3NZHH

Crystal structure of anti-emmprin antibody 5f6 fab
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
222
structure length
222
Chain Sequence
MKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAQIRLKSYNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTPDGSDYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5F6 LIGHT CHAIN
publication title Crystal structure of anti-emmprin antibody 5F6 FAB
rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 52
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2010-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nzhH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nzhH01
1PYWB 4WWKB 4JREC 1AQDB 3VXMB 1EEZB 3MROB 4EZMA 4WUUD 4YO0B 1ZLVK 5TQ2L 3RWGA 2BNUA 1OQXA 3CNKA 2PR4H 2YK1L 2W91A 1NFKA 2IJ0C 5D96C 3FT4B 1MY5A 4QXGL 3RL2A 4C54A 5D7IA 3HC3H 1GZPB 5F3BB 4G6ML 2J6EA 2VABB 1KT2B 1OAQL 3O2DH 3E8UL 3I3BA 3T04D 1BLNA 1EJOL 1L0XA 3SJVB 2ZSVB 3U79A 5C0CB 5LAXB 2BHUA 5DYOB 3TJEL 1ZHLA 2WQ8A 5F6HJ 2BNQB 3GI8L 4PJ7E 4R4FL 5DSCA 5HXMA 1IZJA 5E8DL 3HZYA 1KTLA 1P7QB 1NCCL 5GSVB 3I9GL 3L9RB 3KR3L 3V5HA 2WUCH 4FFWC 1D5XB 3T8XB 3MJ7B 2R1WA 4XWGL 3S5LB 3VXSA 2HMIC 2OK0L 3FO1B 3MXVL 4Z8FL 1K6QL 2X4NB 3OG4B 4LMQE 1FFOA 3GSWA 2FH8A 4P2RD 3WE6A 2ZOKB 1D5IH 5C6PB 2MJWA 1SY6H 4Y8DC 2YPVL 4HWNA 4PRBA 1HK6A 2CKBA 1JGUL 2QQNH 4LSUH 4MQ7B 1OF2A 1UEYA 1FYHB 3VFRA 1NL0L 2EXWD 2ADFH 4ZG1A 2FRGP 1TTFA 4JFOB 3RKDD 1CS6A 5E5MB 1RU9L 4BZ2H 5F96H 5JPMB 3EYFB 2QHRL 1FYTD 3C5ZD 1GVIA 4O2CA 1HQ4B 3ZYOA 2HLAA 3H3PL 2DQJL 2EDHA 1MRFL 1CD1A 1HHHA 3O3AA 4RFNC 2NYYC 2B4CL 3L5JA 1MJUH 3W82A 2BSTB 3ZYJA 4M6AA 2FECL 1CF8L 2PYEB 3F5WB 1UXSA 1MWAL 2NY4B 2GFBB 5EG6C 4NNPH 4Z7NE 4LHUB 4LCIH 3B83A 2DDQL 5TH2A 4FTVA 2Y7QB 5HSFA 3P11H 4Z7WB 2VIRA 3RGVD 3QIBB 4JRXD 4IM8A 4Y1AE 4UILH 3THML 1ES0B 4KHXL 4PJHA 2E9IA 2P5WE 4WDIB 3VGHA 5LGHL 5DEZA 3S7GA 1ZV5A 2AJZA 4FXGB 3LRGA 1MPAL 3DMMB 1DLHA 3NCJL 1QA9A 2FDBP 3PHQA 1R6VA 2B4CC 5E2TH 1NC2A 3O4LD 4IRSA 2B39A 2VAAA 2JJVA 4HJ0C 1YN6A 3VWKC 3QUZD 4ZAKC 1ONQB 3OJDA 1JRHI 3U1SL 5GISL 5BRZE 4MA8L 3NIFF 1M71B 1MF2H 2VLLB 5DJAA 4XRCA 4HLZG 3BPOC 3EJZC 3G5VA 2E9WA 2Q6WB 4WY7L 3V6ZB 6FABH 4URTB 4OBRA 1HOCB 3N1QC 4M7KH 3O0RL 4PJ7B 3KPQB 1T21A 4CVZA 3UZQA 4R90L 4WFHE 1OT2A 1JNHA 3PL6C 3O2WH 32C2A 4ZOEA 1G7HB 2WIIA 3TM6A 4S2SA 4NJAL 4ERSL 3WL9B 2EEBA 15C8H 2ZNXA 4XP9H 1EMTL 4P4RA 3HI1B 4UUJA 4NHCH 3I2CL 1XFPA 2EH8L 5T1LD 2X09A 2EC8A 5E99H 2EXYC 3S37L 4ENED 3IFNH 3QH3B 4LRNL 5HHME 4QYOA 1I7ZA 4ZS7H 1GGYA 2ITDA 1GSMA 1YY8A 1IAKB 4G6JL 5E0QA 3SEPA 3TBTA 5L8KB 2XT1B 4UT9L 3L3IB 1HEZA 4CNIB 5KSBF 1UVQA 1AD0B 3C60A 3MQIA 2QSCH 3MV9E 3LV3A 1IAMA 5BS0D 3ARGD 1OAYL 3P4LA 1PKQA 5EBLA 3Q1SH 4Z7QF 3ROLA 4L8CB 5IJVB 4F33A 4P23B 3SGKA 1NGWB 4U6HA 5C0JB 4JB9H 4GUPB 1GHFH 5I18H 5DZOA 2QTEA 3FB8B 4R3SA 4YWGL 3RA7H 2GITB 5GGTA 4I0PA 3L5XL 4NCC1 5I1EH 4YHPA 1E6JH 5A16A 3VFUA 1D5ZB 2NY7L 1B4JH 3FN0H 2J6EL 4YR6A 1MIEH 2WUBL 2ZOLB 1J8KA 2VRAA 4X8JA 3E2HB 2BVUA 2R15A 1HHKB 4AH2A 3PP3H 5C0RH 1T03L 1N5YL 1NANI 2FJGA 4K2UL 5DJCA 5K9OA 4NIKB 3IVKA 2YUZA 4MJ6A 4MD4A 3B3IA 5A3ID 1CDCA 3EO0B 5DEFA 2DI7A 1T83A 5FHAH 3L6FA 5HHQA 1A02N 3T0AA 1X5KA 2XKUA 4ORGA 3W5MA 2H2SD 4FQ2L 4Y1AB 2VLRE 3QO0A 1BVKA 4JZJB 4PJEE 1LNUB 5FF6A 3F7QA 2P5WB 4JM2A 1G9ML 5JORB 3DNKA 3QCUH 2VDPL 3UPRA 5FECB 4JG1L 1H3WM 2E27L 1TVHA 2VQ1A 4WO4A 3L95B 4BZYA 3GMMB 4RGMC 4ODTH 4X83A 4QRPE 3RKPA 4JEGB 5CZXC 4OCSL 1FO0B 2CKBL 5C6TH 5BRZB 3UAJD 4W81A 3G6AB 1OSPH 3U4AA 2HFGL 2HH0H 4TVSa 25C8H 4JLRB 1N2RB 5I1IL 1NCDL 3W9EB 1JPGA 2JCCA 3DOSA 3JV6B 4GRLD 5CS7A 1IL1B 1G9MC 5L0QB 4E0RB 4OIIH 4OCRL 4X99A 3MGOA 2VDNL 1VFOA 1J1OL 2BP3A 5DRZB 5FDYA 3DYMA 1VEMA 3EZ8A 5MP6L 1NC4D 5IEKA 3X11B 4PY7B 3TBSA 2ZP0T 2JKXA 1VKXB 4WI7A 4K94L 4XPTH 4MJ2A 1FIGH 5GHWL 3PIQA 4AG4H 1K4CB 1T0MA 3V0WL 5L7XL 3GBNH 4M6ML 4R4ND 5HHMB 2MQCA 5J7CC 5I30L 3IU4H 1XF2B 4YXLH 2XI9A 3S37X 5A2JH 3U7YH 1CDHA 1EFXB 3W0WD 2NXYB 2YPKA 5DURD 5JNYB 2HG5B 4M9PA 4DQOH 3ZSTA 5IV2A 3PP4L 4PBVC 3PABA 1ORSA 2ZUWA 1UH3A 4X6DF 1DN2A 4OZHF 5GGUB 5BXFB 2GK0A 4XI5D 4KRPC 4MDIA 1F3RB 3FRUB 3MV9B 2AKRA 5FA3A 1ZT1A 1BVLB 5FB8A 4DAGL 4I0KA 3N85H 4OKVB 4XAWL 4D0CB 4G6AD 4KJWC 4K94C 4ODSH 3PHOB 1U8MA 2EDQA 1OCWL 4OUUB 4HS6A 3MGAA 3V0AC 3T4YA 3ZKSD 4J1UB 3QDGA 5C0ND 3HE6C 4CU7A 3EGSB 1R5WB 2EEAA 1FL5A 4AENA 4UAOC 2MPAL 3BJLA 3H0TA 4YBLB 3U36A 2FO1A 4Z7VE 2P45B 3B9KD 2GTWA 5IQ7H 3RVVC 1SMOA 1J18A 4QWWD 4PTUA 1HDMA 1MHHB 1CXIA 4K7PL 2Y07H 1IM3B 4PJCF 4F7CA 4NN7C 2AAVA 5IB2A 1RD6A 4PGCB 3R06B 4NZRH 3HCVA 5E56A 3LMJL 5IVNA 4IRSC 1CLZH 4I3RL 1JRHH 2VLRB 4YHIA 4PJEB 5CEZE 1ZGLB 5LQBL 1F3JB 2H8PA 1WFNA 1KBGH 2RCSH 1UYWH 3HE7B 5HYIA 3REVA 4BELD 1BJ1H 3ARSA 4J8RB 1IQDA 2GJ6A 4KMQA 2EYTB 3TYGL 1NDMB 1B2WH 4QOKA 4QRPB 1R3KB 2ZPKL 5CD3B 1VESA 1MUJA 4WFEE 2DBLH 1D3CA 2ESVD 4TVPH 3MRIB 1R0AH 1A7QL 5L9DH 4HD9A 1JGVL 2JB5H 5C2BL 2YEZA 4ODWA 3BPCA 3T1FB 2C3GA 3QDAA 4KRNA 1R3JA 3EYQC 3N1MC 1J9CT 1BZQK 4AZ8A 2GYSA 4P46A 5IVXA 4BH8A 4ZQKA 3I02B 2K7QA 3T77A 2I27N 4Z77A 1L7TL 3DX8B 2VXSH 3BRGC 1ZVYA 2CRIA 4G43A 4PJ8B 4S1RH 5B38G 3T2NL 4JJ5B 4KJYB 3TCLA 2VLJD 4OCWL 4TNWF 5GGTL 1RZKH 2B20A 2E9BA 3L3HB 8FABB 1A7PL 3EFFA 5D2NE 3VW3H 3UJIH 1UCTA 3UYOD 2ADIA 3BN9C 5HI4C 2J8UF 1XF4A 7FABL 4V1DD 1DBJH 3C60C 3E1F1 4H8WH 2BRQA 1B3JA 1JF1B 1NBQA 4G3YL 2IADA 3FRPA 1AGBA 3MRMA 4LCWD 5F21B 3KPSD 4JPVL 4XXDB 4CU6A 2JLLA 3ELAT 1RZGA 4OLYL 5EU4A 4I48A 1EVUA 2C3VA 3S34L 2V2WA 4IRJD 3NZ8B 1OAXH 3MX0A 1VPOH 3KPLB 4DEPC 3OGCB 3LB6D 4JO2H 3SKMB 2OQJB 3VXOB 5HVHC 4LSQL 3PV6B 1I1AD 3QUXD 5D6DA 3UXFA 5JXEA 1OD9A 1NANH 4PD4K 3IJSA 4U1LA 1BZ9A 2WINB 3QFDA 2VXVH 1KENH 3QFJA 1EEQA 3QULB 5EC2B 4FRWA 2A9NH 5DQ9B 2EYRB 4U31A 1S7RA 4PJ9D 4OZIA 4OB5H 2V6HA 1T83C 1SJVA 1WSST 1B90A 3ZE1F 4Z7VB 4AEIH 1CR9H 1MREH 4TSBL 1AGDB 4PTTB 2EDJA 3QQ3B 4GMTH 3SBWA 5ESVB 3WEXA 4LVNC 5GGQL 2NR6D 1XGQA 4JM2C 1OLLA 5EOCJ 4I13B 2VDLH 3OKDB 4K7PX 4N0YH 1KIUA 3V5DB 3LRHA 4OLZL 4DTGL 4KK5D 1HKLL 3MODH 2G60L 4KVCL 5GGSA 3TN0D 3MLZL 2DLGA 3CLEL 4ODHH 3W81A 4RWYH 4O9HL 3KJ6H 5C08A 1AC6A 1JGEB 1EEYA 3HZVB 3V8CA 3G9VA 3CX2A 1NEZA 1OTSD 1IGML 1FORL 1Q1JL 3UTOA 3ZDXF 1F02I 2JIXD 1KXTB 3PQYE 1DQMH 3GO1L 2DQUL 4HWEL 1D5BA 3D0VA 2ZJSL 4Y5XA 1JNNH 3NTCH 1P4LA 3IFPB 4POUB 4N8CH 5INDB 3EYUH 3NA4A 4MHHG 1DEEA 5DUPL 1MLCA 1AHWB 3VXNA 3SDCA 1XF3A 4PRNA 4HAFA 3FTGA 3QEQA 3L3KA 2Y36L 3QDMA 4P5TD 1N8ZA 5LKNA 5KW9L 1BBDH 1WEJH 2O5XL 3F6IA 3PWUA 4M8QB 3P4MA 4YDJA 4MNGE 4AMKH 1G0DA 3T4AA 3TGXA 1X6LA 1EH9A 1AGEB 4MZ3A 5INCB 2I5YH 4Z76B 5DD3H 2Z35A 4JVWA 1HHJA 3M8OL 5EO9B 5D2NB 3AS1A 4HEME 3MCG1 2R8SL 5ID1B 3ULVH 3GUTB 4FQIH 3A67H 1F58L 1NGQH 5EZIH 5KS9E 4P2OB 4S1QL 2X4OB 2GJZB 5AAMA 2DKSA 3LH2H 4G7VH 4M1GL 4OGAC 3QUKA 5D7KE 1IKFH 3TZVB 1CE6B 3RVXD 3WDIA 2NZ9C 3SPVB 4X4YA 2Q20A 1INQB 5FHBH 3IJHA 4HIXL 4HG4J 4ZTOL 1MNUH 1AXIB 2CKNA 3QBTB 5FEBA 3CLFL 4PJ5E 1YEDB 4OF8A 5IMOA 3T0EA 1MIML 3GZKA 4NHUB 1L9NA 1IGCL 5IEHB 2WAHA 5EUOA 4CMMB 3E6HA 1MCDA 5JDSA 4X6BA 3NPSB 3DSNA 4XCNA 2QSTA 4YHML 4IRZL 4QRUA 3KVQA 2BNRA 1NFDE 4J23A 3RRQA 4PJGB 2PYFA 2AGJL 5MI0B 5EU6A 5IGXH 5F7WC 1MJJA 4LLYA 1UKQA 5MHSE 1MAML 3DTXB 4QHUB 2ZCKL 4QCIA 1KLGB 1X5XA 4HQQH 3B6SB 2XZZA 4Q2ZA 2AXGA 4FNLL 2V2TB 4DGIH 4WU5A 1EERB 4RGND 1WV7T 2Z31D 2XA8L 3PNWA 3DECA 1A9BA 5EO0B 1NAMH 4XMPH 1A4JA 3VXTA 2A74B 3BGMA 4HKJA 4F2MA 3PQYB 5HI5C 3OKLB 1AFVL 3MOAL 4F7EA 3QRGL 4P59L 4ZFGH 3GMOA 2IANE 4P46C 4P2CG 3VFNB 3S4SB 12E8L 1DTUA 1P4BH 4Z0BH 4KUCF 5BW7A 1LO0L 4L8DB 2P48B 1AKJD 1KCRL 1X4YA 5FIEA 5T5NG 4HEPG 4Z9KB 5HI3C 2PXYD 4XWOD 4ALAH 2R29L 3CMOL 2FX9L 3PWLA 3ZLQC 3F65A 1QTYT 1UH2A 5CZVL 3BKJL 4MD0A 4MNGB 5J3HD 3HLAB 1QFOA 1RUML 2V5RA 3RWCB 4OFDA 1DQJB 3CFEB 3L3OB 2EECA 2R0LH 3I6LE 4PJDE 1U92A 4WW1B 2F54A 5GRUH 3GHBH 5EPMA 1RFDH 4GBXA 2CDGA 5KS9B 5E6IB 3CX5J 4PP1C 1KLUA 4B41A 1R3LA 4C55A 1ITBB 3NCFB 2HTKC 4XNZB 5D6DC 1BGXH 1NKRA 5ISZA 1WFOA 5JXEC 2HKHL 3IFOB 4FG6D 4I1NB 5TDPB 2RQ8A 3EFDH 2JJWA 1NGYB 2WBJD 2EDYA 3WSQL 1UEMA 4JHWL 4M1CC 2NX5A 1IMHC 1C7SA 4YBQC 4NQSB 1F4YL 1GIGH 1FZMA 1KIQA 3SHSA 4QTIL 3MSPA 3LZFL 1KC5H 1I3RB 4H5SB 4U6XB 3RVUD 5FDWB 4PJ5B 1REIA 4GXVL 1YUHB 3RTQA 2ED9A 4D9LL 4AIZB 3TP4A 5CSZA 4F8TA 2QLVB 1RULL 5T33H 1RUQL 2Q7YA 2FD6H 3MJ8A 4K8RL 3OKKA 1RVFH 1T1XB 4N1EA 3V4PH 5J0BA 3QXWA 1EEUA 1K8DA 1UB6A 4JN1H 3WIFA 1JNLH 3LKRB 1MI5D 3TA3D 3O81A 1CICB 4BSVB 3PWPE 3GKWL 3RWJB 1NCBL 2HFEA 1NH6A 4U1JB 1N6QL 4PJXE 1QD0A 5FFLA 5F7LB 5DK0A 3WLWC 2V7HA 4O58L 4M7LT 2A6KB 4TUJA 1X44A 4RZCB 3VCLB 4RGOH 3BDYH 4O51A 5H8DA 1NEUA 2A38A 2J4WH 1F4XL 4G6KH 1WT5A 3OHXB 2XV6B 3VFGH 4OGXL 2ITCB 4Y5XC 4HCRH 3STBA 2JK5B 3VD5A 1A7OH 1K2DA 1H9VA 5FGCE 3D25A 5JR1L 4FFYH 4K8RC 3SDCC 4S1SL 4OD2B 4I4WB 2HT2D 4P9HL 4KJPD 3SN6N 5M95B 1FGVL 1JMXA 4L4VD 5C92A 1DUYB 1FNGB 1Q38A 2LFGA 2IANB 4S0TD 1ZHKA 2DQFB 2R2BB 5EZJA 1A3RL 1KEGL 3CVHB 5HGGS 3BZEA 2P47B 3K4DA 5HHNB 4NZDA 4OF3A 5SWSE 1OM3H 4HDIB 2VUYA 3SKUD 2AI0L 3DX9B 3OPZH 3ZL4H 3OKMB 3F58H 1R5IA 2XFXA 1YA5A 3FAWA 5F7DB 1MHEB 5TGBB 1WAAA 3MBEB 2HT3D 5B3JE 1KCLA 3C5JA 4XVJH 3UROR 1YPZF 3B2VL 5HJ3A 3UTSE 1MFAH 3HC4H 1BBJB 1BQHB 2AJUH 2XTJC 4PV9A 1KTKE 5MERA 1A5FL 3SO3C 1DQQA 5KSUA 1RJZA 1DBKH 3KNBB 5CP3A 5AUMA 2OI9C 5KSAB 4RCAA 4U1HA 8CGTA 3QIUD 4Q0XH 4V2BA 1T1YA 1TJIH 1QG3A 1OAKL 3WD5L 3P9MB 4PJDB 3OV6A 3H9SA 2EEDA 1A1OB 2YKLL 3C09B 1RHFA 2OTUB 4RNRA 4APQB 1IGJB 2A73B 1JTOA 3PDOB 5IFAH 4KY1H 1LEKA 1XZ0A 4Q9QL 1YNKL 3MLUH 4OV6F 5LGJA 3O8XD 5HYSB 2VLKD 2BVQA 3DROB 4ONFH 4JO3H 3T0EC 5DMKB 2IAMD 4UU9B 5IB3B 1AR1C 3MRJB 4U05A 4BA8A 1YC7A 3RZCB 1AI1L 3JWDL 5F9JA 3U46A 4XC3H 5F6IB 3QIWB 1JZ8A 1QO3B 5IR1B 1Y0LA 3QCTL 2CK0L 1UJ3C 1AXTH 3IDGA 4JFDE 4PJEF 2BHYA 1WZMA 2BVPB 2DTMH 2NLJB 3HRZA 4KQ4L 3SCMB 4YFLF 2WK2A 4OD1H 1CL7I 1IGFL 2AW2A 3NH7L 2I60H 5FYJL 5ICXB 1NUGA 3CDGB 4GG6A 1DL7L 1GGBL 1N3NA 2IGFL 4K3HA 1KB5A 4LCYA 3NA9H 3PWPB 4YQXH 2DWDB 2NW2B 4ZUWA 3UZVB 4PJXB 5KVEL 3DUHA 1FV1B 4FXKB 1ZS8B 2OR9L 3RIAF 3JWDC 1FZJB 3QWRA 5SWZE 5FYKL 5IBLC 2E7CA 1U3JA 2ERJC 3BPLC 5IESH 5D96B 4IHOA 3BRDA 1E28A 4JANB 3JWOL 5BW7C 3P4OB 2CLVA 3AREC 5FGCB 2VC2H 2XN9E 4LQFL 3W2DL 3HI6H 2C1PB 1A6UL 3GSUB 4GAJL 4RIRA 5ADOH 4PR5A 5CBEA 2C1OB 4RAUA 1RIUL 4JKPH 3MBXL 5C0AE 4KKBC 1BECA 2DI8A 3OSKA 3FFCD 1U8QA 4KK9C 4NRZB 1J0ZA 1K8IB 4GXUN 1I9EA 5SWSB 4MS8C 1CGSL 4Y89A 2X4TB 4JY4B 3KWWA 1C1EH 3MXWH 1UM6H 3UTQA 3TESA 3EW3B 3TO2A 1N7ML 3JWOC 4KKCC 3EAKA 1UZ6F 1T1ZA 5E1HB 3QG7L 4D9QE 2IQ9H 4GBXC 4YX2L 4OAWB 4JGUA 1U3HD 3B5HA 1RJCA 3FL7A 5I66A 2D03L 3TO4D 3BH9A 5L2KE 4M7ZC 4ONHB 4UTBL 1J0YA 4X7TB 4X98B 4HWZA 4NQVB 4NZTL 2HVKB 2HN7A 1BM3H 3MV8A 5E5RB 4DCQA 4CVWA 3STZA 2F5BL 4XMLL 1LE5A 4LHJB 3A6CL 1P7HL 1INDL 4XP4L 4EVNA 3BVNB 3FT3A 4LPYA 3OTTA 1KIRB 5IVOA 1G7MB 1YEHL 5CKAA 3ARDB 2DD8H 1M4KA 3HUJF 3QPXL 4G8IB 3X3FH 2EDLA 4Z7VF 1QFWI 3RTQC 2EH7L 5I0ZA 1YYMH 4KQ3H 3SDDD 1HINL 5ITBH 4X9GA 3K2UH 3C5SB 4YDKH 4HIJA 2NY2C 4HMCA 4HIEB 2E5EA 3RWEB 3PWNA 3EOAB 3S3JA 5E00A 5I71C 4PBXA 2PTTB 4JFDB 1JYWA 4MAYB 2CQVA 1NSNL 4MLSA 3QDJA 4PBWD 3C8DA 5CEXB 3QXDB 5LVEA 5F9OL 1QFPA 3B43A 1WT5C 1ODAA 3OXSA 4KROC 2Z0BA 3BYTA 5D7IE 4N68A 4ZUVB 1QACA 3IU3A 4Y4KD 1KJ3L 1J1PH 3SGDI 4WI8A 4Y4FA 5DGRA 5SWZB 2XWJB 2B5IC 4GQ9L 1VACA 3TFKD 5KTEH 5D1QA 2VISB 1MWAB 3VWKB 4ZAKB 4KFZC 3IFLL 4UBDC 4OGYH 5HD8C 4I3GA 1ZAGA 3KLAA 1QSEA 5CAYB 4WGVB 1GAFL 1I3UA 3V4VL 2XN9B 1YDPA 3QG6B 5J1AA 3MUZ1 3MZGB 3FT2A 1F2XK 1Q9WB 2HJFA 2LTQB 3CH1B 4F58H 4LEXL 1IEBB 4P9ML 3NN8B 1UT9A 3RWHA 1AXSB 3ILPA 5FCSH 3VXSE 2QR0B 2V9RA 1P1ZA 4L4JA 4L3AA 1DVFD 1HZHL 2CMRL 4GKZB 4WI2A 4X7DC 3BHBB 2NY3C 4AL8H 3LDBB 2G75A 1DLFH 1EV2E 5E9DD 5HDQL 1I4FA 4FQHA 2FJHA 5D7LD 1T6VN 3BEVB 4MXQC 4X9BA 2YPLE 1C5BH 4FZEH 3UJJH 5C3LD 1C5DB 3KXFA 4TRPH 5EUKB 5I76A 3BYYA 1G7LA 5CP7B 4PRDB 5EBWA 1E27B 5F7MC 5IB5A 5K9KA 5L6YL 5FKAA 5JIPA 4WI9A 5EN2A 2Y06L 4LSVH 5E4EB 5BJTB 5L2KB 4ZFOB 3GSRA 5LG1A 4RMRA 3D18B 1U95B 4LLQA 4GAYB 3IDUA 1KB5L 5K9JH 1KNOA 4HMEA 4Y2DA 3C6SA 5KSBA 5TF1L 2MTPA 3HN3A 5B4MC 2CUHA 5BQ7B 1OWWA 3QI9A 5C09D 1D6VL 5ANMB 5I1KH 2XWTB 4HUUB 5IQ9B 4XAKE 2AV1B 3MOQA 1XGPB 1U42A 1CL7H 1OGAD 3OXRA 3UTTA 3VFVB 3BIKB 4WI6A 1D5MA 1HXYA 3ULUH 3MV7A 1X5YA 4U1MA 1MH5B 3M17A 5CSGA 5I8KL 5BO1L 4LGRB 4RAVA 4PJHE 4L9LA 3MLVL 2X4RA 3OAYK 1Z9SA 5C0BA 1IT9L 4NGHL 1XGYL 5KAQF 4GRMA 1FNAA 5JIIA 3RWGB 2LQRA 4B50A 2BNUB 4QRRD 3RWFB 1FLRL 2DTSA 1CD0A 2GSGA 3MREA 4KI5C 5GZOC 1DQDL 1PY4A 5D9SA 2WBKA 5D7IB 2YD4A 3ILQC 3B2UC 3R4DA 3EBAA 1NQBA 2VLME 5D70L 1QLFB 2WLZA 3ARBA 4DKEL 4RGMB 3DGGA 2FHCA 5FK9A 1CFVH 1TPXC 1ZHLB 4OUOA 2VQUA 2DLEA 5DSCB 5D6CA 5CCKL 3DJ9A 3HZYB 2BFVH 4XCCH 1KTLB 4UV4L 5ELIA 1AD9A 5F72S 4UNTA 4HX1A 1I75A 3U7WL 3V5HB 2XG5A 2DIJA 4OTXL 4NKIH 1VFMA 5DDHA 4AEHH 1BOYA 3KLHD 2R1WB 3VXSB 1SJEA 3L3JA 4P3WA 4OI8A 1MCIA 3MCLL 1CFNA 1ED3A 3GSWB 4PGDA 2R1YB 1WTLA 3ZKND 1MEXH 9CGTA 3WE6B 4BK4A 4TOYL 2XKSA 4WUUA 4HF5L 4KUZL 4WWKD 5E2VH 4PRBB 4RMQA 3VXMD 1AQKL 1JI1A 1MFEL 1OF2B 3N9GL 4NO0A 3VFRB 4ZS6D 1PKQE 3MTRA 1IARB 5KAQG 4MX7A 1QFWH 1I1RA 1OP5K 4KRPB 1NCUA 1NMCC 3TJHD 4FFVC 4HPYL 4O2CB 2DQIL 5C9JA 1FBIH 3SJVD 2HLAB 2A6IA 4M48H 3MRHA 1CD1B 5C0CD 1A7RH 1HHHB 2AJSL 3O3AB 4KK6C 3TT1L 3MUGA 2BNQD 4X6DA 5GS0L 3OF6A 4Q97A 3CU1A 4BQBA 3HZMA 4XH2A 2L7UA 2FHBA 5F88A 3PGDA 3WIHH 3ZYZA 3ULVF 3E3QC 1NFDF 4OFPA 1J12A 1JHKL 1UXSB 2X89A 5F7EH 2P43B 2HRPL 3TH2T 4UAOB 1U8IA 2CDFA 1Y6KR 1RZFH 2MOVA 4MJ5A 5TH2B 4FTVB 5ICZA 4UV7L 5EOTA 2Y5TA 1AP2A 2VIRB 5KVGH 4NNYA 5B38A 3QQ9D 3CSPA 4PJHB 1KTDA 4P0DA 3ZT5A 1S3KH 3SGDH 4LKXA 2AJZB 1YJDH 5GS0C 1DLHB 4DFHA 3PHQB 2B1HH 5I1LA 5T3XH 5EORH 1NC2B 4Y4FC 4IRSB 1FDLH 4WUKL 3WUWA 5CJQH 2VAAB 5D1QC 1I3VA 4CADA 4TUKL 1XIWD 1YN6B 3OJDB 4PJCA 4HZAA 4NQTA 5EO1A 3T2OA 3C5ZA 3WFCH 3BKCH 4KMLB 4LDOB 3WIIL 1CXFA 2AK4E 4M5ZH 5DJAB 4XRCB 3C9NA 2NPLX 3N06B 3IGAA 4EOWL 4XPBL 4JRYA 1ZTXH 1CG9A 2WLYA 2NQCA 4CVZB 1PEZA 4CN6A 2PYED 1JNHB 2DQEH 5T3ZH 32C2B 2WIIB 4S2SB 2NY4D 4B7LA 3FMGH 3K1DA 2SEBB 4LHUD 1KPUA 4P4RB 2BJML 1QSFE 1YMMA 4HS3A 2YD6A 5DHVH 3ZDYF 1E4XI 2BC4A 1FSKC 2DKUA 3QIBD 4PJDF 1OP9A 4P5KA 1Q9KA 2N1KA 4QYOB 1I7ZB 5TJWK 2ITDB 3U30C 2A1WH 2QHLA 2ZCHH 3DVIA 1HWGB 3DMMD 3TBTB 2Y9RT 1HEZB 1UVQB 3F6LA 3C60B 1FAIL 2CK2A 1RUKL 1GGIH 4FA8A 4OFYA 3EOTL 1BF8A 4J4PD 4H26A 4Y2DC 1PKQB 2F8OA 3ROLB 1U41A 3GMNA 2APWA 2J8UA 4ETYA 4F33B 2GHWB 4U6HB 3QI9C 4OCXL 4F37K 1TZGH 3L1OH 4Z95H 3SY0A 4R3SB 1Z5LA 1BZ7A 5GJTH 4LDLB 1KJ2A 1EDQA 4I0PB 3UJTH 5HVHB 2PN5A 4YHPB 5A16B 2ATPA 3IDIA 4XGZA 3VFUB 3CZFB 3ARUA 4YR6B 3VWJA 4QGTA 1FVEA 4X8JB 3O6FA 2X9XA 4AH2B 4UTAH 1NUDA 4QRQA 4L9LC 1P4IH 3IVKB 4N1HB 2WWKO 3VXUD 4C56A 3G08A 4MJ6B 4MD4B 3B3IB 1S9VA 5DEFB 4KAQL 4K3DL 3L3DA 3FO2A 4PRHA 5HHQB 1ZWIA 4ORGB 4K9EH 3QO0B 5FF6B 4LVNB 4JM2B 4JZNB 5ADPH 4FABL 2RIKA 4BM7A 3MROA 1J8HD 2PUQT 1I9JL 1I7UA 1TVHB 5DR5H 1T3FA 2VQ1B 3FJTA 3QQ4A 4WO4B 4YLQT 5F1NA 1B6DA 4QOKE 4WVRA 1A3QA 1TENA 2NY1C 1PZ5A 4QNPE 4MXVE 1ND0A 4GSDL 4WU7A 4O02L 1KXQE 4IOSD 1KV3A 4KVNL 1PY9A 4ETQA 3QT2A 5CKGA 5F3BA 2ZSWB 3F12B 2YSSA 2DQTH 3ME0A 1T6WA 2PO6A 1JHTA 1JPGB 2V7NA 1M7DA 2JCCB 4YUEL 5BZWA 1R24B 4J3UA 3I84A 5E2WL 5IVZA 2VXUH 5JXAH 5B3JF 4XPAL 4X99B 2FX7H 3MGOB 4U33A 2F5AL 5D7SL 2P4AB 2HT4D 1WCQA 4KMTH 4D8PA 4KHTH 1S9WA 1HYSD 1P7QA 4PG9A 1UG9A 5EB9A 3KYAA 1TZHB 5IEKB 3QHZL 1QSFB 2GI7A 1RURH 4RISL 3LD8B 3DRQA 3S5LA 4EDWH 4Q6YA 3NACH 3FO1A 3WBDA 3FN9A 1N4XH 4A2LA 4PB0L 2DLIA 3HAEH 1KPRA 4OLUH 1H15A 4G5ZL 2UWEF 1CBVH 1IEHA 5I75C 1U36A 3PABB 1ORSB 4XHJC 1PX4A 4MDIB 5DWUL 3GSNH 5FA3B 2AKRB 4UT6L 1ZT1B 5GSRB 4JFEA 3O6ML 4F9PA 1BFVH 5FB8B 1YECH 2F74A 2OZ4H 5ALBL 2OSLA 1CFTB 4TSCH 5BRZD 1A21A 4AEEA 1U8MB 3PJSA 1CVRA 5HDLA 3QB7C 4HS6B 3NCBB 4N90D 5C3TA 2XQYK 3ESVF 1QBLH 2G2RA 1P7KA 3Q6FA 3QDGB 3OR6A 3RJQB 5E6ZA 3QFJE 1X5HA 1FL5B 4R8WH 5JUEH 3RY4A 3LKQB 3OKOA 1KOAA 1E4WL 3U36B 1JPST 5KOMC 3Q6GL 2HTLD 2FBOJ 2GTWB 4RMVA 3ULUD 4PTUB 3MA9H 1HDMB 5A40E 3U83A 3SKOB 4KZDH 4LU5L 1HNGA 4JPWL 2X70A 5ID0B 5IB2B 4HUVA 5E6YA 3HCVB 4OSUH 3H7LA 3GMRA 1YEKL 1D6EB 5F7FA 1BWWA 2FATL 3V52L 2YWZA 4F57H 5C08E 3JXAA 4YHIB 2IMMA 1ES0A 4NN5C 4ZNEA 3WFDL 2H8PB 2E6PA 3MRBA 3C5ZC 4RWHA 4FXGA 4X6CF 3REVB 5IFHL 2BOBA 1IQDB 2GJ6B 4FN0A 5GZND 5F7UA 1HNFA 3MV9D 3SE4A 4QOKB 3LEVL 1PSKH 2WWMC 1MUJB 2Z93A 3C2AL 3QPQC 4QHLA 3ZTJG 1GGUA 3CFKA 4ZTPH 2D7MA 2YEZB 4ODWB 3BPCB 1WISA 2VLLA 3NVQA 1R3JB 2DYPA 3BAEL 4C59B 1DBMH 3CSYB 4XNMA 1AO7A 3QEQE 4LIQH 2BRRL 4OLWL 4KPHH 2Q6WA 4LSTH 1JFQH 3V6ZA 4P46B 4U7SA 1E4XH 2VZVA 3QDME 4BH8B 1HOCA 4ZQKB 3D85A 1MFCL 3T77B 3MFFA 2H32A 5B39G 1NGZA 4JQIL 1NLBL 3QDHA 2AQ1A 4G43B 1DSFH 2VDMH 3MJGX 3TCLB 3WLBA 3U9PH 1C8PA 1Q0XL 1KJ2L 4Z0XA 5EWIH 2X2YA 3KYKH 2XWBA 3PF2A 2BERA 2DM4A 3X3GH 1I9RH 2ADIB 2XTJE 4QXTA 3K81A 1CDJA 3EUUA 3NFSH 1MCBA 2VLRD 1WFTA 2CJUH 2XACC 3EO1A 2IADB 1AGBB 3MRMB 2FR4A 2XYCA 1L7IH 5EU4B 2C3VB 2V2WB 3O2DA 3QJFA 5EBMA 1G7QA 2D7TL 2NW3A 4PFEA 2IPUG 3NABL 3P0YL 2GIYA 4MMZC 2NMSA 2VR9A 5TE7L 1R3IL 4BJLA 4J3XA 1T0PB 3VWJC 4L8CA 4HS8L 3FB5A 4P23A 1A14H 4NC1C 3LPWA 3O6FC 4U1LB 1BZ9B 3QFDB 3OKNA 1ZT4A 1FJ1B 1T7XA 5EUOE 2R0ZL 3QFJB 4JGMA 1ACYL 5KSVA 5TF0A 4PREB 1T20A 1S7RB 2VZUA 4IDJL 4O5LH 4OZIB 2R39A 2BNRE 3D9AH 5F1OB 5EZOL 4PJ8D 4HGWA 1QYGL 5EU6E 1S5IH 1OT1A 1HHKA 3H9HA 2E6QA 3EYSH 2IH1A 1B88A 4K23H 4TQEL 1SY6A 1I1YA 1XGQB 1KCUL 1FNHA 4V1DA 1NMAH 1KXVC 3KDMA 1MSPA 1U8JA 1A7NH 5IBTL 2VXTL 1YEJH 5GGSB 3ABZA 2JB6A 3V2AR 1VB9A 5C08B 1SYSB 2YRPA 1YY9D 1LNUA 2FEDC 4NM4H 2IG2H 3VJ6A 1IGTA 1YEEL 4DGYL 1NEZB 1S5HA 5EIVA 3ZTNL 1P2CA 3BEWA 2ICWA 5FECA 3FOMA 4LVOC 4QO1A 1D5BB 2XICA 3H3BC 2PO6C 5C0GA 3LRSA 4ZDHA 3D0VB 5BVPL 4Y5XB 1P4LB 2VDRH 1QNZL 4HH8A 4TTDD 4J3WA 1MLCB 3VXNB 3IRPX 3SDCB 4RA0C 5FV2A 5FYJE 1NUNB 1J88A 5HHOE 1N2RA 3FTGB 3QEQB 1ZEAL 1NGPH 2H3NA 3DO7A 5F9WC 2DRUA 2OP4L 3QDMB 4M8VA 1N8ZB 4CGTA 1CDGA 3GSXA 1I8MA 3PGFH 2XZQH 3PWUB 3EHBC 3P4MB 4YDJB 4CDGC 4P5MA 2GUOA 5KVFH 3T4AB 4YK4B 1TFHA 5FYKE 2B2XH 3GEWB 5FUZL 3GHEH 5C07A 3K2MC 1FPTL 2Z35B 1L6XA 4PY7A 1KG0A 1VKXA 3WKML 4RMTA 3DI3B 3D3VD 4YXKL 3BKYL 2XTJB 3U0PA 5JW4M 4NCC2 3EJYC 3SO3B 4F9PC 4PUBL 2OI9B 1YPZA 3CK0L 3DHMA 4HFUL 4HV8A 4OM0L 3DV4A 5GGUA 2ARJA 2QQLL 5AYUL 3QUKB 1ZGLP 4UINH 1IBGH 1OQOA 4M5YH 1GZQA 2O5YH 4WFED 4D0CA 5DXWA 2FL5B 4YZFE 4W70A 3G5XB 3IJHB 3K1KC 4IMLA 1J05A 4YHLH 4HULB 4KZEH 1VA9A 3G9AB 2KUTA 4N5EC 3DUSA 4J1UA 5IMOB 5GS2H 3Q5TA 5EUOB 1TQBB 4BFEA 3EGSA 3E6HB 5F1SA 4QEGA 1FL6A 3FQUA 4X6BB 2VOTA 4QRUB 2BNRB 1ETZA 3DX6A 3GJFH 3SDAA 2DMKA 2PYFB 5LGKA 4QKXB 5EU6B 5J4MA 3LKNA 1MJJB 4LLYB 3P30L 3S6CA 3DYOA 1XCTB 4S10A 3RQ3A 1VFAA 4QCIB 1A1MA 3O3BB 3E8UH 2HLFD 4OT1H 1EJOH 3R06A 2ZCLL 4Q2ZB 2AXGB 3P2TA 4TNWK 4WU5B 3SE4C 3PNWB 4P2OD 1A9BB 4M1DL 1A4JB 5D5MF 3VMNA 3VXTB 1LVEA 3BGFC 4PJEA 5T1DL 2AVGA 3BGMB 4NPYA 5HDBE 3OB0K 1OY3B 3SGEI 1OARH 5ESAB 4HKJB 4F2MB 4J8RA 3LN9A 3WHXA 4DN3H 4X5WA 4F7EB 1NCTA 2PR4L 1QVOA 2ERJB 1ZANH 3GMOB 3N1FC 4Z8FH 4EXPX 1I8LA 2EE6A 4U1KA 1KN4H 4I2XA 3O2DL 2YPVH 5H35A 5GGRA 3BI9X 5HHOB 2A6JB 4OKDA 1WAAE 4N9GA 3UX9B 5I6XC 3CH8A 5HHPA 4MVBC 1IGIH 1MCCA 4EI5A 4HHAB 3I02A 1Q8MA 3F7RA 1KYOK 2BMKA 4MD0B 1OPGL 5I73C 3UYRH 3DYPA 1CXLA 1SBSH 5TPWH 4JJ5A 1KGCD 2WUCL 4YAQA 3U9UA 3X13A 3L3HA 1PFCA 5E2UH 2G5RA 3MV01 3P77A 1EAJA 4EN3D 1L0YA 3S9DB 2F54B 3H9SE 4UOW1 5EPMB 4ODXA 1T66C 1WF5A 1CD9B 2CDGB 1D5IL 2D0GA 1RHHA 1SY6L 1TETH 1KLUB 2B4CH 2FO4A 4RDQF 2XRAH 5DHYA 1WC7A 4N0CC 4M7ZB 1GGCH 4PS4H 2QQNL 4LSUL 4K7PY 4POZD 5K93A 4Z7OE 4P23C 1LE9B 4S11A 1CN4A 5E4IA 5L88H 1FC2D 2DDQH 2NX5B 4PB9L 4LFHG 2MQ3A 1FZMB 4HJJH 4BZ2L 1KIQB 2LU4A 1FCCA 5F96L 3U7AA 4UDUA 4JDTH 1NMBH 1GJIA 2R4SH 3F7VA 3E2HC 2YWYA 2WINA 1MPAH 2XA3A 2Y72A 4NC2B 4NOBA 1P69B 1IM9A 4FQXB 3RTQB 1AE6L 3ECBA 5CSZB 5FM4A 2NZIA 2Q7YB 2PNDA 2VB5A 3M1BA 3HUJA 3MJ8B 5MEND 3OKKB 1MJUL 5SX4I 3U1SH 4Z7VA 5D4QA 5MEQA 5IT2L 4GG6E 1K8DB 1UB6B 2NY2B 2C3XA 3WIFB 4NNPL 5FOJA 1U3ZA 5I71B 2F8VA 2HFEB 4MA1C 4LCIL 4DKAA 2V7HB 3OKDA 2UY6A 3BP4A 3P11L 2GTZA 4TUJB 2HRLA 3MRCA 1PLGH 2ICES 3PDDA 4O51B 2I07A 3O0RH 5E6ID 1X4ZA 5D8JH 1CDYA 4KROB 4YPJA 5EU3A 3IS1X 4R90H 4XZUA 3HZVA 1K2DB 4NWTH 3G6DH 1V5JA 3PXHA 2K9UA 3D25B 1EMTH 5TQ0H 4HJGA 3BH8A 1U91A 4OD3L 5I1HL 3EDKA 4RDQG 1Y18A 2UVFA 1JN6A 4OLXH 5B8CA 2X40A 1ZHKB 5L0QC 5EZJB 2O93L 4KRMB 1P9MA 4OIBA 3BZEB 2VN4A 1M7IA 3MRLA 4JDVA 4NBXB 4PJ5D 5E7FA 1AHWA 4XC1H 5C71A 2XFXB 1U0QA 4UT9H 6FABL 4M7KL 1V3JA 3C5JB 5DUBA 3OWEA 1LO2L 3K8KA 3QXTA 5HJ3B 1NBVH 2Z8SA 4X4MA 4ODUA 4PV9B 2E7LA 1JHLH 5MERB 3O2WL 1DQQB 2NY3B 2GY7B 5KSUB 1RJZB 2PW2B 3FQNA 1D7FA 1CICD 15C8L 5AUMB 4J6RH 4U1HB 2EE2A 2W92A 1T1YB 2NXYC 3RI5F 4NHCL 4U3XA 3I6KA 1OL0A 5E99L 3H9SB 3GRWA 4YHKH 4L3CA 4ZS7L 2NY7H 4XX1G 5HGAB 3QUYB 2X4OA 4FQ1H 4Y2OA 4UZGA 5CZKA 5IW1A 4S0SD 1XZ0B 1T03H 1N5YH 3R1GH 2V5SA 4L4VA 3TZVA 5LGJB 1LEIA 5J12B 2BVQB 3K0WA 3O3DA 5AYQA 3BP5A 2LVEA 1JUFA 3HMXA 3U46B 5F9JB 4JB9L 1LMKA 1GHFL 3SDAC 5DMGC 5I18L 3E3QE 3VG0L 2YA0A 4HLJA 1KELH 1Y0LB 3RA7L 5C9KA 2YRLA 1BQLH 2P46B 3IDGB 3HRZB 5SV3A 5I1EL 4E5XA 1E6JL 4XMKH 5C0EA 1B4JL 4MCYA 3QDJE 1MIEL 3AGVA 4RBPH 1O5DT 5C0RL 2CKBH 4GG6B 1N3NB 4JCLA 4MLIA 5KSAD 3SGEH 4QHUA 2HFGH 3DTXA 4DGVH 1OWRM 2N56A 4QNPF 4ZUWB 3LKSA 3I6LD 5KOVC 1NCDH 4ZUSA 2X4QA 4WI4A 5FHAL 1MCFA 4K7FA 4ACPA 4DN4L 2W9DH 4XCFH 4NQDA 2Y6SD 4OM1H 4LEOA 1PBYA 1I8LC 2AJYL 4IHOB 1E28B 3QCUL 3K8LA 5DJDA 3VU2A 2A74A 1QSEE 5ICYA 2CLVB 1P6FA 3IAQA 5C0DA 2IAMA 5DMYA 3PQYA 3OKLA 1S7WA 4ODTL 1BQSA 3DRTA 4RIRB 3GBLA 2APBA 5CBEB 4RAUB 1TPXB 4UQ2A 2RR3A 1T80A 4PLJC 3V0WH 1UCBL 1HH9B 4EI5C 4MJIE 5MEPA 3DVFA 1U8QB 5CGMA 3OAUL 4RA3A 1OSPL 4O2EA 5DS8A 5KN5A 2HH0L 5HVWA 3DI2B 3QIWD 1IEAA 2NY6B 4E41E 4D9RE 4WHYH 4R96A 4D94A 1WZLA 3KWWB 5ALCH 3SKJH 2N7BA 5B22A 3ARYA 1UH4A 4AEFA 4C57C 1VSCA 3D39A 3UTQB 4OIIL 3SCMD 3W39A 2YXMA 3MJ9H 3EOBA 3QYCA 4D0BA 3KLSA 1T1ZB 4MNGA 1EHAA 3GB7A 1OB1A 3WS6A 1FGNH 4D2NA 3J7HA 2KQMA 3C6LD 1EJ6A 3PWPD 3RWCA 4XPTL 4PGZA 3EYOA 3BH9B 2DQGH 1FIGL 4EUPH 5I2IB 4AG4L 4HWZB 1LO4H 2MPAH 4FQJH 4RFOH 2HN7B 2DM2A 3IU4L 2AJXH 4YXLL 4DCQB 3STZB 1EBPA 1LE5B 4DQOL 5KSBE 3FT3B 2VDOH 3GDBA 1IGYA 2YA1A 1JZ5A 5TDPA 1NMCB 1NGYA 4C83A 5HGBA 1D9KB 2V9QA 5CEZL 3N85L 3GIVA 1JVKA 3DSFH 2PTVA 1XEDA 1I1CA 4ODSL 5FO7B 1BF2A 5SX4H 5IHUH 1TJHL 4XT1C 4R2GB 1J0JA 3FHQA 3QWOA 1JP5A 1CFQA 3GSVB 4JO1H 3PWNB 4FFWD 5E00B 1YUHA 2Z9TA 1BFOA 1BVZA 2BVEA 5AWNL 4W6YB 5GRJH 5C0BE 4AIZA 2HMID 3R8BB 4EBQH 2VNCA 4N0RA 2QL1A 3QDJB 3OBAA 3HNVH 1NFDA 2Q1EA 3C87A 4WJ5A 4KJQC 3KPRE 3DXAD 3OXSB 3QXAA 3IU3B 3DETC 4PY8J 1ADQA 4Y4FB 1CLZL 4RZCA 2VO5A 1JRHL 1VACB 5CJBA 5D1QB 3DVNA 5I8CA 1YEGH 1L7TH 3VGDA 4MQSB 4DKDC 2RCSL 5B8CC 5BZDA 2ITCA 3T2NH 3KLAB 1QSEB 1P9MC 2CSPA 4OCWH 3GMQA 4X7CC 1B2WL 3GRWL 5J1AB 1AHWC 5FCUH 3BIAX 3FT2B 3LOWA 4LLUA 3TWCL 1OAUH 1U8KA 5DK2A 2HJFB 3BJ91 5J8OA 3GBMH 3PG2A 7FABH 2DBLL 2IANA 2NYYD 3RWHB 3ILPB 4TVPL 1R0AL 2COQA 2R2BA 1P1ZB 2VERN 4IMKC 4ZPTA 4G8GE 2JB5L 4G3YH 3CFBA 3CVHA 2E7LC 2D4FA 4E41B 4JPVH 1RQ5A 3R0MA 4PLKC 3HAEG 3KLDA 3LQAH 4WUUE 1RZ8A 4JFDD 3MBEA 3S34H 2YD8A 1I4FB 2FJHB 3HMXL 3BD4A 5DQJA 4Y4HB 1BQHA 2VITA 2VXSL 4H0HB 5I76B 5DRXA 5EU5A 1G7LB 5EBWB 4FFZH 2GEEA 5FKAB 1NAMA 5F9DC 1RZKL 5EN2B 4BSWA 1C08A 3VW3L 1YNTA 3GSRB 3TVMA 4PJDA 5SWZD 3TZVC 2XNAA 1HH6B 2R1XA 4H8WL 3S4SG 1WZ1H 4HJ0D 4LLQB 3VWKD 4ZAKD 2OTUA 1DR9A 4APQA 3RIAK 4ZD3H 4Y2DB 3C6SB 4TSBH 5KSBB 3D2UB 3QI9B 2XN9D 2EO1A 3PP3K 5GGQH 1S78C 1OSZA 1CGYA 1OAXL 5HYSA 3DROA 3EJZD 5DMKA 4JO2L 1RZKC 3OXRB 5D93C 5AD0A 3VRLE 3NPSC 1CU4H 4FXLA 3H2WA 1D5MB 1HXYB 3RZCA 2OL3B 4U1MB 1NFIB 3PL6D 5JA9A 3M17B 4H8WC 2E7BA 3KYOA 3BWAA 2VXVL 4KV5F 1HSAA 1KENL 1FORH 4RAVB 3VH8A 4L9LB 1YYLH 2X4RB 1ZSDA 1K85A 4GG8A 1QOKA 3GO1H 1BFTA 5C0BB 3KPNB 4GRMB 4O00A 1HN1A 4AEIL 1CR9L 1MREL 2EXYD 1A9EA 4ZFFA 4MB4A 5F9AC 5DVMA 3LIZH 4H88L 2VSCA 3CC5B 4M61A 3KPRB 2GSGB 5C0FA 4Y0GA 4PJCE 3TBYA 5EOCL 4H20H 3O41A 5L2KD 1FYTE 2VDLL 1GC1H 4N1CA 5EA0H 4R7DA 4N0YL 4YHZH 5GGVH 1LGVA 2IAMC 1FZJA 4ODHL 4RWYL 3ARBB 3KJ6L 3BDXA 1JIBA 2BHZA 2XZAH 5FK9B 2HFFB 3TPKA 4F9LA 1UWEH 3MRKA 3VXRA 5D6CB 1AGFB 1G0YR 2GCYA 5I17A 1AD9B 4X6EA 3ARFB 1VFUA 5HHXH 1HIMH 1DQML 4HX1B 4JHAH 3FO0L 2L4OA 1NKOA 3QR2A 5DDHB 3SDYH 3NTCL 2PW1A 4L8BA 1YMME 1SJEB 3EYUL 3L3JB 1JZ7A 2GT9A 3NFPA 1CFNB 2BSSA 1ED3B 5CIPH 2B0SH 5J6HA 3WS6C 1ZHNA 3TYFB 3JZ7A 4JY4A 4WUUB 3TF7C 1F3DJ 4W4OC 3VE0B 1ORQA 1BJMA 4NKMA 2EKSB 1WEJL 3GMLA 4AM0A 2J7LA 1NPUA 1UM5L 2X9WA 2V17L 3UTSA 3T0DA 4HXBL 4R26H 2HKFH 35C8L 4NO0B 1UA6L 4NP4H 1X5FA 2I5YL 5DD3L 3TEUA 3A6BH 2K1MA 4OAWA 4NOFA 1FH5L 5I75B 2DL9A 4MX7B 4XNZC 4HCRA 4M6NH 1IGCH 5EU7C 2J8UE 2WSKA 3ULVL 5F93C 3JV5A 4X7TA 5F3HB 1NGQL 5C9JB 3FFDA 5EZIL 1F6FB 4JN2B 2UWEA 3MRHB 5CZXD 2CR6A 5FKPA 4GKNA 3MUGB 4X6DB 1JL8A 3RVWC 4LCCB 3BVNA 4JKLA 2MKLC 3HZMB 4XH2B 3VDCA 3LH2L 4G7VL 5F88B 1ADQL 3ARDA 1IKFL 3PGDB 4NC1E 4YEEA 2F53A 3O6LH 4G8IA 3MLXL 2OXHA 4L8SA 1U8IB 4C56E 2CDFB 3VXSD 4MJ5B 2XA8H 1MNUL 5ICZB 3ULVC 4PRHE 5EOTB 2Y5TB 1AP2B 4WTWA 1YQ2A 4NNYB 5B38B 1OLZA 4BQ6A 1OVZA 2J8HA 3H42H 5DD6A 2A83A 4NJ9H 1KTDB 3S97C 4LKXB 4U6TA 1S9YA 2M8XA 3MOAH 4MAYA 5D71H 1EXUA 1RZJH 2OBGA 3QRGH 2GK2A 5I1LB 3CVHL 5HDBF 5CEYA 3WUWB 3LS4L 4W68A 4CADB 4JHBA 1UM4H 3MNZB 4PG2A 4PJCB 3T1WA 5EO1B 5H94A 3ZE2F 1FYTB 3C5ZB 2WM0A 1UENA 1FAKT 3CXHJ 4KRPD 1J0HA 4BKLA 3REWA 4DGIL 3B5GA 3C9NB 1G7PB 3IGAB 1NAML 4XMPL 2VISA 4KJWD 3BKJH 1CG9B 3D6GA 4X6CA 2ED7A 1T7WA 1KJMB 1SEQH 1JYXA 2MQ0A 5GJSH 5HY9A 3HE6D 4OV5A 3K4ZA 3JV0A 2EDWA 4ZFGL 2B1AH 1NBZB 3MBEC 2E8YA 3LKOA 1KPUB 2FYYA 1IEBA 1AR2A 1Y6NR 5C0AA 2AXHA 4Z0BL 1YMMB 4FTVD 4HS3B 4MA3A 2X6MA 3TC9A 2BC4B 1H3PH 2AJVH 3RVVD 4P5KB 2VDKL 5ETUA 3RIFF 1U93A 4ALAL 3HNSH 3O2VH 4LSPH 3WSQH 1C12A 2RGSA 4QTHA 3TVMC 1XIWA 3T0WA 1NC2D 4IRSD 1VHPA 1X5JA 2ZUTA 3GGWA 2DIAA 3C09C 3MRQB 5DC0A 5CP7A 4JFEE 2XPGA 4PJIF 4APQC 4HW6A 4YE4H 4H26B 5IB1A 4C4KO 4JPKH 1U6AH 5HHVH 4M43H 5JHDA 2R0LL 4LVHB 4ZFOA 2J8UB 4UIKH 4GXVH 5GRUL 2VLMD 3L3GA 1F42A 2H2PC 2X10A 3AFLA 4PRPD 3ZHDA 1A1NA 3QSKB 1RULH 1U95A 3SY0B 4JKWA 1Z5LB 1BZ7B 5IW6A 4K8RH 1KJ2B 4BH7A 4KTEH 1KSRA 1UACH 1EAPA 2ATPB 3IDIB 4XGZB 3VWJB 3RZCC 3WO3B 4WENB 4Y19D 5BV7L 1FVEB 5BQ7A 5JTWA 3EFDL 5I1GH 3O6FB 4OCYH 4MDJB 3EYQD 1KUMA 2EE9A 4QRQB 4MCZB 4S1DC 4JY5H 4Z6AT 2AV1A 3L5WA 1XGPA 4C56B 3NAAH 3G08B 1G7JA 4NQEA 1CTNA 3ARZA 1S9VB 3HMWH 3L3DB 1KC5L 3FO2B 4PRHB 1ZWIB 4DW2H 1S9KC 3W0WE 1MH5A 2X05A 1WBXA 1F8TH 2AEIT 4MQXC 4ODVL 3BKML 1H3GA 2A77L 4JO4H 4S1SH 5T33L 2X1QA 3BN9D 5HI4D 1RVFL 3C60D 1I7UB 5BV7C 3GNML 3V4PL 3CAFA 1T3FB 3QQ4B 1CI5A 5F1NB 1JNLL 1PZ5B 2Q8AH 3RWFA 3VMPA 1T1WB 1ND0B 4WU7B 2MCPH 5E8EA 4F37F 4H1LA 3L7EA 3RDTA 2ZUYA 2R9HC 4ETQB 4XP5L 1BOGB 4PRIA 2OXGA 4X7SH 4PIRF 4Z5RA 1LEGA 2YSSB 3ETBF 3D48R 3BDYL 4LVOB 1QLFA 2PO6B 1JHTB 1AO7E 4G6KL 2V7NB 1A6AA 4NFBA 1M7DB 2JF1A 5BZWB 3VFGL 2R56H 5CILL 1AC0A 5IVZB 4YFEA 1X5GA 4HCRL 3U82B 5J9PA 5CWSA 5T1KA 4D8PB 3V8OA 1S9WB 4IS6A 4HXAH 4PG9B 4OI7A 4WCYH 1OAKH 4L3ED 2IALA 5F9WB 3LN5A 3DPBA 2R2EA 1F5WA 3SKNA 3F8UB 5LJYH 3DRQB 1KCSH 4EEEA 2P8LA 5J56B 3FQRA 4YDIH 1OM3L 3OPZL 2H45A 3F58L 2R1YA 5JW4R 5DTFA 4BQCA 1BWMA 1UJTA 1M7XA 5GXBB 4Q9QH 1HE7A 1KPRB 1YNKH 3VD4A 1H15B 4JM2D 1J8HA 4XVJL 3DVGA 4RRPG 3EDJA 3BQUA 1MFAL 4KK8C 2AJUL 4PV8A 1MCLA 2YPLA 2GSIA 1KPVB 1BFSA 3UDWC 2ESVE 1DBKL 4JFEB 4NYLA 1DQTA 2F74B 2OSLB 4Q0XL 2X4PA 4HG4K 3PJSB 4IOIA 2ICWJ 1MVUB 3ARDC 2G2RB 1P7KB 3Q6FB 3OR6B 4GRLB 4KQ4H 4YHOH 4NRXA 3KLHC 5DLMH 3NCEB 1IGFH 3Q3GB 4KDTA 1NJ9A 3OKOB 5DJ2A 5IFAL 2ADGA 4KY1L 4EQ2A 1DL7H 3MLUL 1FN4A 4I8DA 3HPJA 4ONFL 4JO3L 1M05B 4XCYA 4XBPA 4GRWH 2BSRA 5CHNA 3U6RA 5IUSA 4V1DE 2VXQH 3B9AA 2X70B 4MAYC 4HUVB 4HC1H 4OI9A 4XC3L 3GMRB 4DUVA 5DURB 4LLMA 5CBAA 4LLAA 1U8PB 4PG2C 3OAYH 1AXTL 2IPTH 1G9EA 4WEUD 2DTML 3ARXA 1VEOA 3MRBB 1QHPA 2BOBB 4OD1L 3WCYA 3DUUA 3SQBA 5JZ7C 2Q86B 5J1TC 2I60L 1RIUH 3FKUS 4GMSH 5JOFA 3X14B 2O26U 1FIEA 3DURA 1ZMYA 5F1IA 2EDKA 3BGFB 4YQXL 3NA9L 2Z93B 4QHLB 3LQZA 3LKPA 3CFKB 2DBJA 4OGAD 3STLA 3ZZ1A 5JMRA 3QDGD 2QADC 1OTTC 2NZ9D 2DYPB 4AJ0A 4LLVA 4OZGF 4G9DA 4GRWE 4XNMB 5D5MA 1GOFA 3UBXI 2W9LA 1AO7B 5IMLA 5IESL 4XBEH 2LTQC 5JIHA 1VGEL 3D85B 3MFFB 4ZFOL 2H32B 5LXGH 1NGZB 4NZUH 2VC2L 3QZWA 2NNAA 3HI6L 5IBUG 2C4FT 4IOFC 5I74C 3E0GA 5C07E 2VR5A 3WLBB 3CZJA 4NUJA 2X4UA 5ADOL 5I6XB 3C08H 4UTBH 4LSDA 4Z0XB 3RPIB 2SEBA 3LDBC 5GRYA 2Y23A 5HYEA 4B5EA 2XWBB 4AK1A 1XIWC 2BXZA 4QXTB 4ZUTA 5I73B 3CX5K 4G9FA 4XP4H 5DT1H 3MUJA 3EO1B 3MXWL 5FOBB 1UM6L 1YPZE 4PYGA 4DOHE 2FR4B 3TH3T 5TE6H 5E4EC 1SJHA 5JW4Q 2GJ6D 4M3KB 2VKXA 4QGYA 1FLTX 2EZ0C 3QJFB 4HWBA 5EBMB 4DKFH 1G7QB 2IQ9L 3HB3C 2ESVB 2LU3A 4XNQB 2NW3B 4NUGH 4JCMA 2YXFA 3RAJH 4U7MA 4PP2A 3L7FA 4RX4A 4XBGA 3FB5B 5HI5D 1Z9OA 3OKNB 1ZT4B 2IH3B 1BM3L 1MQKL 2APTA 1JZ3A 1NSNH 4P46D 5KSVB 1T20B 2WV3A 2QSVA 1DBBL 1XGTA 3CZFA 5F9OH 1S7TA 4R4BA 1LD9B 1UWGH 4HGWB 3X3FL 5HI3D 1T5WA 3H9HB 5DZLA 2IH1B 3KYMA 1I1YB 3KPTA 4V1DB 2JJTA 1YYML 4KQ3L 4GQ9H 4M4PA 3KDMB 3AROA 4FQLH 1U8JB 2NY5H 2VZ1A 1WBZA 4QRTA 5D72H 4Y16A 2HP4A 5ITBL 3IFLH 1JK8A 2JB6B 3K2UL 4YDKL 4LPWA 4XPFL 3LPGA 5H2BA 1SBBA 1K5NA 1RAMA 1GAFH 3VJ6B 4L4TD 2FWOA 1IGTB 1YN7A 3RDTC 4JZNA 4MA1B 1S5HB 5HVGB 2VE6A 1XF1A 1FFNA 1P2CB 3BEWB 2ICWB 4X80L 3FOMB 4LPTA 3CDFA 5C0GB 1I1AB 1KJVA 4PP1D 3LRSB 4ZDHB 2QQKH 2CMRH 2UZYB 1MLBA 2HTKD 5DQDH 5LWYH 5FO9A 5JXED 1I8IB 1N5AA 1J1PL 3OJMB 3IXTA 4I2XE 2ZSWA 2MWCA 3WIHA 2AK4A 4WHYG 3F12A 5KTEL 1TZIA 4M1CD 2AV7A 3MRRA 2H3NB 1XR9A 3DO7B 1JGDA 1R24A 4IJ3C 2FBJL 4X9IA 4YBQD 3GSXB 1BX2B 1I8MB 1MFDH 3S3SA 1TNNA 4P5MB 2GUOB 4JRWA 2Y06H 1I85A 2LAAA 4OQTH 1TZHA 5TE4H 5C07B 4F58L 1KG0B 3I6GA 4NDMA 3RY5A 3BQUC 1QSFA 5I8OH 5DF0A 4NKQB 4EUPG 3U0PB 1KB5H 2KBGA 5C08D 5AG9A 2WWKT 3IJYA 4YIQA 5CSBA 3KPPA 5JW5A 1EHLH 1CGWA 1DLFL 2AXFA 1YPZB 1VADB 4DOHB 5DA0B 3WLWD 4HV8B 2JJSA 4HPOH 5D1XA 3DV4B 1UZ6E 1C5BL 4FZEL 3UJJL 2ARJB 4TRPL 1CZ8H 3GFUA 1W72H 2IPUK 1GZQB 3F62A 5GSRA 4X5LA 2C9AA 5DJ6A 3WNKA 2G9HA 4KDTC 2A6DA 3ZHLA 1CFTA 1Q94A 5BO1H 5I8KH 5JPNA 3UO1H 4IMLB 1J05B 5HGHA 2R0KH 3VRLF 4K8RD 3FOLA 4KKLC 3SDCD 5HBBA 1NAKL 3HR6A 3DUSB 4RFEA 1ZHBA 4P5TB 4H0IA 4OZFH 3QEQD 2WMPA 1HXMA 5K9JL 3MNVB 5D7JA 2FSEA 1WTGT 1FL6B 3FQUB 3LKQA 3ZMRA 3W11C 2A9ML 3UYPA 5DHVA 3FB7A 3HUJE 1ETZB 3DX6B 5FGRA 3SDAB 1DEDA 1IFHH 1WWWX 5I1KL 3LKNB 5FGSA 3CUPA 2VMFA 1CXKA 3D3VA 1VFAB 2DF3A 4YH6A 3G5ZA 1A1MB 2BZDA 3SKOA 3MR9A 4XB7A 5ID0A 1MFBH 2XTJD 5A2IH 3O4OC 1WITA 2ID5A 1D6EA 4XVSH 2ENSA 2Q87A 4N8PA 2C4FU 1MQ8A 1LK2A 4NPYB 4BQ9A 2FEEI 1B6UA 1BJ1J 3WHXB 2V5TA 4LP4A 4NBYB 4X5WB 4LGSB 3SE9H 1QVOB 4LLWB 1IC1A 2A0LC 3HG1D 4U1KB 4M7JH 5J1SC 5I19H 1P84K 3HKFA 1ZLWH 4I2XB 4U1GC 1RJYA 1KFAH 1A3LH 4HWBL 4LSRL 5H35B 3T0ED 5GGRB 1MFEH 2YN3A 3CSYA 1CFVL 1AR1D 3QCVL 4N9GB 3MMEA 1Q72H 3HFMH 5HHPB 3N9GH 4EI5B 4KC3B 5CFHA 4X4ME 1H5BA 4XCCL 1SMAA 2BMKB 5DMIL 4OJFL 3SE8H 4NQCA 5EU6D 1QEWA 1VENA 4MYWB 1TITA 4YAQB 3U9UB 3X13B 4WGWB 4AEHL 1W0WA 1MCSA 1V05A 5EULV 3P77B 2DN7A 1HWHB 4XHQA 4R97C 3I75B 3QNZA 4GAGH 2GQHA 3GM8A 4ODXB 1MCWM 1MEXL 4PJBF 3D0LA 1EGJH 1N0XH 1RHHB 2J88H 3ZT7A 5C86A 2FO4B 2FIRT 5E2VL 5DHYB 1WC7B 5LBSH 4TVPE 4L4VE 4YXHL 3IAPA 2ZG1A 3SGKC 5IBLD 3EYVA 1MJ8H 1G6RH 3UC0H 3RHWF 5DGQA 4ZYKA 3GI9H 2R0WH 4I0PC 2JE8A 2PCPA 4Q9CA 4Y8AA 5HGDB 3ARED 3CGTA 5GPRA 1QFWL 2YBRA 4UDUB 3KAAA 5FYJD 3F7VB 4HUMB 4JJHA 3V7AG 1FBIL 1FJ1A 2J5LC 4M48L 1JGLH 1IM9B 4HUXA 1M6OA 4ZSOE 4KKBD 1MCNA 1DANT 1QSZA 2JJTC 3ECBB 3T2QA 4PREA 3W5NA 4KK9D 1BAFH 1IC4H 5CLTA 4F3FA 4XP1L 3M1BB 3HUJB 1INEH 4Y16C 3WIHL 4MS8D 4N8VG 5FYKD 2HJKA 5MEQB 3GK8H 5F7EL 1V7NH 3HAEA 3WIIH 1Z9LA 4EN3A 5EIIA 4KKCD 2BY1A 5IKCB 4EOWH 1ZKAA 3BP4B 4YDVA 2F54D 4R0LA 2GTZB 1F45A 1MCKA 4FZ8H 5KVGL 3MRCB 1DQLH 4GBXD 3IXAA 3GSNA 4WO4C 2I07B 4NQDE 2O5ZL 1SYSA 4XB8A 2J3SA 1T7ZA 1S3KL 5EU3B 2OZ4A 1BD2A 4XZUB 4JFQA 2DIBA 4DK3A 5ISZD 2B1HL 4ZPVB 5T3XL 3O45A 1FDLL 5I9QB 2BJMH 4HJGB 3BH8B 1GPOH 1U91B 5CJQL 1JE6A 1Y18B 1AJ7H 2NX5D 4PLNC 3R8QA 4BFBD 4OZ4A 1JN6B 3V4UH 1IC5H 2VL5A 5B8CB 5I1JL 4JPIA 4U6YA 1EBAA 4LGPB 4NC0B 1U9KA 2EO9A 1E6OH 1M7IB 3MRLB 4M5ZL 4ZO9A 4JDVB 1EVTC 3QISA 1DDHA 3ALXA 3K4AA 2HFTA 1AY1L 2W0FA 3WJJA 4JM4L 4KTYA 3RTQD 2ZG3A 4ONGH 1ZTXL 3S96A 3D39E 5MENA 5DUBB 5T5FL 2CGRL 3LD8C 4ELMF 3KHOA 4ODUB 5CD5C 2P8PA 3NZHH 2DQEL 5T3ZL 4NM8H 4LOUC 1OGTA 1IVLA 2NY2D 3FMGL 1DJSA 5E8NA 3FQNB 4M4RA 3FAXA 2WNGA 2JJSC 4XNUH 1DBAH 3ARTA 3I6KB 5D1XC 5IG7A 5IMMA 2EDFA 4L3CB 4U0RC 1Y6MR 1CIDA 3BXNB 1LDSA 4AT6A 1CT8A 2ZNWA 2A1WL 5I1CH 3FZUC 4ZXBA 2ZCHL 5DJ8A 2VL4A 5IW1B 5EU7E 4KI1A 1NCWH 4L4VB 3AU1A 3FB6A 1LEIB 3O3DB 3NBNA 1A47A 3BP5B 5T5NF 4W6WB 4KAQH 4UBDD 5IHBA 5D7JC 1UWXH 2ED8A 5HD8D 1EFQA 2FL5A 1ACZA 1JUFB 2FLBT 3G5XA 3RU8H 5I15H 2O61A 3L1OL 4Z95L 5GJTL 4JGJA 4XP6H 3UJTL 1I9JH 5CJOL 5D93B 4ZSOB 1C16A 4E5XB 5B3NA 3BX7C 1A6WH 5C0EB 3MLSH 4G8FA 4HUWA 4MCYB 5IM7A 1GGTA 3ULVE 3HC0A 3BZFA 3MPCA 1IQWL 3MZTA 4L29A 2NY3D 2QJDA 3RVTC 4EI6B 1FVDA 4UTAL 3QIUB 4NNXA 4LCUA 3F7YA 1ZLUH 2Q3ZA 4MB5A 1BMGA 2D2OA 2HYMA 1P4IL 1XCTA 4BYHA 2CLRA 4MMXC 2EIEA 2LE9A 3O3BA 3LKSB 4MXQD 2E9JA 4JFYB 1J5OH 4ZUSB 2X4QB 3MLRH 4GQPH 3H9SD 4YUEH 4K7FB 4K9EL 2FHFA 4NQDB 1RUPL 4LEOB 4P57A 5F7YC 4DUWA 4PRAA 3S35H 1N64H 5DJDB 5ICYB 2W65B 5ESAA 5C0DB 2IAMB 3Q48A 4ZMAT 5DR5L 2OMNA 1S7WB 3WNOA 3IDMA 3DRTB 3ZT6A 4BUGA 4UQ2B 5BOPA 2IQAB 3CCHA 4HAGA 5B4MD 5MEPB 1T04A 5DMJB 1II4E 4O2EB 1H5BC 5DS8B 5KN5B 4G5ZH 1IEAB 4MNQA 2DQTL 3HI5H 1HHGA 4K9EC 4R96B 5J11B 5DO2D 5I1AA 1EUTA 1UQSA 5HYJA 5HHOA 2A6JA 2JELL 1UXWA 2IMNA 3D39B 1XT5A 2ORBH 4HBCH 1CVSC 3W39B 2VXUL 4XVUC 5JXAL 3EOBB 1QQDB 2FX7L 4HHAA 3O6MH 4D0BB 4KHTL 4IDLA 3P4NB 5ALBH 3GB7B 1OB1B 1A0QL 1NEZG 5L2JB 1J86A 3AS0A 3UPAA 2IFFH 5DRWA 4Q6IA 4QHNA 1R3HB 1RURL 3EYOB 3ZDYE 4EDWL 3GSQA 3NACL 3QWRD 1DANU 1N4XL 5AEAA 3PWVA 1HILA 4WFFE 4JHZA 2WZPD 1TJGH 4OLUL 4KI5D 5GZOD 1CBVL 1JZ2A 3OX8A 2ZUVA 1OP3H 5D2LE 3ILQD 4MA7L 3B2UD 1IGYB 1CQYA 1V3KA 1FE8H 2C26A 1LE9A 3GSNL 4NRYA 4C83B 4LU5H 2OJZH 2UUDK 5HGBB 2P8MB 4H25A 3UCRA 1BFVL 1BREA 1S8DA 2P24B 3GIVB 1YECL 1MCJA 5FYLH 3JVGA 2OX5A 4A6YH 4TSCL 1TNMA 3QA3A 4WFGD 4HKXA 3BUTA 1QBLL 1HHIA 2AEPH 3QWOB 1CFQB 4K3JL 7CGTA 2YMXH 3SBWC 1JV5A 2BY3A 4R8WL 5JUEL 1BFOB 1RIHH 4FQXA 3G04A 1MCPH 2PETA 3LEVH 4R0LC 5CINL 1NFDB 1QR1A 2KZWA 1U3HB 3WFEH 5HTSA 4WJ5B 2OJEA 3HNTH 3WFBH 2VH5H 4L9DA 3QUMH 4P4KD 4KZDL 3QXAB 4P48A 4I3SH 3UP1A 2DQDH 3K80A 3VRJB 4OSUL 3CPLA 4LMQI 2BRRH 5FUOH 5C0IA 4L1DA 3MV8D 4F57L 3P9WB 3MOBH 1EUUA 3RI5K 4G42A 3DVNB 5I8CB 4GRWF 5EH1A 5C09E 4JQIH 1NLBH 5BZDB 2YS4A 1JZ4A 4G7YH 3VXRE 4LVEA 2FB4H 1Z6JT 3GMQB 1FG2B 4FFVD 3LCYA 4LLUB 1KB9J 3WJJC 1U8KB 5DK2B 4HIHA 3BFOA 4KK6D 4I5BB 3ZTJH 2FZ3A 2P5ED 3CMGA 4ZTPL 1JPTH 4ZPTB 3CFBB 3GJFA 1H8SA 5FM5O 4YK4C 2OLDA 1I3GH 1RZ8B 4KPHL 4LSTL 1JFQL 2CIIA 4DWHA 1E4XL 3QDJD 4GJTB 4QRRE 5DQJB 4M7LH 2VITB 3U0TA 3P0YH 1DSFL 5DRXB 4FQQB 5EU5B 1LO5A 3BO8A 4P9HC 1NAMB 1PGRB 3RY6A 3U9PL 2PW2A 4F7MA 4Y4KB 4HS8H 43CAA 5EWIL 2WANA 1JTTA 1NLDL 1FNLA 1WLHA 2MHAA 4ZXBC 4BSWB 5GS0D 4IEFB 1MRDH 3X3GL 1C08B 1I9RL 3VA2C 1YNTB 4GS7C 2DWEA 1YC8A 4UIMA 2R0ZH 3TVMB 4Y4FD 2XNAB 2R1XB 1FHGA 3NFSL 4TPRL 5D1QD 2CJUL 1XCQA 2UWEE 1EO7A 3VFOA 5HGAA 5JHLH 5EZOH 3QUYA 5D2LB 1QSED 1L7IL 4PJAF 3Q0HA 2W9EL 5T1MA 4TQEH 5JOPE 3TIDA 1KCUH 1OSZB 2F53E 1H0DA 3IF1A 1R5VA 4PJIA 1S7QA 1TQBC 2VXTH 5FA4A 1Q9OB 3T3PF 5A43C 5AD0B 3IT8D 1QPPA 3D5OF 2LU7A 1A14L 4MJ4A 1MAKA 2X42A 4QT5A 4MNHA 3KYOB 1A7BA 1ULVA 3BWAB 2VZOA 5ERWA 3WHE1 3ZTNH 1HSAB 1Q9LA 3VH8B 4JR9H 4Q9RH 1ZSDB 1CIUA 4GG8B 2UZXB 3NFNA 4O5LL 3QHFL 3P0VL 3KXFD 5BVPH 1A9EB 1U8OA 4ZFFB 5CGYC 1S5IL 1QNZH 3EYSL 3KHQA 4M61B 1XGUA 3W9DA 4K23L 4TSAH 4LRIA 3TNNB 3TBYB 5C0FB 4JQXA 1A4KB 1Z3GH 1NMAL 3O41B 4Q58C 4RRPA 4R7DB 3SJVE 1FNFA 4ELKA 1ZEAH 5BV7B 1T5XA 3LHPH 2NXZC 1GRWA 2BNQE 3MRNA 1MRCH 4NM4L 2IG2L 4Y2DD 1RUAH 4X6CE 3MRKB 4LBEA 1CTOA 3VXRB 4M62H 3QI9D 2GCYB 2IPKA 5I17B 2CRYA 1T4KB 1X7QA 4X6EB 4CKVX 3WKMH 1H3UA 2XZCH 2YC1A 1A6VH 3UTTD 3O11A 3PL6A 2PW1B 2VDRL 1U8LA 4L8BB 3HRPA 1HH9A 2GT9B 3NFPB 3MV7D 2UZIH 3U4BH 2BSSB 2EIZB 3JV4A 1P84J 3CK0H 4KGLA 5J6HB 4HFUH 1ZHNB 2AEQH 4P2QA 4MXWL 1DUZB 4YHYB 4CMHC 1IC7H 1NGPL 1WK0A 2AK1L 1ORQB 4LPXA 4Q6IC 4NKMB 1JPFA 5C0BD 2B8OT 3GMLB 4AM0B 3UMTA 4XNXH 3UTSB 3PGFL 2F19L 2XZQL 3I3DA 2DLFH 3P73A 4TNVF 5KVFL 4LF3A 4UQ3A 2B2XL 1F90H 3BZ4B 4LK4A 3GHEL 4JQVA 4KKAC 4FHBD 1WWAX 3IDJA 4OF0A 1YEIL 3EO9H 5JHDE 1VGKA 4F15C 4NO5A 3BPNC 4QHKI 5I2IA 4F7PA 4LL9A 3GJEB 3FFDB 2NY1D 4ZOAA 2UWEB 2DB8A 3RL1A 5FKPB 3JVGC 4GKNB 5GGRY 4MQTB 1CGXA 3TH4T 4LNVA 3EDFA 2AJ3A 1AH1A 2F53B 4UINL 3OB8A 4Y5VA 4M5YL 4NKDA 1D9KA 2O5YL 1NBYA 1PG7W 2C7UA 4L8SB 1ZE3C 2XOTA 3WNMA 4FQXC 5DFVC 3O9WA 4NQEE 5FO7A 3GSOA 3ARRA 4M1DH 4KZEL 5T1DH 1T2QL 4KI5F 4UT7H 3GSVA 3QXVA 3BSZL 5DD6B 2A83B 3HZKB 4LSSH 1S9YB 1EXUB 3RNKA 1WQVT 3MJ6A 1MHCB 2XXCB 4NO0D 4DUXA 5CEYB 4XNYH 3QWQB 1EHXA 4CDHA 2D31A 1C5CL 4OF6A 4I0CC 2AXJA 5H94B 3OMZA 4XHJD 4OT1L 4WEBH 4PRIE 4BKLB 3REWB 3MUY1 2DLHA 5C1MB 3HPLA 4HZLA 5JA8B 3GIZH 1J7VR 1OW0A 2CXKA 4MGXA 3ORJA 4P3CL 1OPGH 3OF6D 4X6CB 3WO4C 2X5PA 5DJYA 1OARL 5FO8B 5HY9B 2QADB 4DN3L 4OV5B 3VXUE 3NOIA 2X89D 5D1ZA 4LQ1A 4M02A 4OGZA 1J0KA 1F6AA 1ZANL 1JWMA 3DGCR 3LKOB 3BOVA 2FYYB 5E94A 5C0AB 1PQZA 4FS0A 4MA3B 1DZBA 2ZKHL 4MJIA 1KN4L 3TT3H 4LP5A 2RB8A 5SWQA 4OZGA 1YNLL 1ZVSA 5FGBA 5ETUB 4E41A 1U93B 5I74B 3VGBA 1QRNA 3RY6C 4HIIA 2XG4A 3OKYA 3QEGH 1J8HE 1IGIL 5F8RC 4J7RA 4HK0A 5F89A 1C12B 2BCKA 4QTHB 5C7XL 1XIWB 3VMOA 5JIKA 4Y4HA 2OTWA 5I1DA 3UYRL 4PB9H 3GGWB 1OTUC 1SBSL 2DQHH 5TPWL 2XPGB 5IB1B 3QUYC 5E2UL 5JHDB 4GH7B 1SHMA 5HPOA 2RAMA 3L3GB 1AE6H 1HH6A 2YD5A 4OLEA 1FO0H 1A1NB 5J12C 2Z92B 4OZFG 4JRYD 2WWMD 1TETL 2GY5A 5IW6B 3QPQD 2XRAL 4BH7B 1T7YA 4KTDH 4PS4L 1GGCL 5IT2H 1EAPB 1LP9F 3CFIC 3HE6A 5FYLD 1EZVY 3D2UA 2JJUA 2F58L 5L88L 3OZ9H 5IFJA 1U8NA 2UYLA 2ICCA 3L5WB 2CRZA 1QKZH 1YMMD 1G7JB 3VI4E 4HJJL 4NQEB 3X12A 3MJ9A 2H9GA 4JDTL 4HWUA 1NMBL 1KLFA 2OL3A 1NFIA 2R4SL 1FQ9C 2WQRA 4HT1H 2Q8BH 4H0GA 1ZLSL 1WBXB 2UY7A 3BT2H 4LRIC 4JQXC 3OG6B 5E1AA 4FMFA 4HUNB 1B4RA 2VYRE 4QF1B 1B0WA 4OD3H 5I1HH 3TV3H 1JYNA 3KPNA 2CR3A 4EUPA 3UBXG 1E4JA 3FQTA 4WTZG 1BQUA 3VFTA 4OFYD 3CC5A 5E8EB 3KPRA 4N90E 4YGAB 3QAZC 3G6JE 4H1LB 3L7EB 2P1YA 3RDTB 5M94B 4PRPA 3MFGB 3AB0C 4PRIB 1PLGL 3SGJA 4Z5RB 1LEGB 1KN2L 4GW5B 1LO2H 5D5ME 2HA1A 5D8JL 1A6AB 2KH2B 4JFZH 2HFFA 3LPFA 4Y19A 3TBWA 2J8OA 4JFFD 3VWJD 2H1PH 4NWTL 3G6DL 5CWSB 1AGFA 5ESQA 5T1KB 5J9PB 3ULUE 1WBYA 3O6FD 4IS6B 1I7TA 3VGAB 2OCFD 3ARFA 2NY6C 5TQ0L 3VXUB 1PVHA 2E3VA 4DVRH 2DJSA 4CU8A 1HQRA 2BXYA 2IALB 4LAQH 4I18A 3LN5B 4OLXL 5KVDL 2R2EB 4IJ3B 4C56D 6CGTA 4U1SA 3KGRA 3SKNB 3L5IA 3TBVB 4PRHD 2XQBL 2MNUA 1NCAH 2P8LB 3FQRB 3I50H 4G8GA 4WHCA 4XC1L 4G9FE 5DTFB 3MLWH 4JQVC 2CDEB 3TYFA 3T3MF 1E0OB 3CJJA 3VE0A 1J8HB 3NIDF 4ZODA 4QHKJ 3DVGB 3MRPA 3BQUB 2EKSA 1NBVL 2BOCA 4PV8B 1BEYL 1JHLL 1KIPA 1NUFA 2PF6A 2GSIB 2YPLB 3MRGA 1S7SA 5DFWH 1MCHA 3CVIL 1PD6A 4M6OL 4NYLB 1J1XL 2FEDD 4J6RL 3B9VA 1CLOH 3K3QA 2X4PB 1B0GA 2XQYG 3VG0H 1QSVA 4IOIB 3RWIA 2Z91A 4U1NA 1CDBA 5F3HA 4YHKL 2PO6D 4Y5VC 4NRXB 2X1OA 1D9KC 2NY0C 4JN2A 3GMPA 1NJ9B 4FQ1L 4PJFF 3WXWH 5DJ2B 2BDNH 3LS5H 3O9WC 3PDGA 2ADGB 1XMWA 3GJFK 4LCCA 1FN4B 3IDNA 3R1GL 4R2GC 1P7QD 4L3EA 3CFJA 3HPJB 2IFGA 4XCYB 4XBPB 4DK6A 2BSRB 5CHNB 4CVUA 3U6RB 4DN4H 5BVJA 3V9FA 3EHBD 4P2RA 4Z18A 5DJXB 1W8NA 4N0FA 2AJYH 5E8OA 1KELL 4KRLB 4LLMB 5CBAB 2DM3A 1BQLL 5CMAA 1U8HA 1CWVA 5ACZA 4XMKL 3LN4B 3RIFK 4IBLT 3DUUB 3O4OB 5LCVH 3EJYD 3S88H 2OS7A 5JOFB 3U2SB 5DD1H 1UCBH 5DRNA 4JFED 3DURB 3OAUH 3LSOB 1OW0C 5F1IB 1WGOA 4WW2F 1A6PA 4XX1E 4DGVL 1WVZA 3MNZA 3D87B 3LQZB 3G6JB 3LKPB 3LEYH 1FYTA 3V79C 3SOBH 2EDNA 3STLB 4MAUH 1ZA3A 2W9DL 4LLVB 4XCFL 5D1ZC 5KJRH 1G7PA 4G9DB 3DX7A 5D5MB 4OM1L 5IMLB 3EJJX 1G1CA 4NO3A 1U3YA 4HMDA 4X7FC 3X17A 2I9TB 1XAUA 3VFSA 4CN4A 1KJMA 1S7UA 4K07A 3QZWB 4U1GB 3C8KB 2NNAB 2R69H 4ZO8A 4N5ED 5EOQH 5FGBC 3ZKMD 1N59A 3ISWA 2CO6B 4RQQA 4NUJB 2X4UB 4LARH 5FV1L 2P49B 1NBZA 3RGVA 1KCVH 5J6GA 4G80A 4JRXA 4ZUTB 4Y4HC 5T3XE 4N8VA 4Q7DA 4G9FB 3ZHKA 5ALCL 3SKJL 1CGVA 2AS5M 3K46A 4TYUA 5TFSH 3EKCA 3LVEA 3MJ9L 3MLTA 1SJHB 3O4LA 1RK1B 1CDUA 5D2LF 4R97B 5TDOA 5CEZH 2OL3L 3QUZA 2CLZA 1FGNL 3MRQA 1TJHH 2Y25A 2NCMA 5BCAA 2DQGL 4ZO6A 4PP2B 2VDQH 3L7FB 3O3UN 4XBGB 1OAZH 1LO4L 4FQJL 2DYPD 1PW3A 4PJBA 1AIFA 1LK3H 3CXDH 4RFOL 5AWNH 5T3ZE 3KPOA 1FVCA 3IRZA 3RUGF 3LEXA 3ZDZE 1AO7D 2AJXL 4AQ1B 5CUSH 4U2ZA 4U1IA 4HK3N 4ZO7A 3D85D 1MAJA 4OLVH 2VDOL 1XH3A 1XGTB 1S7TB 4R4BB 1PAMA 2BK8A 4LKCA 2FGWH 2Q76A 5CIPA 1T5WB 4MDJA 3OKEA 3NIGE 2J5LB 4YDLC 3BN3B 3D3VE 3VXPA 3KYMB 3CFCH 3DSFL 4MCZA 4WV1A 4MVBD 1MHPH 4HH9A 4KUCD 5T1LA 3SDXF 5EFIA 1LDPL 1PDKA 3OAZH 2D9CA 5IHUL 2DKMA 1WBZB 4QRTB 4Y16B 4CUCA 1PG7H 4Z78A 1JK8B 4YFDB 5H2BB 3IETB 3WDHA 1K5NB 4JO1L 5KANI 4Y5YA 2FWOB 1YN7B 2KDGA 4D3CH 3GRWH 2ZUSA 5GRJL 2VE6B 2P7TA 4EBQL 2D3VA 1FFNB 1I8KA 3TWCH 3O6KH 3HNVL 3ZE0F 1W0YT 3SGJC 1T66D 2HWZH 3BE1L 4POYA 5BS0A 3ARBC 3ARGA 4Z7UF 1KJVB 5ILTH 1T1WA 1MLBB 1QLEH 4YBHA 1V3MA 3WFHA 4N0CD 3UTPE 4DFIA 4XVTL 5FO9B 4XTRC 2D7QA 1N5AB 3IXTB 4P23D 4JG0L 1BOGA 1GOHA 4X4XA 2AK4B 3ARFC 1IAII 4C4KT 1TZIB 3HMXH 1AGCB 3JBG7 2AV7B 2XKNA 3MRRB 1YEGL 1XR9B 4I18C