3NYDA

Crystal structure of kemp eliminase hg-2 complexed with transition state analog 5-nitro benzotriazole
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
303
structure length
303
Chain Sequence
AAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQADFGMVWPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGISVFGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase
source organism Thermoascus aurantiacus
total genus 121
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nydA00
1OINA 4PMNA 4NF7A 3UR8A 2JFEX 3W0KA 3TP4A 2GUYA 3GXMA 4HTYA 1E6NA 4U3CA 1C93A 1KQYA 1JG9A 2D3NA 3AS2A 1BGAA 1FP9A 3ALGA 1BLIA 1LWJA 2CITA 4OBSA 1UH4A 3QGVA 2BHUA 3TTQA 1GQKA 2YL9A 3K8KA 1IV8A 5A3HA 3OGRA 4MJ2A 1OB0A 1QI0A 4MB3A 3WFZA 3U5UA 1CIUA 3MSGA 5M3WA 4EE9A 1B90A 3VDBA 4PYSA 3KEHA 1GHSA 3W29A 5CPQA 4AD1A 1OBAA 1PBGA 1DTUA 1HP4A 1AVAA 2XVLA 4W8AA 2W91A 3VDCA 3FNDA 3T2QA 2WMKA 1LQ0A 1HF6A 3RDKA 3VD4A 1JYWA 5HPCA 2VZTA 1CGXA 4UQCA 1H09A 3AIVA 1GPFA 1D2KA 1ITXA 1BSIA 1UWQA 4WSJA 1VEOA 1G5AA 3LPGA 1CGWA 2CHNA 3ZSSA 4MTVA 1RD6A 3APGA 4MADA 4J7RA 5GNZA 1BYDA 2QLYA 5FIPA 3WDJA 3UETA 1TA3B 1VAHA 1H41A 1GQLA 1D3CA 2O9RA 9CGTA 1Y7VA 4W89A 4M24A 1WPCA 2EPNA 1M03A 3CUJA 4ATLA 3ZT7A 1BYBA 3SCWA 3BMVA 1QPKA 4R27A 1P6WA 3B9EA 3A6OA 3LMYA 1CZ1A 4QLJA 1ZU8A 4H8HA 1B9ZA 1E71M 4UZSA 2GK1B 5DO8A 2OSYA 4TX8A 2E40A 1FFQA 2NSXA 4ACZB 3RCNA 2DPEA 4F66A 5BCAA 2TAAA 1VIWA 4GO8A 3A4WA 1M01A 2DT2A 3MANA 4KH2A 2JALA 1FHLA 1W1YA 5ABFB 5A6BD 2YIHA 4FLOA 4U2YA 1ECEA 3VGDA 1W3JA 1E5NA 2XGIA 1OD8A 2WVUA 2JEPA 1UG6A 2WVVB 1EOKA 4URIA 3L4VA 1JYXA 1E1FA 4UFHA 4DWSC 3LPFA 2ZUWA 1KR1A 4MB5A 2X0YA 5HDRA 5D8WA 1B3VA 2ZICA 1JFXA 3ZM8A 3WDQA 2XSAA 3MUY1 1H11A 5A6JA 1HIZA 3TTSA 2ZWYA 3T0BA 3FXYA 4QCFA 4QLKA 4A3HA 5DT5A 4ATDA 1AQHA 2D2OA 1UR2A 3AJ7A 3GYCA 2VZSA 4HOXA 4UFIA 3SCSA 1A47A 1K9EA 4HMCA 2X0HA 2XPKA 4Q7NA 4JFTA 3WUBA 4AIEA 1QBBA 1B30A 2ZX9A 3U7BA 1VFUA 1WDSA 1PAMA 3CTTA 4LYRA 2WSPA 4PRWA 3WNMA 5A1AA 3WNLA 4PMXA 1JD7A 1KCKA 5JUVA 4UTFA 3ARXA 4MDPA 4UFJA 1W9VA 4GI8A 2WZIA 5JBEA 1H0GA 2VQUA 2PBOA 3WD2A 1HL8A 2VR4A 5HBFA 4FMVA 2EPMX 1MXDA 1GOWA 3SUUA 1BG4A 3BAWA 2Q8XA 2WKGA 4PBGA 3N04A 4D6HA 1QBAA 1HVQA 4GQQA 1EH9A 2PWGA 1V3JA 3PHAA 4AW7A 3SUSA 3IJ9A 1UH2A 2DSVA 1L0PA 3G6MA 6CGTA 2C7FA 1LL6A 4E2OA 2VJXA 5DMYA 5CG0A 5A2BA 5A6KA 5IDIA 3M46A 3UEQA 1QI2A 1FP8A 3MMWA 1J0IA 1SYTA 1SMAA 3VGBA 3GXFA 3WF4A 1JYVA 1PZ2A 1H2JA 2E4TA 2YLLA 1XH2A 2WMIA 3AYRA 1C90A 4B9YA 4DWSB 3BLPX 4JIEA 1J0ZA 1W91A 2BS9A 2CCRA 4HZ6A 4M82A 1FHDA 3ARPA 1FOBA 3BAYA 1KXQA 3HU7A 4UFMA 1XH1A 3EBVA 1UKPA 3RILA 4PTMA 1WKYA 3OG2A 4Z2JA 3WUEA 2Y24A 4XX6A 3SCUA 4PUDA 2J7BA 1OCQA 2B31A 3AMLA 2DQXA 3L4YA 2IUZA 1EA9C 1GW1A 1J01A 4B3KA 5LA0A 2WNWA 1XD1A 3S2CA 3HMCA 4OJYA 2ZUNA 3KE0A 4U5KA 3BAJA 4C7DA 1GVYA 3WH8A 1E3ZA 4AMCA 3AXHA 3BCFA 2CBJA 4BQ4A 4D6DA 1XSIA 2BY2A 1JDAA 1QVBA 1V6XA 2V38A 1EDTA 4NSBA 1J9YA 2JIWA 2PWEA 1WE5A 3N15A 1PZ3A 3WQVA 1H1NA 4HA3A 4CU8A 1W1PA 1NP0A 1BVZA 1UA3A 1E0XA 4M81A 3NUKA 3NIYA 3AICA 2DH3A 3WD4A 2WHKA 3POCA 2VO5A 2AAAA 4UOJA 1DHKA 1W9DM 2Y8VA 2VRQA 4BF7A 3VM5A 1TR1A 1HXJA 3VMNA 1O7AA 1LL4A 4XUYA 2CESA 1CXKA 3PZ9A 2WMHA 4V28A 3B9AA 3WSUA 3OA5A 3WF1A 3TA9A 5M5DA 4AZCB 1E15A 2PBGA 4JHOA 2D23A 4BA0A 1G01A 2JE8A 2ZXBA 3BC9A 3DYMA 1HKIA 3GH5A 3L2MA 5A2AA 3ECQA 1E43A 1JYNA 3W26A 2J7EA 4BQ3A 1XHGA 3TONA 2WB5A 1OWQA 4HOWA 5HXMA 2VTFA 5AC4A 4WKFA 4OOZA 1K9FA 4F8XA 5A6SA 4JFUA 1VEMA 1W9PA 1C91A 1DWJM 1W1VA 4WKHA 4U2ZA 4MPKA 1EO5A 4LX4A 1CTNA 1OSEA 4IPNB 4CCDA 3WFLA 3POHA 3OZOA 5AY7A 1M7XA 3IK2A 4XV0A 4AWEA 2ZUVA 1VFOA 4HPHA 4W88A 2CETA 3DC0A 2EJ1A 3VIJA 3VNZA 2VRKA 1NOWA 1MXGA 2BNJA 5I23A 4GO9A 4NZCA 8CGTA 2XVPA 3WDHA 3IANA 4EKJA 3CZLA 1HJXA 1W32A 1UQZA 2GFTA 1MQPA 1MQRA 1CXIA 2EPOA 1UZ1A 2MANA 1GOOA 1UD5A 3QHMA 1E0WA 1JNEA 1VFMA 2CHOA 1BYCA 4M56A 1GQIA 4EANA 1E6RA 1FH7A 1HKKA 1E72M 4HZ8A 3BGAA 3VD9A 2ZIDA 2QV4A 4F79A 3AXXA 3QR3A 2UY2A 1KBKA 1A3HA 5EB8A 2UWFA 4AZ5A 3OLIA 4J3TA 3NDYA 3T0DA 1EHAA 2YBUA 2DT0A 1WZLA 2ESCA 2WW5A 4CN4A 4JFSA 3GBDA 3GTNA 3WD1A 1MW1A 2VL4A 1MQQA 4JKLA 3F5JA 3I3BA 4P8XA 3I3EA 2V3FA 1CXEA 1ZBKA 4B15A 5EBAA 1JAEA 1EQPA 2A3CA 4GPNA 5I0DA 1OGSA 2ZXAA 3VVGA 1V02A 2V3EA 4PSPA 1J0JA 3UCQA 4ML4A 1HJQA 1V6UA 2J4GA 2XVKA 3WY1A 3OIHA 4DM2A 1HJUA 4W84A 5GPRA 2XIBA 4Y7EA 4F9JA 1CWYA 2J78A 1PIGA 2J7FA 4BS0A 4PSRA 5F7UA 1ISWA 1LJYA 4D6CA 1NOFA 8A3HA 3BAXA 3FN9A 3OZPA 5ABEA 3VDAA 4PMQA 3CUGA 2X8RA 4JCMA 3WMCA 2BXYA 2ZXQA 3PZNA 3VUPA 5CJ5A 1NM9A 4K68A 1SR0A 4BCEA 4P7OA 2DGAA 2Z1SA 1V3MA 2FDMA 1XYFA 2WK2A 1JXJA 1OIFA 3VIKA 1G0CA 3N1AA 3PN8A 2CIPA 2FGLA 1MFUA 4ACYA 2O92A 1W2PA 5I77A 2J8GA 5ABGA 1CGYA 3DYOA 4Z2HA 2YOCA 1E70M 5BYWA 1V0KA 3EMCA 3ZJ7A 3F4VA 3GXIA 1JIBA 1KWKA 3ZQ9A 3N18A 3VGEA 1R8LA 4QFUA 3UESA 4MAZA 2WHMA 3CHEA 4W87A 3VD5A 4JFVA 4S3JA 1E4MM 1ZS2A 2O9PA 5GNXA 1MVYA 3L2LA 1HP5A 5FKYA 3ALFA 1MW0A 1KXTA 3SEPA 4OOUA 3NSXA 1Q6FA 4IISA 3WQ4A 4E8CA 3EMZA 4PMZA 5CLTA 4D71A 2VNCA 1DWGM 2XG9A 4P8WA 2XJ7A 1ODZA 3LPOA 2Z1KA 3MU7A 1MWOA 1MW2A 1QI5A 1WO2A 4IUGA 1KFWA 1UKTA 2VUYA 5FL1A 1BPLB 3AHXA 4XZBA 1FA2A 3WN6A 1IZKA 4HZ7A 5AC5A 2QHAA 1BAGA 3O6AA 5DT7A 3M7SA 1CLXA 4UNIA 2A3EA 1ISYA 3OGVA 1XSJA 3EDEA 2HISA 1X6NA 4EAMA 4U33A 3CBWA 2EO7A 1W9BM 2XSBA 3VX0A 2WC4A 1C8QA 1V3HA 2EBNA 4CU6A 1O6IA 1JXKA 3AMGA 2OSWA 4PTXA 4ZFMA 1BFNA 1E56A 1JGIA 2W62A 1WDPA 2DEPA 3ARQA 1QI3A 4AD0A 4X0NA 1ZL1A 3EDJA 1UUQA 3VIGA 5M03A 1HKMA 4JKMA 4H8UA 1ODUA 1JZ8A 1M04A 1Z32X 1R87A 4D1IA 3DHPA 1US3A 3PZTA 3D5HA 2BHZA 2PWDA 3GH7A 1UWUA 2VURA 5D9OA 3IJ8A 1NOUA 3RM9A 3PZOA 2PWFA 4W5UA 4H04A 1VFFA 5E9AA 3AIBA 1VEPA 3MV01 4HMDA 1JAKA 4GINA 2A3BA 1OIMA 3VMOA 3BLKA 4AZBA 4AZIA 4AYSA 2JF7A 3WF0A 5I5RA 1DWFM 1W2VA 2OYLA 4NRSA 3VGHA 1QHOA 3EDDA 1TA3A 2X1IA 1VJZA 1KR0A 2WVTA 3QHNA 3SUWA 2PWHA 3PBGA 4PN2A 3HJEA 1TVPA 3O2LA 3CHFA 1HJWA 1EQCA 2F61A 4UQBA 1CEOA 1XSKA 3MKKA 5A8NA 3UG3A 1ISXA 4IM4A 4GIAA 4CN1A 3RJYA 2ZWZA 4PMUA 3CUFA 2GK1A 1R7OA 4AC1X 4ZXOA 1LG1A 3RM8A 3HN3A 4ACZA 2VT0A 2DDXA 2WCSA 2D24A 3CLWA 2CERA 3SURA 1UWIA 1E4IA 1E9LA 1R7AA 2VR5A 1K9DA 3CMJA 4P7NA 5E09A 4MNMA 2G4FA 1OGGA 1V6WA 2ZUSA 3K8LA 1C3FA 4TOQA 1BYAA 1TG7A 5ABFA 3VNYA 3IJ7A 2YBTA 3ZIZA 1BQCA 3NYDA 2WVVA 1EDGA 3FHAA 3PZIA 2PB1A 5TD4A 1WDRA 4CD5A 1L8NA 4TVCA 1TE1A 4HU8A 4UQAA 5A6LA 2PI6A 3CZEA 3GH4A 4D1JA 3ZSTA 5E6YA 3WH5A 2WKLA 2W5FA 3AFBA 4GZJA 3ZJ6A 2GJPA 1DWHM 3G6LA 3M07A 5CXPA 3QOKA 1V0MA 3A3HA 4MNKA 1JNDA 4IPLA 4P8UA 3T2PA 2JIEA 4QP0A 5ABHA 1V6YA 3WDPP 4J3SA 5CZKA 4CUCA 1WNOA 2X2YA 1VBRA 3ARWA 4AEEA 2AMGA 2Y5EA 1C92A 4UQEA 3AISA 1NARA 2C8NA 3WMBA 2G41A 1JZ4A 2YL5A 3LPPA 5DF0A 3VOCA 2DIEA 3GBEA 1V3LA 1PX3A 4OZOA 2YL6A 4HU0A 2WLYA 3JUGA 2FH8A 5DFAA 1FH8A 5CSUA 3BAKA 3RPMA 4FLRA 2DT3A 3EDFA 1C8YA 4J3VA 5E0CA 1UD6A 3CO4A 3SCVA 2G3JA 3W6MA 3WUGA 1KB3A 1XCXA 3MUZ1 4AZGA 3L4XA 3AXIA 5LYRA 1GOIA 1E5JA 1HJSA 1YQ2A 3AIEA 2J74A 2VQTA 1SFSA 4PUEA 2WZHA 3CUIA 1B1YA 3W38A 2WMFA 1B3YA 5C8BB 3VIIA 1BGGA 2WWDA 1UQYA 4X9YA 2ZX5A 2F8QA 1JZ7A 3VX1A 4Z2GA 3WELA 1XGZA 1I1WA 3AQUA 1W9XA 1MW3A 4UOZA 1GONA 3ARZA 1KGWA 5JIWA 4OKDA 3WENA 4W7WA 2DSKA 4DWSA 3W81A 3GZAA 3W6LA 4P7QA 3FAXA 1UR1A 2X09A 3ZMRA 4ZE5A 1HJVA 4LQ1A 3KL5A 2J7HA 1CPUA 3IAPA 1BVNP 3UERA 1CENA 3SCPA 2X05A 1NWRA 5DEZA 4AD3A 3VGGA 3W27A 2J7GA 1E4NA 2A3AA 2NW0A 2VI0A 4S3KA 2W61A 3BSGA 3L4TA 3EMQA 5JBDA 1HKJA 1SMDA 2E8ZA 5I6SA 2IXVA 3N17A 5IHSA 1KXVA 3WD0A 2QF8A 5CPTA 2GJXB 4JAWA 3PZUA 3AOFA 2E9BA 3WH9A 2E0PA 4GXPA 2VRJA 1J11A 3WBEA 2D1ZA 1E4LA 4Z2IA 5BROA 1MFVA 5GQBA 3VILA 5FL0A 2AOSA 4UCFA 3NCOA 1ZJAA 2YL8A 5EFFA 3L4UA 4CCCA 4UOQA 4GI9A 2ZUTA 3W25A 4WF7A 2RGLA 2VX6A 3U5YA 3BCDA 1J12A 3TOPA 1WZAA 1RP9A 1ESWA 5A6AA 3PTMA 3OBAA 3NDZA 2YA2A 3O9NA 1OT1A 3VIOA 1KCLA 2XUCA 1V03A 2DT1A 4AIUA 2J7DA 1KXHA 4GKLA 5EFDA 3GNPA 4ZE4A 4JFWA 3QOMA 1J10A 2CEQA 1R86A 3EDKA 1B31A 2E3ZA 4C7FA 1EOMA 1UKSA 3VO0A 4JHZA 5A69A 2VVNA 5GNYA 1V3IA 1NWSA 4MB1A 1X1NA 2G8ZA 4EK7A 3NSNA 1CXFA 3PZQA 4L4OA 3BH4A 2W92A 3ARSA 1V6VA 2ZX8A 4W86A 4KRUA 1WP6A 3AHTA 4AZCA 3VPLA 1W3HA 4W7VA 2E9LA 3OB8A 1M53A 2O9OA 1E6QM 4UQ9A 3AHZA 3WQ6A 2WHLA 4MAVA 1AQ0A 3AS1A 4PMRA 2JEQA 3WKZA 2J7CA 2BY1A 1V02E 2VVSA 4PCTA 1JZ3A 1W1TA 1J0YA 2G3MA 2ZUUA 4LPCA 1GOQA 4FF5A 1LF1A 4CU7A 5FCZA 2WAGA 5A95A 1WB0A 3ZOAA 2GJRA 5BRPA 1TFVA 3KWXA 4OIFA 5D8ZA 2BVDA 3ZJKA 5ECUA 4JKKA 3AS3A 1XCWA 1E55A 2RGMA 2WMGA 4HMEA 1QW9A 2VX4A 1UR9A 4XB3A 5HOSA 1B3XA 3PZGA 5JIPA 5I2UA 4WK9A 5BXRA 1QW8A 2WCGA 4TTUA 3CUHA 3D3AA 4H2CA 4D6GA 4P7RA 1CECA 2WBKA 4BQ2A 1NWUA 5LA1A 4UFLA 1KWGA 2D20A 3U7VA 2BY3A 3TTOA 1B3ZA 4H41A 4A3YA 3AS0A 4DUVA 3W4RA 3T08A 2D0HA 1U33A 1UR8A 5A6MA 1ZBWA 3BMWA 3MMDA 4AZ7A 3OLGA 2J75A 2UY4A 2W67A 3N9KA 3SCNA 4LYPA 1JF5A 2GDVA 5EMYA 3WD3A 1I1XA 2ZUMA 3PTQA 4CD6A 1BHGA 2C0HA 1F4HA 2XWDA 3OLEA 3IAQA 3GNOA 5A8OA 1DP0A 5I24A 4CD4A 2UY3A 1H0IA 2W63A 3THCA 5IXEA 4RE2A 1JI2A 3CZ8A 5CGMA 4B9ZA 1V0NA 2UY5A 1AMYA 1C8XA 3DYPA 2WC7A 4QDMA 4LXFA 2YDRA 1JI1A 1UR4A 1UWRA 1JDCA 2FHCA 1LWHA 5A2CA 1U30A 1JZ5A 1JL8A 3WEOA 3AI0A 4HOZA 1CGVA 4KMQA 2QPSA 4CN6A 4Z2KA 3ARRA 1JF6A 1B2YA 4Z2LA 1N82A 4D6IA 2XVNA 3S6TA 5AYBA 2DIJA 1BF2A 1EO7A 1E0VA 4R5EA 1B0IA 2XHYA 4W8BA 1W3LA 4ATWA 4CKQA 3KZSA 3VD7A 7A3HA 2V3GA 1R85A 1GJUA 2FH6A 1XYZA 4F9DA 1WZKA 4RL3A 5I78A 5I79A 4U3AA 5D9MA 1GORA 4TX6A 1H4PA 4AD5A 1H49A 3ARVA 4PTVA 4HA1A 3DECA 1FFRA 2CPUA 2OWWA 3WDRA 4TTGA 1QNRA 4UZUA 3THDA 4W8LA 4OUEA 2VZOA 1LL7A 3CGTA 3CPUA 1EGZA 2G3IA 1UD3A 4E4PA 3WF2A 3W37A 4DM1A 7CGTA 2CKRA 4WIWA 1PPIA 2JF6A 4TXEA 3OGSA 1RP8A 3AMDA 1J0HA 2XM1A 3W82A 3MS8A 2QMKA 5E6ZA 2YJQA 3WQWA 5CSYA 3NJ3A 1IZJA 4J3XA 4WJXA 1E6ZA 1E40A 4E8DA 3W24A 1RH9A 1JZ6A 4LYQA 3K1DA 2VX7A 3WF3A 4QLLA 1VENA 1GJWA 1KGUA 2VX5A 1QHZA 1CXLA 1CYGA 4GZEA 4ZENA 1CLVA 5BXSA 1TVNA 1GQJA 2EEXA 3VMPA 2V5CA 2V3DA 3GNRA 2BHYA 2J62A 3A4XA 2OWCA 3SCOA 1E6SM 1JFHA 4UQDA 1QNSA 2V5DA 4YN5A 2OSXA 5IHRA 2WZEA 2YLAA 2VCBA 3WUFA 4DWSD 5BRQA 2CXGA 4YHEA 2WHJA 1JZ2A 4A4AA 1DWAM 3VIFA 1IT0A 4KGJA 4H7VA 3VGFA 4W85A 2EQDA 1QHPA 1ISZA 1E1EA 2GVYA 2BXZA 2PF0A 2GSJA 3VM7A 2CNCA 3WQ5A 4TVDA 2WPGA 2Y4SA 1ZBVA 1VBUA 3A4AA 2YA1A 3K8MA 4J27A 1E6PA 1NH6A 1K6AA 2ZE0A 4AIOA 3MUIA 3W53A 2DSZA 1PJ9A 2FGZA 3MSDA 1XC6A 1GOMA 3CIVA 1GUVA 3ZT5A 4CVUA 3AMCA 1V08A 2YDQA 2XWEA 3TTYA 5CLWA 1CDGA 3VKKA 1UZ4A 1XH0A 3FHQA 1JD9A 5BXPA 5A8PA 3T0AA 1H3GA 4OBRA 3ZR6A 1WZMA 3UR7A 4MB4A 1EHNA 1U2YA 4CGTA 1G1YA 1HNYA 4YHGA 5C70A 3CHCA 3WQ8A 1OD0A 4AXNA 3AHYA 2WMIB 4WLCA 2XFRA 4UR9A 4D6EA 2VCCA 3K4DA 2XGBA 3WNOA 4JL1A 2XTKA 1XV8A 4JZ5A 1BG9A 5A94A 5KZ6A 1NQ6A 1E6XM 2VC9A 4V2XA 4LGXA 1CGUA 3RM4A 3OLDA 1GZJA 3AZRA 4JCLA 3WMSA 1OT2A 4GQRA 3ZJ8A 1UKQA 1HX0A 5CQ1A 2Y2WA 3N12A 6TAAA 2WANA 5HNNA 1W9UA 1Q4NX 1WCGA 2WSKA 3AIRA 1GNXA 1QNQA 1CGTA 4P8VA 4RE3A 3K4AA 3WNKA 1CXHA 2NT0A 1QOXA 4GZIA 4D72A 3VDHA 3AMKA 5D9PA 3SCTA 2DSUA 4MNLA 7TAAA 3KL3A 1J18A 3AIUA 2CBIA 3KL0A 1UKOA 2WBGA 4V27A 1C7TA 5E0FA 1UWSA 3EYPA 1FH9A 3WNPA 4HPGA 2CBUA 3WNNA 4TVUA 1KQZA 2J79A 2Y8KA 2ZX6A 3RIKA 2WLZA 5M17A 3SCRA 2OYKA 4KRTA 4PMDA 2W66A 3AZSA 2W4XA 4RE4A 1PX4A 1V3KA 1VRXA 2WYSA 2D0FA 3AROA 3WL1A 1GVIA 4AY1A 4WSKA 1YHTA 1X6LA 1G94A 3E1F1 3CZJA 3W28A 3CZKA 2XFYA 3SUTA 3AYSA 2WC3A 2YKKA 3VIMA 2GDUA 4Q22A 1W3KA 5IFTA 4FLQA 5A6BA 1ISVA 1J0KA 4PTWA 2XFFA 1OM0A 4YPJA 4GI6A 5A8MA 1KBBA 2DH2A 3SIMA 1CBGA 3CMGA 2O9TA 4C7GA 5E70A 5JBFA 5LA2A 2WM0A 1E3XA 1QNPA 5FD0A 3PTKA 3I3DA 3L4WA 3FW6A 3VTRA 1XD0A 1HVXA 1UA7A 4KGLA 4FK9A 1NP2A 3N13A 2QMJA 5C71A 4HP5A 3ZT6A 2WCAA 5IFPA 2F2HA 3VINA 3BAIA 4MJ4A 1RPKA 4M29A 3DHUA 1DEDA 1AQMA 2WVSA 3A47A 4CCEA 3T09A 4M8UA 2J47A 4MDOA 4BZYA 3VU2A 5HPOA 1VF8A 1UD2A 3RJXA 4P7LA 4D6JA 4BQ5A 1S46A 2CKSA 2DSWA 3SCQA 3WIJA 2XM2A 3U57A 1GCYA 2OLHA 5FOOA 1VJSA 3B9DA 1EDQA 2GJXA 4ZEPA 2XYLA 4PMVA 3WL0A 3WBAA 4QAWA 1TZ7A 1VB9A 2CBVA 3GM8A 2EPKX 1TMQA 1PIFA 4J28A 1TCMA 1NWTA 2PC8A 4H8VA 2VMFA 4J3WA 4KWUA 1OGBA 2IXUA 2D22A 2D3LA 1F4AA 1DWIM 3WH7A 1PX8A 1CNVA 3WEMA 4XZWA 1Q6GA 2VZVA 1GOKA 1LG2A 3L4ZA 4J3UA 3RO8A 4W7UA 1Q6CA 5CGTA 4AD2A 3ARYA 3N11A 4U5IA 3AZTA 4CD7A 1PEZA 1UD4A 1XRVA 4D6FA 2BV9A 3BSHA 4X0VA 5D9NA 3MO4A 1C7SA 2A3HA 4L4PA 4PMOA 2BFGA 4AD4A 1ITCA 2G3NA 3WH6A 5I3DA 1H5VA 1UD8A 1UHVA 3CH9A 3WDIA 2YDSA 1MYRA 1Q6EA 4MNJA 3BXWA 3J7HA 3VIHA 1HT6A 4AEFA 3ARTA 3NSMA 1V0LA 3PZVA 4AZ6A 1UH3A 1KGXA 3M6DA 2XIIA 2EXOA 1UR0A 2FHBA 5BWFA 1WDQA 3MUAA 1HL9A 5KEZA 2CYGA 3II1A 1US2A 3AHVA 2VZUA 3F5KA 4NI3A 2QPUA 3RMEA 1G9HA 4JL2A 4NRRA 2BVYA 2VOTA 3K46A 2NT1A 4UFKA 5BXTA 3CHDA 4PEEA 3T2OA 6A3HA 2ZXDA 1QNOA 3UG5A 3MV11 4PCSA 1UOKA 1WAWA 1E73M 4B3LA 4DUXA 3SUVA 2FHFA 2OYMA 1K9TA 4FLSA 1ZBCA 3UG4A 2E9MA 1LLOA 4HA4A 4QCEA 1D7FA 4AZHA 2BVTA 1UWTA 1EXPA 4CVWA 2EPLX 3ARUA 2J77A 3ZO9A 3F5LA 2YA0A 2WWCA 2WMJA 3VD3A 3GXDA 3FY1A 3VIPA 2HVMA 3B8SA 4M80A 2J8FA 5A8QA 4CD8A 5D4YA 4W93A 4DUWA 3QHOA 3ZR5A 2OWXA 2ZOXA 5AYIA 2XVGA 3AIQA 2WXDM 4B16A 1Q6DA 1QI4A 2BY0A 4M1RA 1ZB5A 4WKAA 4N42A 3CZGA 4PMYA 2ZX7A 2VCAA 2J25A 1I75A 3PZMA 2E8YA 3FAWA 1JDDA 1EIBA 1UYQA 4N0RA 3WEZA 2D0GA 4W5ZA 3GDBA 3AIWA 5CPSA 1GHRA 1HN1A 4AISA 1BTCA 1ZJBA 4ZXLA 1TUXA 4U31A 3MMUA 1B3WA 4TUFA
chains in the Genus database with same CATH superfamily
1OINA 4NXKA 4O15A 1HZYA 3TP4A 1C93A 1KQYA 4WY0F 2PDQA 4MKSA 3V75A 1JG9A 5D32A 5TAOA 4PFMA 3LV5A 1UH4A 5CKSA 4NJGA 3BZGA 3QV8A 4REQA 3U2CA 5C9ZA 3OU8A 5H2ZA 4Q4QA 1CIUA 2PA6A 1YTEA 3M5VA 1VFHA 1I0BA 1GHSA 3TN4A 3GNDA 1DTUA 3OZMA 1TJPA 2XVLA 4MVAA 3FNDA 2WMKA 1LQ0A 4UNKA 1VHCA 4LVGA 4MYAA 1JYWA 5HPCA 4V33A 1D2KA 1UWQA 3GFYA 2OXNA 1CW2A 4IT1A 1KFEA 1VEOA 4DO4A 1E9IA 2YB1A 2CHNA 5GJMA 3APGA 4J7RA 1OX5A 1ZP3A 2QLYA 3WDJA 1TA3B 1H41A 5DMMA 3WLOA 1F61A 1ZAJA 4XKYA 2DQWA 3BE7A 1O12A 3B9EA 5A6TC 1X39A 1E51A 1E71M 3B4YA 1XS2A 2OSYA 3SGGA 1BEUA 3M5XA 2VGIA 2DPEA 1LROA 4RNIA 3A23A 2A21A 1VIWA 4GO8A 3ICJA 1M01A 3K1GA 4WY0B 3SRKA 1P5BA 1P7TA 1W1YA 3FKKA 2XGIA 2OKTA 3UWWA 1UR3M 4I7UA 3PBWA 5E93A 3W7IA 2VYOA 4MZ1A 1KR1A 1K8CA 2E77A 3GD6A 4HYRA 1FDJA 1O60A 3TW6A 4IICA 4LUTB 2AQWA 3HG3A 1HKVA 5A6JA 2ZWYA 3EB2A 1JEZA 4YTSA 2D2OA 1OX4A 2PU0A 2VR2A 4ZOCA 4S3GA 2X0HA 4ENLA 4B5WA 4JFTA 4GQGA 1FWHC 4DJEC 3H2FA 1B30A 1F5ZA 2QULA 4NJHA 1VFUA 4BJHA 1PAMA 3Q58A 4LYRA 2WSPA 5KSWA 1JD7A 3PNUA 1KCKA 4UTFA 2A4AA 2H3DA 1BXCA 4INFA 4JDYA 1W9VA 1PIIA 4Q8PA 1HG3A 4J4KA 2WZIA 3OBKA 2WJEA 4YYFA 4NQ1A 2EPMX 1TV4A 4JX5A 1YLVA 1MZHA 1BG4A 2P5NA 3BAWA 4JXCA 3N04A 4D6HA 2ATSA 4GQQA 3EWBX 2PWGA 1SVDA 2A5HA 3PY2A 3BLLA 2DSVA 4LSBA 3ES8A 1L0PA 3G6MA 5G5IA 4H19A 4GC4A 2C7FA 4E2OA 5CCZA 5IDIA 3M46A 3UEQA 2GSEA 1J0IA 1SYTA 1IWBA 3WJZA 4UTWA 2V2CA 3R8RA 2YSWA 3EOLA 4FF7A 3RX3A 3W1RA 1AL7A 4NAFA 5G1YA 3ME3A 5G2WA 4EWND 1VR6A 1W91A 2BS9A 1FOBA 2WNZA 1KXQA 3V0SA 1YRRA 4EXQA 1XH1A 1UASA 2GQ3A 3RILA 4PTMA 5CPOA 1W56A 3R4IA 3GXNA 3OG2A 5G4HC 3VA8A 2ZTKA 3XINA 1IWAA 1A5NC 2J7BA 1POKA 3AMLA 3QY7A 3UXDA 1EA9C 4IFKB 1J01A 3IVSA 4S39A 4ZQPA 2OT0A 5ENLA 2WNWA 3P80A 4IMGA 1XD1A 2I9EA 3TN3A 4GY1A 3BAJA 1R3TA 3N19B 5F4XA 4GLEA 3HPZA 5HK4A 4EXBA 2Z2BA 4QJ3B 3WH8A 4RCXA 2AQVA 3BCFA 2ZZ1A 2BY2A 2FLIA 2V38A 1J9YA 2PZNA 2WQDA 2GGEA 2PTXA 1V8EA 4C6KA 1H1NA 3QSTA 2FPTA 3NGFA 1NP0A 1UA3A 4NJJA 4XZLX 4UTJA 1E0XA 3MI2A 1QO2A 4C90A 3WD4A 4PFHA 4DBSA 4RV8A 4XZ9A 2PDBA 4GISA 2NX3A 2QYGA 3CL8A 3DG6A 4BF7A 2EF9A 2BDQA 1W1IE 2XSXA 3UJRA 3VMNA 2NUYA 4LRTA 1CXKA 4JEJA 4V28A 3OA5A 3TA9A 5M5DA 4QR6A 2OQHA 2D23A 1WUFA 3U4FA 4BA0A 4ML9A 3N2XA 1O1ZA 3L2MA 1EC8A 5A2AA 2E6DA 3ECQA 1E43A 4BQ3A 3TONA 2L5HA 3URAA 3HO8A 1EA0A 3TSMA 5D37A 5DMNA 1I4NA 4JFUA 5KMYA 1FWSA 2QF7A 4BK9A 4U2ZA 4LX4A 3KS5A 3WFLA 1W1B1 3L65A 1F07A 2ONEA 2ZUVA 1M9HA 2HK0A 3UZJA 1W5PA 4C6MA 3GRIA 3LNMA 2ACQA 1RBOB 1OEPA 2V8ZA 2BNJA 3W3OA 3TWAA 2XVPA 2XIQA 3NQVA 1W32A 4OHQA 3C2VA 1LRNA 4H7CA 2EG8A 3S4TA 2ZRVA 3UY7A 1UD5A 3QHMA 3WLKX 4ASTA 5BW6A 1AODA 1BYCA 4EANA 3DG3A 1XLHA 3COTA 2NLIA 1T0OA 3OQEA 4Z0SA 3P7YA 5EB8A 1E0TA 4LNYA 4K38A 3NDYA 4WGXA 1VQTA 3G24A 3V5FA 1WZLA 4CN4A 3OO2A 4NY2A 3GBDA 3GTNA 3WD1A 1MW1A 2VL4A 3QV9A 3CS2A 1KFBA 4S3EA 3GKAA 3F5JA 4Q8NA 3JW7A 5HJYA 5I3IA 1VHNA 5AC8A 5EBAA 2BODX 3HGRA 4GPNA 1V02A 1BKHA 4PSPA 4ML4A 4HJWA 2J4GA 1X1OA 3WY1A 4UXDA 4DM2A 1TIMA 1HJUA 1REQB 3C52A 3MUCA 1CWYA 1S38A 3KCOA 3PJUA 5LIYX 4D6CA 9XIMA 8A3HA 3UXKA 1SFLA 4A8IA 3CUGA 3GLCA 4FX7A 3U2ZA 1FKWA 5CJ5A 4JNYA 4M5PA 1KO0A 1SR0A 2E7FA 1V3MA 1YTDA 1Z6KA 1EIXA 1G0CA 3GAYA 5T9BG 1X98A 1XRTA 2FGLA 2O92A 3URQA 3W01A 3W73A 1KBIA 4MWAA 4Z2HA 2YOCA 2HPMA 5BYWA 1TWWA 3EMCA 3ZJ7A 4GYPC 5TBOA 1AD4A 2YXOA 4LS0A 1X97A 4Q4OA 3UFYA 3ZQ9A 3N18A 4LEQA 5HWMA 2WHMA 3TC3A 1S5WA 1T96A 3NGJA 2Y1HA 2DZUA 1E4MM 1JUEA 3WK0A 1VGAA 2ATMA 3W7RA 1VPXA 5AVNA 3NO1A 1KA9F 4ONVA 4X2RA 3ALFA 1MW0A 3A5VA 1LRTA 4LB3A 1P1MA 4TO8A 2VP8A 4IISA 4LCSA 4PMZA 2VC7A 5AZ1A 1LOSA 1U22A 1DWGM 2XG9A 3OJGA 4HT3A 4P2VA 4YMZA 2Z1KA 3MU7A 2JQXA 3RGTA 3V1PA 5FL1A 3L5MA 4Y9MA 3S9IA 3SR7A 4NZJA 3URNA 4QEEA 2FZNA 1EZ2A 3L5AA 4KKXA 2A7NA 1KW1A 2A3EA 1ISYA 3XIMA 1XSJA 4C1KA 4EAMA 3QQ0A 4U33A 2EO7A 1LQ2A 2XSBA 4I6VA 1KM5A 3GNXA 4KWWA 4GBDA 2WJZA 1JXKA 4PTXA 1BFNA 1AFSA 3CL7A 5EYWA 1VPYA 4MG4A 5DXXA 4NL1A 5M03A 1HKMA 3BG9A 2PP0A 1NDYA 1Q85A 2VD8A 4PUUA 1ADSA 4LC8A 1R87A 3SECA 1US3A 1TIWA 4D8AA 4GIYA 4U10A 3B8TA 3W7OA 4H6QA 1FWCC 2VURA 4Y8FA 5D9OA 3KRBA 3LNPA 1GEQA 1Q4WA 5HQMA 4DAIA 3PZOA 1KFJA 3MHGA 1P6BA 1VFFA 5E9AA 3AIBA 3EKLA 2NWSA 3L9CA 4O17A 4AF0A 2H90A 3VMOA 3WLIA 2QJNA 2GQ9A 2OYLA 2B4GA 1IXNA 3BG5A 2WVTA 3OQ8A 2PWHA 3AYVA 1J8VA 4DAFA 2XN1A 3CHFA 1EQCA 3WLLA 1B4EA 3ZZ1A 1ISXA 3WLTA 4GIAA 1ZRQA 1MEIA 3RJYA 4ORMA 3SI9A 5TNVA 5G1TA 3R7MA 4HZMA 2GK1A 4MJMA 3ZVHA 1OZQA 4LFYA 1RK5A 2QCLA 4ACZA 2WCSA 3O15A 5C5YA 1E9LA 4L65A 1HQTA 2VR5A 3CMJA 1EP1A 1TV2A 4P7NA 1ME9A 1L6YA 1V6WA 2CZDA 4GABA 4IJCA 1RALA 1PL9A 1NSJA 4TOQA 3VNYA 3IJ7A 1EJSC 2XGZA 4LW7A 4A29A 2C3ZA 2WVVA 3WK3A 3FYYA 5TD4A 3VKJA 4KFOA 4RDYA 5DCDA 3RLGA 4HU8A 3NL6A 1POJA 4F0RA 3M1ZA 4MFDA 3ZSTA 1YE4A 2BSLA 3QPZA 3TZNA 2AL2B 3AFBA 2DP3A 2AGKA 1R6WA 3DBPA 3MA8A 5FESA 1DWHM 1F3WA 2I7GA 4MNKA 2YYTA 2PCEA 4CQDA 4QXIA 2HSAA 3AC0A 4A8LA 2X16A 3WDPP 4JTQA 4HK5A 3LHZA 1WNOA 1VBRA 2QW5A 2E28A 3AISA 3EEZA 3WMBA 1ICQA 4DJFD 3S8HA 1RCQA 2DIEA 3VZXA 3HGSA 3QMSA 1OCBA 1PX3A 4OZOA 5D2VA 1TVLA 3RPMA 1K4GA 4HCHA 1GOXA 3CAVA 3G8RA 1AMKA 1PS9A 3SCVA 1I60A 3LK6A 3C61A 3UF9A 1QRQA 1KB3A 4Z1AA 2OZTA 2C1HA 5AHNA 1HJSA 1XP3A 1NDZA 1SFSA 4PUEA 3TXZA 1GPWA 1B1YA 1YXYA 3KBSA 3MPGA 3F03K 3W38A 1B3YA 5LGXA 3KRSA 2ZX5A 2PP3A 1JZ7A 3S1UA 3IUIA 1A0EA 5JH1A 3NQAA 1W9XA 4HHLA 4X61A 3HJZA 3IWPA 3MP5A 3CYJA 4GVIA 3A9BA 3ARZA 4OKDA 3WENA 2W79A 1MRQA 1GT8A 1F73A 4L7ZA 5TF0A 2X09A 1IXPA 1GTEA 4CQBA 1HJVA 1R3RA 2J7HA 1XYLA 3VC5A 3GSMA 2X7VA 1O5RA 3V4BA 1M41A 3U2EA 3UERA 4YVVA 4NYUA 1NWRA 4NJKA 3VABA 5AYYA 4EPDC 2VI0A 4B91A 5JBDA 1HKJA 1JGMA 5I6SA 5IHSA 4L9YA 1ZPTA 3SRHA 1GEHA 4JIIX 1JCTA 3WH9A 2E0PA 1DBTA 4M19A 4Z2IA 5BROA 4NZ4A 1NELA 4GA8A 4MY9A 4GNVA 1DIOA 4Z1CA 4GI9A 5CEWA 3U5YA 2G5WA 1SSGA 2JK2A 2VFFA 3BCDA 3W83A 1J12A 5A6AA 3PTMA 5G4EA 3VIOA 4DF0A 1KCLA 4GKLA 1ML1A 1XIIA 2G96A 4JFWA 2VDIA 2W6RA 3SY8A 4ZQOA 1A5MC 4JIHA 1J10A 1DE5A 3EDKA 1B31A 3QM3A 4UMAA 3THQA 4GD0A 4IGMA 4AXKA 2VVNA 1V3IA 4MB1A 1X1NA 3GU1A 1VFLA 3BH4A 3H4GA 4H9UA 1QCWA 2Y63A 3BK0A 4DY1A 1QK2A 2HQAA 4Q8WA 2DW7A 4XKMA 2Z1XA 3EWUA 2X2GA 4AZCA 2WSRA 3P0WA 4W7VA 3ENLA 4QG6A 3OB8A 4UQ9A 2PDWA 3D3FA 3P67A 1E9ZB 4MAVA 5FEPA 1FWWA 3AS1A 3VNLA 4S3DA 4LPCA 3FGCB 3SZ8A 1GOQA 2O7SA 3F4NA 5FCZA 5A95A 5C9WA 3FKRA 1M6JA 1RUSA 2GGHA 5TIMA 3QY6A 3EX4A 3W7JA 3ABXA 3CB8A 1VCVA 4OIFA 2BVDA 3KP1A 3F2DA 3DFPA 2VHLA 3TV8A 1G7UA 4B2DA 1OFAA 3VNKA 3DAQA 5HOSA 3W87A 3DCPA 1Y5WA 3D3AA 4D6GA 3DBNA 4QJ1A 2QVHA 2WBKA 4NIRA 5K4ZA 1RXOB 2ZC8A 2R6OA 4JHMA 3TJ4A 4RZ6A 4Q4SA 1HFBA 3QC0A 1VYPX 3A4JA 3R25A 4A3YA 1TPH1 4WX2A 3WLPA 3R12A 3T4WA 5CZ0A 2Q71A 3T08A 2D0HA 2ZA2A 1QXLA 1JRBA 5A6MA 1H60A 1R3VA 3GWQA 3IIZA 5K7JA 5KZEA 1BD0A 3FJ6A 1H1ZA 3SSJA 4AZ7A 2UY4A 2VOMA 3TCSA 1SJDA 5EMYA 4X2PA 4FNSA 2ZUMA 2PGRA 3PTQA 4AVOA 4CD6A 2C0HA 1RY0A 3MSYA 1DP0A 5I3KA 2UY3A 5HULA 4JTJA 2R8WA 4RE2A 1JI2A 1KTCA 5CGMA 2X41A 2WC7A 1NFBA 2QGHA 2VEPA 1OC5A 4GFSA 3INPA 2V9DA 4FP1A 1AZ1A 4PCPA 2XISA 3U4AA 1UZDA 4LCQA 1M7OA 2PLJA 2J27A 3W1MA 2QPSA 4ICCX 4Z2KA 1JF6A 1B2YA 3D6NA 2OEJA 4O4WA 4YL2A 2DIJA 2ZDRA 1EO7A 1DQXA 4ATWA 3GR4A 3KFTA 3SY1A 1W54A 2OO0A 4K37A 3UU0A 1A5SA 5I79A 3N34A 4IGSA 4PRTA 3ARVA 4HA1A 5J5DA 2ZTJA 2XDFA 3E0WA 5LXXA 4S2CA 4QG8A 3LCIA 2B7QA 1DQWA 4GMEA 3CPUA 3B0YA 4UTUA 1EGZA 1UD3A 4PH6A 1SUXA 3W37A 4CLMA 7CGTA 3BLFA 4TXEA 1H7WA 1IGWA 3W1QA 4E6MA 4C6FA 3MCOA 3I6TA 4ZO8A 4LWWA 5CZJA 3QLLA 5FEXA 1Q6LA 3KUMA 2H3BA 2QS8A 1L6WA 3PWIA 2CZEA 3MY9A 3Q65A 3S83A 4RPQA 1VENA 4I7VA 1R47A 1JQXA 4ZOBA 1GWJA 1XBZA 4GI4A 4JBRA 2PRMA 2Y7EA 2VX5A 4Q6XA 4KCTA 4CEUC 4GGHA 4ZENA 4G7FA 1A3XA 1TVNA 1GQJA 3O6DA 2RJHA 4HK7A 3UJSA 2V3DA 3CHVA 3W2LA 3WQEA 2BHYA 4ZODA 3H2NA 2EJAA 1SFTA 3SCOA 1E6SM 4UQDA 4HBKA 1QNSA 1G4SA 1YYAA 4YN5A 2OSXA 4IJRA 4O12A 3EOUA 3H55A 2CXGA 2REQB 2WHJA 4G9PA 4UNLA 1Q2SA 3E5PA 5I03A 1JZ2A 5EMUA 2EG6A 2X40A 1XLIA 3VGFA 2G50A 4W85A 3QPYA 2EQDA 3MVIA 2VEIA 4DBWA 2GSJA 2AMXA 4O1AA 1T8XA 3K4WA 4FR1A 3RG6A 3OVPA 1VBUA 2QPXA 3A4AA 2ZZ7A 4J27A 1M7JA 4O4VA 1ICPA 3MUIA 4N7QA 1I8JA 1RD5A 3MSDA 3G1VA 1EPXA 3LTPA 1GUVA 5BMXA 1SM9A 2DZAA 4BWLC 4ZSUA 4JQ1A 1CDGA 3CXOA 3PBMA 3TYEA 3FHQA 1JD9A 2FIQA 4IL2A 5KETA 2VEFA 3IV8A 5BOFA 2R1NA 2I56A 1A3WA 3CV1A 1HNYA 4UMBA 3CHCA 1MDLA 3LMZA 3TMQA 2WJDA 2VCCA 1ZUAX 3WNOA 4QTGA 3LRKA 4JEQA 4H83A 3GTFA 4TV5A 5A94A 3PJWA 1XLJA 3KM8A 2VC9A 1XYCA 2V68A 1CGUA 4BI5A 3LHTA 3OLDA 2Z2AA 1GZJA 4B5TA 3AZRA 3WMSA 4J9JA 3R58A 3E0FA 1A0DA 2WANA 1WCGA 4JQ4A 1VBHA 3EB3A 3L0NA 1QNQA 3S1GA 4RE3A 3K4AA 3VUSA 2H9AB 1CXHA 1HTIA 1XWYA 4D72A 2PLCA 4F0KA 3C3UA 3SCTA 3P62A 3C2EA 3LXCA 3KL3A 1J18A 3S6DA 4Z17A 4TMCA 2CBIA 1PE1A 1UKOA 4V27A 3ANYA 3EYPA 2EKCA 1P1XA 4N02A 4Q3MA 1IR1A 4B90A 3UQNA 3RIKA 3SCRA 2OYKA 4KRTA 4RZBA 4DWDA 4KEMA 3AROA 3BJSA 4YIWA 5C54A 1GVIA 4AY1A 4WSKA 1YHTA 3NVTA 1G94A 2OELA 3G1FA 3RU8X 4IXHA 3QTPA 3C4UA 2YKKA 3VIMA 3NQEA 2HS6A 1W3KA 5ECVA 3IJ6A 1J0KA 4PTWA 1TTPA 1M3UA 4YPJA 4NILA 2NVCA 3S3GA 1CBGA 4RR4A 4IFKA 4F0SA 1E3XA 1QNPA 1YDNA 4IXXA 2DJLA 3VTRA 2FMNA 1N8IA 3PF3A 3SBFA 1P0BA 1MNSA 1S2VA 4HP5A 3ZT6A 3GIPA 4S23A 2WCAA 5IFPA 3VINA 1RPKA 1DEDA 1AQMA 2WVSA 1CLKA 3A47A 4CCEA 3T09A 2E5CA 2WNQA 2EG7A 2I5GA 4HNUA 3TYAA 2X30A 4PMJA 3RHGA 4ZQCA 4GH3A 3VNMA 4H1ZA 1S46A 3KXQA 2CKSA 3WIJA 2XM2A 1FWRA 3FA5A 4GUHA 5F4WA 4HNOA 4Y9OA 2ZCGA 3LTSA 1EDQA 3GDRA 4Y9NA 3E12A 2B7OA 3JVAA 1NF7A 1PZ0A 2GL5A 3QRHA 2IPWA 1TZ7A 2FVMA 2CBVA 4H9ZA 3LTYA 2FFIA 1TCMA 1MUMA 1NWTA 4KS0A 2HPIA 3W72A 4J3WA 4C5YA 3B0UX 4KWUA 1L6SA 3RR1A 4TR9A 1XKYA 1F4AA 4EIVA 3WEMA 1Q6GA 1LG2A 3RO8A 5I3HA 1Q6CA 3ATYA 3ARYA 3F4CA 3N11A 4U5IA 4ICNA 5LXEA 2VWTA 5C7HA 1PEZA 1SW0A 4K8GA 1EL3A 1Y8BA 1AJ0A 1GK8A 5D9NA 3MO4A 1R3SA 4LC6A 4AD4A 1ITCA 2G3NA 3IUHA 4ERIA 2JKEA 3UA3A 1A53A 2OZ3A 1UD8A 3BOXA 3WLMA 1MZRA 3RX2A 1TJ1A 2YDSA 3MO7A 4UTMA 1MYRA 1Q6EA 2GGGA 3VIHA 1P0EA 3G77A 1HT6A 3WMLA 1KBLA 4AH7A 3ARTA 2Y6ZA 5EMKA 1UH3A 1K77A 1KGXA 1MO0A 4OGZA 1TREA 4PTNA 4XBSA 1UR0A 5E1QA 2CYGA 3KS6A 1XBVA 5DBTA 1AK5A 2Z7GA 1SO5A 3N6HA 8TIMA 2PAJA 4GACA 3CHDA 1IT7A 1CI1A 1LRQA 1DXIA 4PCSA 3N3MA 4MGGA 4ERGA 3W7LA 1SJBA 2FHFA 2ON3A 1LLOA 4QCEA 1VS1A 4AZHA 2BVTA 1OHLA 1I2QA 2EPLX 3GHUA 3HM7A 3UBPC 4LH8A 3IVUA 4JNMA 4J5NA 3KLKA 2ICSA 1CB2A 3VD3A 3FY1A 1VC4A 4M80A 1W8GA 2R1KA 4W93A 1KBJA 1KFLA 3DFHA 3UA4A 3ZR5A 1NDVA 5AYIA 3AIQA 1GVEA 1XPYA 4WVXA 4GCAA 4AG0A 4N42A 4L6HA 3VOIA 2BASA 3CZGA 2C19A 2E6AA 3NQCA 3PZMA 5F2LA 5HINA 2E8YA 3FA3A 3FFSA 4GUFA 5D2YA 3WEZA 1RHCA 4QEHA 5F4SA 1ZHAA 2OX1A 5BRBA 2NV2A 1GHRA 4ZXLA 4U31A 4GYFA 5K4XA 1AH3A 4TUFA 3NQFA 3UR8A 2UBPC 3NQ6A 1U1UA 1LM1A 4IGHA 3THAA 4C6DA 1E6NA 4U3CA 2H8ZA 3S2JA 3AXKA 2TYSA 1GTHA 1BXNA 3TTQA 1WAUA 1IV8A 5A3HA 4UCGA 5D09A 4C6EA 1TMHA 4K1GA 4MB3A 3WFZA 1XICA 1O5XA 4QRNA 2RDTA 1B90A 7ODCA 3VDBA 4EX4A 5LNSA 3W29A 1PCKA 1OBAA 1PBGA 2G97A 1ZENA 3WLNA 1AVAA 3QMRA 4O8RA 3REQB 1F2JA 1TO3A 2P88A 3I4KA 5AHMA 4K8HA 2QDHA 5FJOA 5LIXX 1CGXA 3GU2A 4UQCA 3AIVA 1SZFA 1BSIA 1G5AA 3O07A 3O06A 1CGWA 3ZSSA 3A21A 4PGLA 5FIPA 2LLEA 4FNRA 3UETA 2C0AA 2XN0A 4MSSA 2PTYA 1Y7VA 4W89A 4XD4A 2QZRA 4M24A 1O1HA 3CUJA 3EX6A 5I7GA 1BYBA 3SCWA 1UJPA 3Q37A 3B4UA 3UR2A 1P6WA 3GXPA 1EPVA 1P6CA 2PDGA 4QLJA 5HWNA 2HVNA 5CG7A 1ZU8A 4H8HA 4PCFA 5SWUA 3QSRA 3K5XA 3W02A 2E40A 2HBXA 4XZNX 1KRCC 1FFQA 4XZMX 5J04A 3W6YA 4PL1A 3SFWA 1NJJA 4KCUA 3M7WA 3N2TA 4KH2A 2VUNA 2JALA 2Z1VA 5A6BD 3GW0A 3OBEA 4U2YA 3VGDA 1W3JA 2XH4A 1OD8A 3BG3A 3ZLFA 1TKKA 1EX5A 2NQJA 1XYAA 4WXYA 1EOKA 4URIA 4F0LA 1JYXA 2ZUWA 4IJBA 4S38A 2C79A 3GVGA 1B3VA 5DCEA 1FWBC 3WDQA 3RYSA 2E09A 1H11A 2O4QA 3TTSA 3FXYA 1GGOA 4QCFA 4DO5A 4A3HA 1HKWA 5DT5A 3OZYA 5HNTA 3NEHA 3AJ7A 3GYCA 1PUDA 1UCWA 3SCSA 4HMCA 2XPKA 4XTDA 3WUBA 3QW3A 4FA3A 1NU5A 2VGGA 1V5XA 4Z1YA 4OBTA 1XBXA 1QO5A 1S2UA 5GJPA 2V2DA 2QUVA 4US6A 3A24A 3CTTA 4B5VA 1R9ZA 5JUVA 3ARXA 2VKZG 2HROA 2PDXA 4AEOA 3M0IA 5XIAA 1H0GA 1GW9A 3BW4A 1MXDA 2A0NA 4GK8A 3SUUA 2Q8XA 2P50A 2PDHA 1A5KC 2WKGA 3G1YA 4P5UA 4BEUA 2PGWA 3PHAA 4AW7A 3E49A 3WLQA 1UH2A 1HO1A 3TVAA 1K70A 3OOQA 4GFIA 3ANVA 4UUIA 2GUUA 5CG0A 2J8TA 3R11A 5A6KA 1QI2A 3I68A 4MKVA 3DKJA 4LV4A 2CW6A 3CLMA 2PDCA 1XH2A 3NOYA 3AYRA 3GKFA 1SO6A 3FVMA 4DWSB 3BLPX 4JIEA 4M82A 3E6EA 2ACSA 2KAUC 3EXSA 4LJ3A 1DHPA 1UKPA 2PGEA 4A3QA 1C9DA 1X8CA 2Y24A 2TPSA 5FAGA 2ZBTA 4YTRA 4PUDA 4Y9AA 4A35A 2UZ9A 4EWJA 3H21A 2B31A 2IUZA 1J2BA 1UC4A 4KETA 5FSEC 3MZ2A 1T6MA 4LY4A 1FWIC 4XD3A 3RF9A 4AHOA 3S2CA 3PB0A 2CHRA 2NQ9A 4U5KA 4H8NA 3RCMA 1QNVA 1E3ZA 3AXHA 1JDAA 1K8XA 3P5ZA 1V6XA 4ADUA 4NSBA 4JYDA 1WE5A 3DH7A 3VFCA 1PZ3A 3EX1A 3E3HA 4C60A 4AWTA 3T44A 3KCLA 4QIUA 1BVZA 2CU0A 3QZ6A 5KTLA 5LIWX 3NIYA 4LRSA 1OFPA 1UIPA 3MI3A 2DH3A 2WHKA 2Y7DA 2VO5A 3QR0A 3QW4B 4TQTA 4XO6A 4UOJA 1EC7A 3TC6A 2VRQA 1OYAA 1JJKA 4XK2A 4UR7A 1O7AA 4XUYA 3V0TA 2DW6A 3PFMA 3C56A 4IZGA 4C6LA 3T07A 4E8GA 3K2GA 1XLFA 3B9AA 1QWGA 1H63A 3LCHA 1E15A 1UP0A 3KLLA 4RZ5A 1JYNA 5HUPA 1PDZA 1SZNA 2NQZA 2WB5A 3KBMA 1H62A 5HXMA 4HOWA 1ZQ5A 4WZHA 2DIKA 4OOZA 3F4DA 3NZGA 3S46A 1CT5A 1M68A 3USBA 2WOQA 1CTNA 4IPNB 2OGJA 1ZCOA 2DVTA 2ALRA 1M7XA 1MEHA 3IK2A 4L6OA 4GGBA 4XV0A 4HPHA 4J35A 3UCCA 2PZ0A 4LAKA 2FTPA 3KHDA 1NOWA 1MXGA 5I23A 4OVXA 3IANA 1FBAA 4GG9A 1HJXA 2GFTA 3MYOA 3P5YA 2X0SA 1MQPA 4JX6A 4H6KA 1IEIA 4YVPA 1E0WA 3L66A 1GQIA 1E6RA 4PUJA 4Y90A 1HKKA 4HZ8A 3SQMA 2QV4A 3B06A 3AXXA 3HBLA 3ITVA 5FI8A 1KBKA 2UWFA 4AZ5A 4PA8A 4CNTA 4KFNA 3W76A 2OLAA 4A22A 1ENUA 4KCWA 1EHAA 2YBUA 3C0QA 1W5QA 2WW5A 4JR5A 3QGAC 4JKLA 1JQVA 3IIPA 5C2CA 1EQPA 3H26A 1K03A 4QGCA 2V3EA 3MWAA 1S3TC 4LF1A 3SO7A 3MQTA 2TRSA 1RCOB 4DF1A 3KBVA 2XIBA 4Y7EA 1OFQA 2J7FA 5HR6A 2CWNA 4AVNA 1NOFA 3OZPA 4LAUA 2X8RA 3CQIA 3WMCA 2BXYA 3FX4A 3PZNA 3LCLA 1NM9A 3EA1A 1XBYA 3DC8A 2DGAA 3EX3A 5LIUX 3T0TA 2WK2A 1OIFA 3VIKA 4RV3A 2BOEX 1VBGA 3PN8A 4ZFCA 1W2PA 3T78A 4YCPA 1VD6A 3TYUA 1E70M 3R79A 5MF5A 2XIOA 3LS9A 3FXGA 4B3ZA 2Y70A 5D38A 3OPSA 4ES4A 1RCXB 4QFUA 1AUSL 4PTDA 3CQJA 4MUZA 3VD5A 1VH7A 4JFVA 4Z0JA 4S3JA 1RZMA 3VCNA 5U7SA 3HV9A 1WKEA 2O9PA 3H2OA 1SZEA 3H2AA 3GYEA 4B5XA 2Z26A 4I90A 1E1CB 4G2DA 3S2MA 4FXSA 3NSXA 3CT2A 3EMZA 5CLTA 1OJXA 4JTLA 4D71A 2PTWA 4H9MA 5D2XA 2UV8G 2XJ7A 4KBXA 4JQ2A 1W17A 4A3UA 4J40A 1S2AA 3UXAA 1MWOA 1MW2A 1WO2A 3G0UA 2VGFA 2VUYA 1BPLB 1Y5VA 3AHXA 2CLPA 2QEZA 3WN6A 3APYA 1IZKA 4HZ7A 5AC5A 3E02A 3H53A 2QHAA 5CAHA 3O6AA 5T9CE 3W1XA 1I9CB 3T40A 1CLXA 3FS2A 3S2NA 3IJQA 4UNIA 4JS3A 2I14A 2FTWA 3OGVA 3V7PA 1Z89A 4CNOA 5EU9A 5HR7A 5JH2A 3EOSA 3UJEA 4QHRA 5DXYA 1W9BM 4FX8A 6XIAA 4HCLA 5IOBA 1LCOA 1V3HA 1FX6A 4CU6A 1O6IA 3P14A 1THFD 3LXBA 1YNQA 2W62A 1WXJA 2DEPA 3RO6A 3ARQA 1TPUA 1QI3A 2OG9A 3VAVA 4X0NA 4AD0A 2VWSA 3W7KA 3EDJA 2GJNA 2D2JA 1ODUA 1JZ8A 3AUOA 3M0LA 3H2CA 3DHPA 3ISIX 3C0LA 2PRLA 2PWDA 3U9IA 3SN1A 4NX5A 4ADSA 1WX0A 2IS7A 1SU5A 3BV7A 3LLXA 1NOUA 2Z00A 3S5ZA 2PWFA 5LNWA 4FNPA 4WOZA 4H04A 4Q33A 1UW9A 4I8DA 4HMDA 3JZEA 2ISFA 3VZZA 2W0UA 3QKZA 4AZBA 4IUOA 9RUBA 4W9TA 2FZ9A 5I5RA 1ZGDA 1K3UA 4MM1A 3TXVA 3VGHA 1RLDA 4ZOEA 1CX9A 3EDDA 5E9XA 1NVMA 2X1IA 1TJ2A 1KR0A 3WLRA 3BPWA 2Q02A 1Y65A 2Y7GA 3VI2A 2YCJA 3AAMA 4UQBA 1LUCB 3FDGA 2OGYA 3MKKA 1AJZA 2PU1A 3UG3A 1T5AA 2QJMA 3IARA 3LXAA 1XISA 1TRDA 3VC6A 4CN1A 3NQMA 4LUJA 1R7OA 4ZXOA 1LG1A 1J79A 1Z44A 3H4WA 2DDXA 3P60A 3CLWA 4R7JA 3SURA 5I00A 1UWIA 3DGRA 3CM4A 4IP7A 3EA2A 2REQA 3H24A 3LHVA 1ITQA 5T26A 4F0MA 4CCZA 4MIMA 1BYAA 1TG7A 3CASA 5ABFA 4Y8EA 4CEXC 2FZ8A 2YBTA 4LT9A 3UR5A 4E3TA 4Q6JA 1L8NA 3BOFA 3UT0A 2PI6A 2HBVA 3N2OA 2QUTA 4Q8VA 1JDFA 3G1DA 1HGWA 4O0QA 2WKLA 3CK5A 3WFAA 2ZA1A 3M0KA 4GZJA 3ZJ6A 2XH0A 2PDYA 1GZGA 2GJPA 3O8AA 5CXPA 3A3HA 2NQHA 4YS1A 1XPGA 2GSHA 3T2PA 3IRSA 4NU7A 1DXEA 4XAYA 2I5IA 5EL1A 2QCGA 3AU2A 3ARWA 4HYVA 1LDCA 1C92A 1XLEA 3QV7A 1NARA 3IV3A 3PS7A 2QIWA 4HHMA 3NQ2A 4XTIA 3LPPA 3VOCA 4MZ8A 3RR4A 4C6NA 2MUCA 2YL6A 1EWDA 2A3LA 2G4JA 1FH8A 1Z3NA 1GKPA 2Y88A 3BAKA 5K9DA 2V5KA 3V16A 1UP2A 1C8YA 5CSRA 2IKHA 4J3VA 1UD6A 3RNDA 4RPPA 4DJFC 4JTFA 1YMYA 4G6CA 5REQB 4AZGA 2GWGA 4NAEB 4Q4RA 1E5JA 4TV6A 3W9ZA 2V30A 2ACUA 4QG9A 1XIEA 3O1NA 2J74A 3M5ZA 1IGSA 1QASA 2E1WA 4YCOA 2WMFA 3VIIA 4G1KA 1UQYA 2C71A 4Z2GA 3WELA 1I1WA 1E9YB 2H9AA 1F3EA 2V82A 2CWXA 1MW3A 4DNMA 1X8FA 1GONA 1KGWA 1XLCA 4QAIA 4WSHA 3G0XA 3DIPA 2QAPA 3W81A 3PUEA 4P7QA 4RLIA 1W37A 2ISWA 1PVNA 4LQ1A 2ZE3A 3EGJA 3OW1A 1CENA 3SCPA 5LNVA 4HSOA 3LRLA 3UVIA 2NV1A 1V79A 2YW3A 2OFJA 1DPMA 2I9UA 3L4TA 6ENLA 1SMDA 2E8ZA 1XYBA 4R88A 1KXVA 4JTGA 3WD0A 2QF8A 3STEA 2GYIA 2GJXB 4JAWA 1V7YA 2RDUA 5EMMA 3HMJG 4DJEA 4Q8UA 3ABSA 2BOFX 3KBJA 4DI8A 1MFVA 3KHJA 1WDDA 1FWNA 1DQUA 3W7CA 4QITA 5AZ0A 4HU4A 1SW3A 2YL8A 5EFFA 2NXGA 4UOQA 3W07A 1G69A 4ZA0A 3W25A 4WF7A 1A5LC 2NVAA 5C7VA 1RP9A 1ESWA 1GG1A 3USZA 1T40A 3O9NA 2YA2A 1OT1A 4PE8A 1V03A 2DT1A 2J7DA 1KXHA 5K9CA 1EWEA 5EFDA 4DBUA 3OP2A 1F7BA 3M4HA 3OVRA 4ZQNA 1BSLA 2DUXA 1OG6A 5C2XA 1EOMA 3MP3A 1UKSA 4TX9A 3KP0A 3VO0A 5A69A 5GNYA 1NWSA 4EK7A 3TJLA 3P3BA 1CXFA 4JTRA 4L4OA 1BRLA 3UPWA 3DU0A 1N7KA 1R46A 1P0DA 4IMAA 4ZB2A 3P8IA 1IR2A 1KLZA 2O9OA 3A9IA 2WHLA 2J9YA 3STGA 2XINA 3NZQA 1V02E 3LHUA 3UY8A 1JZ3A 5DY3A 2G3MA 2ZUUA 4LS1A 2Y0FA 5HANA 1RA5A 3RXZA 1ZALA 4R3UA 1EF3A 4HN4A 1M1BA 3ZOAA 2GJRA 2I16A 2DY3A 1TFVA 2DZTA 3UW6A 3UD6A 5ECUA 2DJXA 3HZ3A 3V1HA 4LCRA 2HTMA 1C29A 3HTWA 3S2LA 1ICSA 1QW9A 1XUZA 2VX4A 5FJIA 3I4EA 3PZGA 4XVDA 4YWSA 5JIPA 4HNLA 4KEUA 5BXRA 3LSBA 3LX9A 4IIHA 2DZPA 4H2CA 1CECA 2RFGA 4BQ2A 3GY1A 2QCCA 1PV8A 1EXBA 4XSLA 2TODA 3TTOA 2G95A 1U5VA 3GIQA 4LOCA 1XGDA 3TNOA 3G8EA 2BMBA 4DN1A 2QKFA 1UR8A 3VOHA 4F2TA 1AL8A 4MKNA 1G4TA 3C8NA 2YZRA 3VE9A 3OLGA 2J75A 2W67A 2FZDA 1EEPA 4LYPA 3WD3A 4AMAA 2RHGA 5BNKA 3W84A 3OEXA 3VKAA 5A8OA 3FSTA 1D3HA 3VE7A 3R13A 5C0QA 2W63A 3TOYA 3THCA 3CZ8A 4B9ZA 1V0NA 2UY5A 2ZZ3A 3DYPA 3LI1A 4QDMA 5J5RA 1ONXA 3G1RA 4REQB 1LWHA 3KVMA 4H7ZA 3M0VA 5IBXA 3KTXA 4Q8TA 1QOPA 5EPDA 1U30A 1JZ5A 1KRMA 2OR2A 5DLCA 4Q7IA 1X6UA 3AJXA 1RV8A 1KCZA 3TA6A 3ARRA 6REQA 2YX0A 3G1AA 4PB5A 1MNZA 3FYPA 1QTWA 3W7EA 2QXWA 1JPHA 1KRBC 2OPJA 1ZJHA 3O3RA 4R5EA 2QIIA 4N9EA 1B0IA 5AHIA 3TW9A 3O7UA 2F6XA 4X3ZA 1PO9A 3STFA 1OADA 4ZO6A 4PBFA 2FH6A 2ZA3A 2PWUA 1VKFA 1WZKA 4FOKA 1S39A 3KX6A 4U3AA 1GJPA 4JYEA 4TX6A 4AD5A 5RUBA 5EKYA 2CPUA 4GXWA 1XQLA 4XKYB 3KOZA 2GVEA 4MY1A 1QNRA 3MP4A 4W8LA 2GGJA 4OUEA 5E5CA 3CGTA 2V81A 2G3IA 1RQEA 1YADA 1PPIA 1RP8A 4OWGA 2XM1A 1MXSA 1QW7A 2F7FA 3H22A 3W82A 5E6ZA 1XIJA 1Z7AA 2YJQA 5L6UA 3WQWA 5CSYA 4RKAA 2BXVA 4WJXA 1A0CA 1P7TB 3I6RA 4E8DA 3ONBA 4IPJA 3W24A 1JZ6A 1UB3A 3OYZA 2XIJA 2VX7A 5FJJA 4QLLA 5HNUA 3WF3A 5FF3A 5I06A 5B7ZA 1QHZA 1CXLA 3DG7A 3NM3A 4Q8MA 1CYGA 4DHGA 4AU0A 3VMPA 1Q2RA 3GVRA 5I02A 4I9MA 2OWCA 2PDLA 1LTDA 4JIRA 2V5DA 1K7EA 1OX4B 4HPNA 4QJ4B 3P82A 4PZVA 4Q8QA 4GH1A 4RNFA 3E74A 4YHEA 4GYPA 1DWAM 3SGUA 1IT0A 1EGVA 1NY1A 3MSRA 4YU1A 1TTIA 1QHPA 1E1EA 2YDAA 2GDQA 3TQVA 1Q7ZA 2CNCA 1WKFA 3GG1A 3QJAA 4TVDA 4BR1A 2IKIA 4AHQA 3K8MA 1E6PA 1NH6A 4AIOA 3RCYA 2DSZA 2FGZA 3ES7A 1Q5MA 3Q2DA 1IT8A 3TTEA 2WQPA 1GOMA 3CIVA 3ZT5A 4TMBA 2W9MA 3TTYA 5BXPA 5A8PA 3T0AA 4UTKA 1H3GA 3QQWA 2HZGA 1WZMA 4E0CA 1G1YA 4CGTA 1BKSA 4FI4A 5FACA 3LCGA 1OD0A 4NAFB 5AYXA 2PGFA 4WLCA 4GWEA 5LNUA 4JPGA 2XFRA 4UR9A 1XINA 3LSCA 4ZOAA 3Q4DA 3IK4A 4JL1A 5HATA 1HGYA 1NF0A 3P61A 4JZ5A 4H3DA 1BG9A 4KQNA 1UIOA 2CXEA 4LGXA 3NQDA 2PDUA 4GQRA 3ZJ8A 1UKQA 4RXGA 3MBDA 4QNEA 5D05A 2J24A 3N12A 2B7NA 1Q4NX 2WSKA 1FQ0A 1FTXA 3DUGA 1CGTA 2NT0A 4QM1A 4GZIA 4LBSA 4MLRA 3VDHA 5D9PA 3B40A 1IE7C 4HPXA 1ZAHA 4MNLA 4C6QA 4DZIA 1OFEA 3KL0A 1TJ0A 1C7TA 5I3FA 1SR9A 1RBLA 3KOXA 3WNNA 1LBFA 2Z1WA 3CWOX 1KQZA 3CPGA 2Y8KA 2DZBA 1VFSA 2WLZA 4PMDA 3AZSA 2W4XA 3FEMA 4GE8A 1IEWA 1PX4A 1VRXA 3WL1A 4G5DA 1TELA 1TV7A 3W28A 2RAGA 2XFYA 2P3ZA 3SUTA 3AYSA 2NX1A 2WC3A 3NXLA 3W7GA 2GDUA 2HEJA 5A6BA 4LUYA 1PKLA 1EB3A 3DENA 4O50A 4C6BA 3A5FA 1OM0A 4HNNA 1O95A 4LB4A 1PYFA 1NEYA 2O9TA 5E70A 2XH7A 3S42A 3WLSA 3GC2A 3GU9A 3VCRA 4NJIA 3HFTA 3VFLA 4LALA 1Q8AA 3P93A 2CLOA 3L4WA 1XD0A 1LORA 3DGBA 4FK9A 4BF9A 3N13A 4ROPA 5C71A 1Z41A 2F2HA 4LUSA 3BAIA 1F9CA 4M29A 3M0ZA 3DHUA 4FXFA 2FZMA 1QK0A 4M8UA 4MWAD 3IGHX 3GB6A 1Z69A 2J47A 4CNUA 4BZYA 4BKNA 3SRFA 1TB3A 4C1NA 1UD2A 2DZSA 3L7RA 1IQ8A 4O13A 2POZA 4P7LA 3NZ1A 1WV2A 3EZ4A 2XZ9A 2OLHA 1J5SA 4QE4A 4UMCA 3NM1A 1JCNA 4WHBA 3CO8A 4NNBA 3NAVA 4ZEPA 1H61A 5HAOA 3MC5A 3KCJA 1WXYA 1VB9A 3W23A 3VKCA 1TMQA 1PIFA 3APTA 2QUMA 4ZMGA 4H8VA 3MHUA 3UWUA 2YCLA 4KIRA 4ZO9A 3Q94A 1OYCA 3GG0A 4L61A 2IXUA 1BWLA 1E0UA 5IBXC 1KKOA 3WH7A 1PX8A 2IQDA 3N2BA 1XXXA 4LUIA 3VYLA 3KTSA 2VZVA 3T0CA 3R10A 3S5OA 4AD2A 5D02A 4NVTA 3W7DA 5DRIA 2WSQA 2PRHA 3TDFA 5D2WA 4D6FA 1K8YA 3BSHA 4X0VA 2PDPA 4FHAA 2A3HA 4O14A 3T4CA 4JTKA 4ZL1A 3WH6A 4MOZA 4JY8A 3T81A 5I3DA 2QCMA 4NZ1A 3NO5A 1UHVA 5D03A 3CH9A 2FKPA 1IXQA 2CLFA 4MNJA 3ZWSA 2V0TA 4QROA 4C65A 1ONEA 3EWWA 3OTRA 4AEFA 4RDZA 1KFCA 3PZVA 1T7LA 2OODA 4R85A 3LYEA 2XIIA 1YPIA 4QSFA 5BWFA 5KEZA 1HL9A 3BQ6A 2ZYFA 1US2A 2PD9A 3HQNA 2VZUA 3NPUA 4EXAA 3EA3A 1G9HA 1O5KA 1ZNNA 3FLUA 1LBLA 4IG2A 3EPOA 2BVYA 2VOTA 4MWAB 4UFKA 3AO0A 1IXOA 1QPRA 2CZFA 3L5LA 3MV11 1O66A 4JTCA 4PB4A 4R9XA 4KW2A 4IL0A 2OO6A 4K6AA 1VBJA 2C14A 4C6CA 3LGGA 1PSCA 3SUVA 2OYMA 2NWRA 3BTNA 1ZBCA 1A5OC 2E9MA 2QGYA 1UWTA 2NX9A 1UC5A 3R8GA 3R94A 3GG7A 8RUCA 3CV2A 3N6QA 4L1GA 2WMJA 2HVMA 4G8TA 1KLYA 1BXBA 5CC5A 1Q6OA 1FHVA 4DJDC 3LRMA 3VOGA 2BY0A 3IPWA 4M1RA 4Q4KA 3WX7A 3BZJA 4US5D 3MBFA 4YTTA 5DQPA 3QH2A 2ZX7A 4PMYA 3W70A 3I7RA 2J25A 1I75A 4ZR8A 2PSNA 3T42A 1UYQA 2D0GA 2Q8ZA 4W5ZA 1YKWA 3AIWA 4DF2A 1BTCA 3ONCA 2C15A 4L4LA 1B3WA 3MB9A 4JQ3A 1X7FA 4PMNA 2JFEX 2GUYA 3QPEA 5GJNA 3GTIA 1FUYA 2B81A 2ZQ0A 2D3NA 3AS2A 2BGQA 1BGAA 1FP9A 3ALGA 2PURA 2ZFAA 1BLIA 4OBSA 3UJ2A 2BHUA 1G7VA 1D7KA 4AAJA 3C0JA 1GQKA 2YL9A 4GX9A 3UWQA 2Z6JA 4MJ2A 1QI0A 5DELA 5FA5A 3IVTA 5CJNA 3WJYA 3B3DA 5M3WA 3PP7A 2QJIA 3NO3A 4PYSA 3KEHA 4NXSA 1XQKA 1XLMA 4PULA 3RPDA 4O8AA 3UZ5A 3UZWA 4GYKA 3VDCA 3NQGA 3OIXA 1HF6A 3EKZA 3DN5A 2TSYA 3VD4A 1Q7QA 4AF0B 4BI7A 3QFEA 1ITXA 4WSJA 3G3DA 1XDMA 3LPGA 3CU2A 3BGGA 1XDJA 1BWVA 5GNZA 1BYDA 1VAHA 2PMQA 1K1DA 1GQLA 1D3CA 3S5SA 2O9RA 5CBIA 3TIMA 3U8GA 3W1TA 1XUUA 9CGTA 2Y89A 4CNSA 2EPNA 1OABA 3BMVA 1QPKA 1R3WA 3UXIA 2V2HA 3A6OA 3LMYA 4LTSA 1QU4A 1P43A 3OHMB 4R7WA 4DBEA 3GFXA 2GK1B 4TX8A 3ZVHB 2HNHA 1KFKA 4ACZB 3RCNA 4FXRA 4F66A 2HV5A 4IIDA 5BCAA 2TAAA 3LCWA 4M6VA 1EJTC 1YEYA 3R0DA 4N4QA 2DT2A 2QCDA 5C9UA 2R24A 3GUWA 4OECA 1MRAA 2WVVB 1DJZA 4W4QA 3UG8A 3L4VA 4UFHA 4DWSC 5AVHA 3LPFA 4XUGA 1RJQA 4MB5A 5HDRA 3DFNA 3PSWA 4WRHA 2IMRA 2ZICA 1JFXA 3NPVA 3VNJA 4BEQA 1DIEA 4K39A 2XSAA 1LBMA 3MCMA 3MUY1 4YTQA 3T0BA 3M44A 4QLKA 3LDVA 4ATDA 1MI3A 3LBMA 4H6RA 1W3IA 2VZSA 4HOXA 4UFIA 2IW0A 2H8XA 3BV4A 4F4RA 4AIEA 2OT1A 1QBBA 3NZRA 2I5QA 1FCVA 1FY6A 3CB3A 4GQ0A 3U7BA 4IX0A 2XFWA 1WDSA 3DFQA 4PRWA 3WNMA 5A1AA 4PMXA 4G1NA 4MDPA 3I65A 5C9XA 3W2MA 3NURA 4XQ6A 4GI8A 4B5NA 3HQPA 1AD1A 3FIGA 3E0VA 2VQUA 3WD2A 5AB3A 4FMVA 1MUCA 1GOWA 3CWHA 1EP2A 2O7QA 4PBGA 1IZCA 2INZA 4IMCA 3R89A 3BOLA 1EH9A 1V3JA 3SUSA 3IJ9A 2VC6A 4DLMA 2IKJA 2OCZA 1R0MA 4O54A 2VJXA 5DMYA 2A6NA 5DN1A 1VLIA 5A2BA 3PANA 2FB2A 1J2WA 1SMAA 3VGBA 3GXFA 3WF4A 5CGQA 1PZ2A 5F1VA 4ILSA 2E4TA 3TUUA 2YLLA 1TV8A 2HXTA 5DMLA 2WMIA 3TU9A 3C2YA 4B9YA 3SQLA 2QVNA 1XKJA 1FHDA 4NZ5A 3BAYA 3G3MA 2KZHA 3QTGA 3UGVA 4UFMA 3QMTA 3NR0A 3NWRA 1WKYA 3EWZA 4Z2JA 1K7XA 3TQ0A 3WUEA 4FALA 2YPIA 4G7EA 4XX6A 2QDEA 4B2DD 1OCQA 2JBMA 4Z1BA 4Y2WA 1GW1A 1V77A 5LA0A 3MDUA 2OJPA 1XLLA 2ZUNA 4OJYA 5HJXA 3KE0A 2ZRZA 4C7DA 1GVYA 4KIEA 2QCFA 4BQ4A 4NAEA 4D6DA 1XSIA 3B05A 2GUBA 3R1ZA 4F2BA 4G56A 4UWMA 5HNRA 1IEVA 3N15A 3WQVA 4HA3A 4XAGA 1W1PA 5F2IA 4L64A 6PTDA 1SJAA 5CZSA 4C6JA 2Z28A 4M81A 4DLFA 2IQ0A 3NUKA 2VEKA 3AICA 5AOUA 2Z4GA 2QV5A 2YCEA 4FIQA 2AAAA 1OFOA 1FRBA 3KDOA 1W9DM 1TPC1 1KM3A 4BWLA 1HXJA 4TIMA 6TIMA 1LL4A 2PE4A 3GVQA 2CESA 1AJ2A 3WQFA 4AVFA 4C6PA 5B7YA 2NQ5A 1IF2A 3WF1A 3U3HA 5CZTA 4AZCB 3QC3A 2JKPA 3O0FA 2PBGA 4O0KA 3W75A 1G01A 3BC9A 3DYMA 1H50A 1HKIA 1O68A 3DZ1A 4IPPA 3AXMA 1XFBA 2V67A 3W26A 1XHGA 2ISSA 2I1OA 1RK6A 3EWCA 4C6IA 5AC4A 3SY5A 1W9PA 3WG6A 3W22A 3IGUA 3AYTA 1EO5A 1R2RA 3EOEA 1J5TA 1EJXC 3R0UA 4JTEA 1XI3A 3POHA 5AY7A 4QDPA 1XL9A 5LIKX 3GIYA 4BFAA 1F76A 3MJYA 3DC0A 3VIJA 3VNZA 2VRKA 4O1DA 4AB4A 4CNPA 4NZCA 2AGTA 4V1XA 1K02A 4EKJA 2ABBA 3CZLA 2FDSA 1UQZA 4GOAA 3DDMA 1W31A 4A6GA 1YBQA 4BHYA 1AH4A 5MHBA 3JRKA 2QCEA 1JNEA 1UWAA 4M56A 3KZPA 3TFCA 1E72M 4XAFA 3VD9A 3QR3A 1YDVA 3HOJA 3ITGA 5CAKA 3LBCA 4J3TA 3E2SA 4DUOA 4EACA 3T0DA 1AA1B 1JUKA 3M6YA 1QT1A 1BVWA 4NZ3A 2XU2A 3Q45A 2ESCA 1TWIA 3LLDA 2YBVA 4P8XA 3I3EA 7TIMA 1JAEA 1S5NA 4I7WA 4WR3A 1OGSA 5I0DA 2WSYA 2HRWA 3UCQA 1HJQA 2X1UA 1ONWA 1KRAC 1DTNA 3ZXWA 3SB0A 2J78A 2R94A 5H1WA 5FEZA 4JYFA 3W2UA 1SW7A 4QISA 1ISWA 1FWGC 3BAXA 3FN9A 4FX6M 4Z1DA 4J3ZA 4RZ4A 4PMQA 2PLMA 4JCMA 1IIGA 2ZXQA 4AYGA 3PBVA 3ANUA 2F9RA 4BCEA 2I17A 1S1RA 2FDMA 3FDKA 2IPJA 1JXJA 1Y5XA 4D2JA 3N1AA 5IDZA 4B4HA 1EJUC 3OHIA 3GC5A 5I77A 2J8GA 5ABGA 4NNCA 1CGYA 5D30A 3PPCA 4DBDA 1V0KA 2D73A 4PL2A 1H51A 3F4VA 1V6TA 3GXIA 3EPNA 1JIBA 1KWKA 3DFOA 1F8MA 1UPPA 3BW3A 3VGEA 1PCWA 4DB7A 3UESA 3IS4A 5KITA 4MAZA 1F3XA 4ADTA 4EF9A 4BF5A 1SJCA 4PODA 3SIZA 1TRIA 1ZS2A 4WJEA 5GNXA 1MVYA 2YXXA 5FKYA 2AKMA 4H9YA 1KXTA 3SADA 3SEPA 4OOUA 1Q6FA 1VCFA 5HWJA 4IGNA 4X9SA 3TK7A 5L9FA 4RJEA 1GVRA 3H6OA 4GNKB 4TU1A 5BMWA 1SO3A 4HKPA 3M9YA 3SN0A 3W7PA 1EJ7L 3BGJA 1KNWA 1BAGA 5FF2A 3M7SA 4KT2A 1FCUA 4O57A 2P1FA 3S47A 4UTTC 2ABAA 2HISA 1R38A 1K6WA 3A12A 1KKRA 4RDWA 8XIAA 1TZ9A 3VX0A 2IPGA 4UTLA 3GR7A 5HMSA 3WQDA 3AMGA 1SQ7A 3NVDA 4JTUA 2YB4A 2OSWA 3DOPA 1JGIA 4LAMA 4B92A 2Z2UA 2ISVA 1ZL1A 1UUQA 1VLWA 3KOYA 1ZSXA 4NI8A 4H8UA 2NXHA 2Z6IA 1EBHA 4D1IA 3GHSA 3PZTA 3D5HA 3GNNA 3GH7A 4K36A 1UWUA 2BGNE 1EFZA 1A49A 2Z7KA 1EJVC 4UB9A 4JQAA 4W5UA 3M5YA 5AC6A 1TTJA 3T8LA 3D47A 3MV01 2E6YA 3DHDA 1JAKA 2GQAA 1JPDX 4L56A 2A3BA 1DIKA 3BLKA 4IIGA 4AZIA 3ITOA 3TQPA 4AYSA 3TWBA 1W2VA 2OKOA 3UWEA 4FIRA 1QHOA 1TA3A 1VJZA 2X7WA 3QHNA 1HW6A 4LVAA 3SUWA 3PBGA 4KCVA 4PN2A 3HJEA 1TVPA 1JVNA 1NIUA 3TR2A 4MLJA 3L2IA 2ZWZA 4GVFA 3CUFA 4ECLA 1KM2A 2Q6ZA 2PDNA 4XAPA 3BLEA 3RM8A 2G3FA 3HN3A 2VT0A 1D3GA 2GVJA 4GY7A 2D24A 3V5CA 4O1CA 2DORA 3BJFA 3V35A 4GNJA 3TKFA 4MNMA 4WY0A 1XDLA 1YW1A 2G4FA 1H7PA 1R3YA 2ZUSA 3K8LA 1C3FA 1G4EA 1US0A 1LZOA 3FYOA 4M7SA 4R34A 5G2IA 1OFRA 3ZIZA 1BQCA 3NYDA 4XSMA 1EDGA 3FHAA 2PB1A 1DJNA 1BWKA 1WDRA 5HQLA 1TE1A 2Y7FA 1ME8A 2RDXA 4UQAA 5A6LA 4IF2A 4D1JA 5EBUA 3HGOA 1G67A 1YPFA 5E6YA 2V5JA 3WH5A 1MEWA 5T91A 2W5FA 1A5UA 4LUTA 2D2GA 4IQJA 1DXFA 1EJWC 4IP4A 3M07A 2FYMA 1V0MA 1XF0A 3CPRA 4IPLA 4QP0A 1V6YA 4J3SA 5CZKA 3TSDA 3T9PA 1Y0EA 1FCBA 2X2YA 1M65A 4AEEA 3UPBA 2AMGA 4UQEA 4KWSA 1M5WA 1D8CA 2C8NA 1JZ4A 2YL5A 8XIMA 4ZB0A 5DF0A 4JTDA 1DJHA 4M1BA 3SRDA 2ZRXA 3G1HA 3IACA 3M0JA 4IPIA 3IJIA 2HS8A 4FXJA 4JY9A 3ITXA 5DFAA 5CSUA 4DZ5A 4FLRA 1S5MA 4YWIA 3C2OA 1D9EA 1W0MA 3CO4A 2G3JA 1YDOA 3W6MA 5LHEA 2CC0A 4RX0A 1GOIA 3P6LA 3H7RA 4A3RA 5H8PA 1YQ2A 3DFSA 4RK8A 2WZHA 3WLHA 2DVUA 3IJDA 2AAMA 3BMXA 2QCHA 5LKYA 2BLEA 1TCDA 4L5ZA 4X9YA 2F8QA 3VX1A 1UP3A 4H6EA 1O94A 1SPQA 3AQUA 3W2JA 3W85A 4JGDA 3IJLA 5JIWA 1G4PA 4W7WA 4HYWA 3LY0A 2DSKA 1YTKA 3NQBA 4DIAA 1OFBA 4IOTA 1L2UA 1UR1A 3T1GA 3PVFA 3E0IA 4M3PA 4MZYA 2ZZ6A 3IAPA 1BVNP 2X05A 3AUJA 4FS9A 4QX4A 5CBBA 1FWEC 3LUTA 1NDWA 4D8LA 1XIHA 4S3KA 2W61A 2POTA 1TPEA 1VRDA 4XG1A 1TPFA 2IXVA 7REQB 2VFEA 5H91A 1LYXA 3PZUA 3S9YA 2E9BA 4GXPA 2VRJA 1J11A 2A85A 2D1ZA 3WBEA 1E4LA 2QQ6A 4IP5A 4LU0A 5GQBA 3TQKA 5FL0A 2AOSA 5CSSA 2Y5JA 4LS2A 3EWXA 1ZJAA 4CCCA 3L4UA 1GQNA 2VX6A 1B57A 3TOPA 2BG5A 5CPMA 4NP7A 3NDZA 1QPOA 4O53A 4ZZ9A 3GNPA 4H4IA 5FF7A 3N14A 3W7NA 3T55A 4QS6A 3QOMA 2CEQA 2INEA 2BZNA 3W71A 2E3ZA 4C7FA 4QSHA 2PTDA 2R14