3O0EA

Crystal structure of ompf in complex with colicin peptide obs1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane porin 1a (Ia;b;F)
publication title Directed epitope delivery across the Escherichia coli outer membrane through the porin OmpF.
pubmed doi rcsb
molecule tags Membrane protein
total genus 99
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3o0eA00
1MPFA 4LSEA 4GCQA 2XG6A 5FVNA 3POQA 3SZVA 2PRNA 6PRNA 4RJWA 8PRNA 2FGRA 1HXUA 2ODJA 1GFMA 4KRAA 3VZWX 2J4UP 3SYSA 2ZFGA 1HXXA 2PORA 3PORA 4BUMX 2XE1A 4GCSA 3EMNX 2XE3A 3HWBA 1GFOA 2O4VA 3T20A 5DL8A 4FRXA 2XE5A 4FMSA 3K19A 3WI5A 3WI4A 4D65A 4FSOA 4FT6A 4FRTA 4C69X 2OMFA 3FYXA 3A2SX 3VY8X 3SY9A 3VZTX 3VY9X 3SYBA 1GFPA 4D5UA 1GFNA 3O0EA 3POXA 3POUA 2Y2XA 1OSMA 4LSFA 3UU2A 5DL7A 2Y0HA 7PRNA 1H6S1 4AUIA 5PRNA 4RJXA 4LSHA 3JTYA 4KR8A 4FSPA 4JFBA 1PHOA 1BT9A 4GCPA 1OPFA 3T24A 2QTKA 1E54A 2FGQX 3SZDA 3VZUX 2ZLDA 2Y0KA 5DL6A 4LSIA 2Y0LA 3UPGA 3T0SA 2J1NA 3SY7A 3NSGA 5DL5A 1BH3A 1GFQA 1PRNA 4FOZA 5JDPA 3PRNA 2K4TA 3HW9A 1HXTA 2XE2A 4KR4A 4D64A
chains in the Genus database with same CATH superfamily
1MPFA 1ZHWA 3LK42 4LSEA 4GCQA 2W81C 2XG6A 1MM4A 2M06A 2R4LA 5FVNA 4JCHA 4E1TA 4N74A 4Z3TA 5IYUA 3DWNA 3POQA 1IZNB 3AAEB 2LHFA 3SZVA 2WJRA 2PRNA 5TISO 2YPVA 2X27X 6PRNA 4RJWA 5G39A 4O3WA 2FGRA 8PRNA 1HXUA 2MNHA 3DWOX 2ODJA 1GFMA 2YNKA 3RBHA 3HOLA 2LFUA 3VE2A 4KRAA 3AA1A 3VZWX 2J4UP 4XNLA 3TZGA 3SYSA 2ZFGA 1HXXA 3G7GA 2PORA 4C00A 4AZLA 3PORA 1QJPA 4D5UA 4F4BA 2KXPA 2XMXA 3DA4A 2KDYA 4BUMX 2XE1A 4AKRA 4IL6O 5ADXK 1YS5A 4GCSA 1IZNA 3EMNX 2XTQA 3AAEA 2XTRA 3DZMA 2KXPB 1QJ8A 2XE3A 3HWBA 3HOEA 3LK41 5AFUK 4AKRB 2N2MA 5GTHO 1T1LA 1GFOA 2ERVA 2R88A 4AYEC 2O4VA 3T20A 1T16A 4UB6O 2X9KA 4FRXA 5DL8A 3JCUO 4UB8O 4AKMA 5D5DA 4C4VB 1QJ9A 2XE5A 3LK3A 1ORMA 3BRYA 3PGUA 4GHBA 4AYNA 1Q9GA 4FMSA 4FZNA 3K19A 3WI5A 4U9CA 2R8AA 5G38A 3WI4A 4D65A 4FSOA 1BXWA 2JQYA 4FT6A 4FRTA 3LK3B 4CTDA 4K3BA 3A0BO 1S5LO 4O4XA 4C69X 4PR7A 2OMFA 3FYXA 3PQSA 3A2SX 1G90A 4O3ZA 3VY8X 3BRZA 3SY9A 3VZTX 3NJTA 4O3YA 3SYBA 3VY9X 1GFPA 1ZHTA 4FESA 1GFNA 4O4UA 3LK2B 3O0EA 3POXA 2GE4A 2R4OA 5G3AA 3AA7B 3DA3A 4G75A 3POUA 5KAFO 4G76A 2M07A 4AYDC 4E1SA 2KZ7B 2Y2XA 4O49A 1OSMA 4LSFA 4C4VA 4O3XB 4PJ0O 2F1VA 3PGRA 3UU2A 3UAQA 5DL7A 5GV0A 2Y0HA 3C5OA 7PRNA 4FUVA 2MHLA 1H6S1 3AA6B 4RLBA 3V8UA 4AUIA 5PRNA 1Q9FA 2R89A 1ZHZA 4LSHA 4RJXA 3JTYA 4FQEA 4KR8A 5B5EO 3WU2O 1MM5A 2K0LA 4FSPA 2Y7SA 4JFBA 1PHOA 2JMMA 1BT9A 2N2LA 4K3CA 5H2FO 4GCPA 1OPFA 2R4NA 3T24A 5E79O 4AFKA 3LK2A 2KC0A 3AA7A 3KVDD 5B66O 2IWWA 4RLCA 3BS0A 2KZ7A 2R4PA 1THQA 2QTKA 5G26A 1E54A 1ZHXA 2WJQA 2AXTO 2FGQX 3PF1A 4AYMC 1ZHYA 3SZDA 3VZUX 4AYID 2ZLDA 2W80C 4GF4A 2Y0KA 2F1TA 3AA0A 3AAAA 3GP6A 4FZMA 5DL6A 4RL9A 4LSIA 3AA6A 2IWVA 2Y0LA 5T5FA 5EE2A 4FZLA 3UPGA 4B61A 3T0SA 3AA0B 2J1NA 3AAAB 3KZIO 3VE1A 3QRCA 5ADXL 3SY7A 4PUXA 3NSGA 5DL5A 2F1CX 1BH3A 4N58A 4QQ1A 3PQUA 5GTIO 1GFQA 1P4TA 1PRNA 2WVPA 5KAIO 4FOZA 5AFUL 5JDPA 3PGSA 3PRNA 4XNKA 2K4TA 3AA1B 3HW9A 3QRAA 1HXTA 4N59A 2XE2A 3A0HO 4KR4A 4D64A 4N75A
chains in the Genus database with same CATH topology
1MPFA 1ZHWA 3LK42 4LSEA 4GCQA 2W81C 2XG6A 1MM4A 2M06A 5FVNA 4JCHA 4E1TA 4Z3TA 5IYUA 3POQA 1IZNB 3AAEB 2LHFA 3SZVA 2PRNA 2YPVA 2X27X 6PRNA 4RJWA 8PRNA 4O3WA 2FGRA 1HXUA 2MNHA 2ODJA 1GFMA 2YNKA 3RBHA 3HOLA 2LFUA 4KRAA 3AA1A 3VZWX 2J4UP 4XNLA 3TZGA 3SYSA 2ZFGA 1HXXA 3G7GA 2PORA 4AZLA 3PORA 1QJPA 4D5UA 4F4BA 2KXPA 2XMXA 3DA4A 2KDYA 4BUMX 2XE1A 4AKRA 5ADXK 1YS5A 4GCSA 1IZNA 3EMNX 2XTQA 3AAEA 2XTRA 2KXPB 1QJ8A 2XE3A 3HWBA 3HOEA 3LK41 5AFUK 4AKRB 2N2MA 1GFOA 2ERVA 4AYEC 2O4VA 3T20A 5DL8A 4FRXA 4AKMA 5D5DA 1QJ9A 2XE5A 3LK3A 1ORMA 4GHBA 4AYNA 1Q9GA 4FMSA 4FZNA 3K19A 3WI5A 4U9CA 3WI4A 4D65A 4FSOA 1BXWA 4FT6A 4FRTA 3LK3B 4O4XA 4C69X 2OMFA 3FYXA 3PQSA 3A2SX 1G90A 4O3ZA 3VY8X 3SY9A 3VZTX 4O3YA 3SYBA 3VY9X 1GFPA 1ZHTA 4FESA 1GFNA 4O4UA 3LK2B 3O0EA 3POXA 2GE4A 3VE2A 3AA7B 3DA3A 4G75A 3POUA 4AYDC 4G76A 2M07A 4E1SA 2KZ7B 2Y2XA 4O49A 1OSMA 4LSFA 4O3XB 2F1VA 3UU2A 3UAQA 5DL7A 5GV0A 2Y0HA 3C5OA 7PRNA 4FUVA 2MHLA 1H6S1 3AA6B 4RLBA 3V8UA 4AUIA 5PRNA 1Q9FA 4RJXA 1ZHZA 4LSHA 3JTYA 4KR8A 1MM5A 2K0LA 4FSPA 2Y7SA 4JFBA 1PHOA 2JMMA 1BT9A 2N2LA 4GCPA 1OPFA 3T24A 4AFKA 3LK2A 2KC0A 3AA7A 3KVDD 4RLCA 2KZ7A 1THQA 2QTKA 5G26A 1E54A 1ZHXA 4AYMC 2FGQX 1ZHYA 3SZDA 3VZUX 4AYID 2ZLDA 2W80C 4GF4A 2Y0KA 2F1TA 3AA0A 3AAAA 3GP6A 4FZMA 5DL6A 4RL9A 4LSIA 3AA6A 2Y0LA 5T5FA 5EE2A 3UPGA 4B61A 3T0SA 3AA0B 2J1NA 3AAAB 3VE1A 3QRCA 5ADXL 3SY7A 4PUXA 3NSGA 5DL5A 4N58A 1BH3A 4QQ1A 3PQUA 1GFQA 1P4TA 1PRNA 5AFUL 4FOZA 5JDPA 3PRNA 4XNKA 2K4TA 3AA1B 3HW9A 3QRAA 1HXTA 4N59A 2XE2A 4FZLA 4KR4A 4D64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPF A;  4LSE A;  4GCQ A;  2XG6 A;  5FVN A;  3POQ A;  3SZV A;  2PRN A;  6PRN A;  4RJW A;  8PRN A;  2FGR A;  1HXU A;  2ODJ A;  1GFM A;  4KRA A;  3VZW X;  2J4U P;  3SYS A;  2ZFG A;  1HXX A;  2POR A;  3POR A;  4BUM X;  2XE1 A;  4GCS A;  3EMN X;  2XE3 A;  3HWB A;  1GFO A;  2O4V A;  3T20 A;  5DL8 A;  4FRX A;  2XE5 A;  4FMS A;  3K19 A;  3WI5 A;  3WI4 A;  4D65 A;  4FSO A;  4FT6 A;  4FRT A;  4C69 X;  2OMF A;  3FYX A;  3A2S X;  3VY8 X;  3SY9 A;  3VZT X;  3VY9 X;  3SYB A;  1GFP A;  4D5U A;  1GFN A;  3O0E A;  3POX A;  3POU A;  2Y2X A;  1OSM A;  4LSF A;  3UU2 A;  5DL7 A;  2Y0H A;  7PRN A;  1H6S 1;  4AUI A;  5PRN A;  4RJX A;  4LSH A;  3JTY A;  4KR8 A;  4FSP A;  4JFB A;  1PHO A;  1BT9 A;  4GCP A;  1OPF A;  3T24 A;  2QTK A;  1E54 A;  2FGQ X;  3SZD A;  3VZU X;  2ZLD A;  2Y0K A;  5DL6 A;  4LSI A;  2Y0L A;  3UPG A;  3T0S A;  2J1N A;  3SY7 A;  3NSG A;  5DL5 A;  1BH3 A;  1GFQ A;  1PRN A;  4FOZ A;  5JDP A;  3PRN A;  2K4T A;  3HW9 A;  1HXT A;  2XE2 A;  4KR4 A;  4D64 A; 
#chains in the Genus database with same CATH topology
 1MPF A;  1ZHW A;  3LK4 2;  4LSE A;  4GCQ A;  2W81 C;  2XG6 A;  1MM4 A;  2M06 A;  2R4L A;  5FVN A;  4JCH A;  4E1T A;  4N74 A;  4Z3T A;  5IYU A;  3DWN A;  3POQ A;  1IZN B;  3AAE B;  2LHF A;  3SZV A;  2WJR A;  2PRN A;  5TIS O;  2YPV A;  2X27 X;  6PRN A;  4RJW A;  5G39 A;  4O3W A;  2FGR A;  8PRN A;  1HXU A;  2MNH A;  3DWO X;  2ODJ A;  1GFM A;  2YNK A;  3RBH A;  3HOL A;  2LFU A;  3VE2 A;  4KRA A;  3AA1 A;  3VZW X;  2J4U P;  4XNL A;  3TZG A;  3SYS A;  2ZFG A;  1HXX A;  3G7G A;  2POR A;  4C00 A;  4AZL A;  3POR A;  1QJP A;  4D5U A;  4F4B A;  2KXP A;  2XMX A;  3DA4 A;  2KDY A;  4BUM X;  2XE1 A;  4AKR A;  4IL6 O;  5ADX K;  1YS5 A;  4GCS A;  1IZN A;  3EMN X;  2XTQ A;  3AAE A;  2XTR A;  3DZM A;  2KXP B;  1QJ8 A;  2XE3 A;  3HWB A;  3HOE A;  3LK4 1;  5AFU K;  4AKR B;  2N2M A;  5GTH O;  1T1L A;  1GFO A;  2ERV A;  2R88 A;  4AYE C;  2O4V A;  3T20 A;  1T16 A;  4UB6 O;  2X9K A;  4FRX A;  5DL8 A;  3JCU O;  4UB8 O;  4AKM A;  5D5D A;  4C4V B;  1QJ9 A;  2XE5 A;  3LK3 A;  1ORM A;  3BRY A;  3PGU A;  4GHB A;  4AYN A;  1Q9G A;  4FMS A;  4FZN A;  3K19 A;  3WI5 A;  4U9C A;  2R8A A;  5G38 A;  3WI4 A;  4D65 A;  4FSO A;  1BXW A;  2JQY A;  4FT6 A;  4FRT A;  3LK3 B;  4CTD A;  4K3B A;  3A0B O;  1S5L O;  4O4X A;  4C69 X;  4PR7 A;  2OMF A;  3FYX A;  3PQS A;  3A2S X;  1G90 A;  4O3Z A;  3VY8 X;  3BRZ A;  3SY9 A;  3VZT X;  3NJT A;  4O3Y A;  3SYB A;  3VY9 X;  1GFP A;  1ZHT A;  4FES A;  1GFN A;  4O4U A;  3LK2 B;  3O0E A;  3POX A;  2GE4 A;  2R4O A;  5G3A A;  3AA7 B;  3DA3 A;  4G75 A;  3POU A;  5KAF O;  4G76 A;  2M07 A;  4AYD C;  4E1S A;  2KZ7 B;  2Y2X A;  4O49 A;  1OSM A;  4LSF A;  4C4V A;  4O3X B;  4PJ0 O;  2F1V A;  3PGR A;  3UU2 A;  3UAQ A;  5DL7 A;  5GV0 A;  2Y0H A;  3C5O A;  7PRN A;  4FUV A;  2MHL A;  1H6S 1;  3AA6 B;  4RLB A;  3V8U A;  4AUI A;  5PRN A;  1Q9F A;  2R89 A;  1ZHZ A;  4LSH A;  4RJX A;  3JTY A;  4FQE A;  4KR8 A;  5B5E O;  3WU2 O;  1MM5 A;  2K0L A;  4FSP A;  2Y7S A;  4JFB A;  1PHO A;  2JMM A;  1BT9 A;  2N2L A;  4K3C A;  5H2F O;  4GCP A;  1OPF A;  2R4N A;  3T24 A;  5E79 O;  4AFK A;  3LK2 A;  2KC0 A;  3AA7 A;  3KVD D;  5B66 O;  2IWW A;  4RLC A;  3BS0 A;  2KZ7 A;  2R4P A;  1THQ A;  2QTK A;  5G26 A;  1E54 A;  1ZHX A;  2WJQ A;  2AXT O;  2FGQ X;  3PF1 A;  4AYM C;  1ZHY A;  3SZD A;  3VZU X;  4AYI D;  2ZLD A;  2W80 C;  4GF4 A;  2Y0K A;  2F1T A;  3AA0 A;  3AAA A;  3GP6 A;  4FZM A;  5DL6 A;  4RL9 A;  4LSI A;  3AA6 A;  2IWV A;  2Y0L A;  5T5F A;  5EE2 A;  4FZL A;  3UPG A;  4B61 A;  3T0S A;  3AA0 B;  2J1N A;  3AAA B;  3KZI O;  3VE1 A;  3QRC A;  5ADX L;  3SY7 A;  4PUX A;  3NSG A;  5DL5 A;  2F1C X;  1BH3 A;  4N58 A;  4QQ1 A;  3PQU A;  5GTI O;  1GFQ A;  1P4T A;  1PRN A;  2WVP A;  5KAI O;  4FOZ A;  5AFU L;  5JDP A;  3PGS A;  3PRN A;  4XNK A;  2K4T A;  3AA1 B;  3HW9 A;  3QRA A;  1HXT A;  4N59 A;  2XE2 A;  3A0H O;  4KR4 A;  4D64 A;  4N75 A; 
#chains in the Genus database with same CATH homology
 1MPF A;  1ZHW A;  3LK4 2;  4LSE A;  4GCQ A;  2W81 C;  2XG6 A;  1MM4 A;  2M06 A;  5FVN A;  4JCH A;  4E1T A;  4Z3T A;  5IYU A;  3POQ A;  1IZN B;  3AAE B;  2LHF A;  3SZV A;  2PRN A;  2YPV A;  2X27 X;  6PRN A;  4RJW A;  8PRN A;  4O3W A;  2FGR A;  1HXU A;  2MNH A;  2ODJ A;  1GFM A;  2YNK A;  3RBH A;  3HOL A;  2LFU A;  4KRA A;  3AA1 A;  3VZW X;  2J4U P;  4XNL A;  3TZG A;  3SYS A;  2ZFG A;  1HXX A;  3G7G A;  2POR A;  4AZL A;  3POR A;  1QJP A;  4D5U A;  4F4B A;  2KXP A;  2XMX A;  3DA4 A;  2KDY A;  4BUM X;  2XE1 A;  4AKR A;  5ADX K;  1YS5 A;  4GCS A;  1IZN A;  3EMN X;  2XTQ A;  3AAE A;  2XTR A;  2KXP B;  1QJ8 A;  2XE3 A;  3HWB A;  3HOE A;  3LK4 1;  5AFU K;  4AKR B;  2N2M A;  1GFO A;  2ERV A;  4AYE C;  2O4V A;  3T20 A;  5DL8 A;  4FRX A;  4AKM A;  5D5D A;  1QJ9 A;  2XE5 A;  3LK3 A;  1ORM A;  4GHB A;  4AYN A;  1Q9G A;  4FMS A;  4FZN A;  3K19 A;  3WI5 A;  4U9C A;  3WI4 A;  4D65 A;  4FSO A;  1BXW A;  4FT6 A;  4FRT A;  3LK3 B;  4O4X A;  4C69 X;  2OMF A;  3FYX A;  3PQS A;  3A2S X;  1G90 A;  4O3Z A;  3VY8 X;  3SY9 A;  3VZT X;  4O3Y A;  3SYB A;  3VY9 X;  1GFP A;  1ZHT A;  4FES A;  1GFN A;  4O4U A;  3LK2 B;  3O0E A;  3POX A;  2GE4 A;  3VE2 A;  3AA7 B;  3DA3 A;  4G75 A;  3POU A;  4AYD C;  4G76 A;  2M07 A;  4E1S A;  2KZ7 B;  2Y2X A;  4O49 A;  1OSM A;  4LSF A;  4O3X B;  2F1V A;  3UU2 A;  3UAQ A;  5DL7 A;  5GV0 A;  2Y0H A;  3C5O A;  7PRN A;  4FUV A;  2MHL A;  1H6S 1;  3AA6 B;  4RLB A;  3V8U A;  4AUI A;  5PRN A;  1Q9F A;  4RJX A;  1ZHZ A;  4LSH A;  3JTY A;  4KR8 A;  1MM5 A;  2K0L A;  4FSP A;  2Y7S A;  4JFB A;  1PHO A;  2JMM A;  1BT9 A;  2N2L A;  4GCP A;  1OPF A;  3T24 A;  4AFK A;  3LK2 A;  2KC0 A;  3AA7 A;  3KVD D;  4RLC A;  2KZ7 A;  1THQ A;  2QTK A;  5G26 A;  1E54 A;  1ZHX A;  4AYM C;  2FGQ X;  1ZHY A;  3SZD A;  3VZU X;  4AYI D;  2ZLD A;  2W80 C;  4GF4 A;  2Y0K A;  2F1T A;  3AA0 A;  3AAA A;  3GP6 A;  4FZM A;  5DL6 A;  4RL9 A;  4LSI A;  3AA6 A;  2Y0L A;  5T5F A;  5EE2 A;  3UPG A;  4B61 A;  3T0S A;  3AA0 B;  2J1N A;  3AAA B;  3VE1 A;  3QRC A;  5ADX L;  3SY7 A;  4PUX A;  3NSG A;  5DL5 A;  4N58 A;  1BH3 A;  4QQ1 A;  3PQU A;  1GFQ A;  1P4T A;  1PRN A;  5AFU L;  4FOZ A;  5JDP A;  3PRN A;  4XNK A;  2K4T A;  3AA1 B;  3HW9 A;  3QRA A;  1HXT A;  4N59 A;  2XE2 A;  4FZL A;  4KR4 A;  4D64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...