3NYDA

Crystal structure of kemp eliminase hg-2 complexed with transition state analog 5-nitro benzotriazole
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
303
structure length
303
Chain Sequence
AAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQADFGMVWPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGISVFGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
source organism Thermoascus aurantiacus
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
total genus 121
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nydA00
1XC6A 5A6KA 1OGBA 1P6WA 1BAGA 1ISYA 4F8XA 3OIHA 3AMCA 1J0ZA 2Y24A 4AIUA 1J0HA 2J8FA 5LA0A 5A6BD 1ZU8A 2NT1A 4FK9A 1K6AA 2RGMA 1J11A 3W25A 2PBOA 4QLKA 5JBDA 1XSIA 2XJ7A 1CGYA 2E9MA 5FL0A 1UKPA 3N13A 1GJUA 1VFUA 1MFUA 5HXMA 4Z2LA 1FFRA 4HOZA 3RDKA 4HZ6A 3OG2A 2IUZA 1BHGA 1G5AA 1QI0A 1I75A 3AHZA 4J28A 1GQIA 1PIGA 1W1TA 1OT1A 1VIWA 1C8QA 3TONA 2ZX8A 3VGGA 1OT2A 4QCFA 3VMPA 2PWEA 4EE9A 2WVTA 1TR1A 1WZMA 1B1YA 4J27A 1JI1A 3WH7A 3VD5A 2FHBA 4M56A 1IV8A 2ZE0A 2GJRA 4P8XA 4GIAA 3U5YA 1US3A 1GOMA 3THDA 1OCQA 3UR8A 2VRJA 3AIBA 4W5ZA 1ZB5A 4W85A 2CBIA 1SR0A 2BXZA 1UQZA 3WNMA 1WDPA 5ABHA 4OBRA 3AS2A 3WQVA 3RCNA 2ZXAA 1E0WA 3ZIZA 3MANA 1BSIA 4M24A 4WF7A 2ESCA 5A2AA 1UG6A 2V3DA 3VGBA 1W9UA 4LGXA 3A6OA 2WANA 2CXGA 4YHGA 3RMEA 5LA1A 5JIWA 3FN9A 2XSBA 2PF0A 4P7QA 1HJSA 2AOSA 1HL8A 2VZOA 4HP5A 4BS0A 3BSGA 4X0NA 3RPMA 1FA2A 1JZ3A 2WHMA 5IXEA 1WZAA 3F5LA 1MW1A 3KL5A 4AD5A 1CGTA 5GNZA 2JIWA 1OGGA 3W38A 5JIPA 3VOCA 3ZSSA 2WWCA 2WCSA 1E56A 1CDGA 1JZ2A 4JKKA 4ATLA 3A47A 2W67A 2G41A 4D6IA 2D24A 3VGDA 2ZUSA 2D3LA 3ZT6A 4B3LA 3WDIA 3AXIA 5D9OA 4D1JA 1QHOA 1JZ8A 2DPEA 2VNCA 2XTKA 1MQRA 5AC4A 3BSHA 3EMZA 2E9LA 4HA4A 2BXYA 3VNYA 4AYSA 4KH2A 1HF6A 2ZWZA 5BXTA 3VIIA 7A3HA 1D7FA 3LPFA 3SCUA 3TA9A 4DWSA 2CYGA 4JHZA 1QPKA 4B3KA 1OGSA 2Y8KA 1J01A 2WMJA 1M01A 2Z1KA 4CCDA 1V3LA 3AMKA 1JYNA 1O7AA 2YL5A 3W4RA 3L2LA 4UFLA 2F61A 1HL9A 2WC4A 4QFUA 2DSUA 3QOKA 2JALA 3GM8A 1OD8A 3WBAA 1CWYA 1BGGA 3BLPX 2GJXB 2GDUA 1IZKA 3MO4A 2CERA 1GZJA 4KRTA 1J0YA 2EPOA 1Q6GA 3VIJA 1VFFA 2WCAA 3UG4A 2AMGA 3KZSA 1CZ1A 3L2MA 2XIIA 3AISA 1VEPA 2GK1B 1DWHM 4LQ1A 5HNNA 3OGRA 2ZUNA 2WK2A 1KCKA 3II1A 1B31A 2X8RA 1PZ2A 4XX6A 1ZJAA 1OIFA 1WB0A 1UD3A 3VIKA 1V0KA 5A6MA 4W8LA 4AZIA 2YDQA 4FF5A 1FP9A 2XVLA 4UFIA 1H3GA 2W5FA 1XSKA 3RM4A 2J47A 3PZ9A 2NT0A 4A4AA 4ACYA 5BXSA 2XPKA 3AROA 4UZSA 5EFDA 5C8BB 1W32A 3VU2A 2B31A 4W84A 4UOJA 3IAPA 1B0IA 1K9TA 1UHVA 2W66A 2O9PA 3I3DA 2YA0A 3WMBA 1X6NA 3PZOA 2W4XA 3WH9A 2WSKA 2V5CA 1H11A 1UD5A 1LL7A 3BAIA 3A4XA 1D2KA 3PTQA 4PUDA 4J3UA 1UH3A 4UFKA 4U2ZA 2X0HA 1XYFA 1VF8A 4JFUA 3ARQA 1W1YA 4S3KA 2CHNA 1DWFM 3MUZ1 4WIWA 4CCCA 1HKMA 3WD2A 3IJ8A 4QAWA 3F5JA 4J3SA 3N11A 3WEZA 4JL1A 3T09A 2D1ZA 2F8QA 2VX5A 2IXUA 3VD9A 1QW9A 4B9ZA 4MB5A 3GNRA 3T0DA 1TMQA 2C8NA 5GQBA 3PN8A 1ZS2A 3VGFA 3IJ9A 4AD2A 3N17A 3WUFA 5DEZA 1HKKA 4HOWA 2X09A 2UY3A 3CMJA 2VRKA 3WNOA 1UWQA 1JFHA 3EDJA 5A95A 4GXPA 2ZUTA 1HN1A 4MB1A 2BHUA 3VMNA 1C90A 2JIEA 2ZICA 4HU8A 1EQCA 1RP8A 2ZXBA 3SUTA 1ZBWA 2XGBA 3W0KA 2XSAA 3OZOA 3UG5A 1LWJA 2CEQA 4UQAA 3W81A 3TP4A 3W37A 4JFTA 2WNWA 2XUCA 3WNNA 4W5UA 3GNPA 3VDAA 4DM2A 1ZL1A 2VURA 1WNOA 3G6LA 4P8WA 3CZKA 1UQYA 1B30A 4RE4A 4LPCA 1W3HA 3VKKA 1XGZA 3WUBA 3ZM8A 3K8LA 2WLZA 4TVCA 3ZR5A 2J7HA 4PMYA 4AW7A 1J18A 1U30A 1KQYA 3CUHA 4P8UA 4Z2HA 1QNQA 1VRXA 4MJ2A 1B3ZA 4N0RA 1TZ7A 4L4OA 3WQ6A 3WD4A 3W29A 2A3BA 2E8YA 3TTSA 4LXFA 1E40A 1C8YA 1FFQA 1PIFA 2BY0A 3ZJ8A 1V6XA 2BVDA 4NI3A 3L4UA 4OBSA 3MV11 1CYGA 4MNKA 1MQQA 1CNVA 3G6MA 3AXHA 2JF7A 4D6DA 3PZNA 1JDCA 2G3MA 3CHFA 1DTUA 2EBNA 2X1IA 3BC9A 6TAAA 1YHTA 3MV01 5JBEA 5DMYA 1E1FA 1EDQA 3MU7A 4MADA 3VIHA 4AEEA 1HJWA 4MB4A 4ATDA 1W9PA 5EBAA 3NYDA 3VIOA 3PZVA 1IT0A 3FNDA 4D1IA 5BXRA 5CG0A 3FHQA 1M03A 1PJ9A 1R7OA 5BXPA 5A3HA 1OSEA 1TUXA 4DUXA 5CPQA 2XFYA 2D20A 3UESA 3HU7A 3ZOAA 2O9RA 2O9OA 3AYSA 2JFEX 2DT0A 3RILA 1HX0A 4MNJA 2RGLA 3WF4A 3SCWA 4H41A 1XH2A 1VBRA 2GFTA 2J75A 3RJXA 3VUPA 3VGEA 2VR4A 3WNKA 3WY1A 1EXPA 1PPIA 1HVXA 1VEMA 2EEXA 1GOWA 2A3EA 4WLCA 3CZGA 4MDOA 3FAXA 3ARVA 5GNYA 2FDMA 1GPFA 2UY5A 4J3VA 1W1VA 4D6FA 3RIKA 2QMJA 4GI8A 1JAKA 4M8UA 4W7UA 1OM0A 2VX7A 3BLKA 4J3WA 1MQPA 3PZQA 2YOCA 4HZ7A 3WENA 5IHRA 4MPKA 4UR9A 3D3AA 4HA1A 1UR8A 1UD2A 2YDRA 1LF1A 5E09A 3W27A 3T2PA 8A3HA 2CBUA 3O2LA 3VIMA 2GUYA 3RJYA 3I3BA 5M03A 4BQ4A 1JZ5A 3SURA 2GK1A 5HPOA 2DH2A 3WEMA 4E8CA 2ZX5A 3QHNA 5M17A 1M04A 4TVDA 2J74A 5DT7A 4U5IA 3AZSA 4AZ7A 5A8NA 3A4WA 2G3IA 2WM0A 4U2YA 1G01A 5E9AA 2DT2A 4YN5A 4XB3A 2ZX7A 3L4TA 2BVYA 2QV4A 2C0HA 3OGSA 3B9EA 4CVWA 1VJZA 1UA7A 2VCCA 1BFNA 3QHOA 1EDGA 3HN3A 1B90A 4JCMA 2CBJA 4TX6A 4KMQA 3BAJA 3WSUA 3WF2A 1ITXA 4PMRA 1HKIA 3CUIA 5I2UA 4S3JA 1E5NA 4JL2A 3J7HA 4PTXA 2QHAA 3GXDA 2AAAA 3GYCA 4FMVA 2EJ1A 2OYMA 3GTNA 3WQ4A 4OKDA 1KB3A 2OYLA 4PEEA 1NWRA 3AMLA 3OA5A 3W6MA 2DSWA 1SMAA 3WEOA 3WH8A 1NOUA 1HJXA 4D6JA 1ODUA 1V03A 2FGZA 3CZEA 3AHTA 1K9EA 6A3HA 2W62A 1ZBKA 2VZVA 3MUY1 4IPNB 4P7LA 5E6YA 3L4WA 4LYQA 1MFVA 1JZ7A 1KWGA 4V28A 4M1RA 3CZ8A 3SCVA 4AZBA 3UETA 3QHMA 2E0PA 1QNOA 2WZEA 1UWTA 4HOXA 1CXEA 2WB5A 1CTNA 2BY1A 3WUGA 3NIYA 1JYWA 2CESA 3BMVA 3ZO9A 2A3HA 5M5DA 1IZJA 2WWDA 1C8XA 4AZGA 1E6ZA 3ARUA 3VDCA 3ARSA 1W91A 3U7BA 4Q7NA 1R85A 2J7CA 2D0GA 5A69A 1KCLA 4D6CA 1V3MA 3B9AA 3WDHA 4U5KA 1JF6A 4Z2IA 4IPLA 1RD6A 4Z2JA 2WMFA 1NOWA 3KL3A 3SEPA 3WQ8A 1XRVA 1MXGA 3F5KA 4NRRA 1ECEA 3SCRA 2OSXA 3ARWA 3SIMA 3GZAA 1ISWA 4AZ6A 2MANA 4OOUA 1NWUA 2XVNA 4ATWA 3CGTA 4ZXLA 3EBVA 1QBAA 3VD3A 3AZTA 3MMUA 3BAKA 3WELA 3UEQA 2E8ZA 1QHZA 4NZCA 4GZEA 1BGAA 1QVBA 2J79A 3E1F1 1NP2A 2D22A 5GPRA 4J3XA 2DIJA 4ZEPA 3WUEA 4D72A 4QLJA 4UQ9A 4CUCA 3CIVA 5I77A 1JDDA 1NOFA 1W2VA 4P7RA 1QOXA 2V5DA 3SCPA 1V3KA 4URIA 2V3EA 3AFBA 3AI0A 4YHEA 4CD4A 5I5RA 3CUFA 1CLVA 5CZKA 2PBGA 4PMDA 1JL8A 2BFGA 1TA3B 2PB1A 3APGA 1LQ0A 4MTVA 1UOKA 2YIHA 3BCFA 1V6UA 2EQDA 2G4FA 2XIBA 4CD7A 1B3YA 3AYRA 4R27A 2ZXDA 4K68A 3MKKA 1BF2A 4PCSA 4U3AA 1GOOA 2Y4SA 4HA3A 4X0VA 1Q6DA 1F4AA 4CD6A 2HVMA 1PZ3A 5DFAA 5DF0A 3DYOA 5CPSA 2WAGA 3NCOA 5A8PA 5FOOA 1JNDA 4BZYA 5ABFA 3ZT5A 5JBFA 2CITA 4Y7EA 3TTYA 1JXKA 3UCQA 1UWUA 3EDEA 5IHSA 3PZIA 5I23A 1AVAA 2D3NA 5CGTA 3UG3A 1E3XA 2NSXA 2ZUWA 3EMQA 5JUVA 1BVNP 2J7BA 1XD1A 3CPUA 3AS1A 2A3AA 4CU8A 3PZTA 5CPTA 2WKLA 4M81A 5CJ5A 1AQ0A 4H04A 1H41A 3PZGA 3AQUA 2G8ZA 3VO0A 3WL0A 3L4VA 3A3HA 2ZX9A 4RL3A 5LA2A 3SCQA 3ALGA 4AC1X 1DWGM 4F79A 3MSGA 3WKZA 4P8VA 1PX4A 1X6LA 4TUFA 3OB8A 4AIEA 2EPNA 1U2YA 4W7WA 5CSUA 3GNOA 3CHEA 2VR5A 3K8MA 1W3KA 2VL4A 1W3JA 3O9NA 2WLYA 1KXVA 4ZXOA 4U31A 8CGTA 1W9BM 4OZOA 2BVTA 5D4YA 4BCEA 1QNPA 1W2PA 4UOQA 1Q6FA 4QP0A 2BHYA 2XVPA 1ODZA 2DQXA 2YJQA 2PWHA 2Z1SA 5HDRA 1M53A 1HP4A 1PX3A 5BYWA 3VIGA 1C7SA 1UR1A 1CENA 3W82A 1B2YA 1Q6EA 3WMSA 1UZ1A 2BS9A 3U57A 5EFFA 1CXLA 4DM1A 1QHPA 2DGAA 2FH8A 3EDDA 1GOQA 4J3TA 4PBGA 3NSXA 3L4XA 4P7OA 2OWXA 1E6PA 2V3FA 1AMYA 1ISXA 1H0GA 3VNZA 3QR3A 1WKYA 1XD0A 1QNSA 4MAZA 4AZHA 4EKJA 2O92A 3AIQA 4JZ5A 2VQUA 5BCAA 1E4LA 4GPNA 4H8UA 1J0IA 1E3ZA 5A8OA 2XVKA 3TTOA 4W8AA 1E4IA 5C71A 1V02A 2DEPA 2JEQA 2WMKA 1MW2A 4GZIA 3MMWA 1UR0A 1YQ2A 1WE5A 1CBGA 4OOZA 1QW8A 1GNXA 1JAEA 3UERA 1EO7A 2E40A 3AIRA 1QNRA 4GI9A 4CD5A 3AS3A 2VX4A 3KEHA 2IXVA 2QLYA 1VFOA 1MW0A 4MAVA 1H5VA 3MSDA 3ZMRA 1R8LA 1GQJA 1Z32X 4W89A 2YL9A 2YA2A 4TOQA 1OB0A 1LJYA 3I3EA 3AMGA 1CGVA 1E6QM 2XHYA 1WZKA 4KGLA 4AIOA 2E4TA 3VILA 2QPSA 5HPCA 2PWGA 1E6SM 1Y7VA 4H8HA 1EHAA 4UOZA 4D6EA 2VZTA 2Y5EA 3ARYA 1FOBA 1JZ4A 1FHDA 5CQ1A 2NW0A 4TTGA 1TVPA 2VTFA 1KXTA 1NH6A 4FLRA 3ZJ6A 2GDVA 2WHJA 2WYSA 4OUEA 2VVNA 1B3WA 1UWRA 1PEZA 3AHYA 1EDTA 5A94A 3DC0A 4JHOA 1WP6A 1R87A 5LYRA 2J25A 1C92A 4UFJA 3NDZA 1DWAM 1WDQA 1I1XA 1GQLA 2WMIB 4UQBA 2J8GA 3L4YA 4D71A 2HISA 3WN6A 4AY1A 4WKFA 2XFRA 1UKSA 4B15A 4DUWA 4Z2KA 4W8BA 3T2OA 5D9NA 1R86A 1H09A 5KZ6A 5A2BA 2WMGA 2EO7A 4GO8A 1X1NA 1RH9A 1UH2A 3SUSA 3WDQA 2XWEA 1B3VA 5GNXA 4P7NA 2CPUA 2EPMX 1V3IA 1VBUA 5M3WA 3L4ZA 3WL1A 1CIUA 4PMVA 1BYCA 4XV0A 1W9DM 2V38A 1UZ4A 2ZUVA 2WSPA 3VD7A 4PUEA 3NJ3A 4H2CA 1LL6A 1BYBA 4UCFA 2XWDA 4UFMA 4IISA 1E43A 4UZUA 1UWIA 4ML4A 1XV8A 4UTFA 1WAWA 4W7VA 1JIBA 2VCBA 2WKGA 2UWFA 4CKQA 4PMXA 4AD3A 3N18A 1H0IA 1OBAA 2BNJA 4J7RA 4DWSB 3THCA 5TD4A 3K4DA 5ECUA 3WFZA 3VDBA 2WHLA 4AD1A 1PX8A 3ARTA 4MJ4A 1GVIA 3AIWA 3DYPA 4HMEA 2W63A 3W28A 2VJXA 1UKTA 3OLDA 1E55A 1I1WA 1ZBVA 2D0FA 4R5EA 1A47A 3POCA 2ZXQA 3FW6A 4W86A 2J7EA 1OIMA 1VEOA 2WXDM 3NUKA 2WCGA 5FKYA 1C7TA 4PTWA 2JE8A 1V0NA 3M07A 1JD9A 4C7GA 3AS0A 1JI2A 1V3HA 1PBGA 3T2QA 2GSJA 1NARA 3N12A 4D6HA 2WZHA 1V6YA 3ZJ7A 2XFFA 1UD6A 3WF0A 1F4HA 1HT6A 2CETA 3F4VA 3AICA 1CGXA 3WNLA 4E2OA 2VT0A 3VX1A 1W9VA 2WBKA 1E15A 4QLLA 1KXQA 1KGWA 2OWCA 3BAYA 1JZ6A 3PTMA 4CCEA 4IM4A 4CVUA 1EHNA 2BY3A 1BVZA 3AIEA 1KFWA 2CBVA 1JDAA 3W6LA 1VFMA 3EDFA 3FY1A 3NSMA 3AHVA 1E6XM 3MMDA 4UQDA 1CEOA 4HMCA 2XGIA 3GXIA 1PAMA 3QOMA 3WBEA 2A3CA 3AHXA 1UYQA 1DP0A 2E9BA 5FL1A 2J4GA 4UNIA 1MW3A 2GJPA 3GDBA 4HMDA 1U33A 3AIUA 1ZBCA 3BAWA 1HJQA 1FH7A 4ZENA 3BMWA 3WFLA 1VJSA 1BG9A 3HJEA 4NRSA 2OSYA 4LYPA 2J78A 1HXJA 3WQ5A 2D23A 1US2A 3CTTA 5FD0A 2WVSA 1GJWA 1C91A 4ACZA 4JCLA 4DWSD 5HBFA 3LPPA 4GZJA 5DO8A 1HJVA 2BY2A 4AD4A 3WDJA 1EOMA 2FGLA 1K9DA 1FH8A 4C7FA 1CPUA 5ABFB 4PYSA 3T0BA 1W9XA 2W91A 1V08A 1EA9C 2VQTA 4FLOA 1ISVA 2WC3A 2DIEA 3ALFA 2VOTA 1C93A 4AD0A 4ZE5A 3IJ7A 3BXWA 4L4PA 3N15A 4HU0A 2ZUMA 1MVYA 2PI6A 3ZR6A 4WKHA 5I6SA 1E72M 4UQEA 1CLXA 3SUVA 2QF8A 1NP0A 2UY4A 2WVVB 1BTCA 1EQPA 2J77A 1GORA 4GO9A 4V2XA 3GBEA 3KL0A 4A3HA 5E70A 3RM8A 1TA3A 4BA0A 3OLIA 2WVVA 1BYAA 4CD8A 4MB3A 4NF7A 1EIBA 2VI0A 3CMGA 3WNPA 1GW1A 1Q6CA 3WIJA 1VB9A 4PSRA 1GOIA 1DWJM 4W93A 5A1AA 3T0AA 1J10A 3EYPA 2BV9A 1MYRA 1W1PA 2JEPA 1WDRA 1NWTA 2VVSA 4PMUA 4B9YA 2YDSA 3BAXA 1KGUA 1UR4A 2VRQA 1BG4A 5CLTA 4EANA 3SCSA 3FAWA 2ZX6A 4BQ3A 1TE1A 4M29A 2JF6A 5A6LA 1XSJA 2VZSA 3VTRA 2CIPA 3AOFA 1E73M 4CN6A 5AYIA 1E4NA 2VCAA 3POHA 4HTYA 4E4PA 1AQHA 3JUGA 2VMFA 2DSVA 5C70A 4F66A 3S2CA 1XH0A 4F9JA 1GONA 4PRWA 4N42A 4GINA 3W26A 1UKOA 5FCZA 1EGZA 3WDRA 1UA3A 4FLQA 4JFVA 2WC7A 2W61A 3CUGA 1G94A 3VM5A 1KQZA 4E8DA 7CGTA 3O6AA 1KR1A 5I0DA 3ZT7A 4H7VA 3ECQA 1DHKA 4Z2GA 3VIFA 3OGVA 3IANA 2DSKA 1CXFA 3WD3A 2XG9A 3U5UA 1UH4A 3ARPA 2QPUA 5ABGA 1CXIA 1KBKA 3S6TA 2VX6A 3WMCA 2X2YA 1JG9A 2CKRA 2GJXA 1QBBA 3MUAA 3SCNA 1KBBA 1V0LA 3OBAA 1E5JA 4WKAA 4AMCA 1UKQA 2PWFA 5HOSA 1CXKA 3GH5A 1VENA 3WD0A 1HP5A 2VC9A 4LYRA 2CHOA 2J7DA 1XCWA 3CZJA 9CGTA 4M80A 4IUGA 4EK7A 2YA1A 4KRUA 1FHLA 4GI6A 5I79A 1E0XA 5D8WA 4WJXA 4WK9A 3N9KA 2YL6A 2UY2A 3GXFA 3RO8A 3VMOA 3AZRA 4GKLA 1NM9A 3N04A 1NWSA 1JFXA 5A8QA 1XHGA 1J12A 2FHCA 4W87A 4MNLA 1UR2A 1BLIA 4PCTA 5CLWA 1D3CA 2V3GA 3OLGA 4MNMA 1HNYA 5A2CA 3K46A 1WO2A 4D6GA 5CGMA 3HMCA 4XUYA 1B3XA 3A4AA 4DUVA 4AZCB 2W92A 1H4PA 4RE3A 1L0PA 2PC8A 5I78A 2YLLA 5IFTA 1E1EA 1ESWA 4ZE4A 4JFSA 3CLWA 4C7DA 4AISA 2EPLX 4PN2A 5A6JA 1LL4A 1E6RA 4BQ2A 1G1YA 4GQQA 4XZWA 4BQ5A 3M46A 5KEZA 4PMOA 4LX4A 2O9TA 3VDHA 1GHRA 3FXYA 5FIPA 5A6BA 4PTMA 1SYTA 3EMCA 3UR7A 4WSKA 3CO4A 5IFPA 3VM7A 4AEFA 1VAHA 1N82A 1JNEA 1E6NA 1KGXA 1UUQA 3WQWA 2J7GA 2CKSA 1QI4A 4HZ8A 3CZLA 2G3JA 1QI2A 3MS8A 1S46A 1K9FA 4QCEA 5EMYA 5E6ZA 1V6WA 4U33A 2OSWA 1E4MM 4XZBA 1HJUA 3B8SA 2XYLA 5AY7A 1FH9A 2WW5A 3SCOA 4TX8A 4AWEA 1JF5A 2VO5A 2WMIA 3WF3A 3ZQ9A 1MXDA 1UWSA 3VX0A 1E9LA 1TG7A 3VIPA 1JGIA 5E0CA 5F7UA 3BCDA 1TFVA 1WDSA 3BH4A 3PTKA 1OD0A 1B9ZA 4KGJA 3DHUA 1Q4NX 4KWUA 3W53A 3DYMA 3AXXA 1HIZA 1J0KA 1E70M 5CXPA 3SCTA 2QMKA 3EDKA 3DECA 1GOKA 3SUWA 3PZUA 1BQCA 4JIEA 1TVNA 1UD8A 4F9DA 2OYKA 2EPKX 3WH5A 2YBUA 1V3JA 4X9YA 1UD4A 1H49A 2WHKA 5BROA 2GVYA 5D9MA 2X0YA 4PTVA 1G0CA 2Q8XA 1E71M 5AYBA 2CNCA 3DHPA 3PBGA 4JKMA 2XVGA 5I3DA 3OLEA 1CGWA 2DH3A 1WZLA 1R7AA 3GH4A 4AZ5A 4YPJA 1SFSA 1LLOA 4A3YA 5BWFA 3U7VA 4UQCA 4FLSA 3D5HA 3GH7A 2DT1A 3ZSTA 3CUJA 3LMYA 4H8VA 4PSPA 4PMQA 5AC5A 4W88A 2YLAA 4CN1A 1SMDA 4Q22A 1OINA 5DT5A 2ZWYA 1JYVA 1ISZA 5D9PA 1JD7A 3LPGA 1G9HA 3AIVA 2VUYA 3ARZA 3MUIA 5D8ZA 5EB8A 2YL8A 1W3LA 2D2OA 3ZJKA 4JFWA 2CCRA 4WSJA 4RE2A 1ITCA 2C7FA 3CHCA 4M82A 2OLHA 4HPGA 2XM2A 1XCXA 1OWQA 1J9YA 2X05A 1V6VA 1CXHA 3GBDA 1EOKA 3ARXA 2WBGA 4OJYA 4BF7A 1GHSA 1XYZA 2WZIA 4GQRA 4AZCA 4HPHA 1ZJBA 3M6DA 3NSNA 3CH9A 1O6IA 1AQMA 5E0FA 1UR9A 1HKJA 3IK2A 1QI5A 4ACZB 6CGTA 4JAWA 3TOPA 7TAAA 3QGVA 5BRPA 1LG2A 3K8KA 4TVUA 1HVQA 3FHAA 1JXJA 5ABEA 1KWKA 2WVUA 3CBWA 3K1DA 2FH6A 1WPCA 3KWXA 1H2JA 1V02E 3WDPP 3SUUA 4QDMA 2WPGA 2OWWA 3WH6A 2XM1A 2TAAA 2DSZA 3B9DA 2Y8VA 5CSYA 2BHZA 3PHAA 1A3HA 1CGUA 2G3NA 3LPOA 4TTUA 1BYDA 4PMZA 4MDPA 3M7SA 3VVGA 4CGTA 2DDXA 4NSBA 1KR0A 3ARRA 2EXOA 1KXHA 4B16A 3W24A 1J0JA 1E0VA 1XH1A 2PWDA 4OIFA 4JKLA 3VPLA 1WCGA 1EO5A 2YBTA 5IDIA 2D0HA 4UFHA 2J7FA 1FP8A 1V0MA 4PMNA 2FHFA 5A6SA 3WD1A 1RP9A 4DWSC 1TCMA 1M7XA 2ZIDA 2DT3A 4EAMA 5I24A 1GQKA 1NQ6A 5A6AA 1LWHA 1QI3A 4ZFMA 2Y2WA 1DEDA 1GVYA 2ZUUA 4V27A 2VZUA 3BGAA 5BRQA 1C3FA 1DWIM 3NDYA 3KE0A 1L8NA 4CN4A 4U3CA 4CU7A 3IAQA 2F2HA 3WF1A 3CHDA 3OZPA 1GCYA 3PZMA 1EH9A 1MWOA 1CECA 2ZOXA 3K4AA 4AXNA 2E3ZA 1JYXA 1H1NA 1BPLB 3GXMA 4TXEA 3VD4A 1GUVA 1RPKA 2YKKA 3TTQA 2J62A 3AJ7A 3AMDA 1LG1A 3N1AA 3T08A 3VGHA 3RM9A 3VINA 2WMHA 4CU6A 5A8MA
chains in the Genus database with same CATH superfamily
3PJUA 5FSEC 2P8BA 1VBHA 2FTPA 4OHQA 3ITCA 2CC0A 2E7FA 3AMCA 2VFIA 1J0HA 5LA0A 2CZVA 3W7GA 5A6BD 4QS5A 3HGJA 3E5PA 3QN3A 2OMAA 1WKEA 3IVTA 1DQXA 4QLKA 5JBDA 1XSIA 4Z08A 1UKPA 4ERIA 3C4UA 1VFUA 4DZHA 1DIKA 4QJ4B 4WY0A 3RDKA 4OT7A 4BF5A 4WZHA 5CKSA 1BHGA 5FF4A 1X8FA 5DBUA 3P6LA 1PUDA 5HMDA 2AL2B 2Y7GA 2DZTA 3AHZA 2B7OA 1GQIA 3KCOA 4J28A 4DWDA 3HIJA 4I9TA 4JPGA 4CQ9A 1VIWA 1TELA 3RPTA 5F4WA 1YXDA 3E02A 4L5ZA 4IGNA 4EE9A 3TN3A 2PUZA 1B1YA 3SRDA 2FHBA 2GJRA 1VCGA 1XDMA 3FGCB 3THDA 1O1HA 3DCPA 7XIMA 3NNTA 4Y9AA 2P5NA 2ODOA 5FEPA 4YXGA 3L65A 4WR3A 5I3HA 1WDPA 4FAMA 4PL1A 1RLCL 3A22A 4N4QA 3RCNA 1IE7C 3GXNA 4YMZA 1MSSA 1UG6A 3NO1A 4LBUA 4GX9A 3KS5A 4IMGA 3A6OA 2WANA 3FJNA 3NQEA 2OT0A 1XYMA 3GXTA 4HB7A 1A3XA 1NELA 3URAA 3TJIA 4LRSA 1L6WA 4HP5A 4X0NA 1PS9A 3TIMA 1FA2A 2WHMA 3B0XA 5HUPA 2WQDA 2Z1VA 4ZO7A 3MP4A 2YCLB 2QDGA 1CDGA 1JZ2A 4Z0SA 5K9DA 3N4AA 2G41A 1K3UA 1E9ZB 3VGDA 3TZFA 5CSSA 1FWWA 3UG8A 4D1JA 1KFCA 5D30A 2XH0A 3LGEA 2D2JA 4ILSA 3BSHA 2BXYA 4WQ6A 4F2BA 4KH2A 4L9YA 4DWSA 5L6UA 1QPKA 1J01A 3H2MA 4KRZA 2PD9A 3VFLA 3WZ0E 5HMFA 2A85A 1V3LA 3ABRA 3L2LA 4UFLA 2DSUA 3RR1A 3OBKA 3GX9A 2GGIA 1CWYA 2GJXB 3VINA 3LGDA 3I6RA 1Q6GA 1A0CA 2PRHA 3FCPA 3NEHA 4JYDA 2PDMA 3UG4A 3KZSA 1XLGA 1CZ1A 2E67A 3LU2A 3NPWA 5HNNA 3LNPA 3OGRA 2ZUNA 4OECA 5HMSA 2D2GA 2X8RA 1PZ2A 4XX6A 1OIFA 4R9OA 4NAFB 3VIKA 3N73A 4IFKA 4QITA 3LUTA 4GISA 4W8LA 5TAOA 4NY2A 1AW2A 4FF5A 4NZFA 4DJEC 4X2RA 3NL5A 1QXLA 4C6PA 3SJ3A 2OZ8A 1ZENA 2FB2A 1XIBA 4UMAA 3ITTA 5BXSA 4N9DA 4UZSA 4E4FA 1ZTVA 1W5MA 4W84A 2QCEA 1H63A 2W66A 1K8CA 4PCFA 3PZOA 4QS6A 4MWAE 2W4XA 2Y7FA 3CB8A 4DXVA 3MZ2A 3UJRA 4MLJA 3RPDA 1D2KA 2C1IA 2FPTA 3MPGA 4PUDA 4U2ZA 2X0HA 1XYFA 3QTPA 3U2EA 4BI5A 1ZJIA 1KFLA 3C0JA 3VZXA 3F5JA 3PUDA 4J3SA 3N11A 3LXCA 3T09A 2XH7A 2D1ZA 2J66A 2PEVA 4UNLA 4EPKA 2VFGA 4R85A 3GNRA 4H9VA 4HYRA 4WRHA 3W2UA 4J2MA 3U2OA 2XGZA 1KRBC 4F2TA 3BW3A 4DELA 5LIWX 3GC4A 5DEZA 2ISDA 3TYEA 3CAVA 2UY3A 3H6OA 3LI1A 1EX1A 3WNOA 1EUAA 7REQB 5EGRA 4GIEA 4PTDA 4WOZA 1HN1A 2E6DA 4E2DA 4B2DA 4MB1A 2PTDA 1EP3A 1ALDA 4DJDD 3XISA 4HSNA 1V6TA 3SUTA 4XSLA 2XSAA 1XQLA 3W81A 3TP4A 4JFTA 4W5UA 3VDAA 2EPHA 1IGSA 4FALA 4LV4A 1F61A 3CZKA 3G6LA 1XIJA 2KAUC 3ZM8A 3K8LA 4PMJA 3GYEA 3T7VA 2ACQA 1W8GA 2WLZA 1ZNNA 4EF9A 4TVCA 5E9XA 4PMYA 3G8RA 1KQYA 5H8UA 2XISA 4BWLA 4RE0A 2OB3A 1VRXA 4L4OA 4GACA 4CLMA 2XIJA 5AFDA 2A3BA 2E8YA 4HNCA 2QR6A 1C8YA 3T55A 2BY0A 2BOGX 3RGTA 2ISWA 4CQDA 2XDFA 1CYGA 2MNRA 4AC7C 2VDHA 1TTIA 5BRBA 4DJDA 2X1IA 3BC9A 6TAAA 3W85A 1X97A 1KRAC 3MU7A 5EMJA 4PH6A 4MADA 1OC7A 2IKIA 4FOKA 3N2CA 1HKVA 1G69A 2ZTKA 1IT0A 2Z2UA 5BXRA 3HF3A 3FHQA 1M03A 4ZA0A 3P80A 5CPQA 3SZ8A 4M0XA 3CNYA 1UJQA 3M0IA 2ISSA 3AYSA 2HPMA 2TMDA 5HJXA 1DQUA 4EAYA 3DG7A 1YPXA 4EPBC 5G4HC 3RJXA 3VUPA 3WNKA 4H7CA 3WY1A 1EXPA 3SAZA 1HVXA 4DBUA 4QNWA 4MDOA 3FAXA 3V0TA 1GPFA 4HJWA 1IWAA 1W1VA 4MYAA 4D6FA 4KEVA 4XK2A 3TNBA 1W37A 2HK0A 4W7UA 1OM0A 3PZQA 3AYVA 3C3UA 2YOCA 4HZ7A 4IMCA 3WENA 1XBYA 5IHRA 4MPKA 3I68A 1UD2A 1I0BA 4JDYA 2DV0A 2V69A 3A64A 3W27A 3PAJA 3B9NA 3RJYA 2AL2A 2PRLA 1D8WA 2JGQA 3NR0A 4MIMA 5LNUA 2Z28A 1JZ5A 2GK1A 3R89A 4B5SA 3BV7A 1Z42A 1LBMA 1XBZA 2ZX5A 1LORA 5M17A 4TVDA 3FA4A 1I8JA 3CU2A 3A4JA 2NUXA 5EMUA 4U2YA 1G01A 3DXIA 3W7QA 3G1YA 4UTKA 3MT1A 3VZZA 3TV8A 4CVWA 4B5WA 1UA7A 3PB2A 3EPOA 1GEQA 1AMKA 4E6MA 1BFNA 4MG4A 9RUBA 2FPYA 4LAZA 4WY0F 1B90A 1DKWA 4JCMA 3WF2A 2VDIA 1TCDA 5H8MA 3DKLA 4JL2A 3P60A 1W5OA 3S5OA 4I7UA 2AAAA 2Y62A 4WX2A 3GYCA 3CV2A 2I9UA 3LG3A 5REQB 3GTNA 2X7VA 4S3GA 3WQ4A 4NXSA 3N29A 1VYRA 3E0LA 2Z24A 5KZDA 1M7PA 1LLWA 4K3ZA 3OA5A 4QQUA 4RPPA 5HMEA 1GT8A 2XZ9A 1HJXA 1C29A 4O10A 4R3UA 2W62A 1G4EA 1MFVA 1KWGA 2X0SA 3NQMA 3CLMA 3CQ0A 5RUBA 2PC4A 3I6TA 4AWTA 4X9SA 3BK0A 1XXXA 3QV7A 4EXBA 4US5D 3W9ZA 5M5DA 1IZJA 4L6OA 4O1CA 3TYDA 5CAKA 4HK5A 3W1UA 3VI2A 1EGVA 3ARUA 3VDCA 3HPAA 3ARSA 2QW5A 1XLMA 3IJQA 1R85A 3SN4A 1JQXA 3QPZA 5C9XA 4D6CA 1V3MA 3GVRA 2QCFA 4U5KA 3R12A 1QWKA 4L56A 1W56A 4Z2IA 1SO6A 1EA0A 2WMFA 4MY1A 1NOWA 3DZ1A 3VNMA 2CZFA 3AU2A 4IG2A 4JY8A 1PKLA 3F5KA 4WVXA 4CNUA 4NRRA 2OSXA 3ARWA 3W1AA 4HU3A 3GZAA 4XWUA 4OOUA 1VYPX 4ZXLA 3EBVA 1DVJA 3GUGA 2E8ZA 1U1UA 3PM6A 4GZEA 4NZCA 2I9EA 5EMMA 1YBQA 2YDAA 2YW4A 1YYAA 3REQB 3S1UA 3OZYA 1V77A 3STEA 4JDBA 3WUEA 4D72A 5I06A 4QLJA 4UQ9A 5HINA 5LIYX 4AVNA 4QQ3A 1NOFA 1V5XA 4C5ZA 4EXAA 3L0KA 3TSBA 4URIA 2V3EA 1K02A 4HIBA 3TOYA 2RAGA 4A35A 1XDLA 1OVDA 4XISA 4PMDA 4QTGA 3GHUA 3NFUA 1XC4A 1W1A1 4MTVA 3BCFA 3QY8A 1ZCCA 1B3YA 3T42A 2A1YA 2OEMA 1L2UA 1H1YA 1L6SA 3MCOA 2DZSA 5D05A 3MKKA 1BF2A 1R2RA 3SRKA 2Y4SA 4HA3A 3S2MA 4L9XA 1F4AA 2HVMA 4D8LA 5DFAA 3NTYA 4LBSA 3XINA 3NCOA 3G5EA 5A8PA 1VC4A 1ONEA 2ACUA 1AW5A 3W1XA 2FZBA 3ZT5A 2VD8A 1FWGC 3EDEA 5IHSA 4DZAA 3RX2A 1WA3A 4MM1A 4K7YA 1ONXA 4ERGA 4PODA 1ADOA 3A12A 2J7BA 3M5VA 2QIWA 2QXWA 1UBSA 4C6EA 3CPUA 4CU8A 3PZTA 4LNYA 2CU0A 1OZMA 5CJ5A 4G5DA 4H04A 1AQ0A 1XIGA 3VO0A 3L4VA 4TV5A 2HE5A 3F03K 4I3GA 5LA2A 1ZFJA 3MSGA 3WBWA 4Q4PA 4GYKA 5J5RA 5CC3A 2DZVA 5EY5A 2VR5A 4Q6XA 1W3KA 1H7WA 2C1GA 1KXVA 5MKGB 4BCEA 4RV3A 4LRTA 5FJOA 4RXFA 1W2PA 1DTNA 1ODZA 1V7YA 1G4PA 3ORWA 1G67A 3BDKA 5HDRA 2H3BA 2O0TA 1XLDA 3TTEA 5BYWA 1UR1A 2YB1A 3W82A 1B2YA 4LOCA 2R1PA 3VOJA 3QYSA 2P1FA 2BS9A 2PDIA 2DQWA 3GR7A 2YPIA 3LRKA 2DGAA 3ATZA 3NPXA 1K4HA 4J3TA 1JCJA 1ITUA 3NGJA 4LFYA 4QXIA 2VEFA 5FJUA 2V3FA 1ISXA 2ADAA 3VNZA 1W5NA 3OO2A 3BQ5A 4MAZA 3TE9A 4K36A 4AZHA 4WCJA 1A3WA 2IQDA 4EKJA 1FDZA 2O92A 3YPIA 2IKGA 3AIQA 1YTEA 2VQUA 5CZTA 1E4LA 4GPNA 1TZZA 4Y6GA 2Z4GA 5F2MA 3VC5A 3I65A 3WBYA 1CLKA 5MKGA 1E4IA 2DEPA 1ICSA 2G4JA 3RRXA 3V1HA 3MMWA 1UR0A 3SY1A 2NXHA 4ZOBA 2HTMA 1X1OA 2O55A 2OZTA 1GYMA 1RY8A 1GNXA 2QCHA 2ZZ5A 3GHTA 1QNRA 3AS3A 3MVIA 1UP2A 2VX4A 2IXVA 1OX4B 3ID7A 3WLOA 1RCOB 1EBHA 1GQJA 1SGJA 1B57A 1F5ZA 2BZNA 1S1RA 2C79A 2YA2A 3S5YA 4K1GA 1BQGA 5CJNA 2XHYA 1MEIA 1E0TA 1RA0A 5D2YA 2OOGA 1XGEA 4EP8C 4AIOA 3NZ1A 2YCLA 5HPCA 2PWGA 1E6SM 1EHAA 3LM7A 3ARYA 3FYYA 1FHDA 5CQ1A 2NW0A 2VTFA 1KCXA 2DP3A 2R9RA 3KBMA 3ZJ6A 3PG8A 2NZLA 2WHJA 1DXEA 2WYSA 2VVNA 1JCLA 4Q4KA 4PE8A 3S1WA 3FDGA 3AHYA 1EDTA 4JTHA 4XZLX 3DC0A 1TPB1 4FO4A 4HN8A 3M44A 4DI8A 3BW2A 1WP6A 2RDWA 3P3BA 2J25A 1C92A 2AL1A 3E6EA 1YMYA 3GFYA 1DWAM 1GVEA 2WMIB 3CL7A 3W71A 5MHBA 4Q3MA 3R13A 2W9MA 1R9XA 4AY1A 4DNHA 1WBJA 4Z2KA 4PB4A 3APTA 4MWAB 3LCGA 1ICQA 1WUFA 5KZ6A 3NOYA 3EA1A 2HNEA 4XBKA 1BRLB 1LT7A 4DPPA 3HPSA 4QRNA 3LXAA 3EWUA 3L4ZA 3S47A 3WL1A 2OT1A 1SFLA 2PSNA 1BYCA 1W9DM 2V38A 3OOQA 1VD6A 1P0NA 4H9TA 4PUEA 3NJ3A 1XRFA 1LL6A 2YCJA 3S2LA 2SFPA 3WQCA 5C5YA 1DHPA 3ABOA 4UCFA 3L21A 4UFMA 4IISA 1E43A 3PBWA 1IXPA 3CYVA 3H7UA 2QJMA 2UWFA 1YKWA 3NURA 1PTAA 4AD3A 5I3IA 4DWSB 4GNJA 3MO7A 1SJDA 4B4HA 2Y61A 1LDCA 3RCYA 1R3VA 5TD4A 1N2VA 3WFZA 2AQVA 2WHLA 1PX8A 3ARTA 1X1ZA 1A5LC 3BVJA 2XH4A 4I7WA 4HMEA 2W63A 3W28A 2IPGA 4L7ZA 1UKTA 3RLHA 2Z2BA 3S6OA 1LCOA 4IIFA 4W86A 8XIAA 2J7EA 5G5IA 4UIOA 3NUKA 4ONVA 4C7GA 2RKXA 3SN1A 4L61A 4A29A 1JI2A 2GSJA 1RD5A 2WZHA 3ZJ7A 3TYUA 1JPKA 3G1SA 1UD6A 3S1VA 3WF0A 2PDHA 2OCZA 1A80A 1HT6A 3TCEA 1CGXA 1RV8A 2ONEA 2VT0A 3QLDA 2BODX 3ZLHA 4WGHA 2F7FA 3PJTA 3B0VC 3R0DA 5KITA 1DJXA 1S38A 1VKFA 2OWCA 1CB2A 1FXQA 4CCEA 4IM4A 5BOEA 5AN7A 4DXXA 1BVZA 4H6KA 2ZZ6A 2CBVA 5A8GA 1OABA 4NQ1A 1JDAA 1Z6KA 3W6LA 1FWIC 1LBFA 1A0DA 1PYFA 5EYWA 3D3FA 3EDFA 1E6XM 5G2IA 3ABXA 4HMCA 2A7RA 2XGIA 2VFEA 3FJLA 4BEQA 3QOMA 1OC6A 1YTDA 1UYQA 5FL1A 3P14A 1FDJA 1EJRC 3NL6A 2WZMA 1MW3A 3QZAA 3BAWA 4NAEB 3WFLA 3DFPA 4LEFA 4B5VA 1OFOA 3NM3A 2J78A 1YIXA 4B91A 1US2A 1P7TA 3R25A 4H7ZA 6PTDA 3G1FA 1D7KA 3ITOA 3WX7A 1HJVA 2BY2A 4MJMA 1F9CA 2FGLA 1K9DA 1FH8A 3WK2A 4NZ5A 4GH3A 5ABFB 4PYSA 3UJFA 2C13A 4Q4RA 4O1DA 2VQTA 3H21A 1IXQA 2WC3A 1VBJA 2VOTA 1OCBA 2ZUMA 2WV8A 2PODA 4O54A 4UQEA 1CLXA 2QF8A 3P0WA 4C6CA 2UY4A 2QCDA 3DFTA 4H6QA 4GO9A 4V2XA 4A3HA 2TODA 4TR9A 5AVHA 1TO3A 4HNVA 4BA0A 2PMQA 3GTHA 4NJJA 1OF6A 3WNPA 3EXRA 1RVGA 4GIYA 4HK7A 3H2OA 2PURA 1DWJM 4W93A 3T0AA 1YNYA 1J5SA 2BV9A 2E5BA 1DORA 2JEPA 1WDRA 3WLNA 4HGXA 1R47A 2FJUB 4B9YA 3PFRA 3IGSA 1UR4A 1BG4A 5CLTA 4EANA 2XIQA 4RR4A 1TE1A 3BLIA 4CQCA 2JF6A 4ZQNA 3O07A 3VTRA 4IXHA 2CLEA 1E4NA 1KM0A 1O60A 4JTKA 2VCAA 3UXIA 3N2TA 1AQHA 3TUUA 2FZ8A 1OFPA 5C70A 3LK6A 1ITQA 5FEWA 3L66A 4N42A 1VHCA 3UY7A 3DN5A 4GINA 3UZZA 3WLSA 4IGMA 1S3TC 4ZR8A 1VPXA 3STFA 1UA3A 2QT3A 4FLQA 4PRRA 4TV6A 1G94A 5G4WA 3CAQA 3E9AA 3C2OA 4H6EA 3OGVA 3IANA 1V7AA 1TIMA 3CMFA 1RJRA 3W83A 2Q3RA 2QPUA 5ABGA 4QGCA 2NWSA 1KBKA 3S6TA 2X2YA 2GJXA 3FA5A 2DORA 2H6RA 1UP0A 1V0LA 1DJWA 3CQKA 3U3HA 1YDYA 3IIZA 1BKSA 4IXXA 5HOSA 1GYNA 3N9RA 3BO9A 1AH0A 1HP5A 2VC9A 2CHOA 1EYEA 2J7DA 1VR6A 2ZZ4A 3WQOA 4M80A 4NYYA 4EK7A 3W84A 1K7EA 1WYIA 1AA1B 2XZ7A 5D8WA 1RUSA 3T9PA 1WOAA 1Q8AA 3VMOA 4L1WA 3B0PA 1XPYA 1KBJA 1NWSA 2AKZA 3MTWA 4R34A 1J12A 4WHBA 4W87A 1K4GA 3MHFA 1XLJA 3UGRA 4PCTA 1J4EA 1JJKA 4MNMA 3RU6A 4C1KA 3K46A 3KVMA 4HNOA 5CGMA 1UC5A 1S2VA 4AZCB 2VEIA 3B4YA 1L0PA 3DH7A 3FX4A 5IFTA 3EWCA 4JFSA 4XZHA 4I6KA 3BARA 5JQ9A 2YFOA 1LL4A 3SIZA 3LHYA 4XZWA 1CB7B 1PTGA 3M46A 5KEZA 1AJ0A 4DBEA 1X98A 2O9TA 4XAYA 3W1NA 5JXQA 1QK0A 2GOUA 3WLJA 3LTSA 3VC6A 3ONCA 5IFPA 4AEFA 3V1PA 1N82A 4MZ8A 1YTKA 3BLFA 3RLVA 3B8WA 1UUQA 1TV2A 3QSTA 1Q65A 2OELA 3CZLA 4ZCWA 4UTWC 3MS8A 4Q8WA 1PKYA 1FWCC 5H8PA 4U33A 1E4MM 4XZBA 1HJUA 3IUDA 3VK5A 1E9YB 4OU1A 2XYLA 2NXIA 3BOXA 3GDRA 2WW5A 4IP7A 1RAKA 3R79A 1SZNA 3WF3A 1MXDA 1UWSA 3JS3A 1TG7A 3V7PA 4FF7A 4GY0A 1KM2A 3UGVA 1RZMA 4IX2A 5E0CA 4QM1A 2XINA 2OFJA 5F7UA 1I2RA 3NA8A 3USBA 3LI0A 1OD0A 3C2FA 4Q8OA 4ZBCA 1R3RA 1GVQA 3AXXA 1J0KA 2YX0A 5CXPA 3SCTA 2IPWA 1GOKA 3MI3A 1EEPA 4NX0A 3QZEA 4JN7A 5LXEA 2NSOA 4E3TA 5I02A 2YBUA 4RJEA 4IFOA 1V3JA 1H49A 3AU6A 2I57A 2QVHA 3S83A 4US6A 4K38A 2HPIA 1CGWA 3S9YA 3D46A 1R7AA 1KC7A 4ORMA 4CQAA 3JZUA 3CQJA 4J4KA 1LLOA 3LHWA 4KW2A 4FNRA 3LMYA 4NUWA 1A5OC 3P0XA 4PMQA 3AWNA 2R24A 4W88A 3B40A 1SMDA 3A21A 4J35A 1OINA 2QCDB 2A7NA 5D9PA 1PL9A 1TVLA 3LPGA 3QQ1A 1GVSA 2VUYA 3ARZA 3MUIA 3MCNA 4I7VA 4HMNA 1NDVA 4JFWA 4D8AA 3PBVA 3OTRA 2Q8ZA 4NASA 3GQYA 1E1CA 4HPGA 4IMDA 1V6VA 1KKOA 2H90A 3ARXA 4BF7A 3C2EA 2Z2AA 2I56A 5TBOA 3LRMA 4JQ3A 1WX0A 3W01A 3NSNA 3CH9A 1JUEA 3OU8A 1QO2A 1NAL1 4JAWA 5CSRA 2OGYA 5LHEA 1JXJA 3E0WA 3TC7A 3KWXA 6ENLA 3WDPP 3ZYZA 3SUUA 4YJ5A 5DQPA 3WQDA 2DSZA 3TAKA 4BY3A 3LDVA 1QPOA 1SO5A 4JN8A 1PTDA 3QGAC 1AFSA 3MW7A 1IEIA 4WD0A 1KR0A 1AD4A 3PSVA 4M6VA 3CO8A 1KXHA 4GIRA 1XH1A 3CJPA 3N3TA 2P3ZA 2PWDA 3PFMA 2FB3A 1TWIA 1U22A 2YBTA 3P62A 5IDIA 4JTDA 2J7FA 1FP8A 1V0MA 4PMNA 4MZYA 3B03A 1TCMA 1S5VA 2PGRA 3VE9A 3S9IA 1UBPC 3EXSA 1QI3A 4YCOA 1DEDA 3ME3A 1F6PA 3BGAA 1T8XA 3OYXA 1SU5A 3KBNA 3URQA 4U3CA 4C1LA 3W7PA 4JNZA 4C6JA 1FCUA 4YCPA 4XIMA 1TMLA 2JK2A 1AL7A 3B9OA 4GD0A 4AFYA 4DN1A 2HDJA 3AXMA 3DC8A 1JYXA 1H1NA 1BPLB 4PB3A 1OYAA 3N1AA 1M7OA 3VGHA 4KFOA 3RM9A 4CU6A 3WMCA 2DIKA 3S5ZA 1OGBA 1OHLA 1P6WA 1BAGA 1R2SA 1T40A 1DXIA 2NV1A 4OV4A 1ISYA 1BRLA 4F8XA 4JD4A 4HPXA 4GUJA 3CEPA 2Y24A 2F84A 4LV9A 3VCNA 3SJNA 3IVUA 2PP0A 4FK9A 1US0A 4XKYA 3W25A 3B97A 3WLQA 2PBOA 2QAFA 4NZ4A 1SM9A 4KCWA 3DG3A 3K1GA 1XIEA 2VGBA 4XZ9A 4LVFA 5HXMA 4MWAD 2Z0IA 2QAPA 2NV9A 1FFRA 2FQIA 4QEHA 4HOZA 4LBRA 1XIMA 1G5AA 2EF9A 3TVAA 1QI0A 2E09A 1I75A 2F6KA 4K39A 1PIGA 4GJ1A 4LJ3A 1OT1A 4JTJA 2NV2A 4JYEA 3Q37A 3BOLA 1T6MA 1H7XA 4QCFA 3DERA 4FR1A 2WVTA 4M7TA 1TR1A 1OJXA 3WH7A 1Q2SA 4M56A 2WJEA 4P8XA 3GVVA 4R7WA 3R8HA 1A50A 1P1XA 1JCYA 1AQFA 4ZQMA 4W5ZA 3M64A 1ZB5A 4W85A 5AZ0A 2CBIA 2BXZA 3ABSA 1KO0A 4YVPA 2UZ9A 8XIMA 3AS2A 5CPNA 1OYBA 3WQVA 3LCIA 2ZXAA 4U28A 4M24A 2Z29A 1GKRA 3OHIA 2VYOA 2V2HA 4GY1A 4DI9A 2QCGA 5G1MA 4GQBA 3UWEA 3M0HA 4YHGA 3QVQA 3WJZA 5LNWA 2Z27A 3NDOA 2AOSA 5J5DA 1HL8A 2VZOA 4BS0A 2QDHA 1MEWA 1JZ3A 4Q4QA 5IXEA 5B7ZA 1MW1A 5K2ZA 3O1NA 3KBVA 4O12A 2ZZ7A 2PF8A 4IGHA 3ZSSA 2WCSA 2X1SA 3M16A 4ATLA 3W2LA 3DOPA 1TREA 4S3AA 3V5FA 4LCQA 5D09A 3FKKA 4B3LA 3WDIA 4ZOAA 4PC8A 5D9OA 1NTHA 4B5NA 1JZ8A 2XTKA 1MQRA 2ZDSA 1OY0A 4PL2A 2X40A 1JGMA 4HA4A 3VE7A 5GJNA 4MKVA 3W6YA 4AYSA 1ZALA 2NWRA 2VDGA 5BXTA 1YLVA 3LZ5A 3SCUA 3TA6A 3TA9A 4JHZA 5HR6A 4QE5A 1XIFA 3UZXA 4B3KA 1OGSA 3TJLA 4A2SA 2Z1KA 4CCDA 3GTFA 2QGYA 3THAA 1JYNA 3WCZA 4Q6JA 3W4RA 5LNSA 4I9JA 3I4KA 1SPQA 4JY9A 4JIPA 5I09A 1BF6A 2JALA 3GM8A 7ENLA 1GOXA 3KP0A 3MO4A 1QNVA 5T8GA 2Z1XA 2EPOA 4KRTA 2ZTJA 3VIJA 4JNMA 2ACSA 1BVWA 2AMGA 3LRLA 1J96A 1PVNA 3FV9A 2DZWA 2WK2A 1KCKA 4YVXA 3UD6A 4GHRA 4YTTA 4JTIA 1WB0A 3SADA 4NJHA 1UD3A 1PZ0A 4MFDA 1KM6A 4UMBA 3W7NA 2XVLA 1F3EA 1F2JA 2W5FA 4AX7A 1MI3A 3NL2A 1I2QA 4N9CA 3W74A 3RM4A 2J47A 3PZ9A 1H61A 4A4AA 2V82A 3V4BA 3B4UA 5EFDA 2EHHA 5C8BB 3OA3A 2GUBA 4UOJA 1C8VA 4EPEC 1UHVA 5HUOA 5BZAA 2YA0A 1I60A 3NAVA 1X6NA 3HGOA 4ORIA 3H4XA 4UMCA 2JBMA 4KETA 1MZRA 3VXGA 3HM7A 4O4WA 3RFAA 4A8IA 5AB3A 4M7SA 2P76A 1UH3A 3RX4A 4QSHA 2NQ9A 3ARQA 2CHNA 1DWFM 3EX1A 3MUZ1 1W3NA 4WIWA 5F4SA 3WD2A 3IJ8A 2C1HA 4A3UA 3DGRA 3QJAA 4JL1A 3IV8A 1O66A 2IXUA 1EUNA 4O1AA 3UWQA 1W3IA 4CEXC 2QVNA 3CQIA 3T0DA 2C8NA 1ZS2A 1L2QA 3CPGA 1QATA 5D02A 3FEMA 4Z1AA 2VEKA 4LUSA 3N17A 5FF7A 3WUFA 4KIRA 1PHWA 2X09A 2VRKA 5HQMA 3NL3A 3M0KA 4CNTA 4ZQRA 3L12A 3B8UA 3CH0A 2BHUA 3VMNA 2ISFA 1C90A 2ZICA 1ZAIA 3UA3A 1F76A 1EQCA 1RP8A 2CLLA 1ZBWA 3OZOA 2P8CA 2WJZA 5AC7A 2XUCA 4HSOA 3GNPA 1LBLA 4NJIA 2BDQA 1ZL1A 4YTUA 2VEGA 4P8WA 2ASHA 2OU4A 2VC6A 1EX5A 3JU2A 3HG4A 3VKKA 2AQWA 3TQVA 5BU9A 4DHGA 4BI7A 3ZR5A 1FQ0A 2J7HA 3DG6A 4YU1A 1EKOA 1M7JA 4L80A 2PU0A 4M51A 3CQHA 4C6MA 1P5BA 4ENLA 5DCDA 1NVMA 1PV8A 2P53A 3W29A 4Y2WA 1E40A 1FFQA 2QUTA 4IIHA 4REQA 4Z1BA 3L4UA 4S3FA 3F2CA 4PUNA 1KLZA 3TROA 3OYZA 5A6TC 2JF7A 3H22A 1JDCA 2G3MA 1RPXA 2EBNA 3UVIA 3R6IA 1YHTA 4Q8NA 1EEXA 3DENA 4DUOA 2TSYA 1E1FA 1EDQA 1IEWA 3LLXA 2H8XA 4F48A 3BJTA 4AEEA 5CEWA 1HJWA 4GNVA 4MB4A 2UV8G 5EBAA 5HATA 1GJPA 3VIOA 2PLJA 3PZVA 4GYPC 3IJIA 2A79A 2Y1HA 5A3HA 1Z9AA 4JTRA 1OSEA 4WDWA 2XN1A 4HK6A 3H2AA 3OVQA 2BGSA 3UESA 3ZWTA 4JNYA 1IXNA 3E96A 5LNRA 3GIQA 5FSDC 2IKHA 2O9RA 2JFEX 2DT0A 2XH2A 3ANUA 3DESA 3WF4A 4XQ6A 3SCWA 2VGGA 3IIXA 4XD5A 1VBRA 2J75A 5F2GA 2FFIA 2VR4A 3AUOA 4KCVA 2Q09A 1VEMA 3TH6A 4UB9A 4H00A 2QUUA 5KSWA 3CZGA 4HNUA 3ARVA 5GNYA 3QW4B 2UY5A 4J3VA 4MF4A 3RIKA 3ZWSA 3R8GA 4G8TA 1JAKA 1TV7A 4EWJA 2VX7A 4J3WA 1I9CB 3V3WA 1MQPA 5EA9A 3SQSA 4UR9A 4HA1A 5IBXC 5FAJA 1XIDA 1Z48A 1F7BA 4F0HA 1IEQA 3N34A 2G96A 3W7HA 1PE1A 1YXYA 3VIMA 1ZLPA 3IRSA 4JIIX 4BQ4A 4ML9A 1ME7A 3SGGA 1W5PA 5HPOA 3EAUA 4OTKA 3NXLA 3WEMA 3AZSA 3FS2A 4AZ7A 5A8NA 1X8CA 2G3IA 3A4WA 1AODA 5E93A 3T4CA 3VNJA 1OCJA 5EMKA 1I2PA 1IHIA 2DT2A 4XB3A 3L4TA 2QV4A 3L9CA 1ZAHA 3BJFA 2G95A 4NNAA 2VCCA 4GABA 8RUCA 1EDGA 2CLKA 3HN3A 2CBJA 4TX6A 3IUHA 4LB3A 3M0JA 3VCRA 3S8HA 3I7QA 3J7HA 2QHAA 1SZEA 3GXDA 2OQHA 2D2HA 1OFEA 5F2LA 3U0HA 1X6UA 5LNVA 1NWRA 3AMLA 3BMXA 4CCZA 4PBEA 4B2DD 3W6MA 3HQ1A 3WEOA 1G6CA 1NOUA 1ODUA 3VKDA 3CZEA 4DYJA 1K9EA 3VAVA 6A3HA 3NXFA 3O3RA 2VZVA 4LYQA 5H1WA 1JZ7A 4V28A 4B5UA 4GJJA 3CZ8A 5HJLA 3QHMA 2PZNA 4A21A 2A6NA 1XJBA 1EC9A 4WJEA 4HOXA 4QSFA 2WB5A 1CTNA 3WUGA 1RQHA 4WSHA 2Q02A 3ZO9A 2A3HA 3DHFA 4AMAA 5HAOA 3WLRA 4XO7A 4X3ZA 4QHRA 1E6ZA 3U7BA 1UOZA 1TJPA 2J7CA 2D0GA 3ANVA 2VGIA 2XFWA 1CW2A 3VDGA 4LF2A 5FJTA 3TCSA 4HYWA 3I10A 4LS0A 3W00A 3H12A 3KL3A 3O8AA 2ZVIA 4J2PA 3SEPA 4LUTA 1XRVA 3SCRA 1LT8A 2OXNA 4PZVA 4IGSA 2J9XA 4ATWA 1X38A 3CGTA 3VD3A 2GWGA 3P74A 2IQTA 3ITYA 3TW6A 3MMUA 3BAKA 3UEQA 2NX1A 1CX9A 3LQGA 5HNRA 1BXCA 3E1F1 2D22A 4YTRA 5GPRA 4J3XA 2DIJA 3CV6A 2GYIA 2ZVRA 5G2HA 5I77A 5C9ZA 2VEMA 3M9YA 1UC4A 4WXYA 3BE7A 2KZHA 1FVPA 4UTIA 4G6CA 1V3KA 3SCPA 1T5AA 1GKQA 1OF8A 1TV8A 3UJEA 4YHEA 2VFFA 5D33A 3CUFA 1CLVA 2PBGA 2Z6IA 5REQA 1EC7A 1JL8A 1TRIA 2BFGA 2PB1A 3APGA 2EKGA 4IFKB 1LQ0A 2YIHA 2XIBA 4CD7A 4S2BA 3BZGA 4R27A 2ZXDA 5C9WA 1VBGA 2REQA 2J8TA 1MUCA 2KX9A 2P3EA 4OVXA 1XLHA 3W7IA 4I9AA 2ZC1A 1HFBA 4DBSA 1Q6DA 3W70A 1PZ3A 5CPSA 2ZA1A 1UUMA 3O16A 1BD0A 2WAGA 3B04A 3GDKA 4US5A 1JNDA 5FOOA 4O57A 5JBFA 1JXKA 3ES7A 3UCQA 1UWUA 2V81A 4GXWA 1S5TA 1SFTA 2D3NA 4KWOA 2JGYA 3PUEA 1E3XA 1W3TA 1XLEA 4K8EA 3ICJA 3HFYA 1R5YA 4AXKA 1W5QA 3KLLA 1UP3A 2X41A 2WKLA 1AK5A 1YDNA 1TPWA 1H41A 1F3XA 2ON3A 3T40A 2ZX9A 3MHUA 4CNOA 1YNQA 3ALGA 1DWGM 4F79A 1HW6A 3SB0A 4AWUA 1S2AA 4LSBA 3CS2A 1U2YA 4W7WA 4ADUA 3TMLA 1A5NC 2OO0A 1W3JA 3O9NA 4WUIA 4HJFA 5AECA 8CGTA 4OZOA 4Y9OA 5D4YA 3UXLA 4R33A 4TMBA 3SQLA 2J6VA 1Q6FA 1IT7A 2ZRXA 1SUXA 2YJQA 2Z1SA 4IJRA 1M53A 1FWBC 4FIQA 1O1ZA 3RG6A 4G2DA 4OUIA 2W0UA 3QTGA 3IWPA 3THQA 1NJJA 2HMCA 2Y89A 3LN3A 4DJFD 1MXSA 3WMSA 1XI3A 6XIAA 3BLEA 4FNPA 3TWAA 1CXLA 4JTTA 1QHPA 2FH8A 4PBGA 1QJWA 1W8SA 1U5JA 1E6PA 1AMYA 1H0GA 2NUWA 3VA8A 2ZC8A 1WKYA 2C71A 4FX8A 4CNPA 1BEUA 4CEUC 4DO7A 4EOUA 4JZ5A 4A05A 1DJYA 3KDOA 5BCAA 4KEMA 5XINA 5DMLA 2W27A 4J1OA 3TTOA 4W8AA 3EB2A 5C71A 1V02A 2VD9A 2JEQA 2YCIX 3WG6A 1MEHA 3RHGA 5AVNA 3EWXA 4NU7A 3U6WA 2HV5A 1GQNA 3QH2A 1WE5A 3GWQA 1CBGA 1EZWA 2WKJA 1OK6A 3BSMA 3L5MA 5FESA 5CBJA 2EG6A 1EO7A 4GI9A 2OR2A 2OGJA 5EL1A 1P43A 3KEHA 5D2VA 1VFOA 3C3NA 4NI8A 4MAVA 1H5VA 4HSHA 5C2CA 3MSDA 1EB3A 4LVGA 4LALA 4N6EA 5C6MA 5IDZA 5HR7A 9XIAA 4FS9A 4WY0B 3IJDA 1FKWA 3P8JA 3AMGA 3MJYA 3GSMA 1E6QM 2PLCA 1MNZA 1R38A 3BLDA 3DHDA 3P2VA 2E4TA 3VILA 2QPSA 4X63A 2IPJA 1E9IA 4UOZA 2Y5EA 4TTGA 1TMHA 5DLCA 1OX6A 1OFBA 1V8EA 5GVJA 3HB9A 1YEYA 3VYLA 4OUEA 3V35A 1HO4A 4GNKB 2GUUA 1LWIA 2PA6A 3QW3A 4RZ5A 3GC2A 4J40A 4FR6A 5I3FA 4MWAA 3N6HA 4JHOA 1H5YA 1R6WA 1R87A 3WLTA 2XU2A 4JICA 3OBEA 1KM5A 4UFJA 4QDPA 1WDQA 3ITGA 1GQLA 4UQBA 2QDDA 3LENA 2J8GA 3P81A 4D71A 3G18A 3QRHA 4FNSA 2XFRA 1A4MA 2A21A 4DUWA 5E0KA 3COTA 3A3XA 1VFLA 4H83A 4W8BA 3MB9A 5D9NA 2X1RA 4S38A 3UWWA 1O5QA 1R86A 3LHVA 2PDXA 4O13A 5A2BA 1X1NA 1RH9A 1T0OA 1UH2A 2C16A 3SUSA 2XWEA 4JTQA 1B3VA 2OLAA 4P7NA 1MMFA 3TSMA 1R3QA 2H9AB 4DAIA 1UZ4A 3EWWA 3TQPA 2EAWA 1R3TA 3LQLA 2XWDA 5FACA 1UWIA 5HWJA 5CGQA 2RDTA 3I7SA 4UTFA 1WAWA 3W2MA 1JIBA 2VCBA 3EGJA 4JYFA 4PULA 1TE6A 2HS8A 2Y6ZA 1H0IA 1OBAA 2BNJA 4J7RA 3T8LA 3THCA 3Q45A 2FVKA 3QFWA 3VDBA 1GVIA 3QR1A 3DYPA 1J2BA 2DZXA 4B90A 3KBSA 3OLDA 1E55A 1F73A 4GYPA 1ZBVA 1W54A 3P84A 3SRHA 2ZXQA 2CZDA 4L64A 2WXDM 1J8VA 3S3GA 5DXXA 1LOQA 2VM8A 3KVJA 1V0NA 2Y5JA 2RDXA 4NAFA 4JIHA 1V3HA 1YRRA 3BTNA 3T2QA 3U2ZA 4YVVA 1LRTA 1EF2A 3UZYA 2I16A 5F1VA 2NX3A 1F4HA 2QJJA 3T07A 3LSBA 3V5OA 3HPXA 3VX1A 2P88A 2WBKA 1E15A 3FSUA 4LY4A 4QLLA 1KXQA 1KGWA 1JZ6A 1N55A 1TTJA 2QDEA 4HTBA 1X96A 4ZB5A 3E12A 5DY2A 2GGEA 3GIYA 5DMMA 2QUNA 1TJ2A 1KFWA 1LRNA 1FCVA 3BW4A 1RVKA 3FY1A 3W1PA 3AHVA 2BP1A 3MMDA 4NAEA 1TPFA 1CEOA 3TYBA 3GXIA 3NO5A 4F2UA 3AHXA 1SW7A 1WXZA 2E9BA 2P0IA 3O7UA 4O8RA 1HJQA 1FH7A 2DW6A 3BMWA 3MBFA 1BG9A 2OSYA 4AVFA 3PPGA 3RXZA 2PDUA 2FGBA 5KETA 5FD0A 3NQGA 2PCEA 4ACZA 3SECA 3KW3A 1RY0A 4JQ4A 5HBFA 2NQ5A 2VUNA 2DFAA 2F38A 2O56A 1LQAA 5DO8A 4AX6A 3LOTA 5B7YA 1XFBA 3LZ3A 3VOGA 4C7FA 1ME9A 1P6CA 3PP7A 1AD1A 5EBUA 1W9XA 3KDNA 1EA9C 2VFHA 4QJ3B 5D04C 3SDOA 4ZSTA 4UNKA 4HU0A 1PWMA 3ZR6A 4WKHA 3R0UA 5HQLA 4LC8A 1TV4A 3FIGA 2WVVB 1BTCA 1EQPA 3LCLA 2WNQA 1GORA 3TK7A 1OC5A 3OODA 2B0MA 5E70A 4JR5A 1H1ZA 1TA3A 1FKXA 2WVVA 1EIBA 3CMGA 5B80A 1KTCA 1NQKA 4XSMA 4L1XA 2IMRA 2RH9A 3KTXA 3KOZA 1I0DA 3GW3A 1Q7QA 1AW1A 2FZ9A 4H9YA 4O1EA 3WMLA 3QC0A 1W1PA 3P5ZA 3BV4A 3G1AA 3FA3A 4PMUA 1VP5A 3G0UA 2VEPA 3E0FA 1H7OA 1KGUA 1Q8JA 1S2CA 2OO6A 2VRQA 5DCEA 5U7SA 4JHMA 2FIQA 3K5XA 3PULA 3W7RA 3M7WA 2BOFX 3POHA 4AF0A 3CXOA 4E4PA 1BWKA 1DV7A 5CZSA 2QJNA 4F66A 2QF7A 3UYCA 1PCKA 3LYEA 1WXJA 3PWAA 2ZBTA 5BW6A 1UKOA 3T81A 1EGZA 5FCZA 4C6NA 1QOPA 3LA4A 3WDRA 1FWNA 3CK5A 2W61A 4BFAA 1FHUA 1KQZA 3W88A 4EF8A 3RUBL 5AC6A 1V4YA 1WKFA 2V6AA 3WQGA 2FPVA 2P50A 3UWZA 4IJBA 1CXIA 2VX6A 1UMLA 1JG9A 2CKRA 1QBBA 3ENLA 4IH3A 3MUAA 2V68A 1Y5VA 1RALA 1KBBA 3GLCA 1VLIA 2DZAA 1BSLA 4D9PA 3OBAA 1E5JA 2J88A 4OGZA 4ZGYA 4IQDA 3U2CA 1IYXA 1CXKA 1VENA 4JX6A 4LYRA 1OEPA 1XCWA 4MYXA 3PF3A 4OE7A 2ZA2A 2YA1A 4NG3A 4KRUA 1FHLA 2CLFA 5I79A 4KKXA 4WJXA 4N7QA 1FTXA 3RO8A 3AZRA 4ADSA 3MKCA 3IJLA 4TO8A 1VYSX 3DI0A 5A8QA 3R4IA 3GVQA 1XHGA 4MNLA 1UR2A 1BLIA 3D0CA 4M3PA 1L8PA 1B3XA 3A4AA 3NQ7A 3UWUA 3KOXA 1H4PA 3RYSA 4RE3A 3DI1A 5EU9A 3CPRA 1EC8A 2I17A 1E1EA 4ZE4A 8TIMA 4ROPA 1RR2A 3M0LA 2Q8LA 1SVDA 3CLWA 4ES4A 4PN2A 5A6JA 1I45A 4BQ2A 1E51A 4PUKA 1A53A 4ZO8A 2QNEA 3GRIA 4GC3A 3M0VA 3IVSA 2Z25A 4DJDC 3VDHA 1IQ8A 5ENLA 5FIPA 3CEUA 4H01A 4WGXA 5A6BA 4RX0A 3HFTA 2C91A 4WSKA 3OP2A 3OG3A 1VAHA 5CZ0A 2PDWA 5DBTA 4C90A 1JNEA 3VKBA 1OFRA 4UWMA 2DVUA 3E2QA 3LMZA 2CKSA 3S9ZA 4XKMA 1QI2A 1K9FA 4LWWA 4QCEA 3EWDA 5D2TA 1U5VA 1FUYA 3B8SA 5T26A 5AY7A 1FH9A 4NP7A 2WQPA 4FEZA 1JCNA 3UW6A 3GAKA 3RLUA 2CFFA 4I90A 3ZQ9A 2POTA 1E9LA 4DJFA 2I5GA 4M6PA 1TFVA 1WDSA 4KGJA 4KWUA 3WYZA 4O0QA 1A4LA 1HIZA 2A4AA 3EDKA 2NX9A 3SUWA 1BQCA 3PJWA 4HPNA 4JIEA 1MRQA 3G1RA 2OYKA 4XD3A 1UD4A 2J24A 5D9MA 4GG9A 4PTVA 2ACRA 4UR8A 3GIPA 2Q8XA 2VR2A 2CNCA 4JKMA 3R10A 3GY1A 5I3DA 4IPPA 2DH3A 1OFDA 4F0MA 4M6UA 3UZWA 1SFSA 4MZ1A 2QUMA 3QV9A 5AYZA 3U7VA 4MY8A 4UQCA 2DT1A 4IT1A 4G1NA 4H8VA 4PSPA 3N14A 3M4HA 4Q22A 1EYWA 2RJHA 4FXJA 1JYVA 1ISZA 3JRKA 3RCMA 1G9HA 2QCLA 4HQVA 3STCA 2D2OA 3BL3A 1H7PA 3MCMA 3TFCA 1GZGA 1QW7A 1EJXC 3CHCA 1YE4A 2XM2A 2X05A 3GBDA 3VNDA 1EOKA 1S1PA 1C9WA 4OJYA 1XYZA 2REQB 5I3KA 3TN5A 4HPHA 1ZJBA 4IPJA 5E0FA 1GVOA 3VABA 1HKJA 4NNBA 3IK2A 4ACZB 6CGTA 1N8IA 3OQ8A 5EPDA 3QGVA 1LG2A 3K8KA 1X7FA 4TVUA 3FHAA 5ABEA 1FCQA 2BVWA 3UU0A 4C60A 3NYZA 2WVUA 1ML1A 4GYJA 2HZGA 3GXPA 3LBMA 2WPGA 5C55A 2Y7DA 1P0KA 2Z1WA 5CPMA 4BK9A 2CHRA 3KS6A 2Y8VA 3APYA 5CSYA 3PHAA 1A3HA 1CGUA 2J9ZA 2V2DA 4NJKA 1BYDA 4UBPC 3OQEA 1XM3A 3VVGA 5BOOA 4CGTA 2DDXA 3LV5A 2EXOA 1WDWA 3PBMA 3Q2DA 5AHNA 4PUMA 1IIGA 1M68A 4OIFA 6TIMA 1Z8AA 1H60A 3VPLA 3OJGA 1K77A 3T4WA 3CAWA 4UFHA 3WD1A 2WJFA 4NL1A 4BJHA 4DWSC 3GHSA 4DO5A 4EAMA 5DCBA 5I24A 5A6AA 1H50A 2Y2WA 1IT8A 4DZIA 2VENA 1GVYA 1EWDA 5BRQA 1C3FA 1DWIM 3BCJA 3NDYA 3PWIA 3LY0A 1L8NA 1SZGA 1IIHA 1XX1A 3IAQA 4GFIA 1GK8A 5DMNA 3PZMA 1MWOA 2ZOXA 4AXNA 2E3ZA 3VD4A 1J6OA 1LG1A 3QMRA 2PWUA 4H4IA 2DZUA 1KM3A 5A8MA 3UPMA 5A6KA 3CIXA 2DUAA 1KBLA 1EJSC 4H9XA 3EEGA 4Q8PA 1TPDA 1ZU8A 2V63A 3WO8A 2NT1A 3IEBA 5TQLA 1XKJA 4A2RA 1J5TA 2RGMA 5LIKX 3I7RA 1PYMA 3UQNA 2XJ7A 1CGYA 2E9MA 5FL0A 4NXKA 2ZFAA 3QV8A 1GJUA 2G50A 1MFUA 4Z2LA 1XINA 4HZ6A 2HVNA 2IUZA 3GKFA 3PPFA 3ITVA 3FK4A 1W1TA 3TQ0A 3VGGA 4GYFA 4M1BA 1OT2A 4FHAA 2CLMA 3VMPA 2X42A 2PWEA 4A22A 2GGHA 1WZMA 3ITLA 1JI1A 3VD5A 4DYEA 1XYAA 1IV8A 2ZE0A 3E74A 4GIAA 3U5YA 1US3A 1XIIA 2YBVA 4CQ8A 1GOMA 1OCQA 1LOSA 3TSDA 3U4FA 2R1MA 1UQZA 3WNMA 1LYXA 3G3MA 5ABHA 4KCTA 4OBRA 1PZ1A 3ZIZA 1UIPA 3MANA 4IIGA 3W3OA 1E1CB 1M9HA 1D8CA 4IICA 3Q65A 1W9UA 4LGXA 2PTZA 1JPDX 4DNMA 4Y90A 3GTXA 4ICCX 5LA1A 3MZNA 5JIWA 1ZP4A 2XSBA 3FN9A 1TTQA 4G56A 1J79A 3DFQA 1U1HA 4IMFA 1WZAA 3F5LA 1XDJA 4DAFA 3KL5A 4YTQA 4MFEA 4Q8MA 5GNZA 4GVGA 4IX0A 3H55A 2PP1A 2V5KA 3L5AA 3GB6A 1RHCA 4FNTA 4OBTA 4TIMA 4JKKA 4ZOCA 3GE7A 3A47A 2W67A 3VNLA 1TQJA 3BPWA 4D6IA 4RNFA 3HPZA 2ZUSA 3ZT6A 4NT0A 4XTIA 1N7KA 3HG5A 1TB3A 4GBUA 2OKTA 1XBVA 4L4MA 2DPEA 1LROA 3EXTA 3C0SA 1IEXA 3EMZA 2Y70A 2E9LA 4JIQA 3C6CA 2VXNA 4A8RA 4MUZA 1F6KA 1IEVA 2WNZA 1A5AA 3QY6A 1D7FA 1JUBA 4DX3A 2CYGA 4LVAA 2ABAA 2Y8KA 2WMJA 4JEJA 2E77A 1EBGA 1TX2A 3AMKA 5T9BG 2AKMA 1Q3NA 3SBFA 3G0SA 2F61A 1HL9A 2WC4A 3C8NA 2QJGA 1M65A 4QFUA 2PTXA 3WLLA 3FFSA 1U1JA 3WBAA 1I2NA 1X39A 3GDMA 2GDUA 5FJJA 2YXOA 2V8ZA 4Q4OA 4ZO6A 2PDNA 2Q01A 3G3DA 4IP4A 4GY7A 1KRCC 3A9BA 1VFFA 2WCAA 2XIMA 2PDJA 1TTPA 3L2MA 3M0MA 2XIIA 4Q32A 4KCUA 3VOHA 3E2RA 4C65A 3II1A 5KINA 1DQWA 4RNIA 1TWWA 1V0KA 5A6MA 4ZSUA 3K2GA 3ITXA 2YDQA 3ZVHB 1FP9A 5I7GA 1FBAA 1O94A 1H3GA 1UIOA 3TR2A 4N2YA 3VFCA 4QX4A 5AHMA 1L6FA 4ACYA 1S39A 3AROA 4JX4A 1TUFA 1X7IA 4HHMA 2X1TA 1W32A 1EGMA 3VU2A 2B31A 3N2MA 3T0TA 1B0IA 3KFTA 3O06A 2O9PA 1ZZMA 5M1TA 1V79A 3WH9A 3JW7A 2WSKA 2V5CA 1UD5A 3BAIA 1LL7A 3DUGA 3A4XA 3EKGA 2BMBA 1PDYA 4O0KA 3W23A 2BB0A 3PJXA 4L6DA 5DN1A 1VF8A 4JFUA 3GVGA 3GU2A 1W1YA 2JQXA 4S3KA 1PXGA 1HKMA 4L1GA 1F3WA 2WJDA 2QIIA 4KS0A 3HO8A 3V0UA 1O68A 3CL8A 3QPYA 1QW9A 4B9ZA 1OG0A 4LS1A 3W7JA 1KV8A 1TMQA 4QEEA 5GQBA 3PN8A 6XIMA 3VGFA 4IZGA 3IJ9A 4QNEA 2LLEA 4MKNA 4A3RA 4HOWA 3FDKA 4GA8A 4E0CA 4GLEA 2DZPA 1Z7AA 3CMJA 4HYVA 1JFHA 4GXMA 4QJ5B 4AQLA 4GXPA 3BLLA 2ZUTA 4LAUA 3TU9A 4O11A 4UTJA 3EOEA 1XCFA 2BX7A 4HU8A 1GKPA 2XGBA 4ICNA 3W0KA 3UNDA 1LWJA 1XLAA 3A13A 3N6QA 3URNA 3WNNA 1KA9F 4DM2A 5AHEA 4S1FA 2VURA 1WNOA 5ECVA 1B30A 3QZ6A 4LPCA 2WSQA 3O6CA 1JCMP 3WUBA 2ABBA 3E3HA 4IF2A 1JVNA 3H54A 4LH8A 1J18A 1U30A 3CUHA 3LXBA 1ENUA 5TIMA 4A6GA 4MJ2A 1B3ZA 1G4SA 1OFAA 1TZ7A 1C9DA 4QISA 3LTYA 4IFRA 1G4TA 7TIMA 2TYSA 1PIFA 3ZJ8A 4OBSA 2FYMA 4MNKA 2NVAA 1MQQA 1CNVA 3BICA 3AXHA 4M19A 3R7MA 4LUTB 3PZNA 4LAOA 1A5KC 3S2JA 1EFZA 1K8YA 2PWVA 4W9TA 5JBEA 4JN6A 4KFPA 1M1BA 1WBHA 3VIHA 3GDTA 1W9PA 2HROA 3NYDA 4D1IA 3FNDA 1U5HA 5CH9A 5FF2A 5BXPA 1KFEA 1ONWA 4DUXA 4LCSA 4EXQA 3LCWA 3HV8A 5CC7A 3RN6A 1DXFA 2R94A 1ICPA 4B3ZA 4XAPA 2YFNA 2HXTA 2A3LA 1AL8A 4YYFA 1HX0A 4HCHA 5DY3A 3S6DA 4N6FA 2ZADA 3T8QA 3RLGA 1XH2A 2A2IA 1YE6A 3N2XA 3VGEA 2A6LA 4NKCA 1PPIA 3A23A 3FYPA 2EEXA 3S1GA 4C91A 2FDMA 2ZCGA 2FZMA 2QMJA 2CLHA 4GI8A 6ALDA 3NWRA 1JPMA 4KPLA 4AIBA 2VFDA 1B54A 1Q6OA 3LERA 3D3AA 1UR8A 2IW0A 2YB4A 2YDRA 5E09A 3T2PA 3O2LA 3GFXA 4ZL1A 1P7TB 1XS2A 1VPYA 1FDYA 1R2TA 1H51A 3KTSA 4DO4A 1TWDA 2HNHA 1JCXA 3EOOA 3SW6A 1M04A 2J74A 4GVFA 3M6YA 3KOYA 2Q71A 4AY8A 5C7HA 4C1NA 2PFHA 2WM0A 1VGAA 2VWSA 2AAMA 3STPA 1ECQA 2VELA 4YN5A 4V1YA 5AHFA 5CZJA 3OGSA 1VJZA 1SO4A 4ICMA 4RDWA 2ZYFA 3C8FA 2HSAA 2Y8UA 4MHBA 2Y0FA 3DU0A 4KEUA 4KMQA 1J93A 3BAJA 3A9IA 2FMNA 1WXYA 5BOFA 3CUIA 3FVMA 5I2UA 4S3JA 1E5NA 1HZYA 1YPFA 4JQ2A 4FMVA 2EJ1A 2OYMA 2ZZ3A 3H24A 1KB3A 3FJ4A 4R9XA 2OYLA 2VC5A 4X60A 2CLOA 3USZA 4EX4A 4GQ0A 2DSWA 2I14A 3HV9A 4KESA 4Q7BA 2TRSA 5KMYA 4D6JA 2FGZA 2PRMA 3RX3A 3PC0A 5D37A 1UJPA 2YR1A 4IPNB 4P7LA 5E6YA 3OZMA 3L4WA 2L5HA 4JOMA 4M1RA 4DIAA 1QPQA 2E0PA 4M6QA 4B5XA 2OQYA 3N2BA 1HGYA 1CXEA 2BY1A 2Q6ZA 3WJXA 1JYWA 3BMVA 2WWDA 1C8XA 3OEXA 3QF0A 1Z69A 1W91A 4Q7NA 1LLZA 4AWSA 4LNCA 2OODA 4ROQA 2GVGA 1ZGDA 3B9AA 3WDHA 3SGUA 4S3CA 4YLWA 3SN0A 2P0OA 3UP8A 4UUIA 1RD6A 3REQA 3GW0A 4JTLA 1MXGA 1FXPA 3I6EA 2NVCA 3SIMA 1ISWA 4AZ6A 1EP1A 4GGHA 1GG0A 1P0DA 1U83A 2RJGA 4V1XA 3KBJA 3AZTA 2VC7A 1QVBA 2J79A 3BG9A 1NP2A 2W6RA 4ZEPA 1QPRA 3FVDA 4V15A 4TMCA 3UR5A 1JDDA 5LIUX 1W2VA 1QOXA 1RK6A 2OQLA 4EPDC 4B92A 3W73A 3AFBA 4LAKA 1XIHA 3WBXA 1F07A 2V67A 4Z1YA 3LSCA 3OVGA 3N2OA 1UOKA 3NM1A 2PGEA 4MMWA 1A5SA 5E5CA 2XN2A 1OQFA 3AYRA 3KP1A 3NO3A 3R5EA 1D9EA 4HT3A 1DBTA 5BMWA 4F4RA 4Z0JA 1A49A 5C54A 4ZMGA 4U3AA 4NIRA 4FX6M 4CNSA 1SW0A 3W1LA 5ABFA 3NQDA 4ZVJA 3W07A 4Y7EA 2X7WA 3TX9A 4LT9A 3TFXA 3MVTA 5CGTA 3MYPA 4HNNA 1D3GA 3UG3A 2NSXA 3EOSA 3M5ZA 5JUVA 3NOEA 3AS1A 5CBBA 3TXZA 4M81A 2VWTA 2E5CA 4EACA 3AAMA 4L65A 4V33A 2G8ZA 1SSDA 3WL0A 3A3HA 4RL3A 3IARA 3NZQA 3SCQA 4AC1X 1HKWA 3B05A 4LTSA 2ICSA 4RKAA 3WKZA 1PX4A 1X6LA 4TUFA 3OB8A 1W1B1 4AIEA 2HE8A 4IPIA 2EPNA 4AG0A 2VL4A 3B0YA 3CT2A 2Z1BA 5CAHA 4XAGA 1QNPA 4UOQA 4WEVX 2BHYA 2XVPA 1PKNA 2PWHA 3H2FA 1G7UA 3QKZA 1PX3A 3GR8A 1UW9A 3R43A 3VIGA 1XLLA 5AKQA 4A8LA 1Q6EA 3MHGA 2D73A 1KNWA 1PHQA 4Q7IA 4BF9A 3U57A 3H23A 5EFFA 4S39A 3UY8A 2Z26A 1REQA 4N9EA 4NZ3A 4DM1A 3SFKA 2YCKX 3WK1A 2ZKMX 3NSXA 3S5SA 3L4XA 1HGWA 5K7JA 3S46A 4HBKA 3UPWA 2V9DA 2C3ZA 3QR3A 4JTAA 1XD0A 1QNSA 4NX5A 5FJRA 2Y85A 4LB4A 4H1ZA 2FDSA 4RDZA 3F4NA 2R82A 3V18A 2YZRA 3EB4A 4G7FA 1W1IE 1J0IA 2B81A 3M0YA 1E3ZA 3EX2A 1W17A 4JEQA 1WKDA 4S3BA 4ZFCA 4AY7A 3QR0A 2C0AA 1KTNA 4GZIA 2ZE3A 1T7LA 3UERA 1AZ2A 4IUOA 3AIRA 1Z3NA 3BJSA 3FXGA 3BZJA 2QLYA 3KHJA 4O0ZA 1NFPA 1R8LA 4XD6A 2YL9A 4DF1A 4IQEA 4O52A 4TOQA 3GNNA 2INZA 3I3EA