3NYDA

Crystal structure of kemp eliminase hg-2 complexed with transition state analog 5-nitro benzotriazole
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
303
structure length
303
Chain Sequence
b'AAQSVDQLIKARGKVYFGVATDQNRLTTGKNAAIIQADFGMVWPENSMKWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHSQLPSWVSSITDKNTLTNVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQTVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQTHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGISVFGVADPDSWRASTTPLLFDGNFNPKPAYNAIVQDLQQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
molecule tags Hydrolase
source organism Thermoascus aurantiacus
publication title Iterative approach to computational enzyme design.
pubmed doi rcsb
total genus 121
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3nydA00
1B3ZA 5ECUA 5I24A 1B30A 1UUQA 2VCBA 4GZIA 3OGRA 3RM8A 1UA7A 3DYPA 2XHYA 1QHOA 2DH2A 2YL8A 1HT6A 2PB1A 1NOFA 2V3FA 3OZPA 5AYBA 3AZSA 3CZLA 7TAAA 4PMYA 4IISA 1E0WA 2VI0A 2D3LA 3VDHA 1JG9A 1JZ4A 1HVQA 4PTWA 4HMCA 2E40A 5I2UA 1R87A 5E0CA 4UQBA 2GJXB 1SFSA 4UFJA 4CGTA 3F5LA 1XRVA 3KZSA 1ZJAA 1DWHM 4HA4A 3TA9A 3E1F1 3UERA 1EDGA 1CPUA 1OGBA 2VZSA 1J10A 1ITCA 1KXHA 4J3WA 2BFGA 4K68A 3VMOA 1G1YA 3L4ZA 5A2AA 2WMIA 3QOKA 1CECA 2J25A 4TX6A 1CGWA 3NUKA 1W91A 1ZBCA 1MW2A 3SUSA 3UETA 2V3EA 2XFYA 2D3NA 4PSPA 1GUVA 1UHVA 1GOOA 4EKJA 1V0LA 1W2PA 3K8LA 5AYIA 3MSGA 2ZICA 2ZWYA 4DWSC 4ATDA 2O92A 4HU0A 4PMNA 1UD4A 5D9OA 3OLGA 5I5RA 2CBJA 1HF6A 1QI4A 1R7AA 3GM8A 4GO9A 4P8WA 2E0PA 3TTOA 4EANA 2F8QA 1HJUA 4M29A 5IDIA 1HL8A 3CMGA 1ODUA 2GDVA 3WQ6A 5EB8A 1MFVA 3L4UA 1OSEA 1G0CA 1HXJA 4D6HA 3VINA 1AMYA 4P8UA 1E6PA 4W85A 4BF7A 1BQCA 3KE0A 1RP9A 3GBEA 3SURA 1I1WA 4W8BA 4XB3A 2VZUA 4KGJA 1HJXA 1CWYA 2PWGA 1I1XA 4CN6A 3BC9A 4RE4A 2D0GA 2C0HA 3W6LA 5CLWA 3CTTA 1CXIA 2VQUA 2X0HA 3ZR5A 4FK9A 5A8PA 1CXHA 1TR1A 3UEQA 3A6OA 1GJWA 5ABHA 2PF0A 3GXDA 2V5DA 2D22A 4AZ6A 1CLXA 5JBDA 3WH5A 1WKYA 3L4VA 1UZ4A 4HP5A 4HOWA 2X09A 1DP0A 2FH8A 1TVNA 5CSUA 4A3YA 2GJPA 4ATLA 1AQHA 2A3HA 3VNYA 1JXJA 2XSBA 4QFUA 3CHEA 3WUEA 1JL8A 3UESA 1BTCA 3VVGA 1MQRA 4X9YA 1P6WA 2CKRA 1WDRA 3M46A 1V3IA 4M1RA 4U5KA 3SCNA 4AZ5A 2VNCA 1BG4A 2UWFA 2ZE0A 4M81A 1KGUA 3WIJA 1CGUA 1OM0A 1B2YA 3WBEA 4JKKA 3AICA 3VX0A 3VMPA 5I23A 3BCFA 4OUEA 2GFTA 4J3SA 5EFDA 3RMEA 3MU7A 3AS0A 2ZOXA 3UR7A 3L2MA 4MDOA 4KMQA 2J7CA 1JDCA 5HPCA 3D3AA 3WF1A 3WF0A 2WHJA 3VU2A 1WAWA 2XG9A 4AIEA 2X2YA 4HOZA 1NOWA 3S2CA 1VEOA 2QPSA 3MANA 2WMIB 3BGAA 4UQAA 1H0GA 1SMDA 1UD5A 4W86A 1OT1A 1CTNA 1TA3A 4DUXA 3PZMA 1V02A 1GJUA 3LPGA 4C7GA 1QPKA 4J28A 1L8NA 4MNKA 5M3WA 4RE2A 2J47A 2YDSA 1ZBWA 2PC8A 4MJ4A 3MUAA 5I3DA 2YLAA 3TOPA 2GJXA 2OWWA 4TOQA 1C8QA 3ARTA 4CN4A 1GORA 2YOCA 3NIYA 4CVUA 2WHLA 3NDYA 3CIVA 3VD7A 3GDBA 5JBEA 4HA3A 1CENA 1CGVA 2W91A 1Q6DA 2CERA 4MAZA 4UQCA 2J4GA 1UR4A 4HOXA 2DDXA 4E2OA 4V28A 2DH3A 5BYWA 1M01A 1W1VA 2EPMX 3W25A 3VKKA 4AWEA 2VRQA 4JCLA 3QHOA 1GOQA 1CGXA 4AD3A 1L0PA 3EDJA 2YKKA 5GQBA 3AHVA 2XFFA 3W26A 3WDIA 1E4IA 3F4VA 1NWTA 1H09A 1C92A 4OBSA 4WSKA 3TP4A 4UNIA 3AFBA 1V0MA 4ZXLA 2A3AA 2HISA 1GZJA 1E1FA 4S3KA 1EDQA 1H49A 3AMDA 4YN5A 1GNXA 2WVUA 1RH9A 1MQPA 5I78A 2Y4SA 1M53A 3O9NA 2CBIA 1NOUA 4MB1A 2J79A 2XUCA 5E0FA 1E6SM 1WDQA 3T0AA 2OLHA 1XV8A 3A4XA 4DM1A 2O9PA 3MMUA 2OYKA 3PZIA 3NSMA 3EDEA 1MW0A 1H11A 1J0IA 3MO4A 2VX7A 3BSGA 2XYLA 1OD0A 3IK2A 5A8OA 3IANA 1BLIA 3EMQA 4H8HA 1E1EA 1LWJA 3VM7A 1PBGA 1XCWA 2WXDM 3WNOA 5KZ6A 4JAWA 1WB0A 3FHQA 1VFOA 2VR5A 2XVPA 4TX8A 3UCQA 4JFUA 4L4OA 4AW7A 2J7DA 3CZEA 1UH4A 3CMJA 3L2LA 4JKMA 4AZHA 3AIQA 3WF4A 4DWSA 4TVUA 4J27A 5LA1A 4GXPA 1F4AA 4WJXA 1E4LA 2ZUSA 3AIWA 4QAWA 2IXUA 1C8XA 2W67A 2WZHA 3WF2A 4J3XA 3DYMA 1UKOA 5A8MA 2Y5EA 5ABEA 2WCSA 2VZVA 1V6VA 1NH6A 3AMGA 1B31A 1JZ8A 1W2VA 1KCLA 2WMHA 3AROA 2EPLX 5DT5A 1JYWA 5JBFA 1WCGA 4P7RA 3VMNA 5AC5A 3CUGA 3SCRA 1KWGA 3CHFA 4B16A 2ZX6A 2VURA 5D9NA 2CKSA 2WANA 2AOSA 1UOKA 1PX4A 2WHMA 3PZTA 2RGLA 3BAIA 1W9DM 4IM4A 2QPUA 3DC0A 3DHPA 2CYGA 4PYSA 1EHAA 4FF5A 4B9ZA 3W0KA 4A4AA 1U30A 4AZGA 1V6YA 2VTFA 4GZJA 1QOXA 3CHDA 3QR3A 4H8UA 3U5YA 4Z2JA 2WK2A 4HMEA 2BVYA 2J78A 2ZIDA 3U7BA 4YHGA 4F66A 3CZJA 5A6LA 1JAKA 4E4PA 4BZYA 2FDMA 1H5VA 2JF6A 2ZXQA 3BAKA 3AMLA 4UOQA 4NRSA 3ECQA 4W7VA 2W62A 2A3EA 2D0HA 2DPEA 2GJRA 2G8ZA 2YL5A 1TE1A 1ISYA 3ZJKA 1W9VA 1ODZA 4PUEA 1E5JA 4W8AA 2BXYA 4OIFA 2VC9A 1UKPA 8A3HA 4QLJA 4R27A 1KCKA 3AIEA 4J3TA 1OGSA 4BQ2A 1W32A 3KL0A 3EDFA 1HN1A 4U33A 1GQJA 3I3EA 1UYQA 3N04A 4PMOA 4PTXA 3SCWA 2YJQA 4N0RA 3PZVA 4U2YA 4CD4A 1GQIA 4PRWA 2EO7A 1WNOA 2G3NA 4AY1A 4H7VA 3BXWA 1EQPA 2XGBA 4B3LA 5HBFA 4KWUA 2VL4A 4BS0A 5DF0A 1JZ7A 1E43A 5IHSA 1JAEA 1JD9A 4AD2A 4W89A 2WWDA 4AIUA 2OSXA 3ZT6A 1EHNA 4OZOA 2JE8A 1UR2A 2BHZA 2UY5A 3A3HA 3VO0A 2GK1B 5A6BA 4D1IA 2EXOA 1V3HA 1FOBA 3HU7A 5EBAA 3NJ3A 3GXFA 5CPTA 3WQWA 1GOMA 1H1NA 2VR4A 3VX1A 1DWFM 4HU8A 3WMSA 5BROA 3AIRA 3VIKA 3I3BA 4UZUA 1R8LA 1IT0A 1V6WA 4BQ3A 4LQ1A 4M56A 4H8VA 1JD7A 3KL5A 1MYRA 4AEEA 2CPUA 3WF3A 2XSAA 3QHMA 4J3UA 1R7OA 2XIIA 2D24A 4GI8A 2JALA 1M7XA 3MMDA 5LA2A 2YLLA 1W9BM 2NT0A 3AMKA 4WKFA 4PTMA 4MTVA 4D6IA 2DT0A 3ARXA 2WSPA 2J8FA 3T08A 3RIKA 5FL0A 1J0KA 1UZ1A 1FP8A 1DWAM 4UFKA 3SIMA 1MVYA 2FHFA 4M82A 3GZAA 2E9MA 3OA5A 2PBOA 5C8BB 2BY2A 2YA0A 3RILA 4V27A 3WMCA 1W9XA 3L4WA 3AXHA 2B31A 3UR8A 4HMDA 4JZ5A 4GIAA 1PIGA 3VDCA 1J0HA 1E9LA 2WC3A 1XYFA 2JF7A 4AC1X 5LA0A 4MNMA 1D2KA 2JEPA 3L4TA 3TTQA 2WVSA 2OYLA 3VGHA 3B8SA 3W82A 5C71A 5HPOA 4WSJA 1BYCA 3SUVA 3WNNA 1GVIA 1K9FA 2BNJA 3OGSA 5A69A 3VGBA 3AIVA 3OLIA 5FCZA 4PMDA 3ARRA 3AISA 1QW9A 1E6ZA 3A4AA 4IPNB 4JFSA 4QP0A 2PI6A 1J0YA 4AISA 3WQVA 2Q8XA 2D23A 1E73M 1H3GA 1OIFA 2OSWA 7CGTA 1ISWA 4ACZA 3ARYA 1MW3A 1MWOA 5A6AA 3VNZA 4TXEA 4AZ7A 1UH2A 2C8NA 1OIMA 5CPQA 3GH7A 2ZX9A 1EH9A 4NSBA 3CO4A 5IXEA 1QNPA 4J3VA 2RGMA 1VIWA 3G6MA 1WDPA 5FOOA 1FHDA 3AYRA 3WH8A 1E6QM 4MB5A 3I3DA 1ECEA 3VGEA 4EE9A 3OB8A 3VTRA 1J18A 1ZS2A 4HZ8A 4MDPA 1NWRA 4GO8A 1VBUA 3PZNA 4ZE4A 3DYOA 1XCXA 2BY1A 3GNOA 3MSDA 3EYPA 4JHOA 4XUYA 1CYGA 3CZKA 3BMWA 1UG6A 3AJ7A 4OOZA 2YBTA 4UFMA 3WDHA 3M7SA 3WEZA 1OWQA 1JZ2A 3VILA 2CXGA 3AXIA 1E71M 5CG0A 4GI9A 1PPIA 1LWHA 3IJ9A 4U2ZA 1X6LA 1WO2A 2VT0A 1XD1A 3GH5A 4JIEA 1GONA 5ABGA 1PJ9A 3VPLA 1BYAA 2PBGA 3GTNA 2PWHA 2YBUA 1OINA 3M07A 2WMFA 4PMZA 3ARZA 4MADA 5D8ZA 2ZUUA 4B3KA 5A95A 1TFVA 1V0KA 4P7NA 1C93A 1KR1A 1JZ5A 3WH6A 1VB9A 3WD4A 1VFFA 1HKIA 1FFQA 4ML4A 4XV0A 1J0JA 1BVNP 1FFRA 3HJEA 1KXVA 2CHOA 5CQ1A 1GQKA 1CXEA 6CGTA 1HKJA 1JFHA 4OOUA 4E8DA 3VIPA 5F7UA 1B0IA 3OLEA 4W93A 1V3MA 1Q6GA 2E9BA 1S46A 1V6XA 2X0YA 4U31A 5A6SA 2G41A 1GOKA 2WVVB 4CD8A 3VIGA 4GINA 4EK7A 1UD3A 1LG1A 4IUGA 4Y7EA 1VEPA 5DO8A 2A3CA 4CKQA 3WD0A 2E3ZA 3U57A 1N82A 1JGIA 3LPFA 4JCMA 3K8KA 1IV8A 2E9LA 2JIWA 1HP4A 4ATWA 3OG2A 4M8UA 4PMVA 1EOKA 2WMKA 3WUFA 1H4PA 3PTMA 4AZCB 5A94A 1UD6A 1X6NA 2XJ7A 2A3BA 1ZB5A 4UR9A 2CHNA 3WSUA 5A8NA 2BHYA 4CVWA 4MNLA 2D0FA 1NQ6A 2YL9A 4UQ9A 4PMQA 1W1YA 1J0ZA 4F9DA 1HKKA 3T2QA 1U33A 3GBDA 1CNVA 3TTYA 1H41A 2ZX7A 1R85A 1Q6EA 1OCQA 2GDUA 4TTUA 4WKHA 2DEPA 3CUFA 1JI1A 2Z1SA 4ZXOA 1WDSA 1W1TA 2X8RA 1U2YA 3EDKA 2W4XA 3WQ5A 2QHAA 3CUIA 1CIUA 3MV01 1NP0A 3BMVA 2EBNA 2XM1A 4H2CA 4J7RA 3W4RA 4CUCA 2GSJA 4IPLA 5CPSA 5ABFB 2XVNA 1K6AA 4F9JA 4AZCA 3WKZA 4AD5A 3RM9A 4TTGA 3WL0A 3AMCA 3WDJA 1JZ3A 2YA1A 2C7FA 4P7LA 4ACYA 3SCQA 1C91A 3ZIZA 1W9PA 5CLTA 1E15A 3WDRA 1GPFA 4OBRA 2O9TA 3K8MA 1XHGA 1BPLB 2EPNA 4PSRA 1BYBA 1JDAA 1E4NA 3ARUA 4LYQA 2EEXA 5FL1A 4Z2KA 1PZ3A 3K46A 4OKDA 5FIPA 3T09A 2ZUVA 4PBGA 1CDGA 4AXNA 3MUIA 4DUVA 4PMUA 2UY2A 2CITA 3VIOA 3ALGA 2DSZA 3OBAA 5EFFA 1QVBA 2VX5A 2BS9A 4ZE5A 3MKKA 3VGGA 1E55A 3NYDA 2WPGA 1UKQA 2J7HA 4D6GA 4XX6A 3ZOAA 1XSKA 5C70A 4W5UA 3LMYA 3VIIA 4KH2A 1ZBKA 3KWXA 4GKLA 4WLCA 1BGGA 1D3CA 4QDMA 4AZBA 3APGA 3BAXA 4WKAA 1CXKA 3AS2A 2VRKA 4CN1A 1KBBA 1ISZA 4KRUA 2FGZA 2J7EA 2NT1A 1V0NA 4UFHA 3HMCA 1B1YA 3FAWA 3VD5A 6A3HA 1JZ6A 2J7BA 3VIFA 2DSWA 4TUFA 1QI5A 3N9KA 4BA0A 1WZMA 4N42A 2WYSA 4GI6A 3K1DA 4GQRA 5M03A 2BY0A 2O9OA 1JFXA 3EBVA 1EA9C 3ZM8A 1B3WA 2NW0A 2VO5A 2J77A 5CXPA 4GQQA 1JNDA 3WD2A 1M04A 1DWIM 1QI2A 2DGAA 4W88A 5I77A 5EMYA 1UD2A 1CLVA 3WFLA 1GW1A 3WH9A 3UG3A 4PUDA 3SUUA 1LQ0A 3VOCA 3W6MA 2ESCA 1BHGA 3W24A 2J74A 4UTFA 2V3GA 3BLPX 4JKLA 4LGXA 4RE3A 4CU8A 2OWCA 2W63A 1BAGA 1UWQA 3CBWA 4YHEA 4FLSA 1LLOA 4Z2GA 1XC6A 1E0VA 4HTYA 4LX4A 4Z2HA 4ZENA 5AC4A 3AHTA 2BVTA 3IJ7A 1DHKA 5FD0A 1CEOA 2DIJA 4TVDA 1CGTA 4PCSA 1XGZA 3WN6A 3EDDA 2D2OA 1TUXA 5CGMA 1QBAA 2CEQA 2ZUMA 3NCOA 2V3DA 2F2HA 2CBUA 4JFVA 4JFWA 1EIBA 1VFUA 3PN8A 3B9DA 4W7WA 3ZMRA 1B90A 1UWRA 5JIWA 4WK9A 1KFWA 3ZT7A 1VENA 3LPOA 2W92A 1EGZA 4P7OA 1UWTA 3F5JA 1J9YA 4WF7A 1NP2A 2QV4A 3DHUA 1XSJA 1FHLA 4UFLA 5BXRA 1UQYA 2WLZA 1NWUA 3VD4A 3POHA 2G3IA 1Q6CA 1QI0A 4UZSA 2XGIA 1W3LA 1KGXA 3OGVA 1ISVA 1JIBA 3WEMA 3WDQA 2X1IA 1XH2A 1PAMA 1JI2A 3VGFA 3VD9A 2VUYA 3A4WA 3BLKA 4DUWA 1SYTA 3L4YA 4B9YA 3BAYA 4MJ2A 2FHBA 5I6SA 3PZOA 1MXGA 3FY1A 3ZJ7A 1JYVA 3O2LA 2E4TA 5E09A 3W29A 4Q22A 3U5UA 3N1AA 1A47A 1B3XA 1XSIA 1KXTA 2CESA 5D9MA 1CZ1A 5HDRA 1TMQA 2DSKA 2VX6A 1E6NA 1NARA 1B9ZA 1EO7A 2V5CA 2GK1A 4NRRA 4EAMA 1QNSA 1Q4NX 1KQZA 4D6EA 4L4PA 1CGYA 1VEMA 2CETA 4D6DA 4CD7A 1QBBA 4OJYA 3WH7A 1O7AA 2VX4A 4JHZA 2EJ1A 1K9EA 2JFEX 1V3JA 1C7TA 1VAHA 2G3MA 4TVCA 3SCVA 4W7UA 4PEEA 3ZJ8A 4BCEA 3PZ9A 5BXTA 1R86A 2VCCA 2FHCA 2XVLA 4R5EA 2WZIA 1RD6A 2WAGA 3WBAA 1ZJBA 3AYSA 4M80A 2WMJA 3THDA 1UR8A 1H0IA 3AHXA 4MPKA 2QMKA 4QLKA 3RJXA 1Q6FA 1VJSA 3WNMA 1C90A 3FXYA 1EQCA 1MFUA 1QI3A 2OYMA 5CSYA 1DWGM 5IFTA 5I79A 5A8QA 1V6UA 3WELA 4HZ7A 2XFRA 3RDKA 5M17A 1QNRA 5GNYA 3WUBA 1HKMA 3SCSA 1K9TA 3FHAA 2XTKA 4D6FA 4AIOA 4AZIA 3K4AA 4U5IA 4LYPA 4UOZA 2YA2A 4W84A 2WCGA 3W53A 1SR0A 2BVDA 2ZUTA 2XVGA 2VZOA 2TAAA 3W27A 4P8VA 2YDRA 2BY3A 1V3LA 4XZWA 3VDBA 2XM2A 2OSYA 3ZSSA 1E56A 3WDPP 5BXPA 5ABFA 1PEZA 4AD1A 2Z1KA 4PN2A 4XZBA 1WZLA 1Y7VA 1OB0A 1TZ7A 4MAVA 1MXDA 2MANA 1ESWA 3EMZA 5IFPA 1ZBVA 2VRJA 4WIWA 5KEZA 4E8CA 2BXZA 3WMBA 4D72A 1IZJA 1FH9A 1JNEA 4W87A 4CU7A 2Y8VA 3IAQA 1AVAA 5HNNA 3ARWA 1AQMA 3PZQA 4D71A 2VCAA 5FKYA 1W9UA 2AAAA 3AZTA 2W61A 2WHKA 1YQ2A 1US3A 2DIEA 2NSXA 3U7VA 2WB5A 3BAJA 1RP8A 3GYCA 1VFMA 2J62A 3G6LA 3RO8A 3QHNA 3WFZA 4DWSB 3VIHA 4FLOA 1UQZA 3FN9A 1KWKA 2PWFA 1MQQA 5A6KA 1XD0A 4AEFA 5E6ZA 4D6JA 3TTSA 3PZUA 4AYSA 3CUJA 4LXFA 1TG7A 2EPKX 5E9AA 2J75A 4U3AA 3T0BA 3N11A 1G5AA 3PTQA 5TD4A 3RM4A 1UH3A 2DT2A 2XWEA 2WVVA 5M5DA 1BGAA 2YL6A 3N13A 1MW1A 1V3KA 5A1AA 4PCTA 3ZSTA 3FAXA 4H04A 3WNPA 1UWUA 1XYZA 2WBGA 1HVXA 3GXMA 4FMVA 3AIUA 3VIMA 1FH8A 5GNZA 4UCFA 1HJQA 4QCEA 1VF8A 3CHCA 4GPNA 2O9RA 1V02E 2G4FA 2YDQA 5LYRA 4Z2LA 4S3JA 1HJVA 3D5HA 1AQ0A 3POCA 5D9PA 1WE5A 1JYNA 3WEOA 3T0DA 3GXIA 3FNDA 3ARVA 3CLWA 4LPCA 1CXLA 3CH9A 5E70A 4CD6A 1JDDA 1EDTA 3BCDA 4ZEPA 1I75A 1M03A 3W38A 3RCNA 1KGWA 3LPPA 4ACZB 4B15A 4QCFA 1O6IA 2WKGA 2QF8A 3PHAA 3AOFA 2DT1A 2V38A 1ISXA 1E70M 1ZU8A 4HPHA 3WQ8A 4H41A 4FLRA 2WKLA 3ARPA 1UA3A 1GQLA 1TA3B 1UR1A 2EQDA 4X0VA 1BFNA 2D1ZA 2VMFA 3VM5A 3ZQ9A 5JIPA 4CD5A 2WZEA 1E6RA 1LJYA 5A6MA 1UR0A 3W37A 3MMWA 2XWDA 7A3HA 3AIBA 1KB3A 1VBRA 1GOIA 2E8ZA 1JYXA 1F4HA 4MB4A 1QHPA 2CNCA 5BCAA 3ARSA 1DEDA 1UD8A 3K4DA 3MS8A 3VIJA 1WZAA 3W28A 1WPCA 1SMAA 3WUGA 5DMYA 4LYRA 3CPUA 3OLDA 1WP6A 1A3HA 1C3FA 2ZX5A 2ZX8A 3PZGA 3AI0A 1BYDA 4A3HA 1QNOA 3SUWA 4M24A 5HOSA 2JIEA 1GHSA 5BWFA 2WLYA 1OT2A 1EO5A 2ZUWA 1ITXA 1KQYA 2Y2WA 2HVMA 3NSXA 3SEPA 4KGLA 1V08A 1KXQA 2VZTA 3DECA 1PX3A 3SCOA 4PMRA 1W3JA 1CXFA 1G01A 2VOTA 2DSUA 5E6YA 3AS3A 3UG5A 5A6JA 5BRQA 1OBAA 2J7GA 1D7FA 3AHZA 3ZO9A 3PTKA 4FLQA 2WSKA 2JEQA 2OWXA 3SCTA 6TAAA 3N18A 3CZGA 3ZR6A 4AD4A 2W5FA 1KR0A 4CCEA 3J7HA 4X0NA 1FP9A 1J01A 1NM9A 2AMGA 4Z2IA 4D1JA 1W1PA 1E72M 1UR9A 1JF6A 1G94A 3RPMA 1K9DA 1NWSA 2DQXA 5D8WA 4KRTA 1KBKA 1UWSA 3KL3A 3M6DA 9CGTA 4C7FA 4ZFMA 1LF1A 2WCAA 2WC4A 2CCRA 3MV11 1BSIA 4JFTA 3AS1A 1HJSA 1LL7A 4JL2A 3T2PA 2FGLA 3SCUA 1CBGA 4URIA 1BVZA 4W8LA 3WQ4A 4AD0A 3BAWA 3EMCA 2QMJA 1HL9A 1G9HA 3WL1A 4NI3A 1HIZA 1FH7A 2GVYA 2ZXAA 4C7DA 3VUPA 2E8YA 2IUZA 2XVKA 1E3ZA 1C8YA 1JXKA 2WVTA 1QHZA 3OZOA 2BHUA 1E5NA 2G3JA 1EOMA 3CUHA 4UFIA 3BSHA 1FA2A 1PX8A 2W66A 3B9AA 1GVYA 3QGVA 2WBKA 3NDZA 4HZ6A 5CZKA 3AHYA 4HA1A 1LG2A 1IZKA 1VRXA 3TONA 4UOJA 1LL4A 3SCPA 1RPKA 3MUZ1 1UWIA 1J11A 3AZRA 2VJXA 4D6CA 1TVPA 2DT3A 3IAPA 3ZJ6A 4AMCA 1X1NA 4UQEA 3VGDA 8CGTA 1HP5A 3GH4A 2Y8KA 4Q7NA 3THCA 4V2XA 5HXMA 1C7SA 2J8GA 3MUY1 1US2A 3O6AA 1E0XA 1GHRA 3KEHA 2X05A 3F5KA 3CZ8A 3ZT5A 5GPRA 5DEZA 1OD8A 3VDAA 3OIHA 1BG9A 1E4MM 5CJ5A 2CIPA 1HX0A 1BF2A 1TCMA 3HN3A 2CBVA 2VVNA 2WW5A 3WD1A 2GUYA 2WWCA 3ARQA 3N15A 1W3HA 1E6XM 4P7QA 3W81A 3T2OA 3RJYA 5I0DA 1GCYA 1V03A 2UY3A 1XH0A 1H2JA 4DWSD 1JF5A 4NZCA 1E3XA 1HNYA 2ZXBA 1HJWA 2VQTA 2PWEA 2WC7A 5BRPA 3UG4A 4PTVA 3A47A 5IHRA 1E40A 2Y24A 3GNPA 4BQ5A 4CCDA 3AQUA 5A2BA 4YPJA 3AXXA 1UKSA 4QLLA 2FH6A 3NSNA 4JL1A 5GNXA 5D4YA 1QNQA 2BV9A 4CCCA 4F8XA 3II1A 1UKTA 4BQ4A 2ZUNA 4NF7A 5DT7A 3JUGA 2F61A 4P8XA 4UQDA 2WM0A 2D20A 4CU6A 1DWJM 4U3CA 4GZEA 3PBGA 1W3KA 3WNKA 3IJ8A 3WD3A 3B9EA 5DFAA 2QLYA 2EPOA 3WY1A 5AY7A 4MB3A 3QOMA 4HPGA 2XPKA 3VD3A 2UY4A 1EXPA 5BXSA 2VVSA 1B3VA 3CGTA 1J12A 1VJZA 5A3HA 3N17A 3S6TA 3WENA 3FW6A 5JUVA 4MNJA 2J7FA 1LL6A 2YIHA 4F79A 2XIBA 4RL3A 4W5ZA 5A2CA 3GNRA 3BH4A 3N12A 3SUTA 2PWDA 4PMXA 2IXVA 1GOWA 5CGTA 1PZ2A 3WNLA 3L4XA 2DSVA 2WMGA 4DM2A 2ZXDA 1B3YA 3ALFA 1XH1A 1OGGA 1ZL1A 1QW8A 1Z32X 2ZWZA 1YHTA 1DTUA 2WNWA 5A6BD 1PIFA 1WZKA
chains in the Genus database with same CATH superfamily
4NY2A 5ECUA 1BRLA 3R0DA 1QTWA 5CJNA 5AZ1A 2E68A 4AC7C 1UUQA 2VCBA 4M6PA 3OGRA 3RM8A 1UA7A 4UMCA 1IIGA 3DFHA 1A53A 3WBXA 7TAAA 3IVTA 3AWOA 1HVQA 5E0CA 4QBXA 3H7VA 1W8SA 1SFSA 4UFJA 3NGFA 5E9XA 4RW3A 1RJRA 4HA4A 4LUYA 1ZLPA 1S39A 4N6FA 1CPUA 1J10A 4H9UA 3C3NA 3LERA 4K68A 3VMOA 2KAUC 3EPNA 3QOKA 3ELFA 3CEUA 3SUSA 4Z17A 3OPSA 2XFYA 1A49A 1R30A 4B5TA 1W17A 1W2PA 1X8CA 3K8LA 5CZTA 5AYIA 4H00A 2ZWYA 4DWSC 4PMNA 4HU0A 5CPNA 1JPHA 1UD4A 2PS2A 5D9OA 2CBJA 3TCSA 1AUSL 4GO9A 4P8WA 1KFJA 2E0PA 2QCGA 3TTOA 2F8QA 4M29A 5IDIA 1XDLA 3O06A 3TSDA 5C9WA 1MFVA 4M19A 1OSEA 4DJDC 3VINA 1PVNA 2BODX 3QR1A 4W85A 4AY8A 2FJKA 2VXNA 5EMUA 3SURA 3UZYA 3BE7A 2DZXA 4XQ6A 4XIAA 3W75A 2C0HA 3CTTA 3BOXA 1H7PA 3ZR5A 1TR1A 3N9SA 1XI3A 4HN8A 1UZHA 1T8XA 1KRAC 1TIWA 1WKYA 3PBYA 3NQFA 5C7VA 2FH8A 2VFIA 3VNYA 1JXJA 3CHEA 4BI7A 3VVGA 3PY2A 1Z8AA 4X9YA 3NGJA 1XYCA 4EPEC 1KM5A 2P8CA 4E2VA 4XD6A 3BZGA 4AZ5A 1BG4A 2ZE0A 3WIJA 4Y9AA 1CGUA 3QM3A 1FCQA 1B2YA 3SSJA 2WQPA 4JKKA 2IQDA 2FZ8A 3AICA 3VMPA 2MNRA 3P5ZA 2H6RA 2VM8A 1MI3A 3L2MA 4KMQA 1JDCA 3WF1A 1DJIA 2WHJA 1WAWA 1M68A 3Q45A 1NOWA 3S2CA 2Z7KA 1A5KC 1I2OA 2QPSA 1F74A 3N6JA 1H0GA 1UD5A 1RA5A 3S2NA 4FPSA 4DUXA 3PZMA 3IJLA 2ZZ6A 3L12A 3UJ2A 1E0TA 1JPIA 1QJWA 5HNUA 1ZBWA 4YTTA 4MJ4A 1P7TA 1TWWA 4TOQA 2D2JA 1FWCC 2ZVRA 2FVKA 2P53A 3ITGA 4JYEA 3O1NA 1XQLA 5JBEA 3FCPA 2W91A 1TWSA 9XIMA 3CLMA 3WQEA 4J35A 4DQWA 1UJQA 4UQCA 3TJIA 2J4GA 4HOXA 1EKOA 5XIMA 5BYWA 4EPBC 3FJ6A 3W25A 2WZMA 3MHGA 5KZMA 3MMTA 1YNYA 2FZMA 3PPGA 1TX0A 2YKKA 3AHVA 2XFFA 3W26A 3TP4A 5LGXA 1V0MA 4ZO7A 4PL2A 5HINA 2HISA 4S3KA 4AFYA 1EDQA 3I6TA 3BG3A 3BW3A 3BLDA 1MQPA 3M0LA 1M53A 3O9NA 1NOUA 4MB1A 5E0FA 4MFDA 1XLLA 3ABQA 2OLHA 3BGGA 1ADOA 3V36A 3ZYZA 3MMUA 3TK7A 4C6JA 3EDEA 3MO4A 3M0VA 2XYLA 1OD0A 3VNIA 4TMBA 1NAL1 1XPGA 2YW4A 1GVFA 1UW9A 5I3IA 3EOLA 1AJ0A 4FXRA 3PWGA 3G1VA 1KW1A 3VM7A 4IIFA 1RQBA 1TV7A 2KX9A 2WXDM 3FHQA 4TX8A 4B2DD 4JFUA 3BDKA 3O6DA 3DG6A 3CMJA 4J2MA 1YDNA 1F4AA 2BTMA 1E4LA 3AIWA 2W67A 3CV2A 5JH1A 3SBFA 2WZHA 3FGCB 3DYMA 3G3DA 1UKOA 4HBKA 2Y5EA 5ABEA 2WCSA 4IGHA 2ZA2A 4WY0F 3SM0A 5FEZA 4WQ6A 1KM4A 1GK8A 4PZVA 2RDUA 2X42A 5AYYA 3RX2A 2BOEX 1R0MA 3IGXA 1JCTA 2W79A 4P7RA 2QF7A 4GJJA 5DMMA 3W7QA 5LZLA 2YYUA 4B16A 2SFPA 3G5EA 2HMCA 3NQ7A 3P7YA 3C52A 3TJXA 3AXMA 2WANA 4EWJA 3N29A 3BAIA 1JUBA 4JTJA 1W9DM 3SSZA 2H9AB 4FF5A 1ZCOA 4A4AA 3KRZA 1B54A 3CHDA 3L5LA 4H8UA 2WK2A 4LUTA 4E2BA 3QVQA 2XIQA 5ECVA 1JAKA 4BZYA 3QTGA 2Z27A 1EJSC 2AKMA 3IGSA 4W7VA 1GOXA 3N4EA 3OBKA 1XIEA 4LAOA 1RALA 4GVGA 1ISYA 1DE5A 1TR9A 3NL2A 1ODZA 1PKYA 2HSAA 1R3VA 1FRBA 2IW0A 5C55A 1IT7A 1G6CA 4R27A 3CUXA 4O57A 1EIXA 4BQ2A 1J6OA 1LRQA 4F0KA 3KL0A 2PTWA 3JVAA 4RNFA 4QTGA 2CLFA 2X1SA 3SCWA 3WJZA 3TWAA 3TQPA 2EO7A 1WNOA 2G3NA 1T0OA 1D3HA 1YX1A 4DBSA 4H9MA 4B3LA 5HBFA 4MY8A 4KWUA 2PLMA 4BS0A 2Z1VA 4CCZA 5IHSA 4GFSA 4OFCA 2WWDA 3ZT6A 4X2RA 1H63A 2YB1A 1UR2A 2BHZA 4HVXA 5C54A 1V77A 2QAPA 1FOBA 1LLZA 5EBAA 4N7QA 4NZJA 3GXFA 4Z1AA 3FA3A 1FWWA 1DWFM 2VDHA 1FTXA 3I68A 1M65A 3I4EA 4D9PA 3AIRA 3VIKA 2NZLA 2HROA 3TAOA 3CPRA 4Y96A 1ME9A 1V6WA 3TW7A 3W74A 3W1UA 1QASA 4FSAA 5HMDA 3UJFA 3UZ5A 6ALDA 3KL5A 4NAEB 5T8GA 4NAFB 3WF3A 4J3UA 2XSXA 3RFAA 4JX5A 1R7OA 3MMDA 2BASA 3W7RA 4WKFA 2RAGA 4GVHA 5I06A 3PPHA 3GDMA 2F2KA 5FL0A 1UZ1A 1FP8A 1GKPA 1MVYA 1S5MA 1EGMA 4M82A 4GISA 3PAOA 4DUOA 3DKLA 4QGCA 3GVVA 5A8GA 1EBHA 3W87A 3PBMA 5LSMA 2BY2A 3GHUA 1LLWA 3RILA 1WKDA 3TR9A 2B31A 3B8TA 1RD5A 4OGZA 2JKPA 2NVAA 4HMDA 4GIAA 4S3FA 4UTWA 3VDCA 3UQNA 1E9LA 1VFTA 3ONCA 5G2WA 1X6UA 5LA0A 3GW3A 2JEPA 3L4TA 3VGHA 3B8SA 3W82A 1OFRA 1BYCA 3WNNA 4EXBA 3TQ0A 3NQGA 1KKOA 4N6EA 4WZHA 1UWAA 5JMUA 4PMDA 1QW9A 4JFSA 1J5TA 3VKBA 3Q58A 4QP0A 2PI6A 1OZQA 4HJFA 4NU7A 4FNUA 2PD5A 1DXIA 2P0OA 2D23A 5I09A 1OIFA 3LY0A 3WLRA 3A21A 7CGTA 4IPIA 1YBQA 3ARYA 4ZL1A 1MW3A 5A6AA 5HNRA 1UH2A 3STFA 2C8NA 3F1QA 3GH7A 1IXNA 3CO4A 4ROQA 3F2DA 4DLFA 1WDPA 5FOOA 2QCEA 3I3DA 3IIOA 3VGEA 3VTRA 3H2FA 4MDPA 1NWRA 4K7YA 3D0CA 3HGJA 4X60A 1TQXA 4IP7A 3LCFA 1DQWA 4A3UA 3EPOA 1XCXA 2OEJA 5I00A 1IEVA 3MSDA 1KNWA 1CYGA 2PODA 3RR4A 3AJ7A 2YBTA 4UFMA 2B7NA 3HFYA 2CXGA 4HTBA 3N2TA 5JH2A 4WDWA 5CG0A 4GI9A 2VEMA 4R33A 4YTRA 4DBWA 3LBOA 5B80A 3BQ6A 3LTYA 3IJ9A 4U2ZA 1WO2A 3HPXA 1XD1A 3GH5A 2Y62A 4JIEA 4QJ4B 1XIJA 3EKLA 5ABGA 1PJ9A 3W2MA 4OU1A 1S38A 3W7JA 4LBSA 8TIMA 2CZDA 1R47A 3ARZA 3MP5A 2ZUUA 4IMGA 1FWBC 3WH6A 1R2TA 4A2SA 4LV9A 1HKIA 4F2BA 1J0JA 1KXVA 2QV5A 3SZ8A 1V51A 5CQ1A 2G37A 4H9YA 3ZVHA 1WA3A 6CGTA 2PDLA 2EKCA 4OOUA 5F7UA 4IJCA 1B0IA 4UTJA 3KX6A 4FOUA 1Q6GA 1S46A 4GY7A 2I5QA 2NVCA 3ABRA 4HSNA 4IMAA 1Z9AA 2Y61A 5FEWA 3TOYA 4Y7EA 4GG9A 1VEPA 5DO8A 3LTSA 4C65A 4OTKA 2E3ZA 1WUEA 3TVAA 1N82A 1JGIA 4JCMA 3EEZA 3K8KA 4LVAA 2E9LA 4MVAA 4JBRA 5CPOA 1WQ5A 2VFDA 1OC6A 2C71A 4IPJA 3UYIA 2HBVA 4UC5A 1LOLA 1H4PA 3PTMA 1X6NA 1IQ8A 1Q6LA 4CVWA 5MHBA 4E6MA 2PDBA 2VDIA 5REQA 2CLEA 1NQ6A 2YL9A 2HJPA 4A3RA 1W1YA 3GBDA 4IGSA 3MY9A 2ZX7A 4JHMA 1PCWA 4WKHA 2DEPA 3FEMA 3HG3A 3ITYA 7REQB 3ME3A 1WDSA 1DOSA 1XISA 1WOAA 4GXWA 4IMFA 3BANA 3MV01 1NP0A 3BMVA 1AW2A 3W85A 4P2VA 5CPSA 5TNVA 4HK5A 4TTGA 3WL0A 3D47A 1EZWA 1XBVA 1W54A 3AMCA 3B0UX 4P7LA 1H7XA 3ZIZA 1W9PA 1DV7A 4KCWA 4A8NA 4ADTA 1Q66A 2O9TA 4ZODA 2I56A 3KVMA 1BPLB 4K6AA 1OFAA 1BYBA 1Q13A 3PNZA 1JDAA 5D2WA 1RLCL 4W4QA 2EEXA 1PZ3A 4C91A 4PB5A 3CQIA 1XKYA 2BMBA 1CDGA 3P81A 5LNWA 3TC7A 5F4SA 3LBMA 4PMUA 3RX3A 1IR2A 3JR2A 3OBAA 4D8LA 3IGUA 3MKKA 3VGGA 4P5UA 5HJYA 2J7HA 4D6GA 1K7FA 1P0KA 3S6DA 4ERGA 2C79A 3SDOA 3VIIA 4TIMA 1JRBA 1MZHA 4JNYA 3W9ZA 1ZBKA 4RJEA 4C1NA 3T7VA 4AZBA 3GUGA 3APGA 4KBXA 4Z1BA 2A1YA 5CAHA 4YJ5A 1KBBA 4PCNA 3U2ZA 3H54A 2V5KA 3VIFA 3YPIA 1N55A 2VGGA 4TUFA 3A3WA 1LROA 4ZVJA 4NKCA 3GAKA 4N42A 2EGZA 4GI6A 3GZ3A 1P6BA 2O9OA 4JQ1A 2QJJA 1XQKA 3N2XA 1K3UA 1PCKA 1AL8A 5DLCA 3ZM8A 1PUDA 2INFA 2NW0A 1EZ2A 4TR9A 1JNDA 3WD2A 3HF3A 4PBFA 3G1DA 1UPPA 4AB4A 2YBVA 3SB0A 5EMYA 3UWWA 3BLIA 1QFEA 1GW1A 3CIWA 3TMQA 3KHDA 4Y9OA 1X7FA 1TO3A 1XDMA 4OT7A 4HYRA 1I0BA 3W24A 1BHGA 3DN5A 3FA5A 3BLPX 4LGXA 4RE3A 3V5FA 4CU8A 2OWCA 4H01A 3R10A 1ZQ5A 3G1FA 4LRTA 4L6DA 3CBWA 4PUNA 4YHEA 1QDSA 4FLSA 3VZZA 1SJAA 4Z2GA 1E0VA 3ANUA 4ZENA 3OTRA 4Y9NA 3CL7A 1RK6A 5FD0A 1T5AA 1CEOA 2DIJA 4TVDA 2BB0A 4HU3A 1YE4A 1EWEA 1AJ2A 4ZR8A 4YVPA 3NCOA 3RU8X 3CV1A 2V3DA 2F2HA 1LZOA 1A3WA 3QZ6A 4FS9A 4OVXA 2G95A 3UXDA 4IMEA 4BR1A 3AXKA 3NO1A 5HA7A 3LPOA 1EGZA 7PTDA 3RU6A 2Y7EA 3TXVA 4DO5A 3F5JA 1J9YA 3HZ3A 1UQYA 4QJ5B 2VGBA 2G3IA 3NYZA 2QS8A 4HZMA 1TE6A 1LORA 5I3KA 1JIBA 2BDQA 1PAMA 3VGFA 4L65A 2VUYA 3HO8A 4G56A 4DUWA 3L4YA 4ROPA 5D33A 3FJLA 3LGDA 1MXGA 3RGTA 1A5CA 3WBYA 5E93A 1O66A 2E4TA 5E09A 4KQNA 4XKYB 3WLMA 4O50A 3CHVA 3GYEA 3H7RA 4IPPA 3CB3A 5D38A 2VX6A 1QPQA 1E6NA 1L6YA 3KCJA 3RPTA 2V5CA 2Z00A 3W1MA 5KZEA 1Q4NX 3UWVA 3T8LA 3UWUA 4CD7A 3UYCA 1PKLA 3KRBA 3W76A 3EWCA 1PHWA 4LC8A 4N4PA 5H8PA 2JFEX 1K9EA 4C6PA 4Z0JA 1C7TA 2C91A 2G3MA 2YXXA 3SCVA 4PEEA 2I5IA 5HWJA 4UNKA 3GG0A 1YTEA 3N6QA 2VCCA 1DIEA 2JQXA 4ZB0A 2WZIA 3LNMA 1RD6A 3TMLA 3W3OA 2ISFA 3MHFA 3WBAA 3WQOA 2LLEA 1AZ2A 3AYSA 3IGHX 1XLCA 3PG9A 1MSSA 3CU2A 2QCCA 3RJXA 3ABZA 1VCVA 4ZGYA 3LX9A 4A6GA 1MFUA 1QI3A 2ABAA 3WQFA 1DWGM 5I79A 1V6UA 4PTNA 3GXNA 4Z1DA 3TZFA 3VC5A 3FVDA 3RDKA 3BZJA 5M17A 1QNRA 4A8RA 4LS1A 3SCSA 4IWWA 4DEFA 1FDZA 4JTSA 2E6DA 4AIOA 3FSTA 1XM3A 1XUUA 4W84A 2WCGA 4O28A 4AVNA 4UMBA 1EJTC 2QDGA 2XVGA 2VZOA 4LAUA 4AF0B 1JJKA 2BY3A 1OFBA 2FB2A 1E56A 3QW4B 5ABFA 4AD1A 3R7MA 1XLGA 4CNNA 4XZBA 1WZLA 4PUKA 3NPWA 1MXDA 1JUEA 1LT8A 4MGGA 5IFPA 5KEZA 1KO0A 3OZMA 1QPRA 2BXZA 3FV9A 4WY0A 2CLIA 2PZNA 1GYLA 4F0LA 2A7NA 2VEGA 3N34A 4W87A 1JRCA 2V69A 1AQMA 1NU5A 3CL6A 3LGGA 3MUCA 4MUZA 2DUXA 4H6KA 5AHFA 2BOFX 3U48A 4Q8VA 4ZO8A 1US3A 3OA3A 5REQB 1YEYA 3NQ2A 3CAKA 2ZE3A 3G6LA 4RDYA 4DWSB 1BEUA 2X16A 2PWFA 2RJHA 3ZVHB 4W9TA 1W1IE 5E6ZA 2PDXA 3TTSA 1YXCA 3PZUA 4KIEA 3UWYA 5CEWA 4LXFA 5E9AA 2J75A 1PE1A 5BU9A 1TPDA 2DU2A 3PTQA 3T81A 3RM4A 1R3RA 4F0RA 4I3GA 2GOUA 4XG1A 2HPIA 2E67A 2XN0A 3CTLA 2C3ZA 1UWUA 3NOYA 2WBGA 1MUMA 1GJPA 3CWOX 4RR4A 1N8FA 2J9ZA 1GWJA 3PB0A 4FMVA 4NX0A 3H53A 4ASTA 1FH8A 3W86A 4GXMA 4UCFA 4EPDC 4M0XA 3KUMA 1OHLA 1V02E 1YNPA 5HJLA 5D9PA 1WE5A 2ISWA 3NURA 1JDDA 1N8WA 4DB7A 1I75A 3W38A 2EHHA 3NM1A 3MP3A 1SFTA 5HMFA 3S1WA 1EBGA 4QCFA 2QDEA 3QSRA 1R5YA 2QF8A 3QY6A 3PHAA 4HHMA 5D02A 3RRAA 4NJGA 2OO0A 2ZTKA 2DT1A 1VQTA 1ISXA 1T7LA 2X7WA 1E70M 3M47A 3WQ8A 5D09A 4H41A 2VR2A 2VD9A 3ARPA 1EUAA 1UA3A 4GBDA 1QU4A 5AC8A 3F4WA 1R3WA 4ZTYA 3ZQ9A 1IWPA 2J88A 1ONXA 1LJYA 2I9UA 1XLKA 5G1MA 3MMWA 4UXDA 1KM0A 1O5XA 1GOIA 3MTWA 3GR4A 2AL2A 1O68A 1UASA 2PP0A 3KBWA 1QHPA 1PTDA 2PDCA 1IEIA 1WZAA 2W27A 4MKVA 3W28A 1SMAA 3WUGA 3PUEA 1A5BA 2WV8A 4C1LA 3PZGA 2NQHA 2F84A 3UU0A 3P61A 4A3HA 2A6LA 1GVOA 4NHVA 3SUWA 4M7TA 4M24A 5HOSA 3DH7A 3DBNA 4UB9A 4L80A 1KQYA 2Y2WA 2HVMA 3L7RA 1P0BA 1KXQA 4A35A 3EA1A 4MKNA 1PX3A 3SCOA 1E1CB 2Z4GA 4US6A 4Q8NA 5CJMA 3WK2A 4PFMA 3QV8A 1M9HA 4FXSA 2J7GA 3UR5A 4FLQA 3M5ZA 2OWXA 2J6XA 3GE7A 4AD4A 2CZVA 1WYIA 2ATSA 4LVDA 4X0NA 4CCEA 2Y8UA 1E72M 1UR9A 1FHVA 1K9DA 2DQXA 2VWTA 1L9WA 5D8WA 4GNKB 1V7AA 4AY7A 4KRTA 4O52A 2PDQA 5FF2A 1N8IA 4NAFA 9CGTA 2WCAA 4O16A 3ZS4A 3IARA 2XIMA 4L9ZA 3AS1A 1RHCA 1YE6A 2ISDA 2QCLA 2C6QA 1POJA 3CAQA 4R9OA 1XLBA 4DXVA 2QMJA 1FH7A 4G8TA 3ITCA 4YCOA 2YCEA 4C7DA 3ZWTA 4H1ZA 2H8XA 3V1PA 1J6PA 1JXKA 1XLDA 1RBLA 5I3HA 4LNCA 4TMCA 2G3JA 1EOMA 3TAKA 4DJFA 3S5NA 5CC3A 3B9AA 1MEWA 3PJXA 3VE9A 1VHCA 3KW3A 5CZKA 2ATMA 2AMXA 3STEA 4HA1A 1VRXA 3EXTA 3MUZ1 1TJ1A 3KVKA 4XTIA 3UXLA 3GK0A 2ALDA 1AH3A 4A29A 3ZJ6A 1X1NA 8CGTA 2BSLA 1HP5A 3BLLA 3QC0A 2J8GA 1A5LC 3PSVA 4YU1A 2E1DA 1GHRA 2DZTA 1FWTA 3F5KA 3CZ8A 1WXJA 2E28A 3UA4A 2PRLA 5CJ5A 2CIPA 1HX0A 5HJXA 3QZAA 4GCAA 5MF5A 3E9AA 3GO2A 2GGGA 4E8GA 3HN3A 3UFYA 2CBVA 2VVNA 4QJ1A 3WD1A 1W0MA 1KM3A 3DIPA 1FWRA 3W81A 3ZZ1A 3HV9A 4G5DA 1V03A 3C0JA 4GNVA 3V35A 3VK5A 7REQA 4PR4A 1RCQA 2ZXBA 2VQTA 4WJ8A 1Z44A 5BRPA 2PAJA 4HYVA 3VOHA 4ONVA 5IHRA 1E40A 3BLOA 1EX5A 3GNPA 5KMYA 3AQUA 5JVLA 4YPJA 1TELA 3FDKA 4GQGA 4QLLA 1XFBA 3QXBA 1SR9A 1XIDA 3II1A 4JNMA 1VKFA 1VPXA 5DXXA 1JCYA 2YXOA 4HHPA 4BQ4A 3RN6A 2QULA 2Q71A 3ITOA 2VKZG 4XK2A 4DF0A 2F61A 4P8XA 1IEQA 2R1MA 4CU6A 3AU6A 5FJOA 4U3CA 1DVJA 3IJQA 3PBGA 1W3KA 3WNKA 3K13A 3B9EA 2X30A 3TN3A 3CQ0A 2EPOA 3XINA 5CZSA 5AY7A 3QOMA 4OV9A 4HPGA 3I6EA 4NZ5A 3WK3A 5BXSA 3EOEA 2FB3A 1Q6OA 1SO4A 3CGTA 4Q8QA 4N9CA 1XINA 4NNBA 4KERA 3HQNA 1ZAJA 3FSUA 1QOQA 2PPGA 4F79A 3QFWA 2XIBA 4RL3A 1K70A 1NTHA 3G1SA 4ZSTA 3ANYA 1I2PA 3RYSA 1AW5A 3L9CA 4PCFA 4B2DA 1Y8BA 2PWDA 4PMXA 3CAWA 4DM2A 1G67A 2XGZA 3DHDA 2P8BA 4C6KA 1EYEA 1ZL1A 1Z32X 4PE8A 4HPNA 1BKSA 1A3XA 1MDRA 1YHTA 1ZAIA 4GH1A 4MLJA 1XIGA 3NL5A 3VNKA 1AA1B 4GI4A 3VZXA 5CAKA 3SW6A 1TB3A 5I24A 2CU0A 1HO1A 1JQVA 3MYPA 2QUVA 1L6SA 2QQ6A 4AHOA 2XHYA 4IQDA 1FXPA 1CT5A 3LHTA 4Q4MA 2CLHA 1QUMA 1R9XA 1HT6A 2V6AA 3LEPA 1Z3NA 4IISA 1SSGA 2VI0A 1RSCA 2OX1A 3HFTA 2ICSA 1JZ4A 1HTIA 4HMCA 4HK7A 1P7TB 1XX1A 2FGBA 1ZJAA 1DWHM 1T96A 3E1F1 3UERA 1VS1A 4Y6GA 4OECA 1U1HA 4B5WA 5H8MA 3L2IA 1L8PA 1XLMA 1SFLA 4GACA 1G1YA 5A2AA 2WMIA 1CECA 3OVPA 2J25A 4HQVA 3UD6A 1ZBCA 4HSHA 1D3GA 1LTDA 3DFOA 4GIYA 2D3NA 3EX1A 1UHVA 3LI1A 4GUFA 3P67A 1V0LA 2DORA 3MSGA 2E7FA 3OQEA 2ZICA 3VKAA 4ATDA 1TV3A 3OLGA 1HF6A 3MVIA 1NVMA 3UBPC 2CZ5A 3CMGA 1ODUA 3WQ6A 1OVDA 4KWVA 1HXJA 1E6PA 4QEEA 1RP9A 3GBEA 1S5VA 4W8BA 2VZUA 1CWYA 3BC9A 1G7VA 3W6LA 3UXIA 2VQUA 2X0HA 3UZXA 3EWBX 3Q37A 5FJPA 5T91A 3WBWA 4ML9A 1GJWA 4K7VA 2HVOA 1YXYA 1CLXA 5JBDA 3O16A 1QK0A 4JGDA 3SGGA 3GC4A 1JDFA 1UZ4A 3BOLA 4XO6A 4HOWA 5FAGA 1TVNA 5CSUA 4TU1A 3A24A 3PS7A 2XSBA 2IQ0A 4MZYA 4QFUA 1JL8A 5KINA 3LG3A 2OOFA 1ZPTA 3M46A 1V3IA 3G0SA 3SCNA 3LLFA 4PB3A 2VNCA 1LBLA 3KBNA 3LRLA 1ONEA 2PDYA 2UWFA 4M81A 1LOSA 4MJZA 3VX0A 5I23A 3QYQA 5HWMA 1MEIA 4JTRA 5I7GA 3W84A 5EFDA 3RMEA 3MU7A 3G8EA 3LU2A 1TVLA 2DIKA 4JTIA 4K8HA 4MKSA 2V2DA 4EWND 4ICMA 5IM51 1UJPA 3WF0A 3VDGA 3VFLA 1J2BA 4DLMA 3QQ0A 1U1JA 1J79A 5BNKA 1IE7C 4RX0A 3HOJA 2WMIB 3EEGA 3IIXA 3BGAA 4UQAA 2ZADA 1HUVA 1SMDA 4W86A 3IUHA 2PDWA 2PRMA 1PZ0A 1TA3A 4JXCA 4XWUA 2OQHA 1GJUA 1P43A 3LPGA 4GUHA 1KCXA 5M3WA 4RE2A 2J47A 1TMHA 1TWDA 3MUAA 5I3DA 2OWWA 2R6OA 3GKFA 2EF9A 1GORA 3MCNA 3NIYA 3CB8A 1O1HA 1MRAA 3W7MA 4Q7BA 5K9CA 1PXGA 4RXGA 2VEPA 3CIVA 3PF3A 3GDBA 1CENA 1Q6DA 3LHVA 5CBIA 3OQ8A 2V63A 3P80A 4LV4A 4MUPA 3QMTA 3W71A 1YW1A 1W1VA 3R13A 4O0KA 2VRQA 4JCLA 4AVFA 3QHOA 4AD3A 4H6RA 3CS2A 3S4TA 4F2UA 1E4IA 1NWTA 1PL9A 4OBSA 3LSCA 4DZHA 3LCIA 5I03A 2A3AA 1OFQA 1X97A 4AEOA 3P0WA 1H49A 3UWEA 2R94A 1IHIA 2J79A 2XUCA 3A4XA 4S2BA 4DM1A 2O9PA 3E02A 4Q8OA 4KKXA 2OYKA 3NQEA 1B9BA 4LBUA 3W72A 2Q6ZA 3FYPA 4XZIA 4WGHA 3TV8A 4C6BA 2VX7A 1RCOB 3TC3A 2RDTA 5FJJA 3NZRA 4FNQA 1VH7A 3EMQA 2C19A 3G22A 1XW8A 1LWJA 5CG7A 3WNOA 4AVOA 4JAWA 1WB0A 4KCVA 1VFOA 2VR5A 2XVPA 4HNLA 1GYMA 4H6EA 1RK5A 2J7DA 4QSFA 1KBLA 1T6MA 4AZHA 3DX5A 4DWSA 4TVUA 2P1FA 4J27A 2OO6A 3B05A 4WJXA 4FX8A 1C8XA 3R89A 3WF2A 1Y5VA 4J3XA 2D73A 1ICPA 1KFEA 3CV7A 2VZVA 3H2NA 3VUSA 4MFEA 3MKCA 3PJWA 2VFGA 2JKEA 3AROA 1SSDA 4C6LA 2EPLX 5DT5A 4E5TA 1JYWA 1LM1A 4ORIA 5JBFA 1WCGA 3VMNA 1KWGA 3CHFA 1LOQA 2ZX6A 4RZ4A 5D9NA 2ZDRA 3N9RA 4XBKA 3PFMA 2AOSA 1UOKA 1PX4A 5EL1A 5LNSA 4L9XA 4O13A 1QO5A 1KFBA 1JCMP 3DHPA 5AVNA 1EHAA 4NXSA 3W0KA 4JS3A 4AZGA 1DIOA 2VTFA 3ZLHA 1QOXA 4IHCA 4Z2JA 2ZZ1A 4O18A 2BVYA 3U2EA 2ZIDA 2FMNA 2R1KA 2FDMA 4WOQA 3C2FA 5GJNA 3BAKA 3GU9A 1VLIA 3HB9A 4G1KA 2C13A 3B03A 2D0HA 2DPEA 1ME7A 2GVEA 1ADSA 2GJRA 2C0AA 3R5EA 2ASHA 2HQAA 1JVNA 5C9XA 3TN6A 3H23A 1KTCA 4JQ3A 5AHNA 1S3HA 1P48A 3V75A 4ICCX 2ZZ2A 3WX7A 3T55A 4ZFCA 3P82A 2GWNA 1R3YA 3GUWA 1KCKA 2BLEA 3AIEA 5FSDC 4J3TA 4R7WA 2PF8A 2GSEA 3NWRA 4EXAA 1FX6A 4ZSUA 5B7ZA 3I3EA 1UYQA 3N04A 1KBIA 4GJIA 2V5BA 2YJQA 4N0RA 1TX2A 2FTPA 4U2YA 5HR7A 4CD4A 2GGJA 4H7VA 5I02A 4KEZA 2XGBA 2QZRA 4LB3A 3U2CA 2VL4A 3EX3A 1E43A 4HCHA 1JAEA 1SZGA 2OKTA 3OU8A 2HV5A 1OYBA 2BP1A 1MUCA 3RCYA 1K7EA 5HUPA 3PR2A 3MDWA 3A3HA 1FCVA 5A6BA 1PKNA 4D1IA 4K1GA 1L6WA 1FHUA 2CZEA 2WJZA 2EXOA 3IUDA 4ZO9A 1V3HA 4IIDA 4EACA 2WO5A 2ZA3A 4NNAA 4Q8UA 3B06A 2A4AA 1OF8A 4B4FA 3ICJA 4GGBA 4AAJA 3I3BA 4KT2A 1R8LA 5DBTA 3W02A 4KWOA 1GKRA 4BQ3A 4LQ1A 3HURA 3G8RA 4B5XA 1OG6A 3F4NA 1EJVC 2XIIA 2D24A 3K30A 2BWGA 2YLLA 1W9BM 3NPUA 3AMKA 4V15A 4MTVA 4HNTA 2DT0A 1R9ZA 2PDPA 3ARXA 2WSPA 3D46A 1I2RA 2HBXA 3LM3A 3RIKA 3SGUA 1P1MA 3EWUA 1DWAM 4UFKA 3SIMA 4Z1CA 1P6CA 3GZAA 2E9MA 3OA5A 1Z69A 1F7BA 1S2CA 3VNJA 3FOKA 2WJFA 3WJWA 3AXHA 4DIAA 1KLYA 1YXDA 1NJJA 3UR8A 3NTYA 1GW9A 4JZ5A 4O1AA 4FNRA 3V5CA 1XYFA 4C6OA 3BV4A 1EP3A 4LVGA 2JF7A 1D2KA 2WVSA 1C9DA 5TIMA 2WJDA 3KDNA 5C71A 1X1ZA 4XISA 3TKFA 3KOYA 3P93A 5C2CA 4NASA 2BNJA 5A69A 2FZNA 3M0KA 2PSNA 1OG0A 1CI1A 3VGBA 3OLIA 1IIHA 1B5TA 2PDHA 3ARRA 1KA9F 3AISA 3NR0A 3LK6A 2HK1A 3SJ3A 2PFHA 2AGTA 3WO8A 1MDLA 3TLLA 2OSWA 3G1AA 1ISWA 4GMEA 3URBA 3REQB 4DBDA 4M7SA 1XRTA 3W7GA 1OCNA 4J3VA 1RJQA 4WDTA 3OP2A 3VKJA 1TTQA 1BWKA 3WH8A 3PPFA 1E6QM 4MB5A 4EE9A 1UBSA 3OB8A 4LCQA 1ZS2A 4HZ8A 5LIXX 3W73A 4M6QA 3N4FA 3S1GA 2Z2BA 2C16A 2JK2A 4RPQA 4ZE4A 2BY1A 1VYRA 4K38A 3EYPA 3PP7A 1PYFA 1X39A 3CZKA 3BMWA 3V18A 4OOZA 4H9ZA 1C9WA 1S5WA 1OWQA 4L9YA 4I7VA 3R8GA 1K8ZA 1FWFC 3RLGA 4JIHA 3C8FA 4DRSA 4NX5A 3OZYA 1DXFA 5LIUX 1S2AA 3VPLA 2QUTA 4LUJA 1FWJC 4PMZA 2WMFA 5D8ZA 4UTKA 4B3KA 5A95A 2B0MA 3STGA 1S2VA 3WD4A 1VFFA 3FFSA 3R4IA 2CC0A 4F3HA 4ML4A 1M6JA 4MZ8A 1NQKA 3W7PA 3HJEA 5LNVA 3C56A 1VCFA 3M7WA 2FTWA 5AHIA 3IACA 5CC7A 3VIPA 3OLEA 2DZPA 4XO7A 4CQAA 4Q8WA 4U31A 2X0YA 3ERPA 2E1WA 2WVVB 1KRCC 3IV8A 3HTWA 4GINA 4IUGA 1LG1A 1ZUAX 2A3CA 1ZALA 2PP1A 4WR3A 3CNYA 3S8HA 2HZGA 1IV8A 2JIWA 3W1NA 5CKSA 4ATWA 3NOEA 4PMVA 4GVFA 4QSHA 1O95A 4HHHA 3WUFA 4BEUA 1YRRA 2XJ7A 2A3BA 4MLRA 2DZBA 4UR9A 4AG0A 2CHNA 4UBPC 3WSUA 2WZTA 4MNLA 1EJUC 5K4ZA 5DCEA 1PIIA 1LUCA 3GTFA 2PTZA 1ZP4A 4F9DA 1HKKA 4AF0A 3TTYA 1Q6EA 2GDUA 2FKPA 4HNNA 3W1RA 5LXXA 5D04C 5DCBA 1S2WA 3M9YA 3S46A 2Z1SA 4ZXOA 2X8RA 5EA9A 3H26A 4AH7A 4HSOA 4Z0SA 2QHAA 3ID7A 1E0UA 3DKJA 2GGEA 1BWLA 4MYAA 3LN3A 4H2CA 4CUCA 1YKWA 3W2NA 3TDFA 4WRHA 4F9JA 4AZCA 3WKZA 2Y88A 4AD5A 4FA3A 4WVXA 2PDFA 5F2IA 2CZFA 4DNMA 4GIEA 3N19B 3O8AA 3WDJA 4ACYA 3GXTA 2J27A 3QPYA 3S9YA 1XHGA 4F0HA 1D8CA 3L23A 4R88A 2EPNA 1E4NA 4QNEA 3ARUA 3KFTA 4DI9A 3VFCA 2NQ9A 2FFCA 4D8AA 2ISSA 3I65A 2ZUVA 5LHEA 4K3ZA 1QNVA 1G4EA 4IFKA 4A3QA 4DUVA 3E12A 2UY2A 3VIOA 3ALGA 2ZZ4A 4ZE5A 5K2ZA 1F3WA 1E55A 4NUWA 2P50A 4S3AA 2WPGA 1UKQA 2O7SA 4WGXA 3S9IA 3MJYA 5C70A 4B5VA 4JDBA 3QEZA 2V5LA 5DMLA 3I10A 3GFZA 2DP3A 3LMYA 4XUGA 3HPSA 5LKYA 2V67A 3NZ1A 3JRKA 4GKLA 4QDMA 1A0EA 4LUIA 3AS2A 2NV1A 3NQAA 4YS1A 2Z2UA 1AH0A 1KV8A 2FGZA 2J7EA 1V0NA 3W22A 4L56A 5CZJA 6A3HA 2J7BA 1QI5A 4EOUA 3C2OA 3K1DA 5M03A 4L1XA 3SADA 2BY0A 4JR5A 4GBUA 1JFXA 1OADA 3QRHA 1Q3NA 3TFCA 4JIPA 3SN1A 3T0CA 4RDVA 5F1UA 3PWIA 1DWIM 1QI2A 4W88A 1ZAHA 2ZRWA 4O1CA 5I77A 4ZB2A 1UROA 3WH9A 1RA0A 3EA2A 3VCNA 3MWCA 3V5OA 2B7OA 4UTFA 2V3GA 4JKLA 2YCJA 1KRMA 1O4UA 3QTPA 3GVQA 1JPKA 2F6XA 2NUXA 3OYXA 4X22A 5L6UA 1Y65A 1LLOA 1W5OA 1XLFA 4HTYA 1MNSA 3MB9A 3HGSA 4MY9A 1EJWC 1DHKA 4ALDA 4MIMA 3OHMB 4MYXA 4E4FA 1QCWA 4PCSA 3HGRA 3A5VA 3EDDA 4L1WA 4PCPA 5K9DA 4DO6A 2CEQA 1TPUA 4HPJA 5ENLA 2CBUA 4Q32A 1UUMA 4JFWA 1RR2A 1VPQA 1VFUA 1F5ZA 3PN8A 4GC4A 4NYUA 3ZMRA 1O94A 3QV6A 3IK4A 3BUVA 4IUOA 2YFOA 1YYAA 4YTUA 2OEKA 2Z29A 1UWTA 4DO7A 1PYMA 4UWMA 1NP2A 4QE1A 2QV4A 1HKWA 1XSJA 2QJHA 4UFLA 1TZZA 5BXRA 1NWUA 2EKGA 1L2QA 3H4XA 2NUWA 3CMFA 2XGIA 2VELA 3OGVA 1ISVA 2HE8A 1A4MA 4PFHA 3BW2A 4QISA 3WQDA 5D2XA 4IF2A 1OC5A 1JDEA 2F9RA 3CV6A 3A4WA 2WSQA 4B9YA 2O55A 2OZ3A 2GYIA 5GVJA 3KDOA 2ODOA 2PGEA 3FY1A 4X61A 1SM9A 1SW0A 3O2LA 5CC5A 3CK5A 3R11A 3N1AA 1A47A 5TQLA 4JN8A 2VFHA 1CZ1A 3IPWA 3U4FA 1YTDA 5AYXA 1NARA 2GK1A 5EYWA 4XTDA 1QNSA 5D03A 1KQZA 1WDWA 3LA4A 2GPTA 2NQLA 3E6EA 4LVBA 4L4PA 1VEMA 2CETA 3GIYA 3A3XA 1SFJA 2PUZA 3QR0A 3W23A 5CBBA 1O7AA 1XG4A 2VX4A 4L61A 2V8ZA 2QJMA 3BURA 4LF2A 4TVCA 1LBFA 1X98A 1H61A 3W2LA 3DDMA 2PWVA 1W37A 3PAJA 3PZ9A 1R86A 4O4WA 2PTDA 4UTUA 1EB3A 2FJUB 2WMJA 1TPC1 1UR8A 1OFPA 4ZB5A 3AHXA 2CW6A 4QLKA 3L66A 3WNMA 1C90A 4Y9MA 2PZ0A 1EQCA 5DANA 2OYMA 3DFPA 4LALA 5IFTA 3LXBA 5A8QA 4L1GA 3CJPA 3G0XA 2A7PA 5GNYA 3QKZA 3WJYA 1NY1A 1WOBA 1GGOA 1K9TA 3FHAA 1JCXA 2XTKA 4HKPA 4AZIA 4M5PA 4LYPA 1K03A 2YA2A 4UOZA 3W53A 1BWVA 2R9RA 2YGYA 1RVKA 2Z1XA 3ES8A 4LVFA 5XIAA 1V3LA 2RHGA 4BI6A 2ADAA 5HAOA 2D69A 5D05A 3L67A 4BKNA 1PEZA 4PH6A 2EAWA 4KFOA 1FKWA 1OB0A 1PB0A 1ESWA 3KVJA 1LYXA 2DW6A 3EMZA 1SW3A 1ZBVA 2CWNA 2XH7A 3W6YA 3WMBA 5J5RA 4WJEA 1GKQA 4JOMA 1AVAA 1Y0EA 4JTHA 5AC6A 2VCAA 3MSRA 1ECQA 2NLYA 3NPVA 3AZTA 3R79A 2WHKA 1V6TA 3W88A 2JBMA 5K3VA 2A79A 1OCBA 3PWAA 3GYCA 4RKAA 2QAFA 2J62A 3KOFA 3RO8A 1TPEA 3DGBA 3T40A 1OX6A 5DELA 3FN9A 3OYZA 1KWKA 5IDZA 4HT3A 5A6KA 4MG4A 5MKGB 1TJ0A 4GVIA 1DXEA 1EGVA 1JCLA 4AEFA 4IL2A 2NSOA 4AYSA 3CUJA 1TG7A 3T0BA 4I9MA 3LNPA 2F6KA 1G5AA 2E5DA 3MZNA 2WVVA 5M5DA 1A5OC 5CGQA 3KP0A 2YL6A 3N13A 1MW1A 1V3KA 2AQWA 4PCTA 1CB2A 1KFLA 3B8VA 1XYZA 1QOPA 5AB3A 3S5OA 4HD5A 3ATZA 1HVXA 2YCLA 3GXMA 4Q4SA 5KTLA 4CNPA 1NDWA 4KEUA 3AIUA 2OT1A 3VIMA 1A50A 3S5SA 3TJLA 1XRSA 1HJQA 4GPNA 4S39A 4RLIA 3SJNA 4JTQA 2PDUA 1VBJA 1VBHA 2OZ0A 2NWRA 2OCZA 3GXIA 4GJ1A 1SO6A 1U5JA 3CLWA 2YB4A 4CD6A 4OUIA 1ZCCA 2O4QA 4QM1A 1M03A 4DHGA 3Q94A 4DXKA 1O6IA 3KOXA 1E9YB 4XAYA 3AOFA 3GB6A 4PGLA 3LM7A 4PUJA 1FWDC 2V38A 5C0QA 3TX9A 1ZU8A 3LQGA 4GABA 4FLRA 3MBDA 3UVIA 2J24A 3HQOA 4J1OA 3W1XA 3R8HA 1GVEA 1TA3B 1IT8A 1UR1A 3UG8A 3M4HA 4X0VA 4GRSA 3VM5A 4CNSA 4CD5A 2WZEA 1UR0A 1EF3A 1LRNA 4H83A 4FNTA 2XWDA 1GG1A 2PDGA 3UNTA 1UMLA 1VRDA 3DG3A 1KB3A 4GZ7A 1VBRA 3ZFHA 1F4HA 3SY1A 3QMRA 1DJNA 5BCAA 3ARSA 1DEDA 1UD8A 3K4DA 3VIJA 1KLZA 4GA8A 3RCMA 3BK0A 5T9BG 2FIQA 3CPUA 4OV4A 3OLDA 1IWAA 4G7EB 1LQAA 3M41A 4O19A 4O0QA 4F2TA 4MHBA 2YSWA 2A6NA 2CHRA 3NA8A 1BTMA 1QXLA 1QNOA 2FVLA 2GJNA 3S2JA 2JIEA 3PJTA 2WLYA 3LRMA 1EO5A 2ZUWA 3AO0A 3EKGA 3H2EA 3NSXA 1V08A 4FX6M 2VENA 1W1B1 1DORA 5E5CA 1OEPA 3R43A 1JPDX 1CXFA 2VOTA 2DSUA 4I5RA 3UG5A 3HJZA 5I3JA 2CXEA 3S47A 3B40A 2VFEA 2F38A 5A6JA 1M1BA 2PCEA 1OBAA 1D7FA 1QW7A 3CWHA 6TAAA 3ZR6A 1XLJA 4NVTA 3J7HA 1FP9A 1NM9A 1XJBA 1YDVA 5DCDA 1XC4A 2AMGA 4D1JA 3RMJA 4U4MA 3FLUA 4O1EA 3W83A 3GWQA 2BBFA 4WUIA 5FI8A 4BF5A 3W2KA 3WLJA 4O11A 7TIMA 2GLKA 2ACSA 2CCRA 2ZRVA 1AZ1A 3LUTA 1LL7A 2FGLA 3C3UA 4OHQA 1C8VA 4KETA 2EG6A 2ACRA 2IKJA 3MCOA 3WQ4A 4IXHA 4C1NB 1G9HA 5FF3A 2GVYA 5JQ9A 2ZXAA 5LXEA 1TV8A 5T26A 1E3ZA 1ZY9A 2C1IA 1C8YA 4DJEA 3TNBA 3N4AA 3GR7A 2WVTA 1QHZA 3EKZA 2HCVA 3G24A 1IXQA 1KM2A 5AYZA 4UFIA 4INFA 4IFKB 1JCJA 3QGVA 4HZ6A 4PEKA 4H19A 4RXFA 1NFBA 3O63A 4H2HA 1EP1A 1LG2A 3PNUA 3TONA 3SCPA 1RPKA 3IUIA 3E96A 1M7OA 4D6CA 1HGWA 1O1ZA 1TVPA 2DT3A 3IAPA 4AMCA 3ITVA 3GH4A 4I9AA 1L6GA 2QIIA 4Q7NA 3THCA 4OBTA 4V2XA 1C7SA 2FZBA 3B04A 1US2A 3LCGA 1GG0A 2D2GA 1E0XA 3TE9A 5GPRA 5PTDA 1OD8A 3VDAA 1VFHA 3OIHA 1E4MM 3EOSA 1GT8A 3EOUA 1UIOA 1B3OA 1PTAA 3G2GA 4H3DA 2QVHA 4NJKA 3ARQA 2OGYA 3N15A 3LV5A 1W3HA 2PE4A 3LLXA 3RJYA 3TR2A 4LCRA 1H2JA 4DWSD 3W1TA 4RV8A 1HNYA 6XIAA 3MT1A 5AC7A 1A0CA 3UPWA 1W3NA 1EUNA 2ZC8A 3QBUA 1YTKA 3L5MA 2QCDA 5F2GA 3A47A 2Y24A 4CQBA 1S3TC 4S1FA 2PDKA 1OY0A 2VWSA 3DFQA 3WLLA 2DZSA 1WDDA 5D4YA 4CCCA 3UWZA 3GR8A 2QUNA 1PV8A 5LNRA 1QRQA 2WM0A 3MA8A 4GZEA 3QPEA 1K8YA 3WD3A 4IH3A 2WKJA 4QG9A 3M0JA 3WY1A 4MSSA 1CW2A 5FEXA 3TZNA 1AL7A 4L5ZA 3W01A 1I8JA 1B3VA 5AHMA 3LCHA 1ITUA 1XIIA 1VJZA 3WENA 4QE4A 4LFYA 5JUVA 3TN5A 3QN3A 3VKDA 2YIHA 5C2XA 2HTMA 1YPFA 4NYYA 3GNRA 3BH4A 2ZQ0A 5L9FA 3SUTA 3KLLA 1GOWA 3DCPA 1PZ2A 5HQLA 3GG8A 5CPMA 3S5ZA 1B3YA 4HNOA 1OGGA 4ECLA 1EJ7L 4G1NA 3BQ5A 2ZWZA 2GQ9A 4HGXA 4O0ZA 2DZVA 4KESA 3EB4A 1ML1A 1PIFA 3GU2A 4CQ8A 3EB3A 1B3ZA 3TTEA 3WJSA 2IKHA 3P14A 1B30A 4KWSA 2GOKA 5DN1A 3A9BA 2DVTA 3DYPA 2X1UA 1QHOA 1CB7B 3MCMA 5I07A 2XH2A 2DH2A 1XKJA 3EX2A 3R2GA 2YL8A 1OX4B 2PB1A 4ERIA 1NOFA 4UNLA 3AZSA 4DZ5A 2I17A 2D3LA 4GYPC 4LSBA 3VDHA 4PTWA 8RUCA 2E40A 5I2UA 1R87A 3TQKA 1XRVA 2XN2A 3KZSA 3P84A 2YFNA 3TA9A 4DYJA 1EDGA 1CX9A 1OGBA 2VZSA 2P88A 1ITCA 1KXHA 2BFGA 3HG4A 2W3ZA 1MZRA 3L4ZA 3ABXA 3NUKA 1W91A 1MW2A 3AALA 4UR8A 4Y8FA 4HCDA 4PSPA 1GUVA 1GOOA 2Q8ZA 4EKJA 1EF2A 2O92A 3GDLA 5I5RA 3GU1A 4JYFA 1QI4A 1R7AA 3T0TA 3GM8A 4MWAA 1HJUA 2ZDSA 1EJXC 1HL8A 1OZMA 5BWAA 5EB8A 3L4UA 4FO4A 1G0CA 3SQSA 1AMYA 3H12A 4P8UA 2X1RA 4Q4RA 4HK6A 1M7JA 3JW7A 3BLFA 1I1WA 4XB3A 1UBPC 2PDMA 1ZTVA 2IS7A 4KGJA 3NQMA 1HJXA 4JQ4A 3GNNA 2J9YA 2D0GA 1QATA 4UTLA 4NXKA 5A8PA 3TA6A 2QXWA 3WCZA 4PB4A 3RK8A 5ABHA 2PF0A 4N9DA 3GXDA 2V5DA 3OVGA 3B0XA 1IGSA 1R46A 3DFSA 3L4VA 1DP0A 1K77A 3EZ4A 3VYLA 4A3YA 2GJPA 3W2JA 1DJZA 1F76A 1XBZA 2A3HA 1EA0A 3WUEA 1BTCA 1MQRA 1P6WA 2ZA1A 2Y70A 1KGUA 4WSHA 2R82A 3S5YA 2DJXA 3UW6A 5RUBA 3WBEA 2YCKX 3FXGA 3GDKA 4OUEA 4J3SA 3LCLA 2H8ZA 3PFRA 3AS0A 1K02A 4MDOA 3ISIX 1W5PA 2J7CA 3W7NA 1QWKA 3LHYA 1RJPA 1U22A 2XG9A 3OG3A 1UB3A 2PCQA 4AIEA 2X2YA 4HOZA 4BWLC 1YMYA 3AU2A 2Z25A 3MANA 1KM1A 3RUBL 5IBXA 1CTNA 3LRKA 2Z2AA 4EPKA 2PDJA 6REQB 5CC6A 4C7GA 1QPKA 3U2OA 1L8NA 4MNKA 3PM6A 2YLAA 4I90A 2GJXA 1C8QA 3R1ZA 3ARTA 1V93A 3UPMA 2YOCA 1XYBA 2WHLA 5EMLA 4JDYA 2OG9A 3NDYA 5EMJA 4AHPA 3VD7A 3LBCA 4HA3A 1CGVA 4MAZA 2CERA 3R6IA 4MWAC 2Y7GA 3O7UA 4TV6A 4FZIA 2DDXA 4O15A 1UMYA 2CLMA 2DH3A 1M01A 3V0SA 3VKKA 4EF9A 4XAGA 1MNZA 1GOQA 1CGXA 2HVNA 1OJXA 3MI6A 1I2NA 3QW3A 4PUWA 3WDIA 3BVJA 4J4KA 2FDSA 3N73A 3SQMA 1C92A 2D2HA 4UNIA 4JIQA 2VUNA 4GUJA 1GZJA 1E1FA 1Z41A 1OX4A 3AMDA 1RH9A 2Y4SA 2CBIA 3VOJA 1E6SM 1Z89A 4PUMA 1GEHA 3T0AA 4MJMA 1GYNA 1W3IA 3DI1A 4DX3A 4F0SA 3NSMA 5DQPA 1ADDA 4YYCA 2A2IA 1P4CA 4BI5A 3BSGA 4PUUA 1TRIA 5GJMA 2VEKA 3DG7A 1F61A 1BLIA 4S38A 4H8HA 1E1EA 4N02A 1KD0A 4HIBA 1QPNA 4C5YA 1SJDA 1PBGA 1PTGA 1XCWA 4R7JA 4UTWC 4LCSA 2OJPA 3V0UA 3FVMA 2H3BA 3TH6A 3UCQA 1XWYA 4AW7A 3AYVA 3CZEA 3L2LA 4JKMA 3T42A 3WF4A 3HQ1A 4YNGA 2R8WA 3S1UA 4NI8A 2E5BA 3L68A 4QNWA 2CWXA 2ZUSA 4V1YA 1PZ1A 1TPH1 2OFJA 1A5NC 5EMKA 3H2CA 4US5A 1SO3A 2QCDB 1NH6A 4RNJA 2WSYA 3BCJA 1W2VA 3PPCA 1KCLA 2E25A 4JTKA 4C6MA 3W7CA 4G6CA 5AC5A 3CUGA 3QV9A 1EPXA 2W6RA 3UZWA 2VURA 3VCRA 3E0FA 1U5HA 2HE5A 2CKSA 1A80A 3H21A 4K39A 2WHMA 2RGLA 1Q2RA 4IM4A 1UP3A 3IIPA 2QPUA 4PYSA 2NX9A 2PDIA 3F4DA 4B9ZA 1MO0A 1WBJA 4GZJA 3U5YA 1WUFA 3TCEA 2J78A 4M6UA 3U7BA 4LJ3A 4YHGA 3CZJA 4AYGA 4F66A 4E4PA 3TYDA 2ZXQA 1ZP3A 2HXUA 3B8DA 4UOQA 3ECQA 2Q3RA 2W62A 4LTSA 1KKRA 2I5GA 4KEVA 1NIUA 3IVUA 4AHQA 2YL5A 2QGYA 2DZWA 3ZJKA 2C1GA 3VE7A 1VC4A 4W8AA 2BXYA 4OIFA 2VC9A 3A9IA 4ES4A 4A8IA 1OGSA 1W32A 4QJ3B 1HN1A 3AJXA 1GQJA 3R0KA 4QX4A 3G3MA 4NQ1A 3B3DA 4PTXA 1JUKA 3STCA 3PZVA 4XSMA 3XISA 1TPWA 4PRWA 4AY1A 4NZ4A 3FX4A 4E3TA 1M3UA 5HK4A 3MJMA 1ZHAA 6TIMA 1JD9A 4AD2A 1F6KA 4AIUA 2OSXA 3A64A 3C6CA 4JYDA 4UMAA 1ITQA 1XBYA 4OZOA 4DI8A 2UY5A 2GK1B 5G2IA 1Q5MA 2VC6A 2NQZA 3H55A 3HU7A 3I7QA 3NJ3A 3WQWA 4A05A 2HPMA 2YPIA 2VR4A 3VOIA 3VX1A 4LW7A 4HU8A 3L0KA 2XISA 5XINA 2POTA 5BROA 4B5SA 1EWDA 4UZUA 5DY2A 5KITA 2FPTA 4H8VA 4XSLA 2R1PA 3OW1A 1F73A 4RNHA 3P2VA 3RRXA 3TFXA 5LA2A 2NT0A 4C6EA 2NWSA 4PTMA 3T78A 1NF0A 3KHJA 4YMZA 4L4MA 3IS4A 3T08A 3C2VA 4PRTA 5A6TC 1S1RA 1YPXA 2E09A 1OFDA 3UXKA 5TAOA 2R91A 4JTDA 4GY1A 2PBOA 1TJPA 5C8BB 4G7EA 4V27A 1DYSA 3L4WA 2BX7A 1VIZA 1R9YA 4DJFD 3BOFA 4C6IA 2OQYA 1PIGA 3NM3A 4E3VA 2VC7A 1HL2A 3AYTA 3UXAA 1J0HA 2WC3A 4FI4A 2VHLA 4JD4A 3N6HA 3IJIA 4AC1X 1W1ZA 3TTQA 3FEQA 2OYLA 1PDYA 4MWAB 4WSJA 2NV9A 3SUVA 2C18A 1Q85A 3QGAC 1HG3A 3WG6A 2QJIA 2QJGA 1REQB 3AIVA 3URNA 5FCZA 3TC6A 3CM4A 4N2YA 1XXXA 3A4AA 2V0TA 4IPNB 2V82A 1J0YA 4WEVX 1FUYA 1E73M 1Q63A 2CLLA 3NZGA 5C7HA 1MWOA 2PLCA 3VNZA 4TXEA 4AZ7A 4HNUA 1M41A 3GW0A 1OIMA 3GS6A 1AFSA 2IPGA 5IXEA 3SI9A 1QNPA 2RGMA 3CUZA 3GHTA 4LS0A 4KCTA 3I7RA 3ZXWA 4JTTA 4GO8A 1VBUA 3ENLA 5F2LA 3B4UA 3PZNA 2HRWA 3DYOA 1DJHA 1XIHA 4AXKA 3GDTA 3GNOA 4J2PA 4JHOA 4XUYA 4DN1A 1UG6A 3WDHA 1SJCA 4HYWA 4X9SA 1JZ2A 2G50A 3VILA 4YCPA 4AX6A 2BGQA 1E71M 5C9UA 1PPIA 3UNDA 1LQ2A 2YR1A 1G4SA 1SJBA 2HS6A 4GOAA 4B91A 2ZZ7A 5AKQA 3QGKC 3GTNA 2PWHA 3M07A 1Q7ZA 1KR1A 1YLVA 4H9TA 3H4WA 1VB9A 3TYZA 3FYOA 3GG7A 3BJSA 1AJZA 2CHOA 4O12A 2PGRA 1TV2A 2UBPC 1CXEA 1TWIA 3E74A 3GKAA 4IICA 4GLEA 2GQAA 1HKJA 4J5NA 4XZNX 1D7KA 1KBJA 4E8DA 1EYWA 2OLSA 1V3MA 3NQ6A 1T8QA 1RBOB 4ZQMA 1Z7AA 1GOKA 1VBGA 4GHRA 4KF1A 4EF8A 4XBSA 4ADUA 2QUUA 4EK7A 1I60A 1UD3A 2MUCA 4CKQA 3WD0A 2NXIA 3DEQA 2O7QA 1EX1A 2X40A 3U57A 3KOZA 5CCZA 1W8GA 3LPFA 3T44A 2OT0A 3C0LA 3OHIA 2P10A 1XIBA 4X2PA 2VD8A 4S3CA 1HP4A 3OG2A 4K8EA 2EPHA 1EOKA 4AZCB 4XD3A 1J8VA 3T07A 2VGIA 4CQCA 5A8NA 2BHYA 1OFOA 3OO2A 4MWAE 2X0SA 3H2OA 1P0NA 2WQDA 3W7IA 1I2QA 1M7PA 1GVSA 1J0ZA 2RH9A 3T2QA 1U33A 1KRBC 3MP4A 1V79A 1CNVA 3VI2A 4AX7A 4N9BA 2Q3OA 4GE8A 4RZ6A 3IJ6A 1A0DA 1K8CA 3NEVA 1QO2A 2AQOA 4RW5A 3CUFA 4G2DA 5A5WA 5FSEC 3UY7A 3QYSA 4Y9PA 1SGJA 4U10A 3CYJA 3CUIA 4MPQA 2EBNA 2XM1A 4J7RA 5FEPA 4IPLA 3VNMA 3EXRA 3SECA 5ABFB 2XVNA 2CLOA 1K6AA 5DRCA 4HMNA 3H24A 3RM9A 3PULA 5D2TA 4YLWA 3R25A 1FKXA 1EEPA 4RZ5A 2YA1A 2C7FA 4E0CA 3SCQA 4D2JA 5CLTA 1E15A 3WDRA 3UR2A 1WKEA 3K8MA 3L0GA 1XLEA 3N2MA 1W56A 4PSRA 1RAKA 3NXFA 5HNTA 1DJYA 3PSWA 4KIRA 4LYQA 4GYJA 1Q45A 2KZHA 1XGDA 5FL1A 4Z2KA 1SO5A 2V5JA 3WZ0E 3K46A 3HPZA 4OKDA 3T09A 4PBGA 1FWNA 4O53A 4AXNA 3EWDA 1XP3A 4JEJA 4IG2B 2CITA 2DSZA 1QVBA 1N7KA 2CLPA 2VX5A 4KRZA 5M2FX 3E2RA 3A13A 3NZQA 3OBEA 5DMNA 4XX6A 3ZOAA 1XSKA 4LAMA 1IXOA 3F2CA 4C6FA 3M44A 4QQUA 4F40A 5JXQA 1BGGA 3DESA 3MI3A 1D3CA 4O8RA 3KP1A 1DPMA 4XKYA 4WKAA 1I4NA 1XIMA 4KRUA 3S3GA 4OWGA 4IGMA 2NT1A 4O1BA 4ZMGA 3HMCA 3FAWA 2WJEA 4O4VA 3VD5A 1F8IA 3KCLA 1KCZA 3NL6A 1JZ6A 3HV8A 2DSWA 3C5QA 4XZ9A 4JEQA 2ZYFA 1WZMA 2Y63A 5HQMA 3GC2A