3NYLA

The x-ray structure of an antiparallel dimer of the human amyloid precursor protein e2 domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
TPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer dis
publication title The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 79
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nylA00
3UMIA 5BUOA 3UMKA 3PMRA 4RD9A 3Q7LA 3NYJA 3K6BA 1TKNA 3Q7GA 4YN0B 3NYLA 3K66A 3QMKA 4RDAA 3UMHA
chains in the Genus database with same CATH superfamily
1HW1A 4M63A 4YL1A 3U9JA 2YL3A 2PBEA 3EGDB 3UGOA 3DAGA 1M2VB 2IOQA 3GEEA 2ASRA 3LS0A 1FFHA 5KYXA 4E0IA 1ZYRF 3EQLF 1CGOA 3NYMA 3IQTA 2VB6A 4DRIB 2P0NA 5FCLA 3LLIA 3KYJA 1JAFA 2ZXRA 5A6BA 3C8GB 5KYNA 4I1OB 4CSAC 3ABMC 1Q0DA 2M4EA 2P6VA 3B29A 5JP7A 1ZW3A 4U9DA 2A6EF 1MMGA 4BG0A 5JUAA 1EQ1A 1E84A 3N2ZB 4CDYA 1PD1A 4FAPB 3VF0A 2X0CA 4FESA 3SXKA 2EPLX 3RIPA 2RD9A 4Z9HA 4DJ9A 2CDQA 4YT2A 3GM3A 4OIQF 2XXAB 4OIPF 2HFIA 3EHMA 5DS5A 2P61A 3ASNC 3K6BA 3S27A 2PX0A 2GA0A 3FVYA 3NRHA 4K0DA 2R03A 3AGUA 3HLZA 5KYWB 1E2XA 2G3VA 3H2VA 3EZHA 2BL2A 2D5RB 4P9FA 4QI0A 2JD3A 4ZLDA 3MX3A 3NMJA 1PD0A 2H7BA 2DI3A 1ZU4A 3G4ZA 2Z15A 4JTDB 3U2MA 5CI8A 3T6JA 3E9VA 3L0IA 3L8JA 4D4XA 4U5CE 1QZXA 3ZG1A 4PJJA 3TQOA 1YA7O 1YJGA 4KBLA 2LK4A 3DI5A 2NSGA 2KSFA 4X0RA 2O9XA 3C18A 3C8GD 3GANA 4ONSA 1XWJA 2J8WA 3QW0A 1B68A 2R7RA 2PNOA 2XLDA 4U5BE 1E86A 3K33A 3HKKA 1MQVA 2EINC 3GORA 3C7JA 3RF3A 4CS7A 5A69A 1TWAA 2C03A 3JZ0A 4QI2A 1MNDA 3AQCA 5EHHA 3QVYA 2IXMA 2XL8A 4HE8D 2J0WA 3ASOC 3PMRA 2G3KA 3LLKA 1SZIA 4YT5A 4EWCA 4CIHA 3O55A 3HNIA 4MVMA 4EKWA 1RKEA 5F28E 2UUIA 3KL4A 2R7QA 2XLMA 4MTFA 3IQCA 2YQYA 3GEIA 1ZVZA 3EH2A 5FZTA 3E70C 1Z23A 3RKOF 4KI2A 1ORYA 2HMQA 3M79A 1O3UA 3IQ5A 3ZVRA 2XL4A 3PCVA 5KYUB 4IJJA 3A11A 2D4UA 1LI7A 4PJLA 2KJGA 3LNRA 2IXPA 2IM8A 1A7DA 2LP4A 3MYIA 3HJCA 4YL0A 3RVYA 3EJNA 5E3CA 2R9RB 1JR8A 2J7PA 4AE4B 4CDVA 2GAQA 3KPHA 1C03A 2OEVA 4BJ5C 1GGQA 4KC9A 4DRJB 4U5FE 4Q4ZF 3EGDA 2KYHA 1ORSC 2L7AA 4N6CA 4ULWA 3DMDA 3EGXB 4MVZA 1T9KA 3S90A 1NG1A 1YVIA 2A1DD 3C63A 4MTOA 2NG1A 5AGFA 1WWPA 3S29A 1C02A 2I15A 3LJBA 2Q3TA 1OR3A 5L0GA 1OW8A 2LFDA 2L81A 4MS2A 5DQZA 1YDIA 2DYSC 5B3SC 3ZQYA 4G7OF 3C8GA 2FGYA 2QE9A 1CGME 1CPQA 1VMAA 2J9UA 1M56C 5DS4A 3DJUB 2WVOA 2R7XA 1SYQA 1ZW2A 4MVOA 3GEHA 4YWQA 1H7IA 1WTYA 4Q5SF 2R7VA 3K7DA 2R7UA 4KNVA 1YYXA 1D1AA 1I5NA 2XLHA 1LPEA 5HV9A 1S05A 1RKEB 3DM9B 1EKYA 1LI5A 2W45A 4G0HA 1VTMP 3QVZA 4MQ9F 4DRHB 2E87A 1VLSA 4JEBA 5KYWA 1TFKB 4XLNF 2L6HA 3U8PA 3LS1A 4JW1A 2HV6A 3QTHA 3ZTMA 2PP4A 2J9VA 4PK4A 2J45A 2OJED 1OCOC 3X2QC 1BBHA 1UG7A 3VRCA 4BEJA 4YN0B 4N06A 2Y3DA 1UFBA 4J7TA 4CS8C 2A0BA 3ZDLA 1FTSA 1W2WA 3JSZA 4Z9IA 3LNMB 4DBRA 2NUPB 3B0PA 3NYJA 2ETSA 3JYYA 4JRZA 1IZMA 5BQGA 4WJ0A 4F4BA 3AG2C 4J7YA 5JT4A 2OEXA 4EUKB 2R02A 1NU7D 1H9GA 4G7ZF 3JRTA 5JVEA 2LQGA 1I4YA 2BC5A 1K04A 1LE2A 3LAYA 3RQGA 5JRAA 3UMHA 2NUTB 2R25A 1D0XA 3QZCA 4G7HF 1YZAA 1SMYF 3MFNA 4JURI 4U5HA 4ULVA 3R2PA 4LDQA 1JPJA 2LSEA 4O7GA 4N6HA 1Z7Qc 4J30B 1RJ9A 2UUHA 1BDJB 2VASA 2H8AA 5L0JA 4AK9A 2LIGA 3M1CB 4P9TA 3TJ6A 4EBKA 2AP3A 2QTVA 1HE9A 3EFOB 2IYLD 2YLGA 3M4BA 2R7TA 1TQGA 5BUOA 1ZHXA 4MVQA 4CIPA 5AC5A 4BJ1A 3N24A 3R7CA 3S9OA 2XL6A 4C3DA 2I8BA 5KYUA 2FFHA 4NY3A 2L6FA 4IRUA 4LLCA 4IGGA 3W2VA 1CPRA 3DXJF 3KYIA 2FAPB 2LFFA 5JLIA 2L6GA 1ZHWA 4U5GA 4C7OA 3RYLA 3TOMA 2GWWA 1Y4CA 4NCQA 4P6IC 1S7ZA 2EPNA 4AE4A 3B0UX 3FMSA 1OR2A 1OKKA 2QUPA 3L1MA 3H2UA 3BRJA 2DYRC 3DD7A 1RXQA 3CZ6A 3KH2A 3UGPA 5A6JA 1OQCA 1N1CA 2J46A 3EGXA 3FDQA 3AOUA 3HNJA 1WN0A 2EIMC 1ZHTA 3GM2A 4PR9A 4JC7A 1M6TA 3S0XA 2R7WA 1FNTc 4XWJA 4EBJA 4H54A 2V26A 5COMA 4FX5A 4MNDA 3G4XA 1V54C 4I1MA 3TK0A 4HFKB 2XLEA 1A7VA 4BJTA 2IBFA 5TJ5E 2KGOA 2LD6A 1OXKA 4RDAA 4ZLCA 2Y3HA 2YVKA 4BJ6A 5BQHA 1HMOA 2OOCA 3NKDA 5D92A 1PCXA 1VOMA 2CGEA 2PX3A 2YHSA 5L3QA 3Q6MA 4EBBA 2Y3BA 2Q9CA 1I4ZA 2XLOA 4O79A 4MVRA 5E2QA 5L0DA 3DM5A 2HSBA 3ABKC 1RJ9B 1ORJA 3SYNA 3LEVA 5T3TA 2ZPAA 4HFFB 3PHF2 1HMDA 1A0BA 1MMDA 4CS9A 1T01A 2ZXOA 3EPVA 4D4NA 5JS5A 5IY5C 2HSQA 1KTMA 2Q9BA 3RQEA 4AX2A 2XM4A 3LESA 3TOLA 3POVA 3KMIA 1DOWA 5K0IA 4OIOF 1XZPA 2PFDA 3FOOA 3L34A 4IAQA 3AG4C 4WABA 1M57C 4C7OB 4BEMJ 4CDAA 2VC9A 4XPYA 2WZFA 3N0TA 3V7OA 1J8MF 2WZGA 1TWGA 1A41A 1Z3IX 2NUPA 5B1BC 3LUTB 1TKNA 1ZU5A 3I4UA 3ZIBA 4E0HA 2HKVA 2XS1A 2YL7A 2AWCA 3K1HA 4N4WA 3U8VA 2R7OA 1G5ZA 4DBQA 1V55C 2JX0A 1D0ZA 1R5ID 3CEXA 4NTAA 4YJWA 2W4MA 2YLDA 5EK0A 5F5HA 1OXBA 5A6AA 1YZCA 2CCYA 3QMKA 1T5OA 2NUTA 2BE5F 4CBEA 4JEAA 3SP1A 4JTCB 3UR3C 4MW8A 2J9WA 4E17A 3M4CA 2JPUA 2EPOA 1O5HA 1MNEA 3ABLC 4I44A 2ZXPA 4GYTA 4L6RA 4NTBA 4OINF 3SXZA 4ER9A 4YT8A 1TFOB 4O6NA 1FMWA 3VAYA 5L0HA 4YK5A 3TULA 3OA1A 3T4RA 2WL8A 3NYLA 3BEHA 2DB4A 3EFOA 2OQMA 4JE9A 4QDLA 4RD9A 1HE1A 4U9EA 2Q00A 4K7BA 2OCCC 3CAXA 3CSKA 1OCZC 2J0XA 2YL0A 4H4KC 5L0CA 3U5SA 3EZIA 3EH1A 2HV7A 1DOVA 1Z6AA 1Z63A 4FWVA 2X51A 3B71A 4JCZA 4XLPF 2HJ3A 1L3PA 2QLAA 5DS6A 4U5EE 3X1OA 1FR0A 3DWWA 1L7CA 2VCAA 4A4AA 3A9CA 1LKXA 1AUEA 3OEOA 2EPKX 1YYJA 2H7VC 2NSFA 3GM1A 3FAJA 3SNHA 5L0FA 2L9JA 2W4BA 1E83A 3JTLO 3W8HA 1G4WR 2B0HA 1LVKA 3ZC4A 3AQBA 3KKBA 2CW0F 4YL3A 5L3VA 3FAPB 3T6GB 2PF4E 3O6XA 4PFPA 4LLEA 2KC3A 3UMKA 2GFHA 3Q6NA 4K1OA 4WGZA 4I3MA 2VCBA 4PFOA 2G62A 5E3AA 4EHPA 4ANJA 1OW7A 3IPMO 1Q0GA 3B9QA 1K40A 3JT1A 1GQAA 1QKRA 4RBNA 2WVNA 1BR1A 4DVZA 1MMNA 3HTKC 4A2NB 1TWCA 3S28A 2AVKA 3ZTZA 3I5QA 1NU9C 1T6QA 2C04A 1NZEA 3IEEA 3RW0A 3VYWA 1D1BA 1LS4A 2WB7A 3PDMP 3JYHA 1KNYA 2W9YA 1Q0KA 4XPXA 5CI9A 4Z9JA 3TD7A 4JCHA 1WASA 3NMIA 3T9OA 2A6HF 4LDKA 1HY5A 4G78A 3OWTA 3RVZA 2CNWD 5EGYA 2P1AA 3EHNA 4AL0A 1QPUA 2YWAA 2EILC 2XLVA 1GM5A 2ICWG 3NKEA 1WOLA 2HZ8A 4OD4A 3F47A 3DAFA 2HMZA 4O6YA 3WHNA 3K1IA 4DVYP 5B3IA 4NTFA 1EI7A 4WGYA 3W4YA 1VB5A 5JSLA 1RMVA 4C3BA 5A6KA 2EIKC 3ZSUA 2OKUA 3IHUA 4CS8A 4XEKA 2NPUA 3F46A 1JRAA 1NFNA 4JVSA 2B0JA 4BJ6C 3DE9A 2KK1A 1G4US 4XEVA 5T1DB 2Q4FA 3U3FA 4XPWA 3MBGA 1BR2A 3V5XA 3V5YA 4E18A 2DGJA 1VYKA 5COFA 1KU2A 1JMWA 2WVQA 1YARO 4NQFA 2QNLA 2R05A 2A0UA 4NC3A 1BR4A 3CQZA 1MMAA 4JKVA 4CS9C 1VYIA 4E7SA 2TMVP 4IARA 1ST6A 1FAPB 1IW7F 2Y39A 2OJQA 3M15A 2RSEB 5AC4A 1V4AA 2J7PD 3U0CA 5L0IA 2H7OA 4CSAA 4MVSA 4CJOA 4E7ZA 3VM6A 5KYYB 1Z5ZA 3JRMO 3Q7GA 2KQ9A 1NBBA 1ZZPA 2AU5A 2WZLA 1VK5A 1Y6DA 2XM0A 3EG9B 3HNLA 4DOZA 3U9MA 1U0BB 1K05A 1GS9A 1T6IA 3UNGC 3ZWIA 1M2OA 2EPMX 1R4TA 1H6GA 1VLTA 4KNWA 2A68F 1E85A 4B6IA 4J32B 2HJMA 1PV3A 2YKZA 1OCCC 4XQ1A 3Q7LA 2YZSA 2YEVA 3RQFA 2AWYA 4JIOA 4JJGA 3L8IA 2CNWA 2R7SA 5BQIA 3GWNA 3V5ZA 3WAQA 1YLMA 1CGNA 4JZAA 4MW3A 5KYXB 1NLXA 1U89A 5COGA 4GEHA 2F22A 4IB4A 256BA 1LS1A 1RKCA 2XRHA 1FMVA 1APCA 3DJNB 3K66A 5B1AC 3RFYA 4AL1A 3AGTA 1U6HA 1H9TA 3DE8A 3AJMA 4EIYA 5T3WA 2M64A 1NSGB 3LEOA 5DQTA 1D0YA 1JPNA 2Q9AA 4U5DE 4O6MA 4W8KA 2IXOA 2HUJA 4DXWA 1YAUO 3UMIA 3W8IA 3WG7C 4UDVA 1V74B 1EA8A 2P7VA 3RH3A 3US6A 4C3EA 3DKAA 5F5FA 1ZHYA 2J9BA 1OCRC 1SF8A 2VH3A 1QSPA 2YL1A 3FXHA 1TWHA 1BZ4A 2MYSA 1G8XA 4MTGA 4PACA 4IAOA 4OD5A 2HS5A 2XLWA 3AG1C 3C62A 2YRFA 1Q0FA 4R32A 1D1CA 1A7EA 2YLIA 4XEFA 1WATA 3HNKA 5GPGB 3GODA 3ITFA 3O10A 4JTAB 2IXNA 1ZHZA 3SXMA 3J06A 4HEAJ 1QQ3A 3FHDA 5DLJA 2QY9A 1M2VA 4JJFA 2OU6A 4MVUA 1AVOB 1QVXA 3NMKA 1XZQA 1SR2A 3B0VC 2Y3GA 2ZD9A 2Q7RA 3G50A 5E33A 5A6BD 3S84A 5HSWA 3QW1A 4OIRF 3ZQVA 2XS8A 5D91A 3NDBB 3NG1A 1O87A 2GDCA 3O39A 1Q0MA 3ATPA 4GQHA 5DVWA 3DZAA 3TJ5A 4IWBA 4BJ5A 3SXYA 2MHRA 2XSEA 1LM3B 3FOPA 2Y69C 1OW6A 1LIHA 3GWLA 3SZRA 3W2WA 5CIVA 2KNHA 1RCPA 1F1MA 2XXAA 1AEPA 4LDRA 1J8YF 3ECSA 2OG2A 3SEOA 3I5PA 3WODF 4W8PA 1T6UA 2LCHA 2MWQA 3MYFA 2ZXWC 3IQ6A 3MLGA 4LACB 4CX9A 4PJMA 2KW3C 1OKKD 3H65A 3U2LA 4BPMA 1WGWA 3JSEO 5KYYA 1JOGA 4Q7CA 4XTKA 4LERA 3T6BA 1LE4A 3EG9A 3JCUQ 3K1IC 3AG3C 1C17M 4YT4A 1FFTC 3C8ZA 1NFOA 2EIJC 4PJNA 2VCCA 1YA9A 1HW2A 2A69F 1QLEC 3U3BA 1TR2A 4CJGA 2CYDA 2V3CC
chains in the Genus database with same CATH topology
4M63A 3EGDB 3UGOA 3DAGA 1M2VB 2IOQA 3LS0A 1FFHA 5KYXA 1ZYRF 3EQLF 5FCLA 3NYMA 2VB6A 3LLIA 2ZXRA 5KYNA 4I1OB 4CSAC 3ABMC 2P6VA 2M4EA 2A6EF 1MMGA 4BG0A 3N2ZB 1PD1A 4FESA 3RIPA 2CDQA 4YT2A 4OIQF 2XXAB 4OIPF 3EHMA 5DS5A 3ASNC 3K6BA 3S27A 2PX0A 3FVYA 3NRHA 4K0DA 5KYWB 3HLZA 2G3VA 3EZHA 2D5RB 4QI0A 2JD3A 4ZLDA 3MX3A 1PD0A 2H7BA 1ZU4A 2Z15A 5CI8A 3T6JA 3E9VA 3L0IA 4U5CE 1QZXA 3ZG1A 4PJJA 4KBLA 4X0RA 2O9XA 3GANA 2R7RA 4U5BE 3K33A 2EINC 4CS7A 1TWAA 2C03A 4QI2A 1MNDA 3AQCA 5EHHA 2IXMA 4HE8D 2J0WA 3ASOC 3PMRA 2G3KA 3LLKA 1SZIA 4YT5A 4EWCA 4CIHA 3KL4A 2R7QA 3EH2A 3E70C 1Z23A 3RKOF 4KI2A 3ZVRA 2XL4A 5KYUB 4IJJA 4PJLA 2KJGA 3LNRA 2IXPA 3HJCA 3EJNA 5E3CA 4AE4B 2J7PA 4BJ5C 4KC9A 4Q4ZF 4U5FE 3EGDA 4ULWA 3DMDA 3EGXB 1NG1A 2A1DD 2NG1A 3S29A 3LJBA 2Q3TA 2L81A 5DQZA 2DYSC 5B3SC 4G7OF 2FGYA 1VMAA 2J9UA 1M56C 5DS4A 3DJUB 2WVOA 2R7XA 4YWQA 2R7VA 4Q5SF 3K7DA 2R7UA 4KNVA 1D1AA 3DM9B 2W45A 4G0HA 4MQ9F 2E87A 5KYWA 4XLNF 3LS1A 4JW1A 2HV6A 2PP4A 2J9VA 4PK4A 2J45A 1OCOC 3X2QC 4BEJA 4YN0B 4N06A 2Y3DA 4CS8C 1FTSA 1W2WA 3JSZA 4DBRA 2NUPB 3B0PA 3NYJA 1IZMA 4WJ0A 4F4BA 3AG2C 1NU7D 4G7ZF 3JRTA 3LAYA 3UMHA 2NUTB 3QZCA 1D0XA 4G7HF 1SMYF 4JURI 4U5HA 1JPJA 2LSEA 4O7GA 4J30B 1RJ9A 2VASA 4AK9A 3M1CB 2QTVA 3EFOB 2IYLD 2R7TA 5BUOA 1ZHXA 4BJ1A 3N24A 4C3DA 2I8BA 5KYUA 2FFHA 4NY3A 4IRUA 4LLCA 3W2VA 3DXJF 1ZHWA 4U5GA 4C7OA 3RYLA 4P6IC 4AE4A 3B0UX 1S7ZA 1OKKA 2DYRC 3DD7A 3CZ6A 3KH2A 3UGPA 1N1CA 2J46A 3EGXA 3FDQA 2EIMC 1ZHTA 3S0XA 2R7WA 4XWJA 2V26A 4FX5A 4MNDA 1V54C 4I1MA 4BJTA 4HFKB 2KGOA 4RDAA 4ZLCA 2Y3HA 4BJ6A 3NKDA 5D92A 1PCXA 1VOMA 2CGEA 2PX3A 2YHSA 5L3QA 3Q6MA 4EBBA 2Y3BA 2Q9CA 4O79A 5E2QA 3DM5A 3ABKC 3SYNA 1RJ9B 3LEVA 5T3TA 2ZPAA 4HFFB 3PHF2 1MMDA 4CS9A 2ZXOA 3EPVA 5IY5C 2Q9BA 4AX2A 3LESA 3POVA 3KMIA 4OIOF 2PFDA 3L34A 3AG4C 1M57C 4C7OB 2WZFA 3N0TA 3V7OA 1J8MF 2WZGA 1TWGA 1Z3IX 2NUPA 5B1BC 1TKNA 1ZU5A 3I4UA 3ZIBA 3K1HA 2R7OA 4DBQA 1V55C 4YJWA 1D0ZA 2W4MA 5F5HA 3QMKA 2NUTA 2BE5F 4CBEA 3SP1A 3UR3C 2J9WA 1O5HA 1MNEA 3ABLC 4I44A 2ZXPA 4GYTA 4OINF 4YT8A 4O6NA 1FMWA 3VAYA 3OA1A 3T4RA 2WL8A 3NYLA 4QDLA 3EFOA 4RD9A 4K7BA 2OCCC 3CSKA 1OCZC 2J0XA 4H4KC 3EZIA 3EH1A 2HV7A 1Z63A 1Z6AA 4FWVA 2X51A 4XLPF 5DS6A 4U5EE 3X1OA 1LKXA 3OEOA 2H7VC 3FAJA 3SNHA 2L9JA 2W4BA 3W8HA 1LVKA 3ZC4A 3AQBA 3KKBA 2CW0F 5L3VA 2PF4E 3O6XA 4PFPA 4LLEA 3UMKA 2GFHA 3Q6NA 4I3MA 4PFOA 2G62A 5E3AA 4ANJA 3B9QA 4RBNA 3JT1A 4DVZA 2WVNA 1BR1A 1MMNA 3HTKC 4A2NB 1TWCA 3S28A 3I5QA 1NU9C 2C04A 3IEEA 1NZEA 3VYWA 1D1BA 2WB7A 3JYHA 2W9YA 5CI9A 3TD7A 4JCHA 2A6HF 3OWTA 2CNWD 5EGYA 3EHNA 2EILC 3NKEA 4OD4A 3F47A 3DAFA 4O6YA 4DVYP 4C3BA 2EIKC 3ZSUA 4CS8A 3F46A 4JVSA 2B0JA 4BJ6C 5T1DB 1BR2A 2DGJA 1VYKA 1KU2A 2WVQA 1BR4A 3CQZA 1MMAA 4CS9C 4E7SA 1VYIA 1ST6A 1IW7F 2Y39A 2J7PD 4CSAA 2H7OA 4E7ZA 5KYYB 1Z5ZA 3Q7GA 2KQ9A 2WZLA 1VK5A 3EG9B 4DOZA 3UNGC 1M2OA 4KNWA 2A68F 4B6IA 4J32B 1OCCC 3Q7LA 2YZSA 2YEVA 4JJGA 2CNWA 2R7SA 4JZAA 5KYXB 4GEHA 3DJNB 1LS1A 2XRHA 3K66A 1FMVA 5B1AC 3RFYA 5T3WA 5DQTA 1D0YA 1JPNA 2Q9AA 4U5DE 4O6MA 4W8KA 2IXOA 3UMIA 3W8IA 3WG7C 2P7VA 3RH3A 4C3EA 5F5FA 1ZHYA 1OCRC 1SF8A 2VH3A 1TWHA 2MYSA 1G8XA 4IAOA 4OD5A 3AG1C 1D1CA 3GODA 3ITFA 2IXNA 1ZHZA 4HEAJ 3FHDA 5DLJA 2QY9A 1M2VA 4JJFA 3B0VC 2Y3GA 5HSWA 5E33A 4OIRF 5D91A 3NDBB 3NG1A 1O87A 3O39A 5DVWA 3DZAA 4IWBA 4BJ5A 2XSEA 2Y69C 3SZRA 3W2WA 2KNHA 2XXAA 1J8YF 3ECSA 2OG2A 3SEOA 3I5PA 3WODF 2MWQA 2ZXWC 3MLGA 4LACB 4PJMA 2KW3C 1OKKD 3H65A 5KYYA 1WGWA 4XTKA 4Q7CA 3T6BA 4LERA 3EG9A 3JCUQ 3K1IC 3AG3C 4YT4A 1FFTC 4PJNA 2EIJC 2A69F 1QLEC 1TR2A 2V3CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMI A;  5BUO A;  3UMK A;  3PMR A;  4RD9 A;  3Q7L A;  3NYJ A;  3K6B A;  1TKN A;  3Q7G A;  4YN0 B;  3NYL A;  3K66 A;  3QMK A;  4RDA A;  3UMH A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  4M63 A;  4YL1 A;  3U9J A;  2YL3 A;  2PBE A;  3EGD B;  3UGO A;  3DAG A;  1M2V B;  2IOQ A;  3GEE A;  2ASR A;  3LS0 A;  1FFH A;  5KYX A;  4E0I A;  1ZYR F;  3EQL F;  1CGO A;  3NYM A;  3IQT A;  2VB6 A;  4DRI B;  2P0N A;  5FCL A;  3LLI A;  3KYJ A;  1JAF A;  2ZXR A;  5A6B A;  3C8G B;  5KYN A;  4I1O B;  4CSA C;  3ABM C;  1Q0D A;  2M4E A;  2P6V A;  3B29 A;  5JP7 A;  1ZW3 A;  4U9D A;  2A6E F;  1MMG A;  4BG0 A;  5JUA A;  1EQ1 A;  1E84 A;  3N2Z B;  4CDY A;  1PD1 A;  4FAP B;  3VF0 A;  2X0C A;  4FES A;  3SXK A;  2EPL X;  3RIP A;  2RD9 A;  4Z9H A;  4DJ9 A;  2CDQ A;  4YT2 A;  3GM3 A;  4OIQ F;  2XXA B;  4OIP F;  2HFI A;  3EHM A;  5DS5 A;  2P61 A;  3ASN C;  3K6B A;  3S27 A;  2PX0 A;  2GA0 A;  3FVY A;  3NRH A;  4K0D A;  2R03 A;  3AGU A;  3HLZ A;  5KYW B;  1E2X A;  2G3V A;  3H2V A;  3EZH A;  2BL2 A;  2D5R B;  4P9F A;  4QI0 A;  2JD3 A;  4ZLD A;  3MX3 A;  3NMJ A;  1PD0 A;  2H7B A;  2DI3 A;  1ZU4 A;  3G4Z A;  2Z15 A;  4JTD B;  3U2M A;  5CI8 A;  3T6J A;  3E9V A;  3L0I A;  3L8J A;  4D4X A;  4U5C E;  1QZX A;  3ZG1 A;  4PJJ A;  3TQO A;  1YA7 O;  1YJG A;  4KBL A;  2LK4 A;  3DI5 A;  2NSG A;  2KSF A;  4X0R A;  2O9X A;  3C18 A;  3C8G D;  3GAN A;  4ONS A;  1XWJ A;  2J8W A;  3QW0 A;  1B68 A;  2R7R A;  2PNO A;  2XLD A;  4U5B E;  1E86 A;  3K33 A;  3HKK A;  1MQV A;  2EIN C;  3GOR A;  3C7J A;  3RF3 A;  4CS7 A;  5A69 A;  1TWA A;  2C03 A;  3JZ0 A;  4QI2 A;  1MND A;  3AQC A;  5EHH A;  3QVY A;  2IXM A;  2XL8 A;  4HE8 D;  2J0W A;  3ASO C;  3PMR A;  2G3K A;  3LLK A;  1SZI A;  4YT5 A;  4EWC A;  4CIH A;  3O55 A;  3HNI A;  4MVM A;  4EKW A;  1RKE A;  5F28 E;  2UUI A;  3KL4 A;  2R7Q A;  2XLM A;  4MTF A;  3IQC A;  2YQY A;  3GEI A;  1ZVZ A;  3EH2 A;  5FZT A;  3E70 C;  1Z23 A;  3RKO F;  4KI2 A;  1ORY A;  2HMQ A;  3M79 A;  1O3U A;  3IQ5 A;  3ZVR A;  2XL4 A;  3PCV A;  5KYU B;  4IJJ A;  3A11 A;  2D4U A;  1LI7 A;  4PJL A;  2KJG A;  3LNR A;  2IXP A;  2IM8 A;  1A7D A;  2LP4 A;  3MYI A;  3HJC A;  4YL0 A;  3RVY A;  3EJN A;  5E3C A;  2R9R B;  1JR8 A;  2J7P A;  4AE4 B;  4CDV A;  2GAQ A;  3KPH A;  1C03 A;  2OEV A;  4BJ5 C;  1GGQ A;  4KC9 A;  4DRJ B;  4U5F E;  4Q4Z F;  3EGD A;  2KYH A;  1ORS C;  2L7A A;  4N6C A;  4ULW A;  3DMD A;  3EGX B;  4MVZ A;  1T9K A;  3S90 A;  1NG1 A;  1YVI A;  2A1D D;  3C63 A;  4MTO A;  2NG1 A;  5AGF A;  1WWP A;  3S29 A;  1C02 A;  2I15 A;  3LJB A;  2Q3T A;  1OR3 A;  5L0G A;  1OW8 A;  2LFD A;  2L81 A;  4MS2 A;  5DQZ A;  1YDI A;  2DYS C;  5B3S C;  3ZQY A;  4G7O F;  3C8G A;  2FGY A;  2QE9 A;  1CGM E;  1CPQ A;  1VMA A;  2J9U A;  1M56 C;  5DS4 A;  3DJU B;  2WVO A;  2R7X A;  1SYQ A;  1ZW2 A;  4MVO A;  3GEH A;  4YWQ A;  1H7I A;  1WTY A;  4Q5S F;  2R7V A;  3K7D A;  2R7U A;  4KNV A;  1YYX A;  1D1A A;  1I5N A;  2XLH A;  1LPE A;  5HV9 A;  1S05 A;  1RKE B;  3DM9 B;  1EKY A;  1LI5 A;  2W45 A;  4G0H A;  1VTM P;  3QVZ A;  4MQ9 F;  4DRH B;  2E87 A;  1VLS A;  4JEB A;  5KYW A;  1TFK B;  4XLN F;  2L6H A;  3U8P A;  3LS1 A;  4JW1 A;  2HV6 A;  3QTH A;  3ZTM A;  2PP4 A;  2J9V A;  4PK4 A;  2J45 A;  2OJE D;  1OCO C;  3X2Q C;  1BBH A;  1UG7 A;  3VRC A;  4BEJ A;  4YN0 B;  4N06 A;  2Y3D A;  1UFB A;  4J7T A;  4CS8 C;  2A0B A;  3ZDL A;  1FTS A;  1W2W A;  3JSZ A;  4Z9I A;  3LNM B;  4DBR A;  2NUP B;  3B0P A;  3NYJ A;  2ETS A;  3JYY A;  4JRZ A;  1IZM A;  5BQG A;  4WJ0 A;  4F4B A;  3AG2 C;  4J7Y A;  5JT4 A;  2OEX A;  4EUK B;  2R02 A;  1NU7 D;  1H9G A;  4G7Z F;  3JRT A;  5JVE A;  2LQG A;  1I4Y A;  2BC5 A;  1K04 A;  1LE2 A;  3LAY A;  3RQG A;  5JRA A;  3UMH A;  2NUT B;  2R25 A;  1D0X A;  3QZC A;  4G7H F;  1YZA A;  1SMY F;  3MFN A;  4JUR I;  4U5H A;  4ULV A;  3R2P A;  4LDQ A;  1JPJ A;  2LSE A;  4O7G A;  4N6H A;  1Z7Q c;  4J30 B;  1RJ9 A;  2UUH A;  1BDJ B;  2VAS A;  2H8A A;  5L0J A;  4AK9 A;  2LIG A;  3M1C B;  4P9T A;  3TJ6 A;  4EBK A;  2AP3 A;  2QTV A;  1HE9 A;  3EFO B;  2IYL D;  2YLG A;  3M4B A;  2R7T A;  1TQG A;  5BUO A;  1ZHX A;  4MVQ A;  4CIP A;  5AC5 A;  4BJ1 A;  3N24 A;  3R7C A;  3S9O A;  2XL6 A;  4C3D A;  2I8B A;  5KYU A;  2FFH A;  4NY3 A;  2L6F A;  4IRU A;  4LLC A;  4IGG A;  3W2V A;  1CPR A;  3DXJ F;  3KYI A;  2FAP B;  2LFF A;  5JLI A;  2L6G A;  1ZHW A;  4U5G A;  4C7O A;  3RYL A;  3TOM A;  2GWW A;  1Y4C A;  4NCQ A;  4P6I C;  1S7Z A;  2EPN A;  4AE4 A;  3B0U X;  3FMS A;  1OR2 A;  1OKK A;  2QUP A;  3L1M A;  3H2U A;  3BRJ A;  2DYR C;  3DD7 A;  1RXQ A;  3CZ6 A;  3KH2 A;  3UGP A;  5A6J A;  1OQC A;  1N1C A;  2J46 A;  3EGX A;  3FDQ A;  3AOU A;  3HNJ A;  1WN0 A;  2EIM C;  1ZHT A;  3GM2 A;  4PR9 A;  4JC7 A;  1M6T A;  3S0X A;  2R7W A;  1FNT c;  4XWJ A;  4EBJ A;  4H54 A;  2V26 A;  5COM A;  4FX5 A;  4MND A;  3G4X A;  1V54 C;  4I1M A;  3TK0 A;  4HFK B;  2XLE A;  1A7V A;  4BJT A;  2IBF A;  5TJ5 E;  2KGO A;  2LD6 A;  1OXK A;  4RDA A;  4ZLC A;  2Y3H A;  2YVK A;  4BJ6 A;  5BQH A;  1HMO A;  2OOC A;  3NKD A;  5D92 A;  1PCX A;  1VOM A;  2CGE A;  2PX3 A;  2YHS A;  5L3Q A;  3Q6M A;  4EBB A;  2Y3B A;  2Q9C A;  1I4Z A;  2XLO A;  4O79 A;  4MVR A;  5E2Q A;  5L0D A;  3DM5 A;  2HSB A;  3ABK C;  1RJ9 B;  1ORJ A;  3SYN A;  3LEV A;  5T3T A;  2ZPA A;  4HFF B;  3PHF 2;  1HMD A;  1A0B A;  1MMD A;  4CS9 A;  1T01 A;  2ZXO A;  3EPV A;  4D4N A;  5JS5 A;  5IY5 C;  2HSQ A;  1KTM A;  2Q9B A;  3RQE A;  4AX2 A;  2XM4 A;  3LES A;  3TOL A;  3POV A;  3KMI A;  1DOW A;  5K0I A;  4OIO F;  1XZP A;  2PFD A;  3FOO A;  3L34 A;  4IAQ A;  3AG4 C;  4WAB A;  1M57 C;  4C7O B;  4BEM J;  4CDA A;  2VC9 A;  4XPY A;  2WZF A;  3N0T A;  3V7O A;  1J8M F;  2WZG A;  1TWG A;  1A41 A;  1Z3I X;  2NUP A;  5B1B C;  3LUT B;  1TKN A;  1ZU5 A;  3I4U A;  3ZIB A;  4E0H A;  2HKV A;  2XS1 A;  2YL7 A;  2AWC A;  3K1H A;  4N4W A;  3U8V A;  2R7O A;  1G5Z A;  4DBQ A;  1V55 C;  2JX0 A;  1D0Z A;  1R5I D;  3CEX A;  4NTA A;  4YJW A;  2W4M A;  2YLD A;  5EK0 A;  5F5H A;  1OXB A;  5A6A A;  1YZC A;  2CCY A;  3QMK A;  1T5O A;  2NUT A;  2BE5 F;  4CBE A;  4JEA A;  3SP1 A;  4JTC B;  3UR3 C;  4MW8 A;  2J9W A;  4E17 A;  3M4C A;  2JPU A;  2EPO A;  1O5H A;  1MNE A;  3ABL C;  4I44 A;  2ZXP A;  4GYT A;  4L6R A;  4NTB A;  4OIN F;  3SXZ A;  4ER9 A;  4YT8 A;  1TFO B;  4O6N A;  1FMW A;  3VAY A;  5L0H A;  4YK5 A;  3TUL A;  3OA1 A;  3T4R A;  2WL8 A;  3NYL A;  3BEH A;  2DB4 A;  3EFO A;  2OQM A;  4JE9 A;  4QDL A;  4RD9 A;  1HE1 A;  4U9E A;  2Q00 A;  4K7B A;  2OCC C;  3CAX A;  3CSK A;  1OCZ C;  2J0X A;  2YL0 A;  4H4K C;  5L0C A;  3U5S A;  3EZI A;  3EH1 A;  2HV7 A;  1DOV A;  1Z6A A;  1Z63 A;  4FWV A;  2X51 A;  3B71 A;  4JCZ A;  4XLP F;  2HJ3 A;  1L3P A;  2QLA A;  5DS6 A;  4U5E E;  3X1O A;  1FR0 A;  3DWW A;  1L7C A;  2VCA A;  4A4A A;  3A9C A;  1LKX A;  1AUE A;  3OEO A;  2EPK X;  1YYJ A;  2H7V C;  2NSF A;  3GM1 A;  3FAJ A;  3SNH A;  5L0F A;  2L9J A;  2W4B A;  1E83 A;  3JTL O;  3W8H A;  1G4W R;  2B0H A;  1LVK A;  3ZC4 A;  3AQB A;  3KKB A;  2CW0 F;  4YL3 A;  5L3V A;  3FAP B;  3T6G B;  2PF4 E;  3O6X A;  4PFP A;  4LLE A;  2KC3 A;  3UMK A;  2GFH A;  3Q6N A;  4K1O A;  4WGZ A;  4I3M A;  2VCB A;  4PFO A;  2G62 A;  5E3A A;  4EHP A;  4ANJ A;  1OW7 A;  3IPM O;  1Q0G A;  3B9Q A;  1K40 A;  3JT1 A;  1GQA A;  1QKR A;  4RBN A;  2WVN A;  1BR1 A;  4DVZ A;  1MMN A;  3HTK C;  4A2N B;  1TWC A;  3S28 A;  2AVK A;  3ZTZ A;  3I5Q A;  1NU9 C;  1T6Q A;  2C04 A;  1NZE A;  3IEE A;  3RW0 A;  3VYW A;  1D1B A;  1LS4 A;  2WB7 A;  3PDM P;  3JYH A;  1KNY A;  2W9Y A;  1Q0K A;  4XPX A;  5CI9 A;  4Z9J A;  3TD7 A;  4JCH A;  1WAS A;  3NMI A;  3T9O A;  2A6H F;  4LDK A;  1HY5 A;  4G78 A;  3OWT A;  3RVZ A;  2CNW D;  5EGY A;  2P1A A;  3EHN A;  4AL0 A;  1QPU A;  2YWA A;  2EIL C;  2XLV A;  1GM5 A;  2ICW G;  3NKE A;  1WOL A;  2HZ8 A;  4OD4 A;  3F47 A;  3DAF A;  2HMZ A;  4O6Y A;  3WHN A;  3K1I A;  4DVY P;  5B3I A;  4NTF A;  1EI7 A;  4WGY A;  3W4Y A;  1VB5 A;  5JSL A;  1RMV A;  4C3B A;  5A6K A;  2EIK C;  3ZSU A;  2OKU A;  3IHU A;  4CS8 A;  4XEK A;  2NPU A;  3F46 A;  1JRA A;  1NFN A;  4JVS A;  2B0J A;  4BJ6 C;  3DE9 A;  2KK1 A;  1G4U S;  4XEV A;  5T1D B;  2Q4F A;  3U3F A;  4XPW A;  3MBG A;  1BR2 A;  3V5X A;  3V5Y A;  4E18 A;  2DGJ A;  1VYK A;  5COF A;  1KU2 A;  1JMW A;  2WVQ A;  1YAR O;  4NQF A;  2QNL A;  2R05 A;  2A0U A;  4NC3 A;  1BR4 A;  3CQZ A;  1MMA A;  4JKV A;  4CS9 C;  1VYI A;  4E7S A;  2TMV P;  4IAR A;  1ST6 A;  1FAP B;  1IW7 F;  2Y39 A;  2OJQ A;  3M15 A;  2RSE B;  5AC4 A;  1V4A A;  2J7P D;  3U0C A;  5L0I A;  2H7O A;  4CSA A;  4MVS A;  4CJO A;  4E7Z A;  3VM6 A;  5KYY B;  1Z5Z A;  3JRM O;  3Q7G A;  2KQ9 A;  1NBB A;  1ZZP A;  2AU5 A;  2WZL A;  1VK5 A;  1Y6D A;  2XM0 A;  3EG9 B;  3HNL A;  4DOZ A;  3U9M A;  1U0B B;  1K05 A;  1GS9 A;  1T6I A;  3UNG C;  3ZWI A;  1M2O A;  2EPM X;  1R4T A;  1H6G A;  1VLT A;  4KNW A;  2A68 F;  1E85 A;  4B6I A;  4J32 B;  2HJM A;  1PV3 A;  2YKZ A;  1OCC C;  4XQ1 A;  3Q7L A;  2YZS A;  2YEV A;  3RQF A;  2AWY A;  4JIO A;  4JJG A;  3L8I A;  2CNW A;  2R7S A;  5BQI A;  3GWN A;  3V5Z A;  3WAQ A;  1YLM A;  1CGN A;  4JZA A;  4MW3 A;  5KYX B;  1NLX A;  1U89 A;  5COG A;  4GEH A;  2F22 A;  4IB4 A;  256B A;  1LS1 A;  1RKC A;  2XRH A;  1FMV A;  1APC A;  3DJN B;  3K66 A;  5B1A C;  3RFY A;  4AL1 A;  3AGT A;  1U6H A;  1H9T A;  3DE8 A;  3AJM A;  4EIY A;  5T3W A;  2M64 A;  1NSG B;  3LEO A;  5DQT A;  1D0Y A;  1JPN A;  2Q9A A;  4U5D E;  4O6M A;  4W8K A;  2IXO A;  2HUJ A;  4DXW A;  1YAU O;  3UMI A;  3W8I A;  3WG7 C;  4UDV A;  1V74 B;  1EA8 A;  2P7V A;  3RH3 A;  3US6 A;  4C3E A;  3DKA A;  5F5F A;  1ZHY A;  2J9B A;  1OCR C;  1SF8 A;  2VH3 A;  1QSP A;  2YL1 A;  3FXH A;  1TWH A;  1BZ4 A;  2MYS A;  1G8X A;  4MTG A;  4PAC A;  4IAO A;  4OD5 A;  2HS5 A;  2XLW A;  3AG1 C;  3C62 A;  2YRF A;  1Q0F A;  4R32 A;  1D1C A;  1A7E A;  2YLI A;  4XEF A;  1WAT A;  3HNK A;  5GPG B;  3GOD A;  3ITF A;  3O10 A;  4JTA B;  2IXN A;  1ZHZ A;  3SXM A;  3J06 A;  4HEA J;  1QQ3 A;  3FHD A;  5DLJ A;  2QY9 A;  1M2V A;  4JJF A;  2OU6 A;  4MVU A;  1AVO B;  1QVX A;  3NMK A;  1XZQ A;  1SR2 A;  3B0V C;  2Y3G A;  2ZD9 A;  2Q7R A;  3G50 A;  5E33 A;  5A6B D;  3S84 A;  5HSW A;  3QW1 A;  4OIR F;  3ZQV A;  2XS8 A;  5D91 A;  3NDB B;  3NG1 A;  1O87 A;  2GDC A;  3O39 A;  1Q0M A;  3ATP A;  4GQH A;  5DVW A;  3DZA A;  3TJ5 A;  4IWB A;  4BJ5 A;  3SXY A;  2MHR A;  2XSE A;  1LM3 B;  3FOP A;  2Y69 C;  1OW6 A;  1LIH A;  3GWL A;  3SZR A;  3W2W A;  5CIV A;  2KNH A;  1RCP A;  1F1M A;  2XXA A;  1AEP A;  4LDR A;  1J8Y F;  3ECS A;  2OG2 A;  3SEO A;  3I5P A;  3WOD F;  4W8P A;  1T6U A;  2LCH A;  2MWQ A;  3MYF A;  2ZXW C;  3IQ6 A;  3MLG A;  4LAC B;  4CX9 A;  4PJM A;  2KW3 C;  1OKK D;  3H65 A;  3U2L A;  4BPM A;  1WGW A;  3JSE O;  5KYY A;  1JOG A;  4Q7C A;  4XTK A;  4LER A;  3T6B A;  1LE4 A;  3EG9 A;  3JCU Q;  3K1I C;  3AG3 C;  1C17 M;  4YT4 A;  1FFT C;  3C8Z A;  1NFO A;  2EIJ C;  4PJN A;  2VCC A;  1YA9 A;  1HW2 A;  2A69 F;  1QLE C;  3U3B A;  1TR2 A;  4CJG A;  2CYD A;  2V3C C; 
#chains in the Genus database with same CATH homology
 4M63 A;  3EGD B;  3UGO A;  3DAG A;  1M2V B;  2IOQ A;  3LS0 A;  1FFH A;  5KYX A;  1ZYR F;  3EQL F;  5FCL A;  3NYM A;  2VB6 A;  3LLI A;  2ZXR A;  5KYN A;  4I1O B;  4CSA C;  3ABM C;  2P6V A;  2M4E A;  2A6E F;  1MMG A;  4BG0 A;  3N2Z B;  1PD1 A;  4FES A;  3RIP A;  2CDQ A;  4YT2 A;  4OIQ F;  2XXA B;  4OIP F;  3EHM A;  5DS5 A;  3ASN C;  3K6B A;  3S27 A;  2PX0 A;  3FVY A;  3NRH A;  4K0D A;  5KYW B;  3HLZ A;  2G3V A;  3EZH A;  2D5R B;  4QI0 A;  2JD3 A;  4ZLD A;  3MX3 A;  1PD0 A;  2H7B A;  1ZU4 A;  2Z15 A;  5CI8 A;  3T6J A;  3E9V A;  3L0I A;  4U5C E;  1QZX A;  3ZG1 A;  4PJJ A;  4KBL A;  4X0R A;  2O9X A;  3GAN A;  2R7R A;  4U5B E;  3K33 A;  2EIN C;  4CS7 A;  1TWA A;  2C03 A;  4QI2 A;  1MND A;  3AQC A;  5EHH A;  2IXM A;  4HE8 D;  2J0W A;  3ASO C;  3PMR A;  2G3K A;  3LLK A;  1SZI A;  4YT5 A;  4EWC A;  4CIH A;  3KL4 A;  2R7Q A;  3EH2 A;  3E70 C;  1Z23 A;  3RKO F;  4KI2 A;  3ZVR A;  2XL4 A;  5KYU B;  4IJJ A;  4PJL A;  2KJG A;  3LNR A;  2IXP A;  3HJC A;  3EJN A;  5E3C A;  4AE4 B;  2J7P A;  4BJ5 C;  4KC9 A;  4Q4Z F;  4U5F E;  3EGD A;  4ULW A;  3DMD A;  3EGX B;  1NG1 A;  2A1D D;  2NG1 A;  3S29 A;  3LJB A;  2Q3T A;  2L81 A;  5DQZ A;  2DYS C;  5B3S C;  4G7O F;  2FGY A;  1VMA A;  2J9U A;  1M56 C;  5DS4 A;  3DJU B;  2WVO A;  2R7X A;  4YWQ A;  2R7V A;  4Q5S F;  3K7D A;  2R7U A;  4KNV A;  1D1A A;  3DM9 B;  2W45 A;  4G0H A;  4MQ9 F;  2E87 A;  5KYW A;  4XLN F;  3LS1 A;  4JW1 A;  2HV6 A;  2PP4 A;  2J9V A;  4PK4 A;  2J45 A;  1OCO C;  3X2Q C;  4BEJ A;  4YN0 B;  4N06 A;  2Y3D A;  4CS8 C;  1FTS A;  1W2W A;  3JSZ A;  4DBR A;  2NUP B;  3B0P A;  3NYJ A;  1IZM A;  4WJ0 A;  4F4B A;  3AG2 C;  1NU7 D;  4G7Z F;  3JRT A;  3LAY A;  3UMH A;  2NUT B;  3QZC A;  1D0X A;  4G7H F;  1SMY F;  4JUR I;  4U5H A;  1JPJ A;  2LSE A;  4O7G A;  4J30 B;  1RJ9 A;  2VAS A;  4AK9 A;  3M1C B;  2QTV A;  3EFO B;  2IYL D;  2R7T A;  5BUO A;  1ZHX A;  4BJ1 A;  3N24 A;  4C3D A;  2I8B A;  5KYU A;  2FFH A;  4NY3 A;  4IRU A;  4LLC A;  3W2V A;  3DXJ F;  1ZHW A;  4U5G A;  4C7O A;  3RYL A;  4P6I C;  4AE4 A;  3B0U X;  1S7Z A;  1OKK A;  2DYR C;  3DD7 A;  3CZ6 A;  3KH2 A;  3UGP A;  1N1C A;  2J46 A;  3EGX A;  3FDQ A;  2EIM C;  1ZHT A;  3S0X A;  2R7W A;  4XWJ A;  2V26 A;  4FX5 A;  4MND A;  1V54 C;  4I1M A;  4BJT A;  4HFK B;  2KGO A;  4RDA A;  4ZLC A;  2Y3H A;  4BJ6 A;  3NKD A;  5D92 A;  1PCX A;  1VOM A;  2CGE A;  2PX3 A;  2YHS A;  5L3Q A;  3Q6M A;  4EBB A;  2Y3B A;  2Q9C A;  4O79 A;  5E2Q A;  3DM5 A;  3ABK C;  3SYN A;  1RJ9 B;  3LEV A;  5T3T A;  2ZPA A;  4HFF B;  3PHF 2;  1MMD A;  4CS9 A;  2ZXO A;  3EPV A;  5IY5 C;  2Q9B A;  4AX2 A;  3LES A;  3POV A;  3KMI A;  4OIO F;  2PFD A;  3L34 A;  3AG4 C;  1M57 C;  4C7O B;  2WZF A;  3N0T A;  3V7O A;  1J8M F;  2WZG A;  1TWG A;  1Z3I X;  2NUP A;  5B1B C;  1TKN A;  1ZU5 A;  3I4U A;  3ZIB A;  3K1H A;  2R7O A;  4DBQ A;  1V55 C;  4YJW A;  1D0Z A;  2W4M A;  5F5H A;  3QMK A;  2NUT A;  2BE5 F;  4CBE A;  3SP1 A;  3UR3 C;  2J9W A;  1O5H A;  1MNE A;  3ABL C;  4I44 A;  2ZXP A;  4GYT A;  4OIN F;  4YT8 A;  4O6N A;  1FMW A;  3VAY A;  3OA1 A;  3T4R A;  2WL8 A;  3NYL A;  4QDL A;  3EFO A;  4RD9 A;  4K7B A;  2OCC C;  3CSK A;  1OCZ C;  2J0X A;  4H4K C;  3EZI A;  3EH1 A;  2HV7 A;  1Z63 A;  1Z6A A;  4FWV A;  2X51 A;  4XLP F;  5DS6 A;  4U5E E;  3X1O A;  1LKX A;  3OEO A;  2H7V C;  3FAJ A;  3SNH A;  2L9J A;  2W4B A;  3W8H A;  1LVK A;  3ZC4 A;  3AQB A;  3KKB A;  2CW0 F;  5L3V A;  2PF4 E;  3O6X A;  4PFP A;  4LLE A;  3UMK A;  2GFH A;  3Q6N A;  4I3M A;  4PFO A;  2G62 A;  5E3A A;  4ANJ A;  3B9Q A;  4RBN A;  3JT1 A;  4DVZ A;  2WVN A;  1BR1 A;  1MMN A;  3HTK C;  4A2N B;  1TWC A;  3S28 A;  3I5Q A;  1NU9 C;  2C04 A;  3IEE A;  1NZE A;  3VYW A;  1D1B A;  2WB7 A;  3JYH A;  2W9Y A;  5CI9 A;  3TD7 A;  4JCH A;  2A6H F;  3OWT A;  2CNW D;  5EGY A;  3EHN A;  2EIL C;  3NKE A;  4OD4 A;  3F47 A;  3DAF A;  4O6Y A;  4DVY P;  4C3B A;  2EIK C;  3ZSU A;  4CS8 A;  3F46 A;  4JVS A;  2B0J A;  4BJ6 C;  5T1D B;  1BR2 A;  2DGJ A;  1VYK A;  1KU2 A;  2WVQ A;  1BR4 A;  3CQZ A;  1MMA A;  4CS9 C;  4E7S A;  1VYI A;  1ST6 A;  1IW7 F;  2Y39 A;  2J7P D;  4CSA A;  2H7O A;  4E7Z A;  5KYY B;  1Z5Z A;  3Q7G A;  2KQ9 A;  2WZL A;  1VK5 A;  3EG9 B;  4DOZ A;  3UNG C;  1M2O A;  4KNW A;  2A68 F;  4B6I A;  4J32 B;  1OCC C;  3Q7L A;  2YZS A;  2YEV A;  4JJG A;  2CNW A;  2R7S A;  4JZA A;  5KYX B;  4GEH A;  3DJN B;  1LS1 A;  2XRH A;  3K66 A;  1FMV A;  5B1A C;  3RFY A;  5T3W A;  5DQT A;  1D0Y A;  1JPN A;  2Q9A A;  4U5D E;  4O6M A;  4W8K A;  2IXO A;  3UMI A;  3W8I A;  3WG7 C;  2P7V A;  3RH3 A;  4C3E A;  5F5F A;  1ZHY A;  1OCR C;  1SF8 A;  2VH3 A;  1TWH A;  2MYS A;  1G8X A;  4IAO A;  4OD5 A;  3AG1 C;  1D1C A;  3GOD A;  3ITF A;  2IXN A;  1ZHZ A;  4HEA J;  3FHD A;  5DLJ A;  2QY9 A;  1M2V A;  4JJF A;  3B0V C;  2Y3G A;  5HSW A;  5E33 A;  4OIR F;  5D91 A;  3NDB B;  3NG1 A;  1O87 A;  3O39 A;  5DVW A;  3DZA A;  4IWB A;  4BJ5 A;  2XSE A;  2Y69 C;  3SZR A;  3W2W A;  2KNH A;  2XXA A;  1J8Y F;  3ECS A;  2OG2 A;  3SEO A;  3I5P A;  3WOD F;  2MWQ A;  2ZXW C;  3MLG A;  4LAC B;  4PJM A;  2KW3 C;  1OKK D;  3H65 A;  5KYY A;  1WGW A;  4XTK A;  4Q7C A;  3T6B A;  4LER A;  3EG9 A;  3JCU Q;  3K1I C;  3AG3 C;  4YT4 A;  1FFT C;  4PJN A;  2EIJ C;  2A69 F;  1QLE C;  1TR2 A;  2V3C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...