3NZLA

Crystal structure of the n-terminal domain of dna-binding protein satb1 from homo sapiens, northeast structural genomics consortium target hr4435b
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
HHSHMLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal domain of DNA-binding protein SATB1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4435B (CASP Target)
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA-binding protein SATB1
total genus 21
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2010-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.70 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 3nzlA00
2L1PA 4Q2JA 3NZLA
chains in the Genus database with same CATH superfamily
1ZS4A 3SCFA 4EZIA 1UTXA 4PU4C 2PE5A 2V3CC 1L1MA 3DNVB 5DSXA 2PXLA 3ME5A 1R69A 3TRBA 3JXDL 2L8NA 4Z5HA 2PXFA 3GZCA 4OBMA 2O4AA 2KEKA 3GZDC 2FFHA 5DTRA 4X4CA 3UWPA 1RZRA 2BNMA 3B7HA 4I6UA 1AU7A 1ZZ6A 3U3WA 4O8BA 2XI8A 5JUWA 2XIUA 1QQBA 2OFYA 1LQCA 5A7LA 1MFQC 3CECA 3A9ZA 1ADRA 1DULA 3GZDA 3JXCL 2PUBA 1RIOA 2PUFA 3QYXA 2PXPA 2LLVA 5DTQA 3VWSA 4X4HA 1U2ZA 2YBDA 1ZZCA 2HINA 2XXQA 4EKGA 4JQDA 3BS3A 2IU7A 2LYPA 3PXPA 2PXQA 4YG7B 3RZZA 5DRTA 1GT0C 3G7DA 4DE9A 1EFAA 4X4BA 3OWQA 3MLFA 3QQ6A 2J7WA 3KXAA 2AWIA 2BJCA 4MCXA 1NW3A 2IUOA 3A9XA 4X4IA 1ZVVA 3GUUA 1LCCA 3QF3A 4F8DA 2LYKA 1X2LA 1CQTA 1RZRD 3BD1A 3ZHMA 2LCVA 2JVLA 4Z59A 1HF0A 2CROA 1LCDA 1JFSA 3GN5A 2LNMA 2WIUB 1OCTC 2FJRA 2PUAA 4GHJA 4ER7A 3OQMA 1HQ1A 2EWTA 4NDWA 4WVLA 1QZXA 2OR1L 2D5VA 2HCSA 4YG1A 2GRMA 1PRUA 4GQMA 2XCJA 3NXHA 3SCGA 2R63A 1PRVA 3TELA 2KPJA 2PPXA 2LYLA 2HFZA 3EUSA 1ZZ7A 4MCTA 2PXVA 3KL4A 1QP7A 1JH9A 1OSLA 3KZ3A 1JFTA 4EQZA 1QPZA 1X57A 3QFIA 5DRYA 2LYRA 2JQEA 1ZZ9A 4FN3A 3D1NI 3NROA 3SR4A 2B5AA 1PNRA 3QOWA 1S7EA 4PU3C 4HRAA 1WETA 2PXKA 2PXDA 3IVPA 3GN5B 3LQXA 1QP4A 5GAGi 1WH8A 1IC8A 2IV1A 2VEOA 4JCXA 1Y7YA 4Z5DA 2EF8A 2H8RA 2L49A 1ZPQA 1E3OC 3KJXA 1QB2A 3GBFA 4IA8A 3JXBC 3CLCA 3FYAA 3ZKCA 3F52A 4EKIA 4IVZA 3OQNA 3LFPA 4YARA 1Y9QA 1ZUGA 2PUCA 2IVBA 2PXBA 2ICTA 4DE8A 1PRAA 4FBIA 2A6CA 3DM5A 2XSDC 3M9LA 3OQOA 1POUA 3QOXA 2EBYA 2MXDA 3CROL 5DTMA 2KZ8A 1XWRA 3R1FA 2LYQA 3G5GA 2PUDA 3QWGA 4ER5A 3R09A 3ZHIA 3SCHA 3SX0A 2XXAA 2PIJA 4Q2JA 4Y42A 3HZIB 2AUWA 4PU7A 1PERL 3ZPXA 4Z58A 2M4HA 3G0TA 2LYSA 1VPWA 3NDBB 4X4DA 1JWLA 2O38A 3L1PA 1UXDA 3OP9A 4X4FA 2PXUA 3S8QA 1YSEA 1NEQA 1O4XA 2AW6A 2MQKA 2ODRD 4ER0A 3VK0A 3PE5A 2PXEA 2PUEA 4ER6A 3FMYA 1DW9A 2KEIA 2JCGA 2WUSR 1NERA 1SQ8A 3BDNA 2AXVA 3F6WA 2O49A 2GRLA 1WH6A 1DWKA 4X4GA 2AXZA 1ZZBA 2J7UA 1LMB3 2MEZA 4I6TA 1CJGA 2BNOA 3LISA 2KEJA 3H5TA 2IVQA 5DT2A 2L1PA 4ER3A 2HCNA 4J1XA 2IVGA 2BNNA 2HSGA 2XJ3A 1QQAA 3OMTA 4J1WA 4IWRA 3FYMA 4I8TA 4OB4A 1QP0A 2LYJA 1BDIA 3TFLA 2AXUA 4X4EA 3OKZA 4JCYA 4YBAA 2PUGA 4YG4A 2LLWA 1UXCA 3MEJA 3NZLA 1ZAYA 1BDHA 5K98B 1RZSA 3UFDA 1R63A 4Z5CA 1B0NA 3F51A 2PXTA 2CSFA 5GAHi 1LLIA 4PU8A 4EK9A 1WIZA 3O9XA 2R1JL 3A9YA 4I6RA 2ICPA 3TEPA 2XXPA 1ZZ8A 1RPEL 2GZUA
chains in the Genus database with same CATH topology
2HCSA 5DRTA 4EZIA 4DE9A 4ER5A 3VWSA 3GZCA 3R09A 4OBMA 4ER6A 5JUWA 4EQZA 3OWQA 3TFLA 3SX0A 3GZDC 2J7WA 3NXHA 2J7UA 3OKZA 2VEOA 1U2ZA 4DE8A 2YBDA 5DTRA 4Q2JA 3QFIA 2XXQA 1NW3A 4EKGA 3UWPA 4EK9A 5DRYA 5DSXA 2LNMA 3A9XA 3TELA 3ME5A 3A9ZA 3M9LA 3A9YA 3GUUA 2L1PA 3GZDA 5DT2A 4ER7A 3NROA 3SR4A 4ER3A 2LLWA 3QOXA 2HCNA 3MEJA 2MXDA 2HFZA 3QOWA 3ZPXA 2ODRD 2XXPA 5DTMA 4WVLA 4ER0A 3TEPA 3PE5A 2M4HA 3NZLA 3G0TA 4HRAA 2LLVA 5DTQA 4EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1P A;  4Q2J A;  3NZL A; 
#chains in the Genus database with same CATH topology
 1ZS4 A;  3SCF A;  4EZI A;  1UTX A;  4PU4 C;  2PE5 A;  2V3C C;  1L1M A;  3DNV B;  5DSX A;  2PXL A;  3ME5 A;  1R69 A;  3TRB A;  3JXD L;  2L8N A;  4Z5H A;  2PXF A;  3GZC A;  4OBM A;  2O4A A;  2KEK A;  3GZD C;  2FFH A;  5DTR A;  4X4C A;  3UWP A;  1RZR A;  2BNM A;  3B7H A;  4I6U A;  1AU7 A;  1ZZ6 A;  3U3W A;  4O8B A;  2XI8 A;  5JUW A;  2XIU A;  1QQB A;  2OFY A;  1LQC A;  5A7L A;  1MFQ C;  3CEC A;  3A9Z A;  1ADR A;  1DUL A;  3GZD A;  3JXC L;  2PUB A;  1RIO A;  2PUF A;  3QYX A;  2PXP A;  2LLV A;  5DTQ A;  3VWS A;  4X4H A;  1U2Z A;  2YBD A;  1ZZC A;  2HIN A;  2XXQ A;  4EKG A;  4JQD A;  3BS3 A;  2IU7 A;  2LYP A;  3PXP A;  2PXQ A;  4YG7 B;  3RZZ A;  5DRT A;  1GT0 C;  3G7D A;  4DE9 A;  1EFA A;  4X4B A;  3OWQ A;  3MLF A;  3QQ6 A;  2J7W A;  3KXA A;  2AWI A;  2BJC A;  4MCX A;  1NW3 A;  2IUO A;  3A9X A;  4X4I A;  1ZVV A;  3GUU A;  1LCC A;  3QF3 A;  4F8D A;  2LYK A;  1X2L A;  1CQT A;  1RZR D;  3BD1 A;  3ZHM A;  2LCV A;  2JVL A;  4Z59 A;  1HF0 A;  2CRO A;  1LCD A;  1JFS A;  3GN5 A;  2LNM A;  2WIU B;  1OCT C;  2FJR A;  2PUA A;  4GHJ A;  4ER7 A;  3OQM A;  1HQ1 A;  2EWT A;  4NDW A;  4WVL A;  1QZX A;  2OR1 L;  2D5V A;  2HCS A;  4YG1 A;  2GRM A;  1PRU A;  4GQM A;  2XCJ A;  3NXH A;  3SCG A;  2R63 A;  1PRV A;  3TEL A;  2KPJ A;  2PPX A;  2LYL A;  2HFZ A;  3EUS A;  1ZZ7 A;  4MCT A;  2PXV A;  3KL4 A;  1QP7 A;  1JH9 A;  1OSL A;  3KZ3 A;  1JFT A;  4EQZ A;  1QPZ A;  1X57 A;  3QFI A;  5DRY A;  2LYR A;  2JQE A;  1ZZ9 A;  4FN3 A;  3D1N I;  3NRO A;  3SR4 A;  2B5A A;  1PNR A;  3QOW A;  1S7E A;  4PU3 C;  4HRA A;  1WET A;  2PXK A;  2PXD A;  3IVP A;  3GN5 B;  3LQX A;  1QP4 A;  5GAG i;  1WH8 A;  1IC8 A;  2IV1 A;  2VEO A;  4JCX A;  1Y7Y A;  4Z5D A;  2EF8 A;  2H8R A;  2L49 A;  1ZPQ A;  1E3O C;  3KJX A;  1QB2 A;  3GBF A;  4IA8 A;  3JXB C;  3CLC A;  3FYA A;  3ZKC A;  3F52 A;  4EKI A;  4IVZ A;  3OQN A;  3LFP A;  4YAR A;  1Y9Q A;  1ZUG A;  2PUC A;  2IVB A;  2PXB A;  2ICT A;  4DE8 A;  1PRA A;  4FBI A;  2A6C A;  3DM5 A;  2XSD C;  3M9L A;  3OQO A;  1POU A;  3QOX A;  2EBY A;  2MXD A;  3CRO L;  5DTM A;  2KZ8 A;  1XWR A;  3R1F A;  2LYQ A;  3G5G A;  2PUD A;  3QWG A;  4ER5 A;  3R09 A;  3ZHI A;  3SCH A;  3SX0 A;  2XXA A;  2PIJ A;  4Q2J A;  4Y42 A;  3HZI B;  2AUW A;  4PU7 A;  1PER L;  3ZPX A;  4Z58 A;  2M4H A;  3G0T A;  2LYS A;  1VPW A;  3NDB B;  4X4D A;  1JWL A;  2O38 A;  3L1P A;  1UXD A;  3OP9 A;  4X4F A;  2PXU A;  3S8Q A;  1YSE A;  1NEQ A;  1O4X A;  2AW6 A;  2MQK A;  2ODR D;  4ER0 A;  3VK0 A;  3PE5 A;  2PXE A;  2PUE A;  4ER6 A;  3FMY A;  1DW9 A;  2KEI A;  2JCG A;  2WUS R;  1NER A;  1SQ8 A;  3BDN A;  2AXV A;  3F6W A;  2O49 A;  2GRL A;  1WH6 A;  1DWK A;  4X4G A;  2AXZ A;  1ZZB A;  2J7U A;  1LMB 3;  2MEZ A;  4I6T A;  1CJG A;  2BNO A;  3LIS A;  2KEJ A;  3H5T A;  2IVQ A;  5DT2 A;  2L1P A;  4ER3 A;  2HCN A;  4J1X A;  2IVG A;  2BNN A;  2HSG A;  2XJ3 A;  1QQA A;  3OMT A;  4J1W A;  4IWR A;  3FYM A;  4I8T A;  4OB4 A;  1QP0 A;  2LYJ A;  1BDI A;  3TFL A;  2AXU A;  4X4E A;  3OKZ A;  4JCY A;  4YBA A;  2PUG A;  4YG4 A;  2LLW A;  1UXC A;  3MEJ A;  3NZL A;  1ZAY A;  1BDH A;  5K98 B;  1RZS A;  3UFD A;  1R63 A;  4Z5C A;  1B0N A;  3F51 A;  2PXT A;  2CSF A;  5GAH i;  1LLI A;  4PU8 A;  4EK9 A;  1WIZ A;  3O9X A;  2R1J L;  3A9Y A;  4I6R A;  2ICP A;  3TEP A;  2XXP A;  1ZZ8 A;  1RPE L;  2GZU A; 
#chains in the Genus database with same CATH homology
 2HCS A;  5DRT A;  4EZI A;  4DE9 A;  4ER5 A;  3VWS A;  3GZC A;  3R09 A;  4OBM A;  4ER6 A;  5JUW A;  4EQZ A;  3OWQ A;  3TFL A;  3SX0 A;  3GZD C;  2J7W A;  3NXH A;  2J7U A;  3OKZ A;  2VEO A;  1U2Z A;  4DE8 A;  2YBD A;  5DTR A;  4Q2J A;  3QFI A;  2XXQ A;  1NW3 A;  4EKG A;  3UWP A;  4EK9 A;  5DRY A;  5DSX A;  2LNM A;  3A9X A;  3TEL A;  3ME5 A;  3A9Z A;  3M9L A;  3A9Y A;  3GUU A;  2L1P A;  3GZD A;  5DT2 A;  4ER7 A;  3NRO A;  3SR4 A;  4ER3 A;  2LLW A;  3QOX A;  2HCN A;  3MEJ A;  2MXD A;  2HFZ A;  3QOW A;  3ZPX A;  2ODR D;  2XXP A;  5DTM A;  4WVL A;  4ER0 A;  3TEP A;  3PE5 A;  2M4H A;  3NZL A;  3G0T A;  4HRA A;  2LLV A;  5DTQ A;  4EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...