3O0EA

Crystal structure of ompf in complex with colicin peptide obs1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin 1a (Ia;b;F)
publication title Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF.
pubmed doi rcsb
molecule tags Membrane protein
total genus 99
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3o0eA00
3SYSA 4C69X 1OSMA 3SY7A 3T0SA 2XE2A 4FRTA 3HWBA 2Y0LA 3O0EA 2XG6A 1H6S1 4RJWA 3VY9X 7PRNA 5JDPA 4FMSA 3T24A 2QTKA 2XE3A 4D65A 3JTYA 3SYBA 2ZLDA 3PORA 3UU2A 2ODJA 5FVNA 3UPGA 4GCSA 3WI4A 3A2SX 3FYXA 4KR8A 3VY8X 3SZDA 4LSIA 1OPFA 3PRNA 3HW9A 1BH3A 2XE1A 4RJXA 2PRNA 2Y2XA 3VZUX 2K4TA 1PRNA 3SZVA 4LSEA 2XE5A 3EMNX 1GFOA 1GFNA 4FSPA 3WI5A 2ZFGA 4D5UA 1HXUA 5DL5A 2Y0HA 5DL8A 2J1NA 8PRNA 1E54A 3POXA 1BT9A 2O4VA 2PORA 3POQA 3POUA 3K19A 4FT6A 3VZTX 2FGRA 4GCQA 1HXXA 6PRNA 4LSHA 3NSGA 1MPFA 5DL6A 4KRAA 3VZWX 1GFQA 1HXTA 4LSFA 4D64A 3T20A 1PHOA 5PRNA 2Y0KA 4AUIA 2J4UP 1GFMA 4GCPA 4FRXA 4FSOA 1GFPA 5DL7A 4FOZA 4BUMX 2FGQX 3SY9A 2OMFA 4JFBA 4KR4A
chains in the Genus database with same CATH superfamily
3PGRA 2ERVA 5T5FA 2KZ7A 3BRYA 4N74A 2XTRA 4AKRB 4AFKA 4N59A 3SYSA 4AYMC 4C69X 5G39A 2KXPB 4UB6O 2IWVA 2R4NA 4AKRA 1OSMA 1Q9FA 3DWOX 1BXWA 2KXPA 3AA0B 5TISO 3SY7A 3T0SA 4E1SA 1S5LO 3AA6B 2R88A 2WJQA 2XE2A 4FRTA 3AA0A 3HWBA 5GTHO 3AA6A 3AA7B 2F1TA 4G75A 1Q9GA 2WJRA 3AAEB 2Y0LA 3AA7A 1ORMA 3O0EA 3AAEA 4K3BA 4XNLA 2XG6A 1H6S1 3HOLA 4G76A 4RJWA 4FUVA 3QRAA 3VY9X 2N2MA 3G7GA 7PRNA 5JDPA 4FMSA 4E1TA 4AKMA 3T24A 2F1CX 2X27X 4JCHA 2JMMA 2IWWA 2QTKA 2XE3A 4D65A 3JTYA 5IYUA 4QQ1A 3SYBA 3AA1B 2ZLDA 5KAFO 4F4BA 5H2FO 2WVPA 3AA1A 3DA4A 3PORA 3UU2A 2ODJA 4N75A 3DZMA 5FVNA 3UPGA 4GCSA 4C4VB 4RLCA 3WI4A 3A2SX 3FYXA 4KR8A 5G26A 3VY8X 5ADXK 4C4VA 3SZDA 4LSIA 2JQYA 1OPFA 3PRNA 3HW9A 5G38A 3JCUO 2X9KA 1BH3A 2XE1A 3PGUA 4RJXA 2PRNA 2Y2XA 3VZUX 2YPVA 4AYDC 2AXTO 2K4TA 2W81C 4RLBA 1ZHYA 4PJ0O 1PRNA 3A0HO 2R89A 4LSEA 2XE5A 3EMNX 4FESA 5GTIO 3SZVA 5ADXL 1G90A 1GFOA 1GFNA 4FSPA 3WI5A 2ZFGA 4C00A 5AFUK 2R4OA 2M07A 2YNKA 1P4TA 4D5UA 2R4LA 4FZNA 5B66O 1HXUA 5DL5A 4RL9A 3VE2A 2Y0HA 2R8AA 2KC0A 4O3WA 1IZNB 3KZIO 2LHFA 4O49A 5DL8A 3KVDD 5D5DA 2J1NA 3LK41 1IZNA 3DWNA 3LK2B 8PRNA 5AFUL 1E54A 3POXA 1BT9A 2O4VA 3LK2A 3PF1A 2PORA 3POQA 4FZMA 2XTQA 2K0LA 2F1VA 1THQA 3POUA 3A0BO 4FQEA 4IL6O 5G3AA 4XNKA 3PQUA 3K19A 4FT6A 4K3CA 4O4XA 2Y7SA 2XMXA 3VZTX 4N58A 3BS0A 5B5EO 4O3ZA 3DA3A 1T16A 2FGRA 4AYEC 1ZHZA 1T1LA 3GP6A 4GCQA 1HXXA 6PRNA 4LSHA 3V8UA 4GHBA 4O3XB 3NSGA 4AZLA 1MPFA 5DL6A 3PQSA 4B61A 4KRAA 3WU2O 3HOEA 4CTDA 1ZHTA 1ZHXA 2M06A 5GV0A 1MM5A 4U9CA 1ZHWA 4O4UA 2KDYA 3PGSA 3VZWX 1GFQA 1HXTA 4LSFA 4D64A 3LK3B 3NJTA 4FZLA 3T20A 1PHOA 3TZGA 3C5OA 1MM4A 5PRNA 3LK3A 2Y0KA 4PUXA 3LK42 2N2LA 2GE4A 1QJPA 3QRCA 4GF4A 4AUIA 3VE1A 5E79O 3AAAB 2LFUA 4O3YA 2MNHA 4UB8O 3AAAA 1QJ9A 2J4UP 1GFMA 4GCPA 4FRXA 4FSOA 4Z3TA 1GFPA 5DL7A 5EE2A 3UAQA 4AYNA 4FOZA 4PR7A 2MHLA 4BUMX 3RBHA 4AYID 2W80C 1YS5A 2FGQX 3SY9A 2OMFA 4JFBA 5KAIO 2KZ7B 4KR4A 2R4PA 3BRZA 1QJ8A
chains in the Genus database with same CATH topology
2ERVA 5T5FA 2KZ7A 2XTRA 4AKRB 4AFKA 4N59A 3SYSA 4AYMC 4C69X 4AKRA 2KXPB 1OSMA 1Q9FA 1BXWA 2KXPA 3AA0B 3SY7A 3T0SA 4E1SA 3AA6B 2XE2A 4FRTA 3AA0A 3HWBA 3AA6A 3AA7B 2F1TA 4G75A 1Q9GA 3AAEB 2Y0LA 3AA7A 1ORMA 3O0EA 3AAEA 4XNLA 2XG6A 1H6S1 3HOLA 4G76A 4RJWA 4FUVA 3QRAA 3VY9X 2N2MA 3G7GA 7PRNA 5JDPA 4FMSA 4E1TA 4AKMA 3T24A 2X27X 4JCHA 2JMMA 2QTKA 2XE3A 4D65A 3JTYA 5IYUA 4QQ1A 3SYBA 3AA1B 2ZLDA 4F4BA 3AA1A 3DA4A 3PORA 3UU2A 2ODJA 5FVNA 3UPGA 4GCSA 4RLCA 3WI4A 3A2SX 3FYXA 4KR8A 5G26A 3VY8X 5ADXK 3SZDA 4LSIA 1OPFA 3PRNA 3HW9A 1BH3A 2XE1A 4RJXA 2PRNA 2Y2XA 3VZUX 2YPVA 4AYDC 4RLBA 2K4TA 2W81C 1ZHYA 1PRNA 3SZVA 4LSEA 2XE5A 3EMNX 4FESA 1G90A 5ADXL 1GFOA 1GFNA 4FSPA 3WI5A 2ZFGA 5AFUK 2YNKA 2M07A 4D5UA 1P4TA 4FZNA 1HXUA 5DL5A 4RL9A 3VE2A 2Y0HA 2KC0A 4O3WA 1IZNB 2LHFA 4O49A 5DL8A 3KVDD 2J1NA 3LK41 1IZNA 3LK2B 8PRNA 5AFUL 1E54A 3POXA 1BT9A 2O4VA 3LK2A 4FZMA 2PORA 3POQA 2XTQA 2K0LA 2F1VA 1THQA 3POUA 4XNKA 3PQUA 3K19A 4FT6A 4O4XA 2Y7SA 2XMXA 3VZTX 4N58A 4O3ZA 3DA3A 2FGRA 4AYEC 1ZHZA 3GP6A 4GCQA 1HXXA 6PRNA 4LSHA 3V8UA 4GHBA 4O3XB 3NSGA 4AZLA 1MPFA 5DL6A 3PQSA 4B61A 4KRAA 3HOEA 1ZHTA 1ZHXA 2M06A 5GV0A 1MM5A 4U9CA 1ZHWA 4O4UA 2KDYA 3VZWX 1GFQA 1HXTA 4LSFA 4D64A 3LK3B 4FZLA 3T20A 1PHOA 3TZGA 3C5OA 1MM4A 5PRNA 3LK3A 2Y0KA 4PUXA 3LK42 2N2LA 2GE4A 1QJPA 3QRCA 4GF4A 4AUIA 3VE1A 3AAAB 2LFUA 4O3YA 2MNHA 3AAAA 1QJ9A 2J4UP 1GFMA 4GCPA 4FRXA 4FSOA 4Z3TA 1GFPA 5DL7A 5EE2A 3UAQA 4AYNA 4FOZA 4BUMX 2MHLA 3RBHA 4AYID 2W80C 1YS5A 2FGQX 3SY9A 2OMFA 4JFBA 2KZ7B 4KR4A 5D5DA 1QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYS A;  4C69 X;  1OSM A;  3SY7 A;  3T0S A;  2XE2 A;  4FRT A;  3HWB A;  2Y0L A;  3O0E A;  2XG6 A;  1H6S 1;  4RJW A;  3VY9 X;  7PRN A;  5JDP A;  4FMS A;  3T24 A;  2QTK A;  2XE3 A;  4D65 A;  3JTY A;  3SYB A;  2ZLD A;  3POR A;  3UU2 A;  2ODJ A;  5FVN A;  3UPG A;  4GCS A;  3WI4 A;  3A2S X;  3FYX A;  4KR8 A;  3VY8 X;  3SZD A;  4LSI A;  1OPF A;  3PRN A;  3HW9 A;  1BH3 A;  2XE1 A;  4RJX A;  2PRN A;  2Y2X A;  3VZU X;  2K4T A;  1PRN A;  3SZV A;  4LSE A;  2XE5 A;  3EMN X;  1GFO A;  1GFN A;  4FSP A;  3WI5 A;  2ZFG A;  4D5U A;  1HXU A;  5DL5 A;  2Y0H A;  5DL8 A;  2J1N A;  8PRN A;  1E54 A;  3POX A;  1BT9 A;  2O4V A;  2POR A;  3POQ A;  3POU A;  3K19 A;  4FT6 A;  3VZT X;  2FGR A;  4GCQ A;  1HXX A;  6PRN A;  4LSH A;  3NSG A;  1MPF A;  5DL6 A;  4KRA A;  3VZW X;  1GFQ A;  1HXT A;  4LSF A;  4D64 A;  3T20 A;  1PHO A;  5PRN A;  2Y0K A;  4AUI A;  2J4U P;  1GFM A;  4GCP A;  4FRX A;  4FSO A;  1GFP A;  5DL7 A;  4FOZ A;  4BUM X;  2FGQ X;  3SY9 A;  2OMF A;  4JFB A;  4KR4 A; 
#chains in the Genus database with same CATH topology
 3PGR A;  2ERV A;  5T5F A;  2KZ7 A;  3BRY A;  4N74 A;  2XTR A;  4AKR B;  4AFK A;  4N59 A;  3SYS A;  4AYM C;  4C69 X;  5G39 A;  2KXP B;  4UB6 O;  2IWV A;  2R4N A;  4AKR A;  1OSM A;  1Q9F A;  3DWO X;  1BXW A;  2KXP A;  3AA0 B;  5TIS O;  3SY7 A;  3T0S A;  4E1S A;  1S5L O;  3AA6 B;  2R88 A;  2WJQ A;  2XE2 A;  4FRT A;  3AA0 A;  3HWB A;  5GTH O;  3AA6 A;  3AA7 B;  2F1T A;  4G75 A;  1Q9G A;  2WJR A;  3AAE B;  2Y0L A;  3AA7 A;  1ORM A;  3O0E A;  3AAE A;  4K3B A;  4XNL A;  2XG6 A;  1H6S 1;  3HOL A;  4G76 A;  4RJW A;  4FUV A;  3QRA A;  3VY9 X;  2N2M A;  3G7G A;  7PRN A;  5JDP A;  4FMS A;  4E1T A;  4AKM A;  3T24 A;  2F1C X;  2X27 X;  4JCH A;  2JMM A;  2IWW A;  2QTK A;  2XE3 A;  4D65 A;  3JTY A;  5IYU A;  4QQ1 A;  3SYB A;  3AA1 B;  2ZLD A;  5KAF O;  4F4B A;  5H2F O;  2WVP A;  3AA1 A;  3DA4 A;  3POR A;  3UU2 A;  2ODJ A;  4N75 A;  3DZM A;  5FVN A;  3UPG A;  4GCS A;  4C4V B;  4RLC A;  3WI4 A;  3A2S X;  3FYX A;  4KR8 A;  5G26 A;  3VY8 X;  5ADX K;  4C4V A;  3SZD A;  4LSI A;  2JQY A;  1OPF A;  3PRN A;  3HW9 A;  5G38 A;  3JCU O;  2X9K A;  1BH3 A;  2XE1 A;  3PGU A;  4RJX A;  2PRN A;  2Y2X A;  3VZU X;  2YPV A;  4AYD C;  2AXT O;  2K4T A;  2W81 C;  4RLB A;  1ZHY A;  4PJ0 O;  1PRN A;  3A0H O;  2R89 A;  4LSE A;  2XE5 A;  3EMN X;  4FES A;  5GTI O;  3SZV A;  5ADX L;  1G90 A;  1GFO A;  1GFN A;  4FSP A;  3WI5 A;  2ZFG A;  4C00 A;  5AFU K;  2R4O A;  2M07 A;  2YNK A;  1P4T A;  4D5U A;  2R4L A;  4FZN A;  5B66 O;  1HXU A;  5DL5 A;  4RL9 A;  3VE2 A;  2Y0H A;  2R8A A;  2KC0 A;  4O3W A;  1IZN B;  3KZI O;  2LHF A;  4O49 A;  5DL8 A;  3KVD D;  5D5D A;  2J1N A;  3LK4 1;  1IZN A;  3DWN A;  3LK2 B;  8PRN A;  5AFU L;  1E54 A;  3POX A;  1BT9 A;  2O4V A;  3LK2 A;  3PF1 A;  2POR A;  3POQ A;  4FZM A;  2XTQ A;  2K0L A;  2F1V A;  1THQ A;  3POU A;  3A0B O;  4FQE A;  4IL6 O;  5G3A A;  4XNK A;  3PQU A;  3K19 A;  4FT6 A;  4K3C A;  4O4X A;  2Y7S A;  2XMX A;  3VZT X;  4N58 A;  3BS0 A;  5B5E O;  4O3Z A;  3DA3 A;  1T16 A;  2FGR A;  4AYE C;  1ZHZ A;  1T1L A;  3GP6 A;  4GCQ A;  1HXX A;  6PRN A;  4LSH A;  3V8U A;  4GHB A;  4O3X B;  3NSG A;  4AZL A;  1MPF A;  5DL6 A;  3PQS A;  4B61 A;  4KRA A;  3WU2 O;  3HOE A;  4CTD A;  1ZHT A;  1ZHX A;  2M06 A;  5GV0 A;  1MM5 A;  4U9C A;  1ZHW A;  4O4U A;  2KDY A;  3PGS A;  3VZW X;  1GFQ A;  1HXT A;  4LSF A;  4D64 A;  3LK3 B;  3NJT A;  4FZL A;  3T20 A;  1PHO A;  3TZG A;  3C5O A;  1MM4 A;  5PRN A;  3LK3 A;  2Y0K A;  4PUX A;  3LK4 2;  2N2L A;  2GE4 A;  1QJP A;  3QRC A;  4GF4 A;  4AUI A;  3VE1 A;  5E79 O;  3AAA B;  2LFU A;  4O3Y A;  2MNH A;  4UB8 O;  3AAA A;  1QJ9 A;  2J4U P;  1GFM A;  4GCP A;  4FRX A;  4FSO A;  4Z3T A;  1GFP A;  5DL7 A;  5EE2 A;  3UAQ A;  4AYN A;  4FOZ A;  4PR7 A;  2MHL A;  4BUM X;  3RBH A;  4AYI D;  2W80 C;  1YS5 A;  2FGQ X;  3SY9 A;  2OMF A;  4JFB A;  5KAI O;  2KZ7 B;  4KR4 A;  2R4P A;  3BRZ A;  1QJ8 A; 
#chains in the Genus database with same CATH homology
 2ERV A;  5T5F A;  2KZ7 A;  2XTR A;  4AKR B;  4AFK A;  4N59 A;  3SYS A;  4AYM C;  4C69 X;  4AKR A;  2KXP B;  1OSM A;  1Q9F A;  1BXW A;  2KXP A;  3AA0 B;  3SY7 A;  3T0S A;  4E1S A;  3AA6 B;  2XE2 A;  4FRT A;  3AA0 A;  3HWB A;  3AA6 A;  3AA7 B;  2F1T A;  4G75 A;  1Q9G A;  3AAE B;  2Y0L A;  3AA7 A;  1ORM A;  3O0E A;  3AAE A;  4XNL A;  2XG6 A;  1H6S 1;  3HOL A;  4G76 A;  4RJW A;  4FUV A;  3QRA A;  3VY9 X;  2N2M A;  3G7G A;  7PRN A;  5JDP A;  4FMS A;  4E1T A;  4AKM A;  3T24 A;  2X27 X;  4JCH A;  2JMM A;  2QTK A;  2XE3 A;  4D65 A;  3JTY A;  5IYU A;  4QQ1 A;  3SYB A;  3AA1 B;  2ZLD A;  4F4B A;  3AA1 A;  3DA4 A;  3POR A;  3UU2 A;  2ODJ A;  5FVN A;  3UPG A;  4GCS A;  4RLC A;  3WI4 A;  3A2S X;  3FYX A;  4KR8 A;  5G26 A;  3VY8 X;  5ADX K;  3SZD A;  4LSI A;  1OPF A;  3PRN A;  3HW9 A;  1BH3 A;  2XE1 A;  4RJX A;  2PRN A;  2Y2X A;  3VZU X;  2YPV A;  4AYD C;  4RLB A;  2K4T A;  2W81 C;  1ZHY A;  1PRN A;  3SZV A;  4LSE A;  2XE5 A;  3EMN X;  4FES A;  1G90 A;  5ADX L;  1GFO A;  1GFN A;  4FSP A;  3WI5 A;  2ZFG A;  5AFU K;  2YNK A;  2M07 A;  4D5U A;  1P4T A;  4FZN A;  1HXU A;  5DL5 A;  4RL9 A;  3VE2 A;  2Y0H A;  2KC0 A;  4O3W A;  1IZN B;  2LHF A;  4O49 A;  5DL8 A;  3KVD D;  2J1N A;  3LK4 1;  1IZN A;  3LK2 B;  8PRN A;  5AFU L;  1E54 A;  3POX A;  1BT9 A;  2O4V A;  3LK2 A;  4FZM A;  2POR A;  3POQ A;  2XTQ A;  2K0L A;  2F1V A;  1THQ A;  3POU A;  4XNK A;  3PQU A;  3K19 A;  4FT6 A;  4O4X A;  2Y7S A;  2XMX A;  3VZT X;  4N58 A;  4O3Z A;  3DA3 A;  2FGR A;  4AYE C;  1ZHZ A;  3GP6 A;  4GCQ A;  1HXX A;  6PRN A;  4LSH A;  3V8U A;  4GHB A;  4O3X B;  3NSG A;  4AZL A;  1MPF A;  5DL6 A;  3PQS A;  4B61 A;  4KRA A;  3HOE A;  1ZHT A;  1ZHX A;  2M06 A;  5GV0 A;  1MM5 A;  4U9C A;  1ZHW A;  4O4U A;  2KDY A;  3VZW X;  1GFQ A;  1HXT A;  4LSF A;  4D64 A;  3LK3 B;  4FZL A;  3T20 A;  1PHO A;  3TZG A;  3C5O A;  1MM4 A;  5PRN A;  3LK3 A;  2Y0K A;  4PUX A;  3LK4 2;  2N2L A;  2GE4 A;  1QJP A;  3QRC A;  4GF4 A;  4AUI A;  3VE1 A;  3AAA B;  2LFU A;  4O3Y A;  2MNH A;  3AAA A;  1QJ9 A;  2J4U P;  1GFM A;  4GCP A;  4FRX A;  4FSO A;  4Z3T A;  1GFP A;  5DL7 A;  5EE2 A;  3UAQ A;  4AYN A;  4FOZ A;  4BUM X;  2MHL A;  3RBH A;  4AYI D;  2W80 C;  1YS5 A;  2FGQ X;  3SY9 A;  2OMF A;  4JFB A;  2KZ7 B;  4KR4 A;  5D5D A;  1QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...