3NYLA

The x-ray structure of an antiparallel dimer of the human amyloid precursor protein e2 domain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
b'TPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer dis
publication title The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 79
structure length 196
sequence length 196
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nylA00
3K66A 3QMKA 3PMRA 4RDAA 3UMIA 3UMKA 4RD9A 4YN0B 3UMHA 3NYLA 3Q7LA 3K6BA 3NYJA 3Q7GA 5BUOA 1TKNA
chains in the Genus database with same CATH superfamily
2X0CA 4FAPB 3GEIA 3ZQVA 4YT8A 2R7XA 2C03A 2CGEA 4GEHA 3Q7GA 4BJ6A 3R2PA 4CS8A 3AJMA 4N4WA 3QZCA 3C62A 4BPMA 4ONSA 4BG0A 2FFHA 3JZ0A 1ZU4A 3C8GA 1YZCA 1RMVA 4HFFB 3SXYA 3WODF 1NZEA 1K04A 1TWGA 2NSFA 3EFOB 2JX0A 1L3PA 2KC3A 2L81A 3TOLA 1D0XA 3L8JA 1RKEB 3AQBA 1HE1A 3K6BA 1BR2A 4P9FA 2L7AA 2OG2A 3DM9B 1TWCA 2C04A 5JSLA 2YWAA 3NMKA 2RSEB 2EILC 4OIQF 3O55A 3KPHA 4AE4B 3NMJA 5BQHA 1YJGA 5JRAA 4EHPA 4ZLDA 2Y3DA 2A69F 3QVZA 3X2QC 5KYXB 3QW1A 1OXKA 2Q7RA 1WASA 3LESA 2M64A 2R03A 3GM3A 3FDQA 1CPQA 3ASOC 4JCZA 2KSFA 2OEXA 2OOCA 2HSQA 3NG1A 2MWQA 1TKNA 4F4BA 3IQCA 4MVSA 1YLMA 5JT4A 1OW6A 3LEVA 1E84A 4JVSA 3NRHA 1G5ZA 2XLWA 3FHDA 3W8IA 1T6QA 3EH2A 4U5FE 3AQCA 5F28E 1ZHTA 2VCAA 5L0FA 2HJMA 2Y69C 5HV9A 2L6FA 3GANA 3W2VA 5GPGB 1CGOA 1ZHZA 3BEHA 3EPVA 4K1OA 2HS5A 2P0NA 5BQIA 4XPYA 1B68A 4RBNA 4NC3A 4OIRF 1K40A 5EGYA 4W8PA 1TR2A 4CS9C 4LLCA 4O6MA 4DJ9A 1LKXA 3GORA 2WVOA 1RJ9A 3IEEA 2YKZA 3X1OA 1W2WA 2XRHA 5L0IA 2HKVA 4MTGA 1JPNA 1LPEA 2CYDA 2LIGA 3UGOA 3JRMO 4X0RA 2X51A 2R7UA 3KYJA 4D4NA 1OCZC 2Q3TA 3Q7LA 2WVNA 2B0JA 3M15A 3V5XA 4Z9IA 2KW3C 4WJ0A 2Q9CA 3QMKA 3QVYA 2KK1A 2A68F 2J7PD 4D4XA 4MVQA 4QI0A 4P6IC 1IZMA 4FESA 4JZAA 5L0DA 3DAFA 3MBGA 2GWWA 3LAYA 3LNMB 2CW0F 4NTAA 2O9XA 5K0IA 3Q6NA 3JSEO 3CSKA 4ANJA 1Q0KA 3OEOA 4B6IA 4XLPF 2VC9A 1GQAA 1JRAA 2QE9A 2VCCA 3B71A 1Y6DA 1Z3IX 2QY9A 4U5DE 1JMWA 3NYMA 4XEVA 4YJWA 1Z7Qc 3KH2A 3VAYA 2W9YA 3RYLA 3HJCA 2AWYA 3L34A 3SZRA 1PD0A 3LS0A 5KYUB 2ZPAA 1VB5A 2R9RB 3OA1A 4JRZA 2XL4A 3HNKA 4G7OF 1ZU5A 1A7VA 2Z15A 5A6BD 3RVYA 2GA0A 4OIPF 5CI8A 5L3VA 1FNTc 2LQGA 2Q00A 2Y3BA 1H7IA 3H65A 3JYYA 4MVOA 3VF0A 3EZHA 1OCOC 1TFKB 2JD3A 4Q4ZF 2YVKA 2R7RA 2XM0A 1SF8A 3U9MA 2HV6A 4BEMJ 4PK4A 2EIJC 3ZQYA 4ULVA 1QZXA 4NY3A 4J7YA 1NSGB 2D5RB 2XLHA 3FXHA 2R05A 3DE8A 2XLEA 4JW1A 4YK5A 4CDAA 3U3BA 4AX2A 2J7PA 4U5HA 3B0PA 3TJ6A 2H7OA 4JTDB 5F5HA 4DRIB 3EHMA 4G0HA 1GM5A 2LP4A 3GM2A 3UMKA 3C8ZA 3RQGA 1RXQA 2IBFA 2J9VA 3SXKA 5E2QA 4CBEA 5JUAA 2YLGA 1MNEA 3ZIBA 4BEJA 5E3CA 3AGTA 3FAPB 2EPNA 2W45A 3OWTA 1WN0A 1T01A 1Y4CA 1Z23A 256BA 2YQYA 5KYXA 4MVZA 5AC4A 1D1BA 2L6GA 4MTFA 3L8IA 1S7ZA 2W4BA 3S28A 5DVWA 3F46A 3IQTA 2J9WA 1PCXA 4KNVA 1V74B 1V4AA 1T9KA 2DB4A 2J45A 2YEVA 1OKKD 4PJJA 1DOWA 2G62A 2XXAB 3DI5A 3O6XA 1NU7D 3EGDB 3M4CA 4PJLA 4YL1A 5A6BA 4RDAA 5E3AA 1T6IA 3LNRA 4PR9A 2IXNA 4YWQA 3C63A 2R7VA 3G50A 5T3WA 1LS1A 3PDMP 1I4YA 4U9DA 4XQ1A 3JTLO 4UDVA 4MQ9F 4XEKA 2ASRA 3LLKA 2XSEA 1MQVA 1LVKA 1PD1A 4K7BA 3KL4A 2GFHA 3V5YA 1M2VB 1UFBA 2A6HF 3O39A 5A6KA 1Q0DA 2EPOA 3N24A 3T9OA 4FWVA 5F5FA 4N06A 2GAQA 3H2VA 2H8AA 1NG1A 5L0HA 3B0UX 1K05A 4CX9A 3CQZA 5CIVA 3HKKA 2PP4A 4CDVA 4CJGA 4KC9A 3DXJF 4J7TA 2R02A 3GM1A 2AWCA 3DD7A 3RW0A 4DVYP 3IHUA 3FOOA 2PX0A 3JCUQ 2KQ9A 3EQLF 3ZVRA 1KTMA 3U5SA 3IQ5A 3LS1A 1QQ3A 1MMGA 1MMDA 1OKKA 2XL6A 1OR2A 4CS9A 5A6AA 2XS1A 5FZTA 4YN0B 2NSGA 4MW8A 5A6JA 2BC5A 5JS5A 4AK9A 3US6A 4JKVA 3V7OA 4IAQA 1E86A 3EGXB 2PX3A 4IJJA 3RKOF 1FFHA 3EG9B 4FX5A 4C7OB 1RKCA 2IXPA 4NQFA 1OR3A 2JPUA 4YT5A 2EIMC 3WAQA 2EINC 2I15A 4M63A 3JRTA 4OINF 5KYWB 4GQHA 3ABLC 3GEEA 5KYUA 3UMHA 3ZG1A 3CZ6A 3K7DA 3MFNA 4MS2A 4MVMA 3G4XA 4L6RA 1YYXA 1M56C 3K66A 1MNDA 3NKEA 3I4UA 2Q4FA 4I3MA 2NUPB 1Z6AA 2IOQA 2MHRA 3DM5A 4YT2A 1XWJA 3RFYA 1ZVZA 4CSAC 1U0BB 4LDQA 4U5BE 5D92A 1JPJA 2DI3A 3BRJA 2HJ3A 3U9JA 3AG2C 1PV3A 2VB6A 1HY5A 2WZLA 1C03A 3JSZA 3CEXA 3L0IA 5FCLA 2OEVA 2FAPB 3GWLA 2J8WA 1OCRC 3V5ZA 2IM8A 4OIOF 3AG1C 1NFNA 1HE9A 3ATPA 4U5GA 1FTSA 1ZW2A 5KYYB 4IWBA 2G3VA 3Q6MA 2VH3A 5D91A 5T1DB 1LE4A 2M4EA 5COGA 3TD7A 5AC5A 1D1AA 1U6HA 5JLIA 3LEOA 4C3EA 1LI5A 3U2MA 1D1CA 1H6GA 3ABKC 3A11A 4A4AA 5DS5A 1SZIA 1NLXA 2V26A 3M1CB 4XTKA 3S0XA 2L6HA 1T6UA 1FAPB 5DQZA 4Z9JA 2LFDA 1G4WR 2UUIA 3W4YA 1VYIA 2FGYA 3C8GB 2AU5A 4QI2A 3SXMA 3E70C 1TWHA 3FAJA 5T3TA 4EUKB 1T5OA 1NFOA 1GS9A 2YL3A 4R32A 5B1AC 2XXAA 3ASNC 3ZDLA 1NU9C 2R7OA 3EHNA 2AVKA 5JVEA 3POVA 3DJUB 3AG3C 1G4US 3E9VA 3SYNA 4KNWA 4PJMA 3PCVA 4RD9A 5DQTA 3DAGA 3GEHA 1OQCA 1NBBA 3EZIA 2E87A 4JIOA 2F22A 4WABA 3K1IC 1LIHA 4HE8D 1BR4A 4AL1A 2XS8A 4Q7CA 4CIPA 3WHNA 2YL7A 4O6YA 1HW1A 2ZXOA 5EHHA 2TMVP 2KJGA 3TOMA 2ZXPA 3K1HA 4J32B 1HW2A 2PFDA 1A7EA 1KNYA 1M2VA 1CGME 1ZHYA 3HLZA 5L0CA 4XLNF 4BJ5C 4P9TA 2WL8A 3LJBA 3DE9A 4JEBA 3RQEA 1SMYF 2YL0A 4JTCB 3PHF2 2J0XA 3EFOA 3K33A 2HV7A 2W4MA 3VRCA 4CJOA 2P7VA 1RKEA 1VOMA 2OQMA 5EK0A 1FMVA 2HSBA 2H7BA 3QTHA 4XEFA 2V3CC 2J46A 3FMSA 2EPMX 1HMDA 1VMAA 2J0WA 1FFTC 1D0ZA 1D0YA 3DWWA 4JJGA 5TJ5E 3VYWA 1BR1A 4AE4A 3NKDA 1TWAA 1EKYA 2OU6A 4CIHA 3T6JA 3SEOA 3KYIA 1ZZPA 1V54C 2EPKX 1I5NA 4YL3A 3RIPA 2HZ8A 1ZHWA 2LCHA 3CAXA 4G78A 1XZQA 3N2ZB 3EGXA 4LERA 1CPRA 2A1DD 4PACA 1N1CA 3IPMO 4JURI 1SYQA 4QDLA 1QVXA 3EG9A 4C7OA 3F47A 4PFOA 5L0GA 3AOUA 4YT4A 3SXZA 1E85A 4ULWA 1APCA 2EIKC 1M6TA 1WGWA 2IXOA 1YVIA 4NTBA 1AEPA 2QUPA 1M57C 3EJNA 2WB7A 2NPUA 3MX3A 4BJ1A 2Y3HA 3NMIA 3C18A 1H9GA 3W8HA 1YA7O 1KU2A 2MYSA 3IQ6A 5E33A 3HNIA 2LK4A 4NTFA 4U9EA 4BJTA 2YZSA 4E7ZA 1J8YF 4NCQA 4LLEA 4O79A 4EKWA 4IAOA 3PMRA 1E83A 3TULA 3MYFA 1AUEA 4JC7A 4EBBA 2OKUA 4CSAA 1QSPA 4I1OB 2LSEA 4IGGA 3UGPA 5BQGA 1GGQA 3TK0A 5KYYA 1BZ4A 1S05A 2Q9AA 4U5EE 3RVZA 4DXWA 4C3DA 4I1MA 4E0HA 3MLGA 3NYJA 3ECSA 4JJFA 3SNHA 2ZD9A 4DRJB 1ST6A 5COFA 3L1MA 4A2NB 3T6GB 4DRHB 4E0IA 3HNJA 4IRUA 2WZFA 3DMDA 4XWJA 2Y3GA 1LE2A 3RH3A 3AGUA 1Q0MA 4JE9A 2Q9BA 5DS6A 4WGYA 4EBJA 4G7HF 5L0JA 1R5ID 2P61A 2XM4A 1TQGA 1A7DA 2NUTB 4JCHA 1QKRA 3S9OA 3ZTMA 4E7SA 1YA9A 1ZYRF 4G7ZF 3NDBB 2ZXRA 2R25A 1VYKA 4LACB 3S90A 3JT1A 1EQ1A 2LFFA 3GWNA 3U2LA 2OJED 1XZPA 3M4BA 3DZAA 1ORJA 2ETSA 2J9BA 4HFKB 4LDRA 2CDQA 3ZWIA 4DBRA 4IB4A 1V55C 1YYJA 2OCCC 1WTYA 4C3BA 2IYLD 1VTMP 3S29A 1MMAA 1O5HA 2HFIA 4EWCA 1TFOB 1SR2A 3FOPA 2XLVA 4K0DA 1BDJB 1LM3B 4BJ6C 2HMQA 3WG7C 4CS8C 2PF4E 4OD4A 5CI9A 2R7WA 1A0BA 2AP3A 4MW3A 2XLDA 1UG7A 4H54A 3K1IA 3R7CA 2CNWD 1EI7A 4O7GA 3U3FA 1O87A 3LLIA 2IXMA 3UR3C 1YAUO 2VCBA 4IARA 5DS4A 2UUHA 2R7TA 1LS4A 4WGZA 1JOGA 3AG4C 2PBEA 2VASA 1WATA 4BJ5A 1J8MF 2XL8A 2BE5F 3B9QA 3MYIA 2QNLA 3U0CA 4ZLCA 1OCCC 4YL0A 1QPUA 2J9UA 2B0HA 4KI2A 2Y39A 1ZW3A 1LI7A 3ABMC 2ZXWC 2QLAA 4MTOA 4N6CA 4HEAJ 2PNOA 3A9CA 3EGDA 4GYTA 4CDYA 1L7CA 1Q0FA 2KGOA 3HTKC 3S27A 1U89A 5JP7A 2DGJA 3SP1A 2H7VC 2GDCA 2G3KA 3UNGC 3S84A 5KYNA 3G4ZA 5HSWA 1QLEC 2XLMA 4MVRA 2RD9A 2YL1A 3C7JA 4JEAA 1WWPA 2QTVA 1H9TA 1VLTA 3TJ5A 3JYHA 2CNWA 2A6EF 4U5CE 2DYRC 3QW0A 4KBLA 2LD6A 3KMIA 1OXBA 1RCPA 4DVZA 3VM6A 3ZC4A 1OW7A 1YARO 2YLDA 2I8BA 1G8XA 2ICWG 3ITFA 1Q0GA 1JR8A 5DLJA 1YZAA 4PJNA 2P6VA 3LUTB 2KNHA 3KKBA 4XPWA 3B0VC 3TQOA 4MVUA 3T4RA 3RF3A 1HMOA 2R7QA 1WOLA 2YLIA 4E18A 1DOVA 1OW8A 2KYHA 4ER9A 2XLOA 1R4TA 4EIYA 3NYLA 1YDIA 4EBKA 4O6NA 3ZSUA 1RJ9B 3H2UA 5COMA 3T6BA 5B3IA 2NUTA 3DKAA 3I5QA 4XPXA 3UMIA 1ZHXA 3M79A 2OJQA 2YHSA 3U8PA 2D4UA 4Z9HA 1C02A 1MMNA 1VLSA 1Z5ZA 3C8GD 2HMZA 1ORSC 2CCYA 1A41A 4J30B 5B3SC 5KYWA 3EH1A 3ZTZA 2DYSC 2A0UA 1FR0A 4W8KA 5L3QA 4JTAB 2NG1A 3N0TA 1AVOB 2A0BA 4MNDA 4E17A 1M2OA 2NUPA 4I44A 3DJNB 3O10A 5IY5C 1I4ZA 4AL0A 2WVQA 4Q5SF 3GODA 2P1AA 4OD5A 4CS7A 1BBHA 2WZGA 3B29A 3W2WA 1JAFA 1VK5A 2EPLX 3HNLA 3RQFA 1ORYA 2HUJA 2YRFA 1CGNA 1O3UA 5BUOA 2L9JA 1Z63A 2R7SA 4N6HA 1IW7F 5AGFA 3I5PA 4DOZA 5A69A 3J06A 4LDKA 2BL2A 1EA8A 1FMWA 3FVYA 4PFPA 5B1BC 1F1MA 4DBQA 1E2XA 3U8VA 1C17M 4H4KC
chains in the Genus database with same CATH topology
2R7XA 4YT8A 2C03A 2CGEA 4GEHA 3Q7GA 4BJ6A 4CS8A 3QZCA 4BG0A 2FFHA 1ZU4A 4HFFB 3WODF 1NZEA 1TWGA 3EFOB 2L81A 1D0XA 3AQBA 3K6BA 1BR2A 3DM9B 2OG2A 1TWCA 2C04A 4OIQF 2EILC 4AE4B 4ZLDA 2Y3DA 2A69F 3X2QC 5KYXB 3LESA 3FDQA 3ASOC 3NG1A 2MWQA 1TKNA 4F4BA 3LEVA 4JVSA 3NRHA 3FHDA 3W8IA 3EH2A 4U5FE 3AQCA 1ZHTA 2Y69C 3GANA 3W2VA 1ZHZA 3EPVA 4RBNA 4OIRF 5EGYA 1TR2A 4CS9C 4LLCA 4O6MA 1LKXA 2WVOA 1RJ9A 3IEEA 3X1OA 1W2WA 2XRHA 1JPNA 3UGOA 4X0RA 2X51A 2R7UA 1OCZC 2Q3TA 3Q7LA 2WVNA 2B0JA 2KW3C 4WJ0A 2Q9CA 3QMKA 2A68F 2J7PD 4QI0A 4P6IC 1IZMA 4FESA 4JZAA 3DAFA 3LAYA 2CW0F 2O9XA 3Q6NA 4ANJA 3CSKA 3OEOA 4B6IA 4XLPF 4U5DE 2QY9A 1Z3IX 3NYMA 4YJWA 3KH2A 3VAYA 2W9YA 3RYLA 3HJCA 3SZRA 3L34A 5KYUB 1PD0A 3LS0A 2ZPAA 3OA1A 2XL4A 4G7OF 1ZU5A 2Z15A 4OIPF 5CI8A 5L3VA 2Y3BA 3H65A 3EZHA 1OCOC 2JD3A 4Q4ZF 2R7RA 1SF8A 2HV6A 4PK4A 2EIJC 1QZXA 4NY3A 2D5RB 4JW1A 4AX2A 2J7PA 4U5HA 3B0PA 5F5HA 2H7OA 3EHMA 4G0HA 3UMKA 2J9VA 5E2QA 4CBEA 1MNEA 3ZIBA 4BEJA 5E3CA 3OWTA 2W45A 1Z23A 5KYXA 1D1BA 1S7ZA 2W4BA 3S28A 5DVWA 3F46A 2J9WA 1PCXA 4KNVA 4PJJA 2J45A 2YEVA 1OKKD 2G62A 2XXAB 3O6XA 1NU7D 3EGDB 4PJLA 4RDAA 5E3AA 3LNRA 2IXNA 4YWQA 2R7VA 5T3WA 1LS1A 4MQ9F 3LLKA 2XSEA 1LVKA 1PD1A 4K7BA 3KL4A 2GFHA 1M2VB 2A6HF 3O39A 3N24A 4FWVA 5F5FA 4N06A 1NG1A 3B0UX 3CQZA 2PP4A 4KC9A 3DXJF 3DD7A 4DVYP 3JCUQ 2PX0A 2KQ9A 3EQLF 3ZVRA 3LS1A 1MMGA 1MMDA 1OKKA 4CS9A 4YN0B 4AK9A 3V7OA 3EGXB 2PX3A 4IJJA 3RKOF 1FFHA 3EG9B 4FX5A 4C7OB 2IXPA 4YT5A 2EIMC 2EINC 4M63A 3JRTA 4OINF 5KYWB 3ABLC 5KYUA 3UMHA 3ZG1A 3CZ6A 3K7DA 3K66A 1M56C 1MNDA 3NKEA 3I4UA 4I3MA 4YT2A 2NUPB 1Z6AA 2IOQA 3DM5A 3RFYA 4CSAC 4U5BE 5D92A 1JPJA 3AG2C 2VB6A 2WZLA 5FCLA 3JSZA 3L0IA 1OCRC 4OIOF 3AG1C 4U5GA 1FTSA 5KYYB 4IWBA 2G3VA 3Q6MA 2VH3A 5D91A 5T1DB 2M4EA 3TD7A 1D1AA 4C3EA 1D1CA 3ABKC 5DS5A 1SZIA 3M1CB 2V26A 4XTKA 3S0XA 5DQZA 1VYIA 2FGYA 4QI2A 3E70C 3FAJA 1TWHA 5T3TA 5B1AC 2XXAA 3ASNC 3POVA 1NU9C 2R7OA 3EHNA 3DJUB 3AG3C 3E9VA 3SYNA 4KNWA 4PJMA 5DQTA 4RD9A 3DAGA 3EZIA 2E87A 3K1IC 4HE8D 1BR4A 4Q7CA 5EHHA 4O6YA 2ZXOA 2KJGA 2ZXPA 3K1HA 4J32B 2PFDA 1M2VA 1ZHYA 3HLZA 4XLNF 4BJ5C 2WL8A 3LJBA 3PHF2 1SMYF 2J0XA 3EFOA 3K33A 2HV7A 2W4MA 2P7VA 1VOMA 1FMVA 2H7BA 2V3CC 2J46A 2J0WA 1VMAA 3VYWA 1FFTC 1D0ZA 1D0YA 4JJGA 1BR1A 4AE4A 3NKDA 1TWAA 4CIHA 3T6JA 3SEOA 1V54C 3RIPA 1ZHWA 3N2ZB 3EGXA 4LERA 2A1DD 1N1CA 4JURI 4QDLA 3EG9A 4C7OA 3F47A 4PFOA 4YT4A 4ULWA 2EIKC 1WGWA 2IXOA 3EJNA 3MX3A 1M57C 2WB7A 4BJ1A 2Y3HA 3W8HA 1KU2A 2MYSA 5E33A 4BJTA 2YZSA 4E7ZA 1J8YF 4LLEA 4O79A 4IAOA 3PMRA 4EBBA 4I1OB 2LSEA 3UGPA 5KYYA 2Q9AA 4U5EE 4C3DA 4I1MA 3MLGA 3NYJA 3ECSA 4JJFA 3SNHA 4CSAA 1ST6A 4A2NB 4IRUA 2WZFA 3DMDA 4XWJA 2Y3GA 3RH3A 2Q9BA 5DS6A 4G7HF 4JCHA 2NUTB 4E7SA 3NDBB 1ZYRF 4G7ZF 2ZXRA 4LACB 1VYKA 3JT1A 3DZAA 4HFKB 2CDQA 4DBRA 1V55C 2OCCC 4C3BA 2IYLD 3S29A 1MMAA 1O5HA 4EWCA 4K0DA 4BJ6C 3WG7C 4CS8C 2PF4E 4OD4A 5CI9A 2R7WA 2CNWD 4O7GA 1O87A 3LLIA 2IXMA 3UR3C 2R7TA 5DS4A 3AG4C 4BJ5A 2VASA 1J8MF 2BE5F 3B9QA 4ZLCA 1OCCC 2J9UA 4KI2A 2Y39A 3ABMC 2ZXWC 4HEAJ 3EGDA 4GYTA 2KGOA 3HTKC 3S27A 2DGJA 3SP1A 2H7VC 3UNGC 2G3KA 5KYNA 5HSWA 1QLEC 2QTVA 3JYHA 2CNWA 2A6EF 4U5CE 2DYRC 4KBLA 4DVZA 3KMIA 3ZC4A 2I8BA 1G8XA 3ITFA 5DLJA 3B0VC 4PJNA 2P6VA 2KNHA 3KKBA 3T4RA 2R7QA 3NYLA 4O6NA 3ZSUA 1RJ9B 3T6BA 2NUTA 3I5QA 3UMIA 1ZHXA 2YHSA 1Z5ZA 1MMNA 4J30B 5B3SC 5KYWA 3EH1A 2DYSC 4W8KA 5L3QA 2NG1A 3N0TA 4MNDA 1M2OA 2NUPA 4I44A 3DJNB 5IY5C 2WVQA 4Q5SF 3GODA 4OD5A 4CS7A 2WZGA 3W2WA 1VK5A 2R7SA 5BUOA 1Z63A 2L9JA 1IW7F 3I5PA 4DOZA 1FMWA 3FVYA 4PFPA 5B1BC 4DBQA 4H4KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K66 A;  3QMK A;  3PMR A;  4RDA A;  3UMI A;  3UMK A;  4RD9 A;  4YN0 B;  3UMH A;  3NYL A;  3Q7L A;  3K6B A;  3NYJ A;  3Q7G A;  5BUO A;  1TKN A; 
#chains in the Genus database with same CATH topology
 2X0C A;  4FAP B;  3GEI A;  3ZQV A;  4YT8 A;  2R7X A;  2C03 A;  2CGE A;  4GEH A;  3Q7G A;  4BJ6 A;  3R2P A;  4CS8 A;  3AJM A;  4N4W A;  3QZC A;  3C62 A;  4BPM A;  4ONS A;  4BG0 A;  2FFH A;  3JZ0 A;  1ZU4 A;  3C8G A;  1YZC A;  1RMV A;  4HFF B;  3SXY A;  3WOD F;  1NZE A;  1K04 A;  1TWG A;  2NSF A;  3EFO B;  2JX0 A;  1L3P A;  2KC3 A;  2L81 A;  3TOL A;  1D0X A;  3L8J A;  1RKE B;  3AQB A;  1HE1 A;  3K6B A;  1BR2 A;  4P9F A;  2L7A A;  2OG2 A;  3DM9 B;  1TWC A;  2C04 A;  5JSL A;  2YWA A;  3NMK A;  2RSE B;  2EIL C;  4OIQ F;  3O55 A;  3KPH A;  4AE4 B;  3NMJ A;  5BQH A;  1YJG A;  5JRA A;  4EHP A;  4ZLD A;  2Y3D A;  2A69 F;  3QVZ A;  3X2Q C;  5KYX B;  3QW1 A;  1OXK A;  2Q7R A;  1WAS A;  3LES A;  2M64 A;  2R03 A;  3GM3 A;  3FDQ A;  1CPQ A;  3ASO C;  4JCZ A;  2KSF A;  2OEX A;  2OOC A;  2HSQ A;  3NG1 A;  2MWQ A;  1TKN A;  4F4B A;  3IQC A;  4MVS A;  1YLM A;  5JT4 A;  1OW6 A;  3LEV A;  1E84 A;  4JVS A;  3NRH A;  1G5Z A;  2XLW A;  3FHD A;  3W8I A;  1T6Q A;  3EH2 A;  4U5F E;  3AQC A;  5F28 E;  1ZHT A;  2VCA A;  5L0F A;  2HJM A;  2Y69 C;  5HV9 A;  2L6F A;  3GAN A;  3W2V A;  5GPG B;  1CGO A;  1ZHZ A;  3BEH A;  3EPV A;  4K1O A;  2HS5 A;  2P0N A;  5BQI A;  4XPY A;  1B68 A;  4RBN A;  4NC3 A;  4OIR F;  1K40 A;  5EGY A;  4W8P A;  1TR2 A;  4CS9 C;  4LLC A;  4O6M A;  4DJ9 A;  1LKX A;  3GOR A;  2WVO A;  1RJ9 A;  3IEE A;  2YKZ A;  3X1O A;  1W2W A;  2XRH A;  5L0I A;  2HKV A;  4MTG A;  1JPN A;  1LPE A;  2CYD A;  2LIG A;  3UGO A;  3JRM O;  4X0R A;  2X51 A;  2R7U A;  3KYJ A;  4D4N A;  1OCZ C;  2Q3T A;  3Q7L A;  2WVN A;  2B0J A;  3M15 A;  3V5X A;  4Z9I A;  2KW3 C;  4WJ0 A;  2Q9C A;  3QMK A;  3QVY A;  2KK1 A;  2A68 F;  2J7P D;  4D4X A;  4MVQ A;  4QI0 A;  4P6I C;  1IZM A;  4FES A;  4JZA A;  5L0D A;  3DAF A;  3MBG A;  2GWW A;  3LAY A;  3LNM B;  2CW0 F;  4NTA A;  2O9X A;  5K0I A;  3Q6N A;  3JSE O;  3CSK A;  4ANJ A;  1Q0K A;  3OEO A;  4B6I A;  4XLP F;  2VC9 A;  1GQA A;  1JRA A;  2QE9 A;  2VCC A;  3B71 A;  1Y6D A;  1Z3I X;  2QY9 A;  4U5D E;  1JMW A;  3NYM A;  4XEV A;  4YJW A;  1Z7Q c;  3KH2 A;  3VAY A;  2W9Y A;  3RYL A;  3HJC A;  2AWY A;  3L34 A;  3SZR A;  1PD0 A;  3LS0 A;  5KYU B;  2ZPA A;  1VB5 A;  2R9R B;  3OA1 A;  4JRZ A;  2XL4 A;  3HNK A;  4G7O F;  1ZU5 A;  1A7V A;  2Z15 A;  5A6B D;  3RVY A;  2GA0 A;  4OIP F;  5CI8 A;  5L3V A;  1FNT c;  2LQG A;  2Q00 A;  2Y3B A;  1H7I A;  3H65 A;  3JYY A;  4MVO A;  3VF0 A;  3EZH A;  1OCO C;  1TFK B;  2JD3 A;  4Q4Z F;  2YVK A;  2R7R A;  2XM0 A;  1SF8 A;  3U9M A;  2HV6 A;  4BEM J;  4PK4 A;  2EIJ C;  3ZQY A;  4ULV A;  1QZX A;  4NY3 A;  4J7Y A;  1NSG B;  2D5R B;  2XLH A;  3FXH A;  2R05 A;  3DE8 A;  2XLE A;  4JW1 A;  4YK5 A;  4CDA A;  3U3B A;  4AX2 A;  2J7P A;  4U5H A;  3B0P A;  3TJ6 A;  2H7O A;  4JTD B;  5F5H A;  4DRI B;  3EHM A;  4G0H A;  1GM5 A;  2LP4 A;  3GM2 A;  3UMK A;  3C8Z A;  3RQG A;  1RXQ A;  2IBF A;  2J9V A;  3SXK A;  5E2Q A;  4CBE A;  5JUA A;  2YLG A;  1MNE A;  3ZIB A;  4BEJ A;  5E3C A;  3AGT A;  3FAP B;  2EPN A;  2W45 A;  3OWT A;  1WN0 A;  1T01 A;  1Y4C A;  1Z23 A;  256B A;  2YQY A;  5KYX A;  4MVZ A;  5AC4 A;  1D1B A;  2L6G A;  4MTF A;  3L8I A;  1S7Z A;  2W4B A;  3S28 A;  5DVW A;  3F46 A;  3IQT A;  2J9W A;  1PCX A;  4KNV A;  1V74 B;  1V4A A;  1T9K A;  2DB4 A;  2J45 A;  2YEV A;  1OKK D;  4PJJ A;  1DOW A;  2G62 A;  2XXA B;  3DI5 A;  3O6X A;  1NU7 D;  3EGD B;  3M4C A;  4PJL A;  4YL1 A;  5A6B A;  4RDA A;  5E3A A;  1T6I A;  3LNR A;  4PR9 A;  2IXN A;  4YWQ A;  3C63 A;  2R7V A;  3G50 A;  5T3W A;  1LS1 A;  3PDM P;  1I4Y A;  4U9D A;  4XQ1 A;  3JTL O;  4UDV A;  4MQ9 F;  4XEK A;  2ASR A;  3LLK A;  2XSE A;  1MQV A;  1LVK A;  1PD1 A;  4K7B A;  3KL4 A;  2GFH A;  3V5Y A;  1M2V B;  1UFB A;  2A6H F;  3O39 A;  5A6K A;  1Q0D A;  2EPO A;  3N24 A;  3T9O A;  4FWV A;  5F5F A;  4N06 A;  2GAQ A;  3H2V A;  2H8A A;  1NG1 A;  5L0H A;  3B0U X;  1K05 A;  4CX9 A;  3CQZ A;  5CIV A;  3HKK A;  2PP4 A;  4CDV A;  4CJG A;  4KC9 A;  3DXJ F;  4J7T A;  2R02 A;  3GM1 A;  2AWC A;  3DD7 A;  3RW0 A;  4DVY P;  3IHU A;  3FOO A;  2PX0 A;  3JCU Q;  2KQ9 A;  3EQL F;  3ZVR A;  1KTM A;  3U5S A;  3IQ5 A;  3LS1 A;  1QQ3 A;  1MMG A;  1MMD A;  1OKK A;  2XL6 A;  1OR2 A;  4CS9 A;  5A6A A;  2XS1 A;  5FZT A;  4YN0 B;  2NSG A;  4MW8 A;  5A6J A;  2BC5 A;  5JS5 A;  4AK9 A;  3US6 A;  4JKV A;  3V7O A;  4IAQ A;  1E86 A;  3EGX B;  2PX3 A;  4IJJ A;  3RKO F;  1FFH A;  3EG9 B;  4FX5 A;  4C7O B;  1RKC A;  2IXP A;  4NQF A;  1OR3 A;  2JPU A;  4YT5 A;  2EIM C;  3WAQ A;  2EIN C;  2I15 A;  4M63 A;  3JRT A;  4OIN F;  5KYW B;  4GQH A;  3ABL C;  3GEE A;  5KYU A;  3UMH A;  3ZG1 A;  3CZ6 A;  3K7D A;  3MFN A;  4MS2 A;  4MVM A;  3G4X A;  4L6R A;  1YYX A;  1M56 C;  3K66 A;  1MND A;  3NKE A;  3I4U A;  2Q4F A;  4I3M A;  2NUP B;  1Z6A A;  2IOQ A;  2MHR A;  3DM5 A;  4YT2 A;  1XWJ A;  3RFY A;  1ZVZ A;  4CSA C;  1U0B B;  4LDQ A;  4U5B E;  5D92 A;  1JPJ A;  2DI3 A;  3BRJ A;  2HJ3 A;  3U9J A;  3AG2 C;  1PV3 A;  2VB6 A;  1HY5 A;  2WZL A;  1C03 A;  3JSZ A;  3CEX A;  3L0I A;  5FCL A;  2OEV A;  2FAP B;  3GWL A;  2J8W A;  1OCR C;  3V5Z A;  2IM8 A;  4OIO F;  3AG1 C;  1NFN A;  1HE9 A;  3ATP A;  4U5G A;  1FTS A;  1ZW2 A;  5KYY B;  4IWB A;  2G3V A;  3Q6M A;  2VH3 A;  5D91 A;  5T1D B;  1LE4 A;  2M4E A;  5COG A;  3TD7 A;  5AC5 A;  1D1A A;  1U6H A;  5JLI A;  3LEO A;  4C3E A;  1LI5 A;  3U2M A;  1D1C A;  1H6G A;  3ABK C;  3A11 A;  4A4A A;  5DS5 A;  1SZI A;  1NLX A;  2V26 A;  3M1C B;  4XTK A;  3S0X A;  2L6H A;  1T6U A;  1FAP B;  5DQZ A;  4Z9J A;  2LFD A;  1G4W R;  2UUI A;  3W4Y A;  1VYI A;  2FGY A;  3C8G B;  2AU5 A;  4QI2 A;  3SXM A;  3E70 C;  1TWH A;  3FAJ A;  5T3T A;  4EUK B;  1T5O A;  1NFO A;  1GS9 A;  2YL3 A;  4R32 A;  5B1A C;  2XXA A;  3ASN C;  3ZDL A;  1NU9 C;  2R7O A;  3EHN A;  2AVK A;  5JVE A;  3POV A;  3DJU B;  3AG3 C;  1G4U S;  3E9V A;  3SYN A;  4KNW A;  4PJM A;  3PCV A;  4RD9 A;  5DQT A;  3DAG A;  3GEH A;  1OQC A;  1NBB A;  3EZI A;  2E87 A;  4JIO A;  2F22 A;  4WAB A;  3K1I C;  1LIH A;  4HE8 D;  1BR4 A;  4AL1 A;  2XS8 A;  4Q7C A;  4CIP A;  3WHN A;  2YL7 A;  4O6Y A;  1HW1 A;  2ZXO A;  5EHH A;  2TMV P;  2KJG A;  3TOM A;  2ZXP A;  3K1H A;  4J32 B;  1HW2 A;  2PFD A;  1A7E A;  1KNY A;  1M2V A;  1CGM E;  1ZHY A;  3HLZ A;  5L0C A;  4XLN F;  4BJ5 C;  4P9T A;  2WL8 A;  3LJB A;  3DE9 A;  4JEB A;  3RQE A;  1SMY F;  2YL0 A;  4JTC B;  3PHF 2;  2J0X A;  3EFO A;  3K33 A;  2HV7 A;  2W4M A;  3VRC A;  4CJO A;  2P7V A;  1RKE A;  1VOM A;  2OQM A;  5EK0 A;  1FMV A;  2HSB A;  2H7B A;  3QTH A;  4XEF A;  2V3C C;  2J46 A;  3FMS A;  2EPM X;  1HMD A;  1VMA A;  2J0W A;  1FFT C;  1D0Z A;  1D0Y A;  3DWW A;  4JJG A;  5TJ5 E;  3VYW A;  1BR1 A;  4AE4 A;  3NKD A;  1TWA A;  1EKY A;  2OU6 A;  4CIH A;  3T6J A;  3SEO A;  3KYI A;  1ZZP A;  1V54 C;  2EPK X;  1I5N A;  4YL3 A;  3RIP A;  2HZ8 A;  1ZHW A;  2LCH A;  3CAX A;  4G78 A;  1XZQ A;  3N2Z B;  3EGX A;  4LER A;  1CPR A;  2A1D D;  4PAC A;  1N1C A;  3IPM O;  4JUR I;  1SYQ A;  4QDL A;  1QVX A;  3EG9 A;  4C7O A;  3F47 A;  4PFO A;  5L0G A;  3AOU A;  4YT4 A;  3SXZ A;  1E85 A;  4ULW A;  1APC A;  2EIK C;  1M6T A;  1WGW A;  2IXO A;  1YVI A;  4NTB A;  1AEP A;  2QUP A;  1M57 C;  3EJN A;  2WB7 A;  2NPU A;  3MX3 A;  4BJ1 A;  2Y3H A;  3NMI A;  3C18 A;  1H9G A;  3W8H A;  1YA7 O;  1KU2 A;  2MYS A;  3IQ6 A;  5E33 A;  3HNI A;  2LK4 A;  4NTF A;  4U9E A;  4BJT A;  2YZS A;  4E7Z A;  1J8Y F;  4NCQ A;  4LLE A;  4O79 A;  4EKW A;  4IAO A;  3PMR A;  1E83 A;  3TUL A;  3MYF A;  1AUE A;  4JC7 A;  4EBB A;  2OKU A;  4CSA A;  1QSP A;  4I1O B;  2LSE A;  4IGG A;  3UGP A;  5BQG A;  1GGQ A;  3TK0 A;  5KYY A;  1BZ4 A;  1S05 A;  2Q9A A;  4U5E E;  3RVZ A;  4DXW A;  4C3D A;  4I1M A;  4E0H A;  3MLG A;  3NYJ A;  3ECS A;  4JJF A;  3SNH A;  2ZD9 A;  4DRJ B;  1ST6 A;  5COF A;  3L1M A;  4A2N B;  3T6G B;  4DRH B;  4E0I A;  3HNJ A;  4IRU A;  2WZF A;  3DMD A;  4XWJ A;  2Y3G A;  1LE2 A;  3RH3 A;  3AGU A;  1Q0M A;  4JE9 A;  2Q9B A;  5DS6 A;  4WGY A;  4EBJ A;  4G7H F;  5L0J A;  1R5I D;  2P61 A;  2XM4 A;  1TQG A;  1A7D A;  2NUT B;  4JCH A;  1QKR A;  3S9O A;  3ZTM A;  4E7S A;  1YA9 A;  1ZYR F;  4G7Z F;  3NDB B;  2ZXR A;  2R25 A;  1VYK A;  4LAC B;  3S90 A;  3JT1 A;  1EQ1 A;  2LFF A;  3GWN A;  3U2L A;  2OJE D;  1XZP A;  3M4B A;  3DZA A;  1ORJ A;  2ETS A;  2J9B A;  4HFK B;  4LDR A;  2CDQ A;  3ZWI A;  4DBR A;  4IB4 A;  1V55 C;  1YYJ A;  2OCC C;  1WTY A;  4C3B A;  2IYL D;  1VTM P;  3S29 A;  1MMA A;  1O5H A;  2HFI A;  4EWC A;  1TFO B;  1SR2 A;  3FOP A;  2XLV A;  4K0D A;  1BDJ B;  1LM3 B;  4BJ6 C;  2HMQ A;  3WG7 C;  4CS8 C;  2PF4 E;  4OD4 A;  5CI9 A;  2R7W A;  1A0B A;  2AP3 A;  4MW3 A;  2XLD A;  1UG7 A;  4H54 A;  3K1I A;  3R7C A;  2CNW D;  1EI7 A;  4O7G A;  3U3F A;  1O87 A;  3LLI A;  2IXM A;  3UR3 C;  1YAU O;  2VCB A;  4IAR A;  5DS4 A;  2UUH A;  2R7T A;  1LS4 A;  4WGZ A;  1JOG A;  3AG4 C;  2PBE A;  2VAS A;  1WAT A;  4BJ5 A;  1J8M F;  2XL8 A;  2BE5 F;  3B9Q A;  3MYI A;  2QNL A;  3U0C A;  4ZLC A;  1OCC C;  4YL0 A;  1QPU A;  2J9U A;  2B0H A;  4KI2 A;  2Y39 A;  1ZW3 A;  1LI7 A;  3ABM C;  2ZXW C;  2QLA A;  4MTO A;  4N6C A;  4HEA J;  2PNO A;  3A9C A;  3EGD A;  4GYT A;  4CDY A;  1L7C A;  1Q0F A;  2KGO A;  3HTK C;  3S27 A;  1U89 A;  5JP7 A;  2DGJ A;  3SP1 A;  2H7V C;  2GDC A;  2G3K A;  3UNG C;  3S84 A;  5KYN A;  3G4Z A;  5HSW A;  1QLE C;  2XLM A;  4MVR A;  2RD9 A;  2YL1 A;  3C7J A;  4JEA A;  1WWP A;  2QTV A;  1H9T A;  1VLT A;  3TJ5 A;  3JYH A;  2CNW A;  2A6E F;  4U5C E;  2DYR C;  3QW0 A;  4KBL A;  2LD6 A;  3KMI A;  1OXB A;  1RCP A;  4DVZ A;  3VM6 A;  3ZC4 A;  1OW7 A;  1YAR O;  2YLD A;  2I8B A;  1G8X A;  2ICW G;  3ITF A;  1Q0G A;  1JR8 A;  5DLJ A;  1YZA A;  4PJN A;  2P6V A;  3LUT B;  2KNH A;  3KKB A;  4XPW A;  3B0V C;  3TQO A;  4MVU A;  3T4R A;  3RF3 A;  1HMO A;  2R7Q A;  1WOL A;  2YLI A;  4E18 A;  1DOV A;  1OW8 A;  2KYH A;  4ER9 A;  2XLO A;  1R4T A;  4EIY A;  3NYL A;  1YDI A;  4EBK A;  4O6N A;  3ZSU A;  1RJ9 B;  3H2U A;  5COM A;  3T6B A;  5B3I A;  2NUT A;  3DKA A;  3I5Q A;  4XPX A;  3UMI A;  1ZHX A;  3M79 A;  2OJQ A;  2YHS A;  3U8P A;  2D4U A;  4Z9H A;  1C02 A;  1MMN A;  1VLS A;  1Z5Z A;  3C8G D;  2HMZ A;  1ORS C;  2CCY A;  1A41 A;  4J30 B;  5B3S C;  5KYW A;  3EH1 A;  3ZTZ A;  2DYS C;  2A0U A;  1FR0 A;  4W8K A;  5L3Q A;  4JTA B;  2NG1 A;  3N0T A;  1AVO B;  2A0B A;  4MND A;  4E17 A;  1M2O A;  2NUP A;  4I44 A;  3DJN B;  3O10 A;  5IY5 C;  1I4Z A;  4AL0 A;  2WVQ A;  4Q5S F;  3GOD A;  2P1A A;  4OD5 A;  4CS7 A;  1BBH A;  2WZG A;  3B29 A;  3W2W A;  1JAF A;  1VK5 A;  2EPL X;  3HNL A;  3RQF A;  1ORY A;  2HUJ A;  2YRF A;  1CGN A;  1O3U A;  5BUO A;  2L9J A;  1Z63 A;  2R7S A;  4N6H A;  1IW7 F;  5AGF A;  3I5P A;  4DOZ A;  5A69 A;  3J06 A;  4LDK A;  2BL2 A;  1EA8 A;  1FMW A;  3FVY A;  4PFP A;  5B1B C;  1F1M A;  4DBQ A;  1E2X A;  3U8V A;  1C17 M;  4H4K C; 
#chains in the Genus database with same CATH homology
 2R7X A;  4YT8 A;  2C03 A;  2CGE A;  4GEH A;  3Q7G A;  4BJ6 A;  4CS8 A;  3QZC A;  4BG0 A;  2FFH A;  1ZU4 A;  4HFF B;  3WOD F;  1NZE A;  1TWG A;  3EFO B;  2L81 A;  1D0X A;  3AQB A;  3K6B A;  1BR2 A;  3DM9 B;  2OG2 A;  1TWC A;  2C04 A;  4OIQ F;  2EIL C;  4AE4 B;  4ZLD A;  2Y3D A;  2A69 F;  3X2Q C;  5KYX B;  3LES A;  3FDQ A;  3ASO C;  3NG1 A;  2MWQ A;  1TKN A;  4F4B A;  3LEV A;  4JVS A;  3NRH A;  3FHD A;  3W8I A;  3EH2 A;  4U5F E;  3AQC A;  1ZHT A;  2Y69 C;  3GAN A;  3W2V A;  1ZHZ A;  3EPV A;  4RBN A;  4OIR F;  5EGY A;  1TR2 A;  4CS9 C;  4LLC A;  4O6M A;  1LKX A;  2WVO A;  1RJ9 A;  3IEE A;  3X1O A;  1W2W A;  2XRH A;  1JPN A;  3UGO A;  4X0R A;  2X51 A;  2R7U A;  1OCZ C;  2Q3T A;  3Q7L A;  2WVN A;  2B0J A;  2KW3 C;  4WJ0 A;  2Q9C A;  3QMK A;  2A68 F;  2J7P D;  4QI0 A;  4P6I C;  1IZM A;  4FES A;  4JZA A;  3DAF A;  3LAY A;  2CW0 F;  2O9X A;  3Q6N A;  4ANJ A;  3CSK A;  3OEO A;  4B6I A;  4XLP F;  4U5D E;  2QY9 A;  1Z3I X;  3NYM A;  4YJW A;  3KH2 A;  3VAY A;  2W9Y A;  3RYL A;  3HJC A;  3SZR A;  3L34 A;  5KYU B;  1PD0 A;  3LS0 A;  2ZPA A;  3OA1 A;  2XL4 A;  4G7O F;  1ZU5 A;  2Z15 A;  4OIP F;  5CI8 A;  5L3V A;  2Y3B A;  3H65 A;  3EZH A;  1OCO C;  2JD3 A;  4Q4Z F;  2R7R A;  1SF8 A;  2HV6 A;  4PK4 A;  2EIJ C;  1QZX A;  4NY3 A;  2D5R B;  4JW1 A;  4AX2 A;  2J7P A;  4U5H A;  3B0P A;  5F5H A;  2H7O A;  3EHM A;  4G0H A;  3UMK A;  2J9V A;  5E2Q A;  4CBE A;  1MNE A;  3ZIB A;  4BEJ A;  5E3C A;  3OWT A;  2W45 A;  1Z23 A;  5KYX A;  1D1B A;  1S7Z A;  2W4B A;  3S28 A;  5DVW A;  3F46 A;  2J9W A;  1PCX A;  4KNV A;  4PJJ A;  2J45 A;  2YEV A;  1OKK D;  2G62 A;  2XXA B;  3O6X A;  1NU7 D;  3EGD B;  4PJL A;  4RDA A;  5E3A A;  3LNR A;  2IXN A;  4YWQ A;  2R7V A;  5T3W A;  1LS1 A;  4MQ9 F;  3LLK A;  2XSE A;  1LVK A;  1PD1 A;  4K7B A;  3KL4 A;  2GFH A;  1M2V B;  2A6H F;  3O39 A;  3N24 A;  4FWV A;  5F5F A;  4N06 A;  1NG1 A;  3B0U X;  3CQZ A;  2PP4 A;  4KC9 A;  3DXJ F;  3DD7 A;  4DVY P;  3JCU Q;  2PX0 A;  2KQ9 A;  3EQL F;  3ZVR A;  3LS1 A;  1MMG A;  1MMD A;  1OKK A;  4CS9 A;  4YN0 B;  4AK9 A;  3V7O A;  3EGX B;  2PX3 A;  4IJJ A;  3RKO F;  1FFH A;  3EG9 B;  4FX5 A;  4C7O B;  2IXP A;  4YT5 A;  2EIM C;  2EIN C;  4M63 A;  3JRT A;  4OIN F;  5KYW B;  3ABL C;  5KYU A;  3UMH A;  3ZG1 A;  3CZ6 A;  3K7D A;  3K66 A;  1M56 C;  1MND A;  3NKE A;  3I4U A;  4I3M A;  4YT2 A;  2NUP B;  1Z6A A;  2IOQ A;  3DM5 A;  3RFY A;  4CSA C;  4U5B E;  5D92 A;  1JPJ A;  3AG2 C;  2VB6 A;  2WZL A;  5FCL A;  3JSZ A;  3L0I A;  1OCR C;  4OIO F;  3AG1 C;  4U5G A;  1FTS A;  5KYY B;  4IWB A;  2G3V A;  3Q6M A;  2VH3 A;  5D91 A;  5T1D B;  2M4E A;  3TD7 A;  1D1A A;  4C3E A;  1D1C A;  3ABK C;  5DS5 A;  1SZI A;  3M1C B;  2V26 A;  4XTK A;  3S0X A;  5DQZ A;  1VYI A;  2FGY A;  4QI2 A;  3E70 C;  3FAJ A;  1TWH A;  5T3T A;  5B1A C;  2XXA A;  3ASN C;  3POV A;  1NU9 C;  2R7O A;  3EHN A;  3DJU B;  3AG3 C;  3E9V A;  3SYN A;  4KNW A;  4PJM A;  5DQT A;  4RD9 A;  3DAG A;  3EZI A;  2E87 A;  3K1I C;  4HE8 D;  1BR4 A;  4Q7C A;  5EHH A;  4O6Y A;  2ZXO A;  2KJG A;  2ZXP A;  3K1H A;  4J32 B;  2PFD A;  1M2V A;  1ZHY A;  3HLZ A;  4XLN F;  4BJ5 C;  2WL8 A;  3LJB A;  3PHF 2;  1SMY F;  2J0X A;  3EFO A;  3K33 A;  2HV7 A;  2W4M A;  2P7V A;  1VOM A;  1FMV A;  2H7B A;  2V3C C;  2J46 A;  2J0W A;  1VMA A;  3VYW A;  1FFT C;  1D0Z A;  1D0Y A;  4JJG A;  1BR1 A;  4AE4 A;  3NKD A;  1TWA A;  4CIH A;  3T6J A;  3SEO A;  1V54 C;  3RIP A;  1ZHW A;  3N2Z B;  3EGX A;  4LER A;  2A1D D;  1N1C A;  4JUR I;  4QDL A;  3EG9 A;  4C7O A;  3F47 A;  4PFO A;  4YT4 A;  4ULW A;  2EIK C;  1WGW A;  2IXO A;  3EJN A;  3MX3 A;  1M57 C;  2WB7 A;  4BJ1 A;  2Y3H A;  3W8H A;  1KU2 A;  2MYS A;  5E33 A;  4BJT A;  2YZS A;  4E7Z A;  1J8Y F;  4LLE A;  4O79 A;  4IAO A;  3PMR A;  4EBB A;  4I1O B;  2LSE A;  3UGP A;  5KYY A;  2Q9A A;  4U5E E;  4C3D A;  4I1M A;  3MLG A;  3NYJ A;  3ECS A;  4JJF A;  3SNH A;  4CSA A;  1ST6 A;  4A2N B;  4IRU A;  2WZF A;  3DMD A;  4XWJ A;  2Y3G A;  3RH3 A;  2Q9B A;  5DS6 A;  4G7H F;  4JCH A;  2NUT B;  4E7S A;  3NDB B;  1ZYR F;  4G7Z F;  2ZXR A;  4LAC B;  1VYK A;  3JT1 A;  3DZA A;  4HFK B;  2CDQ A;  4DBR A;  1V55 C;  2OCC C;  4C3B A;  2IYL D;  3S29 A;  1MMA A;  1O5H A;  4EWC A;  4K0D A;  4BJ6 C;  3WG7 C;  4CS8 C;  2PF4 E;  4OD4 A;  5CI9 A;  2R7W A;  2CNW D;  4O7G A;  1O87 A;  3LLI A;  2IXM A;  3UR3 C;  2R7T A;  5DS4 A;  3AG4 C;  4BJ5 A;  2VAS A;  1J8M F;  2BE5 F;  3B9Q A;  4ZLC A;  1OCC C;  2J9U A;  4KI2 A;  2Y39 A;  3ABM C;  2ZXW C;  4HEA J;  3EGD A;  4GYT A;  2KGO A;  3HTK C;  3S27 A;  2DGJ A;  3SP1 A;  2H7V C;  3UNG C;  2G3K A;  5KYN A;  5HSW A;  1QLE C;  2QTV A;  3JYH A;  2CNW A;  2A6E F;  4U5C E;  2DYR C;  4KBL A;  4DVZ A;  3KMI A;  3ZC4 A;  2I8B A;  1G8X A;  3ITF A;  5DLJ A;  3B0V C;  4PJN A;  2P6V A;  2KNH A;  3KKB A;  3T4R A;  2R7Q A;  3NYL A;  4O6N A;  3ZSU A;  1RJ9 B;  3T6B A;  2NUT A;  3I5Q A;  3UMI A;  1ZHX A;  2YHS A;  1Z5Z A;  1MMN A;  4J30 B;  5B3S C;  5KYW A;  3EH1 A;  2DYS C;  4W8K A;  5L3Q A;  2NG1 A;  3N0T A;  4MND A;  1M2O A;  2NUP A;  4I44 A;  3DJN B;  5IY5 C;  2WVQ A;  4Q5S F;  3GOD A;  4OD5 A;  4CS7 A;  2WZG A;  3W2W A;  1VK5 A;  2R7S A;  5BUO A;  1Z63 A;  2L9J A;  1IW7 F;  3I5P A;  4DOZ A;  1FMW A;  3FVY A;  4PFP A;  5B1B C;  4DBQ A;  4H4K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...