSMA 4PCPA 1OC6A 2QAPA 3OLIA 5GJNA 3WH6A 1XW8A 4JTTA 3SSJA 3M0VA 1HKWA 4C6BA 1EQCA 5A69A 4TTGA 3O2LA 3QLLA 4TXEA 4HK6A 1TA3A 2PDHA 3P0XA 4D71A 3DFNA 3QM3A 3ZVHA 2G4JA 1YTKA 4ZOEA 1TE6A 3C0JA 1AQFA 2DFAA 3CTLA 3IGHX 4GIEA 1FUYA 4K1WA 1NELA 1XUZA 1GUVA 4FA3A 3E2SA 3VIJA 2V5JA 2CERA 4M6PA 3S1UA 2GDVA 4OBSA 4FIQA 2J77A 1LYXA 1XC6A 1SZNA 1ZJIA 1PTDA 5AC7A 1QNQA 3UPBA 4MPKA 1YADA 3DYMA 3DG7A 4QCEA 5HK4A 3RCMA 1JZ2A 2P8CA 4P7RA 3IIVA 4ZA0A 3SZ8A 3H22A 4O15A 4L65A 2DEPA 1ISVA 1KW1A 1MFVA 2W79A 4KQNA 1PKYA 4FXFA 4UQAA 2D20A 1ODZA 1UD8A 3USBA 1A5CA 1SMDA 4YU1A 5LHFA 3BV4A 1EDGA 1LF1A 3I3BA 3S3GA 4NZCA 2OZ8A 1R85A 1XLFA 4N4PA 2VXNA 1FOBA 2P5NA 1ZU8A 1CGVA 3CJPA 5BXTA 5BRBA 4RLIA 4HCHA 5E5CA 1OWQA 3KWXA 1KCKA 1BTCA 2HK0A 2FQIA 4AIBA 2IPGA 1VEOA 1YRRA 1JCLA 3GHUA 4B2DA 1XLCA 2A7RA 5TNVA 3TV8A 1R9XA 5CPQA 1DJYA 3WJXA 4LAKA 1UZ4A 3RNDA 4RNJA 1VHCA 3VNZA 2E5CA 4LJ3A 3ABZA 3TW7A 4LNYA 4XZNX 2I5IA 1SMAA 4HQVA 1BXNA 1N8FA 3G3DA 2ZUNA 1BFNA 4Q7IA 2WCAA 2E8YA 5DCBA 1AJ2A 3DGRA 3L65A 4XZMX 3PPCA 4JNYA 3IACA 4XBKA 3QVQA 1HUVA 4PMYA 4GBDA 2PDWA 1X6LA 1BQGA 4XX6A 1NM9A 3KOXA 4O8RA 2C91A 3W25A 4ASTA 4ECLA 2D0GA 2EPNA 2ZICA 3MKKA 1X1OA 4YTQA 4G7FA 4CCEA 2P1FA 4NZ1A 2E25A 2FMOA 2QDEA 4GVHA 1D2KA 3NIYA 1YEYA 1CXKA 3PB2A 2QVHA 4DYEA 1HKIA 2WLZA 4NZ5A 1IZKA 4JGDA 4GIAA 1OFRA 4DJDD 3GDMA 5C9XA 1ZBKA 3QW4B 2PWEA 1R3RA 3GNNA 1X97A 3ZVIA 4KPLA 1FCUA 1WAUA 3RRAA 4LVBA 4AB4A 2VFGA 3HQOA 4KT2A 4C90A 4O17A 1DP0A 1S5TA 2BGSA 2WQPA 4ZR8A 1E40A 4F4RA 2E0PA 3QY6A 2WM0A 2VGIA 3MYPA 3W29A 3HG4A 4L6HA 4G1KA 5I3GA 4GFSA 4HU8A 1QW9A 1FWSA 2IXVA 2QUUA 5F2GA 4DWSD 4QTGA 4J3UA 3TTQA 1XKJA 1QO5A 2CXGA 4MY9A 2E7FA 1S5MA 5JIPA 1Q6CA 1X98A 2UV8G 3N34A 4UTFA 2CBVA 2NW0A 1E9ZB 4F9JA 3NSNA 3VD7A 1HFBA 3I10A 1RCQA 3OVGA 3SN1A 2VCCA 4A8IA 1DJNA 4S3GA 3N19B 2ZZ7A 1JPKA 1ZB5A 1TZ9A 4WDUA 3TDFA 3HGRA 3OODA 1ZAJA 2A6NA 3N3TA 1T8QA 1T40A 4OBTA 3H2EA 5AHEA 4O0ZA 4J3VA 1EDQA 2DSWA 3WY1A 4DNHA 4H9TA 4RE0A 3PJWA 1UMLA 1U33A 2PMQA 3WD2A 3T2OA 2FHBA 4UR8A 2I14A 3U48A 4KCVA 4ZB2A 3LK6A 4IPIA 3WBXA 2HE5A 3O0FA 1A80A 2EEXA 1TUXA 3FFSA 1QATA 2VCAA 3EPMA 5A6LA 5A6KA 5HNNA 4M82A 1KCXA 3GH4A 4OQVA 5HNTA 2CLOA 4DF1A 4Y8EA 2RDUA 1GQJA 1LZOA 5FOOA 1Q2SA 1XIJA 1ITQA 3O7UA 4FHAA 2E68A 5CG0A 3NXLA 2DH3A 3ZZ1A 3VIFA 3COTA 3M64A 4MB5A 5M2FX 2F84A 2WMIA 3UGRA 2EG8A 3TMQA 4FOJA 2DT3A 4OIFA 4OV4A 2YCIX 2YB4A 1AD4A 1IHIA 3OLGA 3AUOA 1DWJM 5BOFA 4L4MA 1P4CA 2HJPA 2JEQA 3E0LA 2ZA2A 4GYFA 3M0ZA 1PIIA 1BSIA 3IJLA 1ZLPA 2OOFA 1KBKA 2OQHA 4NI8A 3V0TA 2V3FA 2KZHA 5LYRA 4K7YA 1W1A1 3KBJA 4AZIA 4UFJA 3RLHA 3QTPA 5A94A 1OCNA 3LXAA 6XIMA 4AZ5A 1S2TA 1J0YA 2R1KA 3T0TA 4K1GA 2QVNA 3E02A 2QMKA 1IYXA 4UNIA 3RR4A 3L5MA 1GOKA 1FWBC 4XAFA 1RPXA 3KOFA 5ABFB 2WHJA 4HOZA 3TZFA 1W1YA 6REQA 3HQPA 3M47A 3JZUA 4PCNA 1RPKA 2DU2A 1XG3A 3QFEA 2GSHA 3PZVA 1KWKA 1QUMA 5I77A 3LD5A 4E5TA 5AB3A 1K8ZA 1DQXA 1TR1A 4LTSA 4RJEA 1ME7A 4J3WA 3L4TA 4EKJA 4AHPA 1J9YA 3LERA 3N2CA 2ZZ6A 4K3ZA 3ZLHA 1OG0A 5BOOA 4CUCA 4JCLA 2YDQA 4O18A 4DQWA 2QCDB 4GYPA 2WJFA 4QG6A 1OADA 4DELA 2OOGA 1L8PA 2YKKA 4MWAE 5C6MA 1E9LA 3O06A 4DUVA 1T41A 3UG8A 2GUBA 2Q3OA 4UUIA 3N25A 1P1MA 1C90A 5FACA 5EBUA 2X1TA 1F74A 3QSRA 3T07A 2YB1A 1R9ZA 1ONXA 4Q8WA 2JF7A 1UD4A 2PDNA 3PC0A 1RK6A 3THAA 1GPFA 1QI0A 4KWWA 3DI0A 1IE7C 1P7TA 3W00A 3UZJA 3GU1A 4A3RA 2DT1A 1NP2A 1TVLA 3ZMRA 3WLPA 3N6JA 4E8DA 5F4SA 3VXGA 4E0CA 1P6BA 3S6DA 2OVLA 2CKRA 1W8GA 3NQBA 4PL1A 1TQXA 4IP4A 3FCPA 4YVVA 3WQ4A 1H0IA 4QNWA 1O6IA 3NAVA 4NZFA 1XXXA 4OGZA 2QIIA 1X7IA 5H91A 3IGUA 4Q8QA 4GJJA 3N04A 2PDLA 4C5ZA 2QNEA 1EO5A 2TODA 3WQDA 3SRKA 1F8MA 4UR9A 3C0QA 1VC4A 5DMYA 3MW7A 3F4VA 1E73M 2VM8A 2OJPA 1VFOA 3L4ZA 4RPPA 3IRSA 3D6NA 4LBSA 5E70A 3WK1A 5G2IA 3OBEA 1W1PA 2VR5A 3S6OA 3T6CA 2PEVA 4LAUA 1UR9A 4YL2A 5A8PA 3GLCA 1JCJA 1BEUA 3IGXA 3AJXA 2Y5JA 2IKIA 1Q85A 1KD0A 3VC5A 1LL4A 4Y9AA 3NWRA 1V02E 1K1DA 5E9AA 4GI8A 3ABRA 3W73A 3KOWA 1K4HA 1J2WA 3BW4A 5C9WA 3MO4A 4MWAD 1W3TA 3MYOA 5TQLA 4ACYA 4JQAA 3OJGA 4GPNA 5GPRA 3UERA 1FDZA 3W27A 4IPNB 4ZXLA 4XD4A 1KRAC 1GEHA 4BKNA 1TV7A 3AIWA 5FF4A 2OX1A 3QFWA 1MXGA 1CLVA 3DXIA 3SECA 1HJSA 2PCEA 4IMDA 1YQ2A 4GO8A 5CJNA 3LSCA 4ERIA 4FMVA 4W87A 1GW9A 1ITUA 2WV8A 2CPUA 2ZXQA 4N0RA 5A6AA 4HZ8A 4TMBA 5DY3A 3J7HA 4FR1A 4O14A 4MNJA 2RFGA 3AXHA 2PDYA 1NJJA 3B9EA 1BYAA 2JQXA 2ZUTA 5CZJA 2Z2BA 4D6JA 3RMEA 1C8VA 4ZOBA 1SZEA 3LNMA 4Q8TA 1CBGA 3MC5A 4EANA 3KP1A 3L4YA 4OOZA 3PSVA 1QFEA 2P50A 2VZUA 7REQB 3SUSA 4BR1A 3WUGA 2NX1A 5C2GA 3UXLA 2ZXBA 2X0HA 1V8EA 2QR6A 3CASA 4AF0A 5IBXA 3TTSA 3CNYA 5M17A 3S2JA 4C6NA 3FA5A 3MMTA 2D0HA 2IQTA 1C91A 3MI6A 3KBNA 4QSFA 2P88A 3IJ6A 3HMCA 1UROA 2PDIA 1UKQA 2Y7FA 3G2GA 3ZJKA 7ENLA 4A3HA 4FK9A 1UWTA 2GSJA 2YBUA 5ENLA 3DHUA 2A21A 1NSJA 3PULA 8A3HA 3QGVA 2IKGA 4NUWA 3OHIA 2VDIA 3UJRA 3GVWA 1AZ1A 2NXGA 3WLIA 4M0XA 4JTLA 1U5VA 3S2CA 4G2DA 4XV0A 1ICQA 4EAYA 3UNDA 4I3GA 3G1RA 1Q13A 4HHLA 4OKDA 3AYRA 2J25A 1FXQA 3ES8A 3M0HA 3KRSA 3KLKA 3M7SA 3VNYA 2QCMA 3P67A 4LBUA 2OB3A 3GW3A 4JIRA 3LXCA 4IUGA 4ZSTA 1HP5A 3UWVA 2OT0A 3B05A 2ZIDA 3LBMA 5DEZA 1QTWA 1IEWA 2XG9A 3VYLA 2BY3A 4JL1A 5HPOA 2J24A 4QRNA 2GDUA 2OLHA 1FHLA 1V7AA 3OGVA 2WKLA 2DSUA 3BSGA 4NASA 4HP5A 3GR4A 3I6EA 3EOOA 1K3UA 1NFGA 4V28A 3TAKA 3RLGA 1L6SA 4ATLA 5RUBA 1FWRA 3W1UA 4CU6A 1ZAIA 3M1ZA 4G7EB 3EOSA 3W1RA 3MCNA 3VOJA 3W7HA 3DHPA 3R8HA 5TBOA 4Q7BA 1I2QA 5AHFA 1NWTA 3PJUA 4DO6A 2ZUMA 5KEZA 2J66A 1WE5A 4W8BA 4N9DA 4GY1A 5CSSA 4UCFA 3QPZA 1VYRA 2CETA 3LDVA 3M0IA 1W9UA 3GTHA 4PTWA 5A8GA 1Q6OA 1J0KA 1JDAA 4JOMA 4JFTA 2NVCA 1BQCA 3UNTA 2XISA 4ADUA 3KWSA 1ZGDA 3C61A 2HPMA 1OSEA 3A12A 3LCHA 2IKHA 4H9XA 1OZQA 4LYKA 4I7VA 1RJRA 3BG9A 2XHYA 3AZTA 3GG1A 3R58A 3HQ1A 1EEPA 3GDBA 2AGTA 3UD6A 1UQYA 1TUFA 4H3DA 3WQEA 1RP8A 3PWAA 3RCNA 1EOKA 1XLGA 2ZE0A 3VGBA 3T1GA 4KGLA 1S5WA 1LL7A 1WX0A 3BOFA 3CQJA 3AMDA 3A47A 2WJEA 2CZFA 4JTUA 1PCWA 2H6RA 4DHGA 1VCFA 1R38A 4NX5A 4NP7A 4DXXA 3PBYA 4C7FA 4Y96A 1HO1A 3LMYA 3G1AA 3ARQA 2YDRA 3TOYA 5G1TA 1QW7A 4GZ7A 3DFOA 1X7FA 5JXQA 3BC9A 4R34A 5E1QA 2OFJA 3PZNA 1XLAA 1KM6A 3UR5A 2Y70A 5I3KA 3KS6A 3QQ1A 1EUNA 3MZ2A 4G6CA 3H2FA 5FJPA 3AAMA 2GQ3A 2FDSA 4JHMA 3KVJA 3TEVA 3ARWA 2Y8KA 3POHA 2J6VA 3MI2A 1AW1A 1YKWA 3QKEA 5F1VA 3VKBA 1WB0A 2A79A 3QRHA 3NQ6A 3TN3A 2C14A 4PYSA 4PEKA 3FYYA 3NOYA 4M56A 1Q2RA 1XLLA 5JBFA 4LCSA 4WY0A 2PBOA 4UTJA 1OYAA 1O5RA 5C9ZA 4HMEA 1JGMA 3LQLA 3QJAA 3CZJA 4XO7A 4AYGA 1TYGA 3NQ7A 2IS7A 2ISFA 4I9AA 1GG1A 2QPXA 3HJEA 1J2BA 1R3WA 4DO7A 3ARSA 3GYEA 1CX9A 4TV6A 2V63A 4DJED 1UP2A 3CHVA 2I1OA 3RRXA 1FH7A 4A8LA 4IIHA 3GR8A 1IGWA 4TOQA 1W1B1 4BFAA 4DNMA 3KRBA 1ICPA 4PBEA 5HQLA 3NTYA 4TIMA 1FH9A 2J8FA 3WDQA 2OELA 1QRQA 4S3DA 4DY1A 3FGCA 3CLMA 2YA0A 5C8BB 1VJSA 2Z28A 1VBUA 2HS8A 1AL8A 4C6IA 2F2HA 4DZ5A 5KZEA 1GW1A 3UCCA 4IL2A 3M0JA 2A3LA 1W9PA 5AZ0A 1XIIA 2ISSA 1V08A 3WDIA 4ROPA 1W91A 1WV2A 2WVSA 4PMRA 4O1AA 4JKMA 4RDVA 4A2RA 1EUAA 4Y2WA 4P2VA 1WKYA 3UJ2A 4CQBA 2PDGA 4QCFA 4DBSA 3FW6A 1MEWA 3S5ZA 3UA3A 3CAQA 4IMEA 4DM1A 2ZRUA 3KP0A 2BGQA 2YLAA 3A6OA 1V03A 1BG9A 3WUBA 4E2BA 1LDCA 3K1DA 3KBSA 3WELA 5CJ5A 4C60A 1GJWA 4AEEA 1YNYA 3W2LA 4NSBA 2PF0A 3BTNA 4QXIA 1W9BM 1H11A 3IJ7A 4GYPC 3GIYA 3TTOA 1PHWA 4PH6A 5MHBA 1QT1A 3AYSA 2OYMA 1BSLA 4K8EA 1BHGA 1XRSA 4JPGA 1DBTA 1XR2A 3EMZA 3NYZA 3ELFA 3GNOA 3W82A 3EYPA 3VIMA 3MA8A 3ZFHA 4C6JA 3FA4A 2PLMA 3LSBA 4AD3A 1XQLA 1ZJAA 3KRUA 3WF3A 4MKNA 3EWDA 2QJNA 1PSCA 4HHHA 4CQAA 2VVSA 4O10A 5AYZA 3LZ3A 3SUUA 4MLJA 4L4PA 2WMKA 1G69A 4H9UA 2NT1A 5LSMA 1O68A 4YHEA 3N1AA 2ZQ0A 2QJJA 1QASA 3BZGA 4TX6A 1E43A 2WK2A 3WUEA 1VFFA 1FWIC 4J35A 2G50A 3E0FA 3VD5A 3W2JA 2G3FA 2QQ6A 3PY2A 3CGTA 4QE4A 1IXOA 3MWCA 3GXDA 1RA5A 3EA3A 1K6WA 4MNMA 1VFLA 5FJUA 4Z1YA 3DIPA 3C8FA 2VURA 2WC4A 5A2CA 2FGLA 4QM1A 2R1NA 1P43A 2INFA 4MDOA 5DQPA 4S2CA 3PPFA 3GC5A 2XIIA 4EPBC 4XZBA 1H1YA 4KCUA 3STEA 4B4HA 5FAGA 5FEWA 3P84A 3PN8A 1JD9A 3TYDA 2O0TA 1DYSA 1SFTA 4ZEPA 4NJKA 2RGMA 1WCGA 5DBUA 3BUVA 4GIRA 4R33A 3LB0A 1GNXA 3W71A 4RE2A 1G7UA 3UZZA 2PWGA 3RX3A 1PBGA 2FKPA 4M6VA 4I90A 2ICSA 1UG6A 2F7FA 4IWWA 3PNZA 4KEMA 4H19A 4AG0A 4QQUA 2XUCA 5E6ZA 3RFAA 4B91A 4GUJA 4IH3A 5LXXA 4AWUA 1H09A 3O6DA 2YCLB 2C8NA 3W2MA 5A6SA 5GJMA 1TWWA 1XUUA 4O11A 2PLCA 3WX7A 1XL9A 1CZ1A 2EJ1A 5G2HA 3I3DA 3BW2A 2CBJA 3MB9A 3UG5A 3NPVA 3V0SA 3TC3A 2CEQA 3MI3A 7TIMA 3G77A 5K4ZA 1I2RA 3CAKA 3T2QA 1KCZA 3B8DA 3Q45A 4FPSA 1A5LC 3W7RA 2RDTA 4AMAA 3BMXA 4JYFA 1A49A 3NGJA 4DJDA 4C1NB 1Q6EA 2YJQA 1X8FA 5BWFA 3SFWA 5EFFA 4FNPA 1MWOA 2ISWA 1TIWA 1WP6A 2YSWA 3GTXA 5H2ZA 1E0XA 1KFLA 4AZ6A 3VKKA 1Q4WA 3DN5A 2WWDA 3SADA 4H7VA 3KRZA 2DUAA 3OZPA 2ZVIA 4BQ4A 4JIQA 4HZ7A 3WNOA 2O9OA 3BLEA 4L7ZA 3C2EA 2HWGA 2HCVA 4LVGA 4H9VA 4IQLA 3P3BA 3BH4A 2C18A 4LVFA 1FWWA 3LMZA 4LUSA 3PZMA 4GI6A 1DL3A 1WZKA 3F5LA 4D6CA 1OQFA 3WNMA 4DWSA 1EC7A 1XINA 4IIEA 4WKHA 1LWJA 1CECA 4Q6JA 2FVLA 2H3BA 3KVLA 3WQOA 5ECVA 1TB3A 2CW6A 5IBXC 3A9BA 5TD4A 2PUZA 5TF0A 6PTDA 1V0KA 4Z2LA 5AN7A 3LCGA 2FJKA 4R7WA 2W92A 1AQ0A 4NIRA 1U1HA 1JCNA 1WNOA 1NOWA 1W5OA 3FAWA 4LF2A 3KZPA 2J8TA 3VNDA 4BQ2A 4BS0A 1Y0EA 3MHGA 2VO5A 2Z1SA 1V6VA 4FALA 2MUCA 3E49A 1I60A 3BJFA 3MVIA 1VLWA 2PP3A 1E1CB 4JHOA 3TONA 4UTLA 3R5EA 3KZSA 3II1A 3IVTA 1DJIA 4HTYA 4Q8UA 1P0BA 1FWNA 3NQDA 1ONWA 3KAOA 5EMLA 3P61A 3DBPA 1MSSA 4O1FA 2OEJA 1RV8A 4UFKA 3MHFA 1J5SA 4AZHA 3F2BA 3L4XA 1V3JA 4H01A 1YPIA 5C2XA 3K8MA 1HW6A 3G0SA 2VEGA 1W1TA 3MZNA 3N9RA 4HA0A 3PBWA 2EHHA 1BG4A 4HZMA 1NF0A 5CGTA 3SCTA 3QV8A 2ISVA 5LXEA 3HA1A 1OB0A 1OIMA 3PBUA 1UH4A 1HVQA 1GTHA 1TV8A 4M1RA 4Y9NA 2QT3A 5H6HA 2Z7KA 2I9UA 3P8JA 2ZKMX 2HZGA 1D3GA 3H4WA 3UWEA 4L61A 4C7DA 4ICCX 5LNWA 1F8IA 4C6QA 1G4SA 1RQBA 4L9YA 1OK6A 1QI2A 4QJ1A 3ARXA 4CCCA 4JYDA 5CPMA 3HOJA 2WMHA 1RAKA 3LRLA 1PZ2A 1GORA 1JPMA 4HZ6A 2NUWA 3IANA 1B9BA 3NZ1A 4AHOA 2FZMA 2ZUSA 5A5WA 9XIMA 2VKZG 2ODOA 4IP7A 4AZ7A 2HE8A 1H7WA 1QPQA 2Q3RA 4C6CA 5GNZA 5LGXA 1ZBWA 1MNSA 5DMMA 3N9KA 2A1YA 2XH7A 3VIOA 1UWIA 4IIFA 5DN1A 4JR5A 1D9EA 4HB7A 4JFUA 1OGSA 4XVDA 1J6OA 5HA7A 3G8RA 3NCOA 2ZZ2A 1SW7A 4TR9A 3R10A 3WMSA 3P5YA 4L4LA 1UH2A 1XRFA 3APGA 3HPFA 2YLLA 3NXFA 1JXKA 3TSMA 3R0DA 4ZMGA 1RJPA 3OIHA 4JTEA 4FI4A 3VNLA 1CPUA 3LGEA 4UNKA 1DKWA 2VUNA 1V93A 4KEZA 4PCSA 5F2LA 4C5YA 3VDGA 3QMRA 4L5ZA 3HG3A 2ZZ1A 4GISA 6A3HA 2OU4A 3IIPA 2V3GA 2GUUA 1BF2A 2ACSA 3LEPA 3UESA 1GOWA 3OG2A 2DZUA 5XIMA 2CKSA 3GTIA 4GGHA 3SQSA 3I6RA 4PSRA 3QY7A 2D24A 3VU2A 1A3WA 4IUOA 3NO5A 4A3UA 5AFDA 5EMJA 4DO4A 4UIOA 3BG3A 2WNWA 3B8VA 5CC7A 2XVKA 5AYIA 3ZLGA 3SCOA 4PMUA 3LCXA 3W2UA 1VJIA 1Q8JA 3RIKA 1JDEA 3DC8A 1U2YA 2XSAA 2D23A 4S3CA 1K03A 2VZOA 3CUXA 2PD9A 3D3FA 4WXZA 3UY8A 5AC4A 3HZ3A 4XKYA 4MIMA 3TYCA 1GQLA 2CU0A 3GNDA 4HSOA 2HPIA 1CB2A 2BB0A 1YXCA 4O57A 9CGTA 2YOCA 4ZB5A 2DJXA 1PX8A 2P3ZA 4S39A 3E2QA 2CLLA 3RITA 4FF5A 4OOUA 3WFLA 4KEUA 3FKKA 2WJZA 3R2GA 2FZNA 1JZ7A 1R9YA 3SN0A 1MW2A 1VKFA 3ARZA 3Q94A 5A8NA 1B4KA 3U2ZA 4Q33A 4GACA 3L0NA 4PUUA 2WVTA 4L64A 3PP7A 1BRLA 3U8GA 3M07A 2C16A 3REQA 2G3MA 1H50A 3GNRA 2VC9A 1KLZA 2X7WA 2X16A 6ENLA 4Q6XA 1I9CB 4QG9A 3ZXWA 2Z1KA 1GG0A 1G4TA 2CESA 2Z2AA 2J47A 4GI4A 3NZGA 2BV9A 5TIMA 4JQ3A 1XGZA 2JKPA 3HTWA 1W3LA 3RHGA 4XG1A 4C65A 3WG6A 4PMVA 3NM3A 1T96A 4INFA 4XB3A 1O7AA 4AX7A 1TZ7A 3GDRA 4GNVA 4DLMA 4MLRA 3V1HA 1UYQA 3DDMA 1RA0A 4P5UA 1WUEA 3LLDA 1VFHA 1SJAA 1T5AA 4D8LA 1E3ZA 3DAQA 2GVLA 2RJHA 1MW3A 3GZAA 1PHQA 1GQIA 1EBHA 2WNQA 1EJUC 2BODX 1A5UA 4IGHA 4H04A 1JNEA 4IHCA 1K8CA 1VP5A 2WC3A 2OPJA 4PGLA 4PTVA 5B80A 3VX0A 1OABA 3R43A 2VRJA 3RU8X 1JDFA 1Z9AA 1JPIA 3CWOX 5JIWA 3PUGA 1OY0A 1PWLA 4Z17A 4NAEB 2XGZA 2J78A 4GY7A 4PRWA 3QPYA 2DPEA 4AW7A 5EMKA 5D03A 3E0WA 4JQ2A 2CNCA 3V5FA 1JAKA 4YVXA 3I6TA 2JKEA 2OKTA 4C6PA 4ZOCA 2TYSA 1XLBA 2PTWA 4H83A 3P14A 3ZYZA 1FWTA 1SZGA 1IXQA 4XBSA 4AISA 3H70A 2YIHA 1NQKA 3T9PA 4U33A 2DIJA 1TMLA 1TPH1 2BXVA 4EXBA 4AD1A 1FP8A 2V5KA 2OXNA 2PRMA 1Z44A 3LV6A 3A64A 4JL2A 3VO0A 3AS3A 3K4WA 3S5SA 4CQ9A 1HQTA 5ECUA 2ISDA 3GU2A 1KBBA 4A8RA 2BY1A 4GO9A 2PDXA 3O8AA 5A3HA 4MYXA 4B5XA 5FF0A 3LN3A 3LHZA 1E6PA 1LLWA 3FJ6A 1PCKA 5FJTA 1Y8BA 2ABBA 2PC4A 3FXYA 1V02A 2R1MA 4KESA 4IG2B 3SCWA 3VZXA 2BTMA 4H9MA 4H7CA 4ACZB 4BCEA 5CGQA