3O0RH

Crystal structure of nitric oxide reductase from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
EVQLQQSGTVLARPGASVKMSCKASGYSFTSYWMHWVKQRPGQGLEWIGAVYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCSRSSLDGYYVKNWCFDVWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTRPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/oxidoreductase
molecule keywords antibody fab fragment light chain
publication title Structural basis of biological N2O generation by bacterial nitric oxide reductase
pubmed doi rcsb
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o0rH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o0rH02
1KT2B 4LCWB 4HX1A 2IG2H 3WJJC 4G9FD 3TM6A 4ZDHA 4RFNB 3INUL 2A38A 2NZ9D 4KK6D 1G7IA 5CFHA 2AS5M 2VXQL 1CT8B 4MNGB 5BS0E 4GW1B 3VRIB 1A21A 3KPNA 3NIFE 4P4KC 4MVBD 3QHTC 2VWEC 5ID1B 5F1OB 5GGUA 5IEHB 1ZANL 5TF1H 5IOPA 4J3TA 3V6ZA 1A9EA 2IPTL 3L6FA 5DO2C 2BVUA 4KKNA 2JB6A 3OB8A 4TSAL 4FQXC 3TT3L 1FO0L 1U8LA 3OAUL 1D5IH 4QF1A 2EDLA 2H41A 4QHUA 1IL1A 4PB0L 2R4SH 1DBMH 4GBXD 3QDME 1RJYB 3H9SB 5BV7C 4KROD 2XKNA 4Q0XH 5E2TL 3QDJE 2FLBT 4G8GE 3RL1B 4NP4H 2VAJA 3QUZA 5HI5C 3ZDZE 1G7IB 2YN3A 4N0YL 3S88H 3VFNA 1YYLL 2XQYK 3KPNB 1QRND 2I60L 2JB5L 5MENE 3IFOB 1Z6JT 2FEDD 5GGUB 4B5EA 1N5YL 3LH2L 5DJCA 2E9WA 5DA0B 5IOPB 1A9EB 2EXWD 3L6FB 4KQ3H 1INQA 2CUMA 3HNTH 1VGKB 6FABH 1A6ZB 1HSBA 4NQTA 3GHBL 3EO1B 1HHHB 4LLQA 1F97A 4KJPD 1TLKA 3CMOL 5E6ZA 3LKRA 4S2SA 1WUNT 4H0GA 2Q86B 4R8WH 1MCKA 1ADQL 4Y4HA 5TE7H 5H8DA 2FBOJ 4JKKA 1AXSA 4HQQH 4D3CL 3V7AG 5C0BD 4QY8A 1YMHA 1KUMA 3C5JA 4OBSA 5BOZG 3LKPA 3QUZB 4XP9H 4D0CA 2ZSVB 5DMYA 3ARBA 4LIQE 5DVLA 1P53A 3HMXH 4P3DB 1AGFB 1Y6MR 1HQRB 4KRPB 4OZHF 5T3XH 3V6OC 1SYSB 3IDNA 3V2AR 3ZL4L 1MVUA 4MQSB 1HSBB 2PETA 1RZIB 1V7ML 2F8VA 4X9BA 4BKLB 3NN8A 3QRFM 2J8OA 1LNUA 1UQSA 1P2CA 3BN9D 1NCBL 4ONHA 4OLWH 4S1SH 4PJ5A 1RULL 3B9AA 4RZCB 4UNVA 1PG7X 2HP4A 3V4UH 3FO1B 4ZXBA 3OKOA 4N8CL 3LKPB 5A2KH 2NXZB 3RVUD 5F1NB 5IHBA 2UYLA 4KGLA 4U3XA 4Y1AE 3IXTA 3E8UL 5IWLC 1MFDL 3F65A 1MOEA 1Q0XH 1U58A 3IDNB 2KZ1B 4NGHL 3ARGD 4LRNL 2DQHH 4HDIB 2FLRT 4O51A 4GXVH 1A4JB 1UXWB 5D1ZA 2JJTA 3BWAA 4IIQC 4PJ5B 5ESQA 5C3LD 4LCCA 2H9GA 1NAML 1DBAH 2R0LL 1UJ3B 2BNQB 4PTTA 4ZFFA 2VE6A 3QQ4B 5GRJH 4ZXBB 1G9MC 4GW5B 5ILTH 3MRRA 1G0DA 5JDJA 4M3JA 12E8L 2FJFA 3SDDA 1DANU 2NY4B 3RGVA 2IGFH 4L9LC 3T0EC 3NACL 3ZE2F 1FLTX 2UYLB 2AABH 5GIRA 4OD3H 1QSZA 3IXTB 4ZPVB 4YC2C 3WFZA 3FO2B 1Z0MA 4PR5B 3MREA 1U58B 4DZBB 3T0XA 5GSVB 1OF2A 3O4OB 4ENEC 5E70A 4H5SB 4BJLA 4OGXL 4O51B 4R97B 3E6FA 4N1HB 4PD4J 3FQTB 4LCCB 1IQDA 2H9GB 5C6PB 1FL3B 2WSKA 4ZFFB 4KJYB 2EKSA 1OP3H 5EU6E 3O9WA 4U7SA 5E9DE 3MRRB 5DSCB 3F7QA 1G6VK 2X4QB 3QHFH 5EBLA 4XBGB 3FT2A 4Y2OA 5D5MB 1ZTXL 4DZ8A 2XTJE 2HFFA 3RKDD 3SY0B 5I1CH 4JB9H 5F9JA 1N5AA 2E8YA 2PNDA 1W0YT 4WEBL 3SJVE 1IRAY 4EN3A 4XCCL 1VFMA 2DWDA 4R0LC 3VFOB 2NR6D 3I75B 3N06B 4UIMA 4F7EA 4MD0A 1NL0H 3MC0A 4XBPA 4C58B 4XTRC 5JZ7D 4E0RA 1YPZA 4XAKE 3NFPA 4WGWB 5J7CC 4JRXD 4BZ1L 1MJ8L 2EKSB 2R39A 2XN9A 4KY1L 4N0RA 3IXAA 2L7JA 3S96A 5CEXA 3U7WL 3HNVL 4OGYH 5IV2A 1CI5A 1UB5B 4XHJD 2J3SA 2R2BB 4H26A 4OLVL 2CRMA 1FV1A 1JRHL 5DRWA 4DZ8B 4D0DA 1OARL 2J6EA 1B2WL 4K7PY 5E6IA 4MA7L 3QPXL 3M8OL 5KSUA 3DI3B 1UXSB 5IB5B 2NY6C 2LQRA 5ABDE 5JW5A 5C8JA 4WDIB 1UB6B 3W5NA 4F57H 3WS3A 4OZHA 2V5RA 3MUY1 2BY3A 3WNNA 1CK0L 4MXVF 2Y6SC 2JK5B 1RURL 3CD4A 3ULUD 3DLQR 2XN9B 3DRTA 4M93C 1G0YR 4LLUA 3S96B 4O5LL 4MDIA 4D9RE 3SN6N 3DXAB 1J05B 2F19L 4PJBB 1FCGA 5IIEA 4PJ7B 1XCTB 4NQDB 1HOCB 3C6SA 1UH4A 1E28A 4X5LA 2ICCA 3NZHH 4XVTL 2I9TB 1T0MB 2E6PA 1MY5A 5IQ9A 1FGNL 4YHZL 5C8JB 3B2UD 1YC7A 1QFUL 3ARZA 5LGKA 3ZKND 5SWZE 1LK3L 2P8PA 1WAAA 1KN4L 3PL6D 2WM0A 5C9JB 1XR8B 4NO3B 5E8PB 1IEAA 4Y19D 2BXZA 5CEZD 2PTVA 1CFSB 3OB0K 4U1SB 4P5TD 1MHCB 3JWDH 4RGMC 1UWEH 2XFXB 1F4WL 2NY1D 1CU4H 1I8IA 1KV3A 4J6RH 3KPQA 2BDNH 5SWSD 4Z5RB 1E28B 3GKWL 3SDAA 5AYQA 4IJ3B 1CL7H 3OR7B 4KH2A 3P0VL 3HG1D 5D2LA 4ZYKA 4PRIE 4ONOA 4EI5A 1C1EH 1I1AD 1BM3H 3BKJH 4LSPL 1DBKL 2P5WB 2IQAA 5EU7C 4EKXA 2OSLA 4KI5C 3TFKC 3GSWA 1JGLH 3GSUA 1BF8A 1N0XL 4A6YA 3REWB 2AW2A 3GKZA 4NJAH 3CFIC 2AXJA 4N9OB 5F7NC 3BP7A 3CLEH 3D39B 1F5WA 5C7XH 3QUZC 4NWTL 5IFHH 1JFQH 3I50H 4JN1H 4Q2ZA 3OHXB 3O3DA 5JOFA 1FORH 4G3YL 4TYUA 3KPQB 4CGTA 3CVHA 5I15L 3C08H 5F9WB 1UZ8A 2AV7A 4G6FB 4XVUC 3TH2T 5D2LB 1RUQL 4PRAA 1GXEA 4EI5B 4G8FB 3ECBA 3GIVA 5CBAA 1BD2A 2VLRD 4G8IA 2DQDL 4M00A 1CFNA 2A6IA 2KDGA 4M7LH 2J6EH 4D0BA 3CDFA 1HSAA 5J8OA 4BH8B 3VDBA 4Y4HC 3MTRA 2CJUH 4A6YB 1A0QH 4P2YA 4JPKH 1YQVH 5DGQA 4LSSH 5DEFB 4U05A 3JV6A 2WUCH 3VRJB 4JRYD 3SDCA 3O6KH 3WEXB 4OV5A 4Q2ZB 3ARBC 1PSKL 3WXVH 1DVFD 5MP6H 4QEGA 3NA4A 3ILQC 3IDXH 3JUYA 2VZUA 2AV7B 4GQ9L 2GSGA 4PRAB 1YEDA 1EEZB 1QSFA 4ZD3L 4JQIL 5I71B 4UV4H 2FIKB 4ODSH 4XNXH 3EGSB 1BD2B 4G8IB 5J3HC 1FZOB 1GGIH 3C6LA 4KU1A 1CFNB 3STZA 2A6IB 3KG5A 4KKLC 3MNWA 1Q1JL 3QT2A 4LVOC 3S4SB 4XPGH 1AR2A 4M7JL 4YPGA 5FM5M 4ZXBC 3QQ9D 4WFHE 3JV6B 4ODTL 4OV5B 4OCLC 1MWAA 2GIYA 1V8HA 5D1XB 5CGYD 3WD5H 3TT1H 5CP7A 4LSQL 5T3ZL 1JVKA 1A7NH 4AJ0A 4QRQA 1U8KB 3N9GH 3LHPH 3ZHLA 1AD0A 1CD1B 3H7BB 2DQEL 3HS0A 4KKAD 3REVA 4YFLI 2ADIA 5D1ZC 1J87A 2GITB 5TDOB 3C6LB 5MHSE 1AGEA 2JJTC 2B20A 4LCCC 2DLGA 4CDHA 5HHQA 4NNPH 1NUFA 1QFWH 4X7SH 5C0CA 1TVBA 1MFBL 2BSSB 3OSKA 4XI5D 5TGBB 3U1SH 3EYVA 2H2SC 2VITA 3EOBB 1TJGL 3SDDC 1FYTB 2YN5A 3RGVC 4KJQC 3U0TB 3VFSA 5DVNA 2YC1A 4DW2H 3PWPB 1ZHKB 4HH9A 1MPAL 5CP7B 2GK0B 2UZXB 5LVEA 3QI9D 3HE7B 35C8L 4QRQB 2BMKA 3ZHKA 3IAPA 1AD0B 4MAUL 3VXSD 4MA1C 2P48B 3DNKA 2ADIB 3GMPB 1IM9D 3BZEA 3TN0A 5F88B 5DQJB 3JWOL 2LTQB 4NN7C 2E3VA 1J1XH 3RVXD 1JCKA 4HUXB 2OS7A 4M8QA 4OCXL 3K4DA 4CMHC 3G6JE 3O9WC 2DBLH 1L4IA 1MREH 5EBMB 3EYVB 4AIXA 1TDQA 4NYLB 1CDGA 5KSBF 3G08B 3CFCH 4HH9B 2CLZA 4ZTOL 2N1KA 3PV6A 3ZKQD 2QHRH 3FN9A 4G8GB 2BMKB 4ZOBA 2MCG1 3SDYH 2AI0L 3KXFE 1LDPH 4EN3C 3QXWA 1MI5E 2Z4QA 4XPTH 4HIEA 3RZCB 5CP3A 3TN0B 5E8NB 1U95B 2GUOA 2WK2A 2UWEA 2Z35B 3X3FH 1KJ2B 5HVFB 5I8OH 2DL2A 3HPJB 3BP4A 4WY7L 5I1AA 3WLWC 1CD9B 5HPMA 1NMAH 1ZA6B 3HN3A 1B9ZA 5EWIH 1S78C 2VUOA 4X4XA 5GRUH 1FP5A 1HHJA 4MCZA 1QLEH 1ZT1A 2B4CL 2E27L 4L8SB 5E6IC 3TBYB 4R2GB 1P7QB 1ZVYA 2E7LA 1QBLH 3HTLX 1MWAH 4LSRH 4X99A 1CXHA 5E2UH 2P8LA 4UIKL 1AFVH 2DQGL 2I25N 4RMVA 4X9FA 3VDCA 3SO5A 1N3NA 2M2DA 3H7LA 2P24B 2UWEB 3HKFA 4PLKC 5IB1B 4OI7A 3V0AC 1WV7T 4PGCB 3EYFB 3LKSB 1J0YA 1BREA 3L3GA 5GS0C 4U1NB 1FBIH 1T5XA 5F7DA 5GPRA 4AL8H 3ZE0E 3ES6B 1M1SA 5IF0A 1F4YL 3KPRB 4JKPH 3GGWA 1HH9B 1CQYA 3LD8C 1HHJB 4MCZB 3O4LD 1ZS8A 2R2EA 1YNKL 1H5BA 1ZT1B 4PRHE 4F8TA 2H1PH 4TNWF 3LEYH 3BKYH 4WVRA 5FYJD 1HH6B 5AYUL 1PVHA 2VR5A 4CJ0A 5KTEL 2P8LB 4PP2A 3T2NL 4ZPTA 2MSPA 5JXEA 1YEIH 5FGCE 5FA4A 3VFPA 2CDEB 1R6VA 4L9DA 5E99L 1DLHA 1GC1H 4KDTC 3AS1A 2WLZA 1E27B 3FB7A 3MODL 1KGCE 4IM8A 4O58H 5CLWA 1T5WA 3CSGA 1AHWB 4PUBL 5DVKA 3S37X 3SDAC 1XH3A 1UM6L 2O61A 2IH3B 3MLSL 1ZS8B 1KG0B 1H5BB 3BKML 1YJDC 3ARDB 4YGAB 4JGJA 4QTHA 3WSQH 2X2YA 3P4MB 5I1IH 5GGVY 1G7HB 2PYED 1NEZB 3G5ZA 3LDBB 4L4VD 2NXYC 4UB0L 3C60D 3T3MF 2AJVL 3VGAC 4AMKL 1U93B 5HGGS 2DIAA 3VFPB 4FFZH 3F6LA 1F11B 4IOSD 2LU7A 5F89B 4X7FC 5IB3B 1QNZH 4N68A 4MJ6B 1T5WB 4KHXL 1OSPL 2DJSA 2D7TH 2N56A 5HHMD 4HGKC 4JFEE 3H3PH 2X4OB 2JCCF 1CXKA 3ARYA 4HC1L 4QRPA 5EUOE 1FVCB 3KPMB 4Z7UE 1GGCL 3G5XA 1N6QL 5I71C 4CL7A 4FQIL 3DGGB 2XTJB 3G5ZB 5SX5K 1U8NB 1RZKH 5F3BB 4MNHB 4UBDD 2FJGA 4HH8A 3OKDA 5J89A 2OTWB 1AO7D 5IVXB 1ZA3A 3QUML 4AK1A 3ZTNH 1JF1B 2IPKB 1UM5L 2HT3D 1E4XH 3D3VA 3SDCC 5J9PA 1UH2A 5FDWB 5IK3A 3GMLB 4YDLC 3L5JA 5D1QC 3RWCA 2Z91A 2RFXA 2EDTA 5GZOD 3RVWC 3VDAA 5EC1A 1FVEA 1X5IA 2AEQH 4MX7A 3E3QC 3MRFA 4M61A 3WFBL 3NCYS 1Z3GL 3HRZA 3K3QA 3MYJB 5FO7A 2ESVD 4OKVA 4G9FE 4OCSL 3BVNA 4RIRA 5DD0H 4RWYL 3C6LC 1J88A 3C2AL 3CAFA 3MSPA 5JLZB 3OKDB 2JIXA 3D6GA 3PG2A 3L1OH 4NCC1 4YNYA 3U9UB 1ZLUH 1HN1A 1G6RH 4F8QA 4HLZH 3DX8B 1T2JA 1NCTA 5I30L 1OTSC 2BOBA 5IK3B 2GJZB 1H3GA 4X5WB 1JHLH 3TBSA 3U9PH 4NHCH 5FYKL 1G9NH 3B9KB 1LO4H 1LO3L 2PXYB 4YHKH 3WO3B 1I7UB 3D0LA 5EC1B 1F45A 4Q9CA 1X4XA 1HKLH 3SE8L 3UXFA 1MCQA 5FO7B 1XMWA 2W60A 4ZAKA 1YYMH 5ADPH 4EEEA 1CFVL 4LCUA 4RIRB 2ZG3A 1WZ1H 3BIKA 4Z18A 3CH1A 1J1PL 1WBZB 1AP2A 4NFDA 1OAZH 1F90H 5DA4A 4O4YH 4FQQB 1F4HA 2X41A 4FQJL 3D5OF 4JN2B 1QRNE 5D7LD 3FZUD 4PY8J 2YXFA 5GHWH 1OM3H 3JBG7 2FO4A 5SWZB 3WCYA 4OZIF 5BZDA 4MXWL 2VDLL 3ROLA 3P9MA 3HB3C 1DN2A 1FO0A 4Q9QL 2XACC 4XCEB 2W59A 4JM2F 1OSZB 1QPPA 3BO8B 4ZUWB 5D96B 4HK3J 4O02L 4Z7WB 1GC1C 4ZAKB 5M95B 3W0WA 3MUHL 5EU3A 5C0BE 1IGTB 4JDZA 3BIKB 3UTZA 2EDXA 3AROA 3GSXA 4AIOA 3BIBX 1D9KA 5DK0A 4HJ0C 1BLNA 2XA8H 5DD6A 4PJEB 1ZSDB 4MQ7A 1GYAA 5DC0A 2AK1H 2I07A 1CF8H 4R9HA 3TVMD 2HJFB 4YXHH 3SCMB 4HHAA 4AIZB 3MRIB 4CN6A 1MHPL 4U4BA 4LKCB 3ROLB 3VWJA 2J8UA 1RUAL 1FO0B 1C5DB 5C0GA 5FO9A 4AEIL 3GI9L 3QH3B 4ZUTB 2K7PA 4YHML 3P30H 1ADQA 1A8JH 3WNOA 3W0WB 3DRQB 1W8NA 5EU3B 2JCCA 4WUUE 1C5CL 1FG9C 5DQDL 5E24E 3BYYA 3LKNA 2X6MA 2EC9T 4K71B 3MOBH 2VERN 4YXKH 2VLJD 1I8KB 3ULVD 4C83B 2VQ1A 1MEXH 1F3JA 1Y18B 4U0RC 1A7QH 43C9A 3ARFC 3KAAA 4X80H 4OCWL 1JPGB 4BK5A 1S7RA 2H6PA 4HIJA 4IOIB 3IF1A 4G7VH 3VWJB 1ZT7A 1WVZA 3LKQA 4IDLA 1RZKC 4XGZA 5C0GB 1ZLVH 3W2DH 5FO9B 5B4MC 5LBSL 2E7LC 1N59A 3LRSB 4NUGL 4CUCA 1XGTA 3TIDB 1ND0B 1I9JH 3JV4A 3A6OA 2ZPKL 2VKXA 4PRPD 5C0EA 4ZFOL 3H9HA 1A7OL 3DSFL 5D7IB 1FZJB 5EU5A 1KJMA 4Z7VF 1J0KA 2ZCHL 4K23L 1P69B 2DQIH 1RIVH 3KLHC 4MYWB 3RRQA 3SE9H 1KCVH 2H6PB 2AJUL 3IF1B 3RUGE 5T1MB 4WHCA 5IB2B 4ONGH 1DQML 3BGFC 3L3HB 1N59B 4PJGE 1O5DT 1YY9C 1VACB 3KR3H 4H1LG 4B7LA 4OFPA 1NAMA 1MF2H 1HCFX 4LCIL 1IGCL 1S7UA 1UEMA 2BZDA 2WWMD 3D69B 1NFDE 4LCYB 5JXEC 1MCSA 1NPUA 5C0EB 3WHE1 4QHKI 5DYOA 4K9EL 3QIUD 3X3GH 4UUJA 2P46B 1N64L 5EU5B 1Y6NR 5BQ7A 1CFQB 2A0LD 3RVVC 4H1LB 3EO9H 1U91A 5EZLB 3V9FA 1I8MB 2QSTA 1KACB 3UJIL 1AI1H 4PD4K 4XP4L 1KJVA 1L9NA 1BGXL 5CKAA 2BY1A 1G7PA 4OZIA 4NN6B 2WBJB 5FUZL 2R2CA 4XC1L 3I6LD 1NAMB 4AENB 3SQOL 4MA8H 4JRXE 5L2KD 2X4PA 3BPCA 2PYFA 5EU4A 2FATL 5GS2D 3VMOA 5I6XB 3FMGH 2HN7A 3IU4L 1CD8A 2P47B 3CPLA 1CVSC 1N2RB 5ICZB 4MJIA 1IAKB 2NY2B 1L0XA 3EJYD 3P0GB 4U0QB 4MNQD 4BSVB 3EYQD 1WWBX 3ZTJG 2QJDA 4PREA 3NPSB 4YBQC 4ZSOE 5AZ2L 4AH2B 4ZNCD 4GRWF 1AE6H 3U0PA 1R24B 2QADB 3G6JB 3MLRH 2D3VA 1G7PB 3K81A 1I1CA 1SVZA 5GJTL 1SYVA 3T1WA 5JA9A 5F6HI 2ERJC 3MLWH 1MCOH 2DI8A 3ULUE 2GJJA 4HJGB 2HT4C 4MQXC 1AKJA 5EU4B 3VXQA 4PJCB 1H0DA 3IDIA 3Q5TA 3QCVL 2HN7B 1PX3A 1OTTD 3TLRA 2AK4A 4ZG1A 2HKFL 3HZMA 5FA3A 4UI2A 4RQQB 3ZKMC 4M9PA 4JFZH 2VZVA 4KKBD 1FZMA 1JNHA 3DTXA 4CVXB 5KOVC 4G5ZL 4WWKD 1TIUA 4UT7H 4HPYL 4C56D 1MJUL 3GB7B 3O6FA 4W6YB 2A73B 5EOCH 1AIFA 4M7ZC 5DHVB 3VW3H 1ONQA 3BOVA 1D5XB 3EYOA 1OOAA 3KWWA 5C1MB 2MKWA 1T0NB 4PRBA 1G7QA 4YWGH 5DRXA 3EZJB 2EZ0D 5DTFA 4Z7QF 4Y19E 5CEZE 1Q9KA 3L5WB 1AKJB 4ODXA 3QDGD 4NQEB 2EXYC 4XXCA 3ORJA 3TZVD 3CJJA 4ZQKB 3UYRH 3BH9B 5ISZA 2WIIA 1EDQA 2F58H 2WMPA 4KMLB 5F7EL 3S98A 4XCFL 5FA3B 5SWSE 3T65A 4DUXA 1AR1C 5EULV 4E5XB 2ZJSL 1MCJA 2PW1B 3LQAH 5D5MF 1FZMB 3GNML 3DTXB 3HG1E 1QD0A 3SPVA 3U2SB 3PHOA 4HEME 1JGUH 1TENA 2WP3O 4JZJA 2DM7A 1RHFA 3L7FB 4RISH 5J11B 3F58L 4PRBB 2B0SH 5IEKB 1BOGA 4ZAKC 4V2CB 1JNLL 1AD9A 3PF2A 1RZ7H 5HDBF 4ODXB 3H3BC 4J1UB 5IMMA 1JIBA 4K3EH 4PJ9D 5DLML 5JHDB 4GAFB 3KNBB 1KC5L 5DUML 3PGFH 4A2LA 1TTGA 5DFTA 4HBQA 2XNAB 3MV7B 4Q9RH 3HR5B 3SDXB 1F3RB 4M62L 3E2HB 3T3PF 1JK8B 3OAZH 4XCNB 1A3RL 1ITBB 2V2WB 2C26A 4NZRL 4RMRA 4D8PA 1Z0NA 3D2UA 2VLRE 1I75A 4DWHA 4NKIL 1YEJH 3SOBL 3UDWC 5BVPL 2IFGA 1FIGH 4BSJA 4N9GA 1WFTA 1BZ7A 4JO3H 5T1KB 1RUMH 1A64A 1BOGB 5ECJE 4ODUA 4Y5YB 2AEPL 1AQKL 1GIGH 2N4IA 1G7JB 2AJXL 4RGNB 2FL5A 5IMMB 3CDGB 4JRYE 4K71C 1INEH 1D9KC 3QWRA 2J4WH 1RK0A 1RZFH 4IRSA 4JANA 4LGRB 3QNXA 1CBVL 4PJ7F 3JTTA 5D7JA 1T80A 4S1QL 4OIAA 1RZJH 3UBXI 2FJHB 3Q0HA 3VJ6A 2OZ4L 4D8PB 1EZVX 3L3DA 2GY7B 3VWJC 4TULH 3EOTH 1NCAL 4JDVA 2YS4A 3MXVL 3H9ZA 3QJHA 4EIGB 4WW1B 4OFVA 5DMIH 3GSNA 5BJTA 1X5LA 1KENH 4J3XA 4OTXL 2CGRL 4R4NC 4ODUB 3B3IB 4JR9L 4R3SA 3HNSL 1BFOB 4JFEB 4RDQF 2P7TA 4OBRA 1HINH 1U3HD 2AXHA 2A9ML 3FJTA 3GMNB 5HHXL 1PGRB 3OMZA 4PJIA 1P4LA 1RK0B 4IRSB 5JW3L 1EUTA 3OKEB 4TUJB 1IAII 3MRCA 4R4FH 4TTDD 3V5HA 4LASH 1F13A 3CVIH 1P5UA 2QL1A 5D70L 3MLUH 4BA8A 5DRZB 5F93C 1YEEL 2FD6L 4NKOB 4U6HB 2OI9B 4AEHH 4PJ8A 4B0MM 5BJTB 4XMKL 4N1EA 4R3SB 1KPVB 5J6HA 4BM7A 4JY5L 2DQCL 2G5BB 4N5EC 4PPTA 5F7MC 4EBQH 4P2OD 4J2XA 1OGAD 1BIIA 1PLGH 3DMMD 1FH5L 5EZOL 1LD9B 4PJIB 1P4LB 1UKTA 4YXLH 4RMWA 2X9WA 4X6CA 4XPHL 1JF5A 5D93C 1T7ZA 3MCKA 3HZKA 3LY6A 2VR9A 1MRDH 3V5HB 2BNUA 3B2VL 4XP1H 1VADB 4LOUD 1BFSA 4G7YH 4BH7B 3VXSE 1M4KA 4JZNA 3BKCL 3G5YA 5DO2D 2F53D 4JQVC 5IFJA 1RVFL 5KVEH 2NNAA 3LPWA 3BIAX 4FQXD 1YEKL 5JQ6L 3NZ8A 4TVPD 2Q8AH 5GRZA 4XAWH 1DP0A 2RJMA 4OQTA 1A7PL 4F7CA 2VDNH 1KLGB 2FB4H 3D1MC 4V1DA 5FYLH 3BI9X 1ZLWK 4OF7A 4JVUA 1TXKA 4YUEH 4HCRH 4X6CB 4Y5VA 2E9BA 3HZKB 3IFNL 1Z5LA 2RCSL 5DZOA 4KDVA 4U2YA 1J8HA 2BNUB 2YA2A 4PTUB 3VFGH 5E1HB 1QRNB 1OP5H 4JZNB 1DQTA 1QBAA 3G5YB 4I48B 3OF6D 5IFJB 5DJYA 3NBNA 4PY7A 1DANT 4JM2C 3D0VB 4U1MB 1TVHB 3RWDB 1XZ0A 3QO0B 4G8EA 1PJ9A 1JGVL 1QYGL 3WFHA 4ZFGH 1EHLH 1UA6L 4MXQD 1LO2L 4GRWH 1CGSL 1NSNL 3CXHJ 4OZ4A 1QR1B 1MFAL 4F15C 4I77H 2VH5H 1Z5LB 4B53A 1KB5L 4J4PD 3MX0A 3S6CA 5HGAB 4PLOB 1YMMA 3DV6A 5D2NB 1GPOH 3MXWL 4PS4H 3CZJA 1QFWM 4OLZH 1A1MB 4OLUH 5E1AA 3TBVA 4OB5L 3HPLA 3VU2A 1A3LL 4KRLB 4PP1C 1EFXD 1R5IA 4QXGH 4K07A 4D94A 2OL3L 2Z8RA 5ALBL 3P4NA 1XZ0B 4IRJA 4Z0BL 4G8EB 4X0KA 1I85A 1CIDA 1RZJC 3WFHB 4Z7OE 4PJDE 5F6IB 5EZJB 3VGDA 2CPCA 5FCSH 3ZMRA 4PGZA 1NMBH 1QEWB 3FT4A 4M7LT 1B3JA 3EJJX 2J5LC 5SX4I 4OM0L 4KTDL 3O4LE 15C8H 1EH9A 3F5WB 3WYRA 1D5MB 4NKDB 3CXDL 5FYJE 2BVQA 2W0FA 4FQLL 5B21A 1S9YA 1KBGL 3O6FC 2IPUK 4TOYL 2P5EA 1MJ7L 2GCYA 3V6FB 1YMMB 1CR9L 4XVSH 3NIFF 1OP9A 3TNNB 2EIZB 3MRGA 3WKMH 3HPLB 1MIEL 2OMBA 5B3JF 3P4NB 4XXCC 1PG7H 1YECH 4KVCH 5FHBH 3GMMA 3FT4B 1VA9A 1BQLH 4I4WA 1R3HA 4WW2B 5D9SA 1MIMH 3FHAA 2AQ1A 5FB8B 5LCVH 2WP3T 3UC0L 4OQTH 2MPAH 3TWCL 3MV01 1S9YB 1CGTA 3ZYJA 2JELL 3MJ6A 4JZJC 5C71A 2PYEE 2P5EB 3ZDZF 4L4VE 1LO5A 4OF8A 4WU5A 3L5HA 1XT5A 4PFEA 3BUYB 4HZAA 3H42L 1UCTA 1NAKH 4JO4H 3RUGB 1VESA 3CX2A 4FQ1H 4DGIH 3V4PH 4RGNC 3AREB 4M5ZL 5TJWK 3KYOA 3V4VH 1NGZB 5TE4H 3GIZL 4AQ1B 1JZ4A 5HVHB 5AZEL 4I4WB 4LAJH 2C3XA 5HHME 1R3HB 3PJSA 4YHIB 1XF1A 4P23D 5D9SB 4PGJA 1GOGA 2R2HB 4R26H 4HUVA 2FZ3B 3QG6A 5EFIA 4KQ4H 2NY5H 5C0RH 4M1DH 5DZLA 2UUDH 3KLDA 3U4EB 1WSST 4Z7NE 3WFEH 4NRZA 5CWSB 1EJ6A 4M1CC 2DTML 2G60H 3Q3GA 4L3CB 5JORA 2BSRA 4JFDD 5ICYB 1MUJA 4E42A 1AO7E 5J1SC 3K0WA 3QG7H 2AXGB 1JUFA 5FECB 1OD9A 1W72L 1GZPB 3IJSA 4CJ1A 1IVLA 5DQ9A 2CLRA 4AT6A 1EK3A 1BJ1H 3F7PC 3TF7C 4XTRD 5SV3A 1T21A 1LP9E 1D5ZA 3C5SA 1H8OA 4IRSC 1D6EB 4JRXB 3FOMB 4NPYA 5BMFH 4JFPA 4XMPH 5D7JC 4ZO7A 3PDGA 4XHQA 4ETQB 2BVOA 1A5FH 4JJHA 2C7UB 4XC3H 3D25B 4GRLA 4HSQA 2R8SL 1T7VA 4YGVB 1CICA 1J12A 4HUUA 4LBEA 5E03A 4X9HA 4AM0B 1H9VA 4S0TD 2OM5A 4BK4A 4E42B 5HSFA 2IBBA 3KPSA 1JUFB 1PX4A 3OPZH 4X6DE 3RWHB 4K94H 1S9KC 2VC2H 1YNLH 3QXDB 4P9HH 2FGZA 2NW2A 5DQ9B 2CLRB 4QXTA 4X98A 5I1EH 3VE0B 5C08D 1OCWH 1T2XA 1P1ZA 5KG9A 2BVTA 1D5ZB 2I24N 5FGSA 3BE1H 4PRDB 5HY9B 4QKXB 3NCBB 2G75A 3B9EA 3WS6A 3MNZB 3LS5H 2BVOB 2LAAA 5JMRA 3MLYL 1KCSL 5K9OA 4GRLB 1QSEA 5I9QC 5HYJD 3UPAA 1KELH 3OXRB 2ED7A 2VIRB 1CICB 4L8BB 3RA7L 3MJ7A 5JR1H 3QCTL 1AY1H 4OT1L 4PJ8C 1L6ZA 2NLJA 3W5MA 3CMGA 5F97E 3G04B 3QUMB 1UENA 1KCRL 3LS4H 4M6OL 5D7LE 4CRPA 1TZGH 4LARL 1S8DA 1FE8H 2AGJH 4JY6B 4PJXE 4ALAL 1DR9A 5FO8B 2ZCKH 1N8ZB 1IGFL 5K9KB 1IC4H 3UTQA 1IBGH 3DYOA 3UJTL 1OPGH 4JPVL 2VDOH 2Y36L 1JZ6A 2ZUQC 3QEQA 5BOPA 2ZUSA 2BXYA 4LLVB 4NNXB 4HIIB 1QSEB 3QP3A 3QDMA 4G9DB 4QGYA 5J56B 2WUBH 4GSDH 3V7MA 1KYOJ 5SWSB 2FEEI 3MJ7B 2ZKHL 1ZVSB 4MS8C 3QA3A 2NLJB 3UTTB 3HG1B 3QDJA 1X4ZA 3OZ9L 1I1AB 1TZIA 3QXTA 4KI5D 5IVXF 5EORH 1D6VH 4QXUH 5MENA 1FSKB 5KAQF 1TETH 3D9AL 1TCRA 4H8WH 4HULB 4JFFA 2XQBL 5EBWB 1XGUA 1TZHA 3O2VH 4JO2L 1DQJB 3QUZD 4Y5VC 3RVTC 5B22A 3L9RB 5DMKB 5C2UB 3W11D 3U6RB 4F58L 1QFHA 3T0VA 3S36L 5MEQA 1D3CA 2AQ2A 2EDDA 5TFSH 3UJJL 3RPIB 1FZKB 4XVUD 5GRVK 3BZFA 5JTWA 4HAGA 3VXNA 2AEWA 4KPHL 2E7MA 3QR2A 2VLJE 3FB5B 3ULVE 3P73A 5BVJA 5MI0C 5MEOA 5CJQL 4MMZC 4PJAA 4I13B 2MQ3A 2FGWL 3MCLH 1TCRB 2CXKA 4OGZA 3TJHC 5K93A 5L88L 1P7KA 4FQ2H 3FO9B 1WTGT 3MLZL 2W0PA 1TJHH 5LWYL 2VUYA 4JRYB 3HCVA 2H2PC 3BRGC 1N7MH 3KHQA 3QWOA 1DVFB 2DLEA 5I8CA 4ORZC 4OFDA 1SM3L 3QCUL 3BZFB 4PRPE 1KEGH 3WUWA 3DV4B 2YPLE 2NPLX 2CMRL 1YA5A 5BVJB 1BBDL 5J3HD 4DKEL 4IRJC 4U6VH 1I9IH 1I85C 4KKLD 4PJ5D 4I3RH 5DUBA 5CEYA 4Y1AA 1IEHA 4LKXA 3V8CA 2DB8A 2BNQD 1KNOB 1F02I 1SY6L 3WUWG 1P4IL 4YQXL 1MH5A 3RHWK 4B50A 3TNMB 5GZNC 4ZXBD 3WNMA 1P7KB 1J1OL 4LPXA 3AU1A 3FO0H 3QO1A 2LV4A 2SEBA 1OAQH 4WI9A 2NY4D 1R3LB 1MAML 5BV7L 5BW7A 1BQHA 2HVJA 1DSFH 3QWOB 3BZDA 3GRWA 3FRUA 3UBXB 3BZ4A 1T83A 3ARRA 4LPWA 4GAJH 4Z7WF 1F58H 3L95B 3V0WH 3WUWB 1NLDL 1MCRA 1OY3B 2GI7A 4YX2L 1PYWA 2CXGA 2VJXA 5D1ZD 4LLDA 1NGQH 5KSAA 3EFFB 1U8PA 3DYMA 5T1DL 1U8HB 4JRWA 4PJEF 3RBGA 4LKXB 3IDUA 5HVHC 2ENYA 5JIIA 3CC5A 2FBJH 3R06B 4NC1E 4JHWL 1CE1L 4JFOA 2XXCB 4KVNL 1IGYA 4UT9H 2A9NL 5I1KH 1G9EA 5F7WC 2H2SD 4YJZL 5E7BA 3HMWH 3RGVD 3E6HA 3EUUA 4LAQL 5GGSB 2C5DC 4KKCC 2Y07H 3P0YH 3BZ4B 5L2KE 4XNQB 4HIXH 4UDUA 1NDMA 2Z92A 1K2DA 5E8DL 4L8DB 3QI9B 4ZFOB 2D0FA 3GMQA 4MMXC 1DQLH 4MNQE 4E41A 2A77L 1U8PB 3Q2CA 5T5NG 3LPGA 3U7AA 4ORGA 1MHEA 2W9EH 4BZ2H 3O9WD 1JJUA 3HE6A 4J3SA 3SJVA 4U6YA 1AXIB 3EO0B 1YNTA 4QRSA 5IHUH 1NLBH 2APXA 2UZIL 3HC4H 1OP3K 4LIQH 3QHZH 1NMCC 5I17A 4XRCB 3CSBA 1HIML 5GGVL 3SKJH 5HDQH 3C5ZA 4FXLA 1OAXL 3CUPA 4EN3D 5E6YA 1FAIH 2FX9L 1N4XH 4E41B 4HLJA 1L7TH 2DTSA 4QHMA 2HFTA 3PDDA 1KULA 1MHEB 3OBAA 2XN9D 3RJQB 4C56E 3KPOB 4Z0XB 1RJLA 3RY5A 2ORBL 4U6YB 1MCDA 3LN9A 1YC8A 5CZXC 4FOMA 4OSUH 1SJEA 4NQDD 2A6JA 4P2CG 5IFAL 1J5OH 4N1CA 4GG6A 5I17B 1CICC 3AMLA 1JI1A 3MUJA 1G9ML 2O5ZH 1RD6A 5E6ID 4MA3B 1F42A 3BD3A 5HGBB 3QDGE 3PABA 3B43A 1DJSA 2XZAL 3H6JA 4GMTL 4RFOL 1ETZB 3MOAH 3FFCA 3GRWH 4F37K 2OTUA 1NH6A 2R0ZH 3UTSA 3WHXB 2IG2L 3JUZA 4PLKD 4O2CA 5GS0D 5ESAB 1LEKB 3WS6C 4GRMA 5EOCJ 1Q9WB 4O2EA 3FQRA 3FFDB 4RAUA 4EZMA 2BP3A 1U2HA 5TF1L 3IDJB 3VFTB 1U92A 1BVKB 1CE6A 4GG6B 2EIBA 4M7KH 3O4LB 1S9XA 2R0KH 3DVNA 3DUHA 3ZYOA 3WIIH 1D5IL 1SEBB 1CDUA 2VLMD 4YFLF 2R4SL 1DBML 2M8XA 4DVBA 4YHOL 4G43A 2VLKB 4U1LA 1HKFA 3FQWA 3GM8A 4LNVA 3DBXA 1GGBH 5HHPB 1GZQA 4Q0XL 3D39D 3O11A 3ZKXB 4LQFH 4NP4L 1E4JA 1ACYH 3TH4T 4PRIA 5J6GA 4Y16A 4ELME 4P57A 2NYYD 2EH7H 4G42A 4KXZI 5GRVL 4PB9L 3O6LH 4HFWB 3G6JF 4P59H 4ZS6C 1QA9B 5AD0A 2PKDA 3RNQB 3Q6FA 3LEXA 3M1BA 1CE6B 2YUWA 2ZG1A 1FQ9C 4G6FD 4KQ3L 3S3PA 4WI6A 5LGHH 3HNTL 6FABL 3S35H 3BQUA 4DFHA 5CLTA 4EI5D 5I1JH 4Y0GA 1OGTA 3JSSA 3N1FC 1W0WA 3V52H 5I1LA 5FV2A 1NCCH 4DVBB 4R8WL 5HHOA 4G43B 5TE7L 2K1MA 4U1LB 3C60B 3S34H 3F7YB 5HHNA 3QNYB 5KSBE 3IRZA 4TUKH 2A2QT 1LILA 4OQ1A 4FZ8H 4G42B 4XP9L 1VHPA 5I8EA 1ERNA 4DJMA 4PJHA 2EYRA 1ED3A 1R5VA 3RPKA 3F62A 3HMXL 3Q6FB 3LEXB 2YOCA 1NGWA 1EEUA 5T3XL 4PJFE 3VFMB 1B88A 3QYCA 4UAOB 4HGMA 25C8H 5MEPB 3HR6A 3RWIA 2CK0H 4U1IA 4KK5D 1EVUA 4CVZB 1BD2D 1KLUA 3CLFH 1MLCA 5I1LB 4OLWL 4S1SL 4DOHB 3O45B 5HHOB 5GGRA 3L3IA 4XXDB 1OTUD 1EV2E 5DJXA 5IW3A 5ICXA 4OCYH 5I2IA 3V4UL 4K8RH 5EO1B 5HHNB 3BEWA 5JPNB 3QUYB 5CJXA 1CLYH 5JA8B 2EH8H 1J0ZA 4ZUVA 1JYXA 1NKRA 1I7TA 4FTVA 2P43B 3VGHA 4ZOEA 4P0DA 5E94A 5C0FA 3MRLA 4XPAH 5ERWB 1Q0XL 1U9KA 2DS4A 3H0TB 3ZE0F 2APTA 1B6DA 1OGAE 1MQ8A 1QSFD 1QRKA 2DQHL 4GXVL 2C1OB 2ESVB 3C6LD 4XNZB 1MLCB 3QIBA 4GKNB 4RX4A 4KUZH 3MA9H 1I4FA 1WBXA 3OQ3B 1DBAL 2DQTH 5HD8C 3L3IB 2H3NA 1FN4A 5GRJL 5F44A 1QKZH 4C57C 5ILTL 5DRNB 3HAEG 3U0WH 3N1PC 4P5MB 3QQ3A 3LN4B 1FYTD 2IGFL 2F53E 4WHDA 4X4ME 4ZUVB 4HXAH 2AABL 4KDWA 4RMUA 4Y7MA 4OD3L 4FTVB 3ILPB 4TVPE 1QUNA 4JVWA 1T83C 3HE7D 1GGUA 5D6CA 1LO0L 5ANMA 1EXUB 3BH8B 1WCBA 3NIDE 3WDJA 1J7VR 3HZVB 3HAEB 4QYOB 4X6EA 9CGTA 1JWUB 1KXVC 2HFEB 2XOTA 1A7RH 1P84J 2N7AA 3OKLB 3QIBB 3MO1A 3QNZB 5KSAC 2FNBA 2XYCA 1WBXB 3TT3H 5EG6C 2H3NB 4GMSH 3RP1A 4YK4C 1S7QB 5DGRA 5GJSH 1UT9A 4DN3H 1NBQA 3QHFL 5GS1A 1A2YA 1NGPH 3R8BB 43CAB 4A2MA 1SBSH 2NTFA 2W9DH 3UPCA 3HB3D 4CMMB 1ZEAH 2V5SA 3BD4A 4YDJA 3IKCB 3OJDA 4ODVH 5I1CL 4JB9L 4M6ML 4ZO8A 2EO9A 1JGDA 1B0GB 5E4EC 1VKXA 1WCBB 2I60H 4BUGA 3K1KC 3PUCA 4IDJH 2P1YA 4OLEA 3TYGH 3O2WL 4WCYL 5EUOF 3TN0D 1LHZA 4MJ5A 3WDHA 4EOWH 4KWUA 4XWOD 4Z7UF 2VL5A 2ADJA 1PZ5A 1P6AB 2IBZY 4HJ0D 4PLJC 1JTPA 3HE6C 1DBBH 4OGYL 4QCIB 4KK9D 3KXFA 3V6OE 3WJLC 1MI5A 3DX6B 2Y7QA 2C9AA 4QRUB 3IETB 3VA6A 4YDJB 3FQNA 1H3PH 1OAYH 2BX5A 1P7QD 1JGDB 1INDH 1J86A 2IANB 3C5ZC 3FCTA 3PNWA 2WV3A 4F57L 4K7PX 3ESUF 1AH1A 3I3DA 5FGBA 3SKOA 1RU9H 3TA3A 5ITBH 1PG7W 3LB6D 3F12A 4NZTH 1PZ5B 3CCHA 1T1ZB 4XNMA 2O5YH 3WNKA 5CJ5A 1I7RA 2ZOKA 2EE3A 4G6KH 2XG4A 1EPFA 1OAUH 3I84A 2JJWA 5C0NC 2X7LA 3GBLA 1G84A 5C07A 1L7IL 1OT1A 2OYPA 2Y7QB 4XPBH 4UDTA 1HILA 4NZUL 1FHGA 1K3IA 2X89A 3WBDA 1RK1A 2NY0B 5B4MD 4C55A 1DLFH 3NZHL 2OL3A 3ARQA 1HHGA 5CSBA 5D7KD 3FCTB 4OD2B 1SJHA 1XGYH 3T4AA 4X7CC 4QXWA 5DJDA 4PY8I 3VGEA 3TA3B 2K9UA 3VXPA 3F12B 4NDMB 1A47A 1KB5B 4PRHA 3JWDL 4MWFA 3WFCH 1UWEL 2Y25A 2F54B 1F4XH 3L7EA 4I8DA 3OXSB 4OFYA 2BDNL 1HILB 4U1JB 4UDTB 3ZSTA 1RK1B 4HKBA 1T7YA 4L5FH 1IFHH 2OL3B 1FFOA 1HHGB 2ADGB 1DQDH 3MV9E 4H0IA 1YY9D 1C1EL 1WQVT 1BM3L 3BKJL 1CDHA 3T4AB 5GGTA 5DJDB 5JXED 1JGLL 1T2QH 3GSRA 1P4BH 3P9LA 2NW3B 1S7TB 3CFBA 3I6KB 3BDYH 3BW9A 5DJ8B 4NJAL 5F1IB 4Y5XB 3CLEL 4MD4A 1TQBC 4NO0A 5C7XL 5DD1H 5IFHL 4GW4B 4PV8B 3MLXL 3VWKC 1JFQL 3I50L 4JN1L 4Y16C 4LVEA 4U7KA 3SKMB 1MCFA 3UO1H 4JFDE 3DARA 1FORL 5C09A 3SKNB 3OX8B 4WV1B 3C08L 3RIAF 1KSRA 1IC1A 2X70A 1HDMB 5C6TH 2YPKA 2Z31A 1FFOB 1D5BB 3BQUC 4X8JB 1RJZA 3VXUB 2R29H 1V5JA 4KK8C 2DICA 2Y9RT 4APQA 3GZKA 3WE6A 1BWMA 4M7LL 2R9HC 2J6EL 4NQXA 3GSRB 5F3HA 2CJUL 3CFBB 4YE4H 1A0QL 2WQ8A 1S7WB 4JPKL 1YQVL 3P4LA 5H94A 4MD4B 2BRRL 4LSSL 1OLLA 2VZSA 5DHVH 3OKKB 2OJEA 1MQKH 2HG5A 2ICWJ 2WUCL 3O6KL 4OZGE 3EKCA 4MNQB 3WXVL 2MHAA 5MP6L 1DDHB 3GHEH 4NUJA 3O3BB 5C09B 1QACA 3IDXL 5HYSA 4WFED 3BPOB 1G7LB 1W72A 3M07A 3TC9A 3MLTA 1CWVA 4UV4L 2H8PA 4QOKA 2OJZH 5IBLC 4ODSL 4XNXL 1BJ1J 3QBTB 1SJXA 3IKKA 3BWUC 1GGIL 2AEIT 2HT4D 5T1LA 2XY2A 2BHYA 1HYSC 1J9CT 3QPXH 5GRXG 5HYSG 4DCQA 2EEAA 1HXMB 4MNGE 4XPGL 3L5XH 5H94B 4R7DA 3SGKA 3CFKA 2F9BT 5HYJE 2HG5B 1GRWA 1OHQA 3ME0A 5CJXC 5TQ2H 1FNEA 5FK9A 2OXHA 1SVCP 1ZT4A 2MHAB 4AEEA 4NRYB 3WD5L 3TT1L 4RAHA 4WWKB 3AY4A 1A7NL 3C8KB 2PXYD 4JJ5A 4JAMB 1VEOA 1W72B 2D03H 1CG9B 1T89A 3N9GL 3JWNC 3LHPL 3IFLH 3H9SE 4GQPH 3MLTB 3RUGF 2H8PB 4QOKB 2YBRB 1H8NA 2X44D 3PHSA 5JHLH 4AG4H 3K1DA 2YEZA 4PJGF 1K8IA 1NC2B 2JIXD 2KKQA 1DE4A 2X4SA 3TZVB 1YJDL 4NNPL 3LCYA 1QFWL 1MRCH 4JREC 4X7SL 5HI3C 1NFDF 1QFUH 3TYFB 3BPNC 1AR1D 1VFAA 3U1SL 2VL4A 2FWOB 3LRHA 5GGTH 3RDTC 4MCYA 2NX5B 4DW2L 4ZS7H 1ZLUK 3VCLA 3QJFB 5L6YH 2QQKH 2EO1A 4NOFA 5FFLA 5EU7E 3UTOA 4CW1B 4KI5E 4XWGH 1F4WH 4JKWA 2EDOA 3RQ3A 5DZNA 3BESR 4LEXH 4JM4L 2GJ6A 4ZAKD 4FA8A 3ROOA 3K2MC 2G2RB 3EOAB 5DK3A 1O7VA 1S5HA 4IRZH 1J1XL 1A9BA 4G6MH 2DBLL 2ATPA 1JNNH 1MREL 3PQYB 1VFAB 3SCMD 4YIQA 1YN6A 1ZWIB 5GS1C 1NJ9B 3CFCL 5E5MB 3V7AE 3G6AA 3NFNB 1IARB 1TQCB 3VCLB 4OGAC 4F7TB 2QHRL 5KSVB 3SDYL 2ID5A 2FX7H 2OP4H 3VXTA 1CDJA 4L1HA 1KB9K 2GJ6B 1A4KA 3ROOB 3W0WD 3RWGA 4XPTL 3GSQA 4X6FA 4M5YH 4MHHG 1S5HB 5DD5H 1FPTH 3X3FL 2J88H 3MMEB 3W9DB 3ULUF 5I8OL 2IALA 3PGCA 1NMAL 2ZUWA 5DDHA 3P9WB 5EWIL 1VSCA 5HGDA 2EDFA 4M6NH 3RWFB 1ZGLB 2J7LA 3L3JA 4HZLA 5GRUL 3VWJD 2CD0A 3G6AB 3CX5K 1QLEL 4WUUA 5HGHA 5EUKA 2G9HB 1CLCA 5EZIL 5FKAB 4PJ5E 1QBLL 3VXTB 3KYAA 2X05A 1MWAL 2OXGA 1S7VB 1AGBA 2EDWA 4LSRL 3AB0C 2V7NA 2BNQE 4R4ND 1A4KB 5E2UL 3RWGB 2AJ3A 3ARPA 3GSQB 4X6FB 1AFVL 4K3HA 5FGBC 4PJFB 3T2OA 3TA3C 4Z76A 3ARGA 4NHUB 5BO1L 4XZUA 2IALB 1U3HB 2YKLH 1FBIL 4P4RB 2YSSA 1WEJH 4GKZB 1ZMYA 1QZ1A 4AL8L 4XNUL 4N0UA 1U0QA 2IPUG 4J3WA 4D9LH 2HJLB 4BFEA 4WTWA 4X4YB 3L3JB 4JKPL 4HZLB 4U3HA 4Z95L 4U1KA 4GS7B 2H1PL 5EUKB 2NY3B 3LEYL 3BKYL 4Z7QE 2CLVB 2V7NB 1SY6A 1ZLVK 3FT3A 2ARJQ 1X5JA 5EIVA 4N5ED 2VOTA 1YEIL 1HZHH 4UINH 3T4YB 2MOVA 1GC1L 5D5ME 5K9JH 2VDMH 2YSSB 4PJGA 2P42B 4O58L 2CO6B 2VN4A 4N0UB 2X4NA 4OF3A 4P2QB 1NFDA 4S11A 3QULB 4WENB 2PF6A 4P4KB 1CQKA 1NGYA 2Q76B 1IQWH 3RX7A 3V5KB 5CILH 1KPUA 1PDKA 1TJGH 2WBJD 4F7MB 3WSQL 2EDHA 5I76B 4DTGH 5I1IL 5F7UA 5I1HH 3O3UN 4RMTA 4NO2A 4FQXB 3UZQA 5IMOB 2E6QA 3FT3B 3O8XA 4JE4B 3MUGA 1S7XB 5J57B 3GSOB 1LVEA 2AJZB 8FABA 5BV7B 4J3OC 4LSUH 4FFZL 3JXAA 4Y88A 1KPRB 1QNZL 3RTQA 2KPNA 2XWBB 3GJEA 2VXTH 2D7TL 2R1WB 1QBBA 5LJYH 2QADD 2HFGH 3H3PL 2ZG2A 3VXMB 2Z31C 4EXPX 5I73C 3PHQB 1YPZE 5CINL 1F00I 3DYPA 1CLOL 1ORQA 4APQC 2V9RA 3QZWB 2DOCA 3KS0H 2XN9E 1RZKL 3WO4C 1FC2D 4PYGA 2X4TB 3OJ2C 4OAWB 4PG9A 4ZSOA 1HXYA 1Z9LA 3MROB 2XRAH 2DYPA 4P5KA 4PJBE 4ZO9A 3ZTNL 4PJ7E 1JPFA 3I6GA 4NQDE 1ORSA 2VZTA 5C2BH 4MJID 4EUPA 1E4XL 3BP6B 3MCG1 2YUZA 3OWEA 5A3IC 3RTQB 5LQBH 4I1NB 5E8OB 1U8MA 2OQJB 3ULSA 3IJYB 2R1XB 4WNQB 2PN5A 4ONFH 4N8PA 3LN5A 2AEQL 4EUPG 1BFVH 4WU7A 1OT2A 3N1MC 3VXOA 2GSIA 3KVQA 1ORQB 5DD0L 1AGCA 2F8OA 4PP1D 5DWUH 2AV1A 5I74C 1AKJD 3DURA 4NQED 6CGTA 5F71A 1EFXB 3L1OL 3D18B 5CIPB 2DYPB 4IIQA 4P5KB 2AK4D 2YRPA 3SGKC 3IDGB 3DROB 1ORSB 1G6RL 3IDYB 3OB0H 4EUPB 4WGVB 1UVQA 2QQQA 3PL6A 4FMKA 5SWQA 1EO8H 5IMKB 4AEFA 3HUJB 4JFHD 5KVDH 1ZHNA 1JHLL 1IC5H 3U9PL 4NHCL 2DLIA 3MGAA 5TQ0H 3AY4C 1BZ9A 1U8MB 3O6FD 1LO4L 2NZ9C 4KK6C 4YHKL 2BY0A 2VLME 3WN5C 1T89C 2FSEA 1WAAE 4NZJA 3PDOA 4OZFB 2QQLH 1R5WB 5J1TC 1F4YH 3D85A 1Q9OA 1Q72H 1YYML 2DN7A 2GSIB 5ADPL 3MFFA 1C08A 1QLRA 3D39E 5C86A 3GBNH 1WZ1L 2VB5A 2F5AH 1OAZL 5BXFB 1F90L 5JHDD 5ACMA 4O4YL 1FJ1A 2BOCA 1KIPB 2E9IA 4IIQB 1R0AH 3WXWH 4GBXC 2X42A 5GHWL 1OAKH 1OM3L 3GMOB 3X11B 3MV7D 1GAFL 2GQHA 2YD1A 4YO0B 3GJFA 5KN5A 5D2LE 1ODAA 1TQCC 2MNUA 3T0EB 3MGOB 4WJ5B 4NQVA 1CFBA 4XX1G 5TDPB 3QFJA 4L3EB 1KIQA 4YC2B 1GOHA 5T1KD 2Y23A 4PGEB 3PWJA 1DUYB 4UQ2A 1GH7A 4R0LA 4YHYC 1J8KA 4RGND 4FZEH 2DM4A 4MDJB 4CKVX 1FJ1B 1PKQA 4KRNA 2XA8L 5IVNA 2VLRA 4HS3A 2DQFA 5DEGB 2AK1L 1CF8L 5CBEA 1LDSA 3IAQA 4YXHL 4F7PB 4HMCA 1YDPA 4Y4KA 1R3IH 2WINB 5HJ3A 3UPRA 1B0RB 1XF4A 3CFDA 3V95A 4U1HA 4M1CD 3D2UD 1BD2E 1NUDA 5CGMA 3VFUA 1MAJA 4QLRA 3OAZK 3P30L 4ERSH 1TJIH 4HXBH 3MRHA 4HIHB 3ULUH 4JFDB 5J12C 2IC2A 1FCCA 2YA0A 4NN5C 4R0LB 2YA1A 2ZSWA 3FONA 3MOBL 1N6QH 4YXKL 4U3CA 3QWRD 3OR6B 3MRDB 2DQFB 1MEXL 4IRSD 5J0BA 4NQSB 5CBEB 3HMXA 1C5BH 1A7QL 3A6BL 3FAWA 4Z7OF 4PJDF 5D7JD 2HLAA 3DO7B 3IGAB 3UPRB 1XF4B 1FNAA 5KVMC 3CFDB 4XH2A 4W4NA 4G7VL 1QSFE 1G1CA 3CK0L 4HUWA 4U1HB 4ODWA 3W2DL 4LLWB 3VFUB 5IW1A 3RVUC 3LQZA 4TNVK 1M7DB 4YHNA 4NO5B 2ZUTA 4JFXA 3K4AA 3QPQC 1QR4A 4WHYH 1I9JL 5CEZH 2NY6B 1A1NA 4NQCB 1WF5A 3NA9H 1DEDA 1AXTH 3NCCB 4DN4H 3ARGC 1FYTE 3O3AA 5ADOH 5C08B 4YR6A 5J06A 3PWPE 4QRTA 2DQIL 1RIVL 4KAQH 3C2AH 3X12A 2OLDA 4M93B 3SE9L 1KCVL 5DHXB 4XH2B 3IFPA 4UILH 5EOQH 3OJVC 4HS6B 3G6DH 1ACZA 4ONGL 4WFFD 5HYJB 3BAEH 4RBPK 4HK0B 5IW1B 3WV0A 3P77A 5BRZA 3UAJD 4YHNB 5B3JE 5CGTA 3KR3L 3GJFH 4OD1H 5D4QA 1CDBA 1MF2L 2D0HA 2E5EA 1XF5B 3O6MH 3SE8H 5KS9A 3W9EB 2WWKO 4Q74A 1KTDA 4M8VA 3VXSA 3X3GL 2L7UA 2YD6A 1IGMH 1IM9A 4HX1B 1J10A 4ZDHB 5T3ZD 1CXIA 4H0HB 3EO9L 3IFPB 4RGMB 1AI1L 1P84K 3WHE0 5I16A 4MD5A 4YDVA 5C9KA 3RBSA 4MB4A 5GGRY 4BFIA 3T0DA 4FN0A 3V6ZB 5IJKA 3D87B 5TE6H 4Z7NF 2JB6B 4MA8L 1MELA 3RKDC 5D72H 1U8LB 1YEFH 3ARUA 4QF1B 1GGTA 3EFDH 3O8XC 4JFQA 4QRRA 1BECA 4QHUB 1B4RA 1IL1B 3FMGL 5KS9B 4FFYH 2X9XA 1JZ7A 1IKFH 2NR6C 2P49B 1NCWH 1AJ7H 3EJZD 1NANH 2XKNB 4ZOCA 2VLLA 3RTQC 1N0LA 1F6AA 1LP9F 3KDMA 3VFNB 3O41A 5E08H 3MLRL 4QNPE 3KPPA 1JTOA 5HBBA 4XHJC 5IP4A 3F7VA 4P46A 5DJCB 4ACPA 2Z9TA 1UYWH 1MHPH 1INQB 5I8KH 2UWEE 3MLWL 1MCOL 1JZ5A 1E4XI 1OP5K 3PP3K 4IS6A 3GI9H 4I2XA 4LLQB 4JFQB 4QRRB 4IOFD 2V17H 4YHMH 3LKRB 4S2SB 2W91A 4X6DF 5FYJU 4Y4HB 3KPRE 3IDYC 1AXSB 2DLTA 4LU5L 4NKQB 1SBBA 4JFZL 5I18H 4QY8B 1YMHB 3C5JB 1HEZA 5KVFH 4OUUA 4UT7L 1DTUA 2H2PD 4D0CB 3O41B 3ARBB 3J8F7 5EOCL 4OF5A 3VW3L 1YMMD 2AP2A 3T8XA 3OGOE 2CIKA 3F7VB 4P46B 4HF5H 4YWGL 1MVUB 5LXGH 3UZEA 5H35A 1NCUA 3TCLA 1RIUH 1DQQA 4I2XB 3NN8B 4FQHA 4O9HH 1LNUB 1UQSB 5I19H 1P2CB 4ONHB 2F58L 1IAIH 3B2UC 4LVOB 5GZND 2ZPKH 2HWZH 3W39A 3VFRA 3CFJA 3ALWA 3PL6C 4PJXF 1JMZA 3OKOB 3MJ9H 1HEZB 1A7OH 4URTB 5FHAH 5M7QA 2IFFH 1JGUL 1RY7B 1RI8A 2P5ED 1WIPA 1JPST 4RISL 3T8XB 2CIKB 3TO4A 2B0SL 4JLRA 5IESH 5LKNA 3WL9A 2AJUH 3MOQA 3FB6A 3AUVA 1RZ7L 4Q58C 2DKUA 4K3EL 5D1ZB 3ARED 4NM8H 1PEWA 2XY1A 3EYUH 4ISVA 1IGJA 1EO7A 1T3FA 3PGFL 3BWAB 3RWJA 5ESQB 2HVKA 2PYEA 4OLYH 5F8QC 5KZCD 3NVQA 4L4VA 4PTTB 2VE6B 4Q9RL 3VFRB 1MNUH 3KJ6H 1DUZA 1Q38A 5E2WH 4XP5H 3BGAA 4CAGA 2FJFB 3SDDB 2Z8WC 3RGVB 4KKCD 5IM7A 2R15A 1YEJL 3FQXA 5GIRB 1FIGL 4HBCH 5A43C 3TO4B 4JLRB 5IVXE 4JO3L 1RUML 1WWWX 3MREB 4P3CH 3M17A 4LLMA 4XB8A 3R4DA 4NWUH 1OF2B 1URLA 1BVLA 5SX5H 4MA1B 5IR1A 5LAXA 5IW6A 3E6FB 1INEL 4Y4FA 2IAMA 3X13A 5E5UB 2J4WL 2R4RH 2HVKB 4NN7B 1IQDB 5GSRA 3ULVF 3NIGE 1RZFL 1HI6A 2B1AL 4N5UA 2Q6WA 5DJZA 1H3TA 4WFEE 4CMHB 3O9WB 4Y4KC 1DUZB 1X5YA 4JY4A 2ICEA 5ACZA 1RZJL 5EN2A 4TULL 3EOTL 5EBLB 3FT2B 5E2VH 5DUPH 3FQXB 3WFDL 3MZGB 4WO4A 2HFFB 3K46A 5DMIL 2C3VA 3ALXA 5F9JB 1LP9A 1N5AB 1H3VA 2UUDK 5FCUH 1KENL 3M17B 2BSED 4UOW1 1GHFH 2KQNA 1I3RA 2O5XH 4EN3B 2OK0H 2DWDB 5IR1B 2X4RA 1HINL 1Q0YH 5HVGB 5F8RC 4UIMB 4F7EB 4MD0B 4Y4FB 3X13B 4XBPB 4N0CD 4EQ2A 4E0RB 3TJEH 1YPZB 4Q97A 3NFPB 4FXGA 3WIHH 2Y4SA 1KFAH 3UMTA 3Q6GL 5DXWA 1UM4H 3IXAB 4R4FL 5CEXB 5FYJH 1U6AH 2QLVB 4LASL 3I85A 5IV2B 3LOWA 2R23A 1X9QA 3CVIL 2AAVA 4GRLD 2JF1A 4H26B 3MLUL 1T20A 4X8XA 1FNHA 1FV1B 5DRWB 1CICD 3U4BH 4DGVH 4WO4B 4D0DB 4AEHL 2C3VB 4G5ZH 4TUOA 5E6IB 5KSUB 5CGYC 2BJMH 1RUPH 3KPSD 3OKNA 4JPIA 5ETUA 3QUKA 5JW5B 4EBQL 4W68A 1PLGL 2F74A 3WS3B 1LEIA 4OZHB 2FIRT 1CS6A 2F5BH 4KKAC 1M7IA 3RNKA 1RHHA 3ZE1E 4YXLL 5B38A 4M1GH 4KDTA 4KJWC 3DRTB 5ITFA 2N7BA 4LLUB 1MRDL 4MDIB 4XP1L 5D7LA 4G7YL 4Z7WE 5IIEB 1QFOA 1QSED 4GXUM 4MZ3A 1XCQA 1KOAA 4PJXA 3C6SB 3UROR 3LD8B 1WLHA 3DSNA 5B38G 5KVEL 4LEOA 3UTTD 1E6OH 2Q8AL 1A6WH 5TPWH 2WWKT 5JNYA 2AXFA 4F80A 4PJEE 3AXLA 5ETUB 2V2XA 5IQ9B 5CCKH 4FQPA 1BOYA 1LEIB 2BNRA 2P8PB 2FB4L 4QWWC 5FYLL 5GGQH 1M7IB 1JNLH 1WFUA 1RHHB 1OVZA 1IEAB 2A83A 4YUEL 2XPGA 5FYKD 3B9VA 4HCRL 1ZAGA 2FCBA 3QEQD 1BHGA 4ZS6D 3VFGL 1I8IB 3EYSH 4E9LA 3TVMA 3W0WE 4OLXH 5H37H 3SDAB 5IJKC 1MY7A 1A3RH 1JWSA 4NSKA 4ZYKB 2YXMA 1X4YA 4TSBH 4GJTB 2Q8BH 4HT1L 2IQAB 4ZFGL 2OSLB 5JW4M 2NXYB 1EHLL 3GSNL 3GSWB 3VGAB 3GSUB 5INCA 4JFFD 2CRYA 3RI5F 1P5VA 2J8UE 3OAYH 2VAAA 2XPGB 3BP7B 5KBNC 4I77L 5F7YC 2VH5L 3C87A 1KEMH 2WZPD 4JG0H 2VLJA 2VMFA 3O2DH 3VMNA 1XR9A 2GW5A 1Q94A 3O3DB 5D1QA 5DEZA 5JOFB 1X7QA 1EUUA 1GPOL 3CVHB 4PS4L 1F3DH 4P46C 1UZ8B 4XT1C 4OLZL 5CZVL 4OLUL 1JWSB 4NSKB 2X1PA 5D7IE 1DN0A 4QXGL 3ECBB 3GIVB 5CBAB 2PUQT 4POZC 4D0BB 3SO3C 1HSAB 4L4TA 1NMBL 1VPOH 4LNRA 3GMRA 4UT6H 3MBEA 2LVCA 4RCAA 2VAAB 4PRPA 15C8L 5DMGC 3Q5YA 2FHCA 3KPTA 2C1PA 2YPLA 2HA1A 3SDCB 2XWTA 5F1KC 5B3NA 4YDLB 5D1QB 3HA0A 1M7XA 1X7QB 1JPTH 4XVSL 2CR3A 3DIFA 4YDKL 3WKML 2GSGB 4FQCH 2W38A 3LV3A 1YEDB 1QSFB 3LEVH 2AJSH 3RZWA 1PG7L 4KVCL 3JVGA 1E4KA 3STZB 4DEPC 3I3BA 3MNWB 4LNRB 2ED9A 3GMRB 1BQLL 4Q6YA 3MBEB 4C4KT 3T1FA 1NGXA 1Q9LA 4M03A 4CVWA 2DQCH 1MIML 4Z78A 4YPGB 4UNUA 5LCVL 4OQTL 2MPAL 3QIUA 3Q1SH 1DEEA 1A6TA 2XWTB 3PWVA 1MWAB 4ELMF 4FABL 4GAGH 3DIFB 3TO4C 5HVWA 2X1WL 1V3KA 3LV3B 1NAKL 4Z77A 4JO4L 4NBZB 4J8RA 3HS0B 3REVB 4DGIL 3V4PL 5L8LB 2IEPA 3JWDC 1NBVH 5KSAD 5IBTH 3NCJH 1AGEB 3V4VL 5TE4L 1YEKH 4LHUA 3VFVA 2YHGA 4KGJA 5CSGA 5HHQB 1JYNA 5L2KA 4TPRH 5C0CB 4R26L 1TVBB 2CKBA 1A7PH 2XZCH 4KQ4L 1BZQK 2NY5L 4HK3N 5C0RL 4M1DL 2VDPH 2VITB 3MV11 3WFEL 3PWVB 3VFSB 3LMJH 4LHUG 2G60L 2YC1B 5ACLA 1NBZA 3OG4B 2EDJA 4X7TA 3IFNH 4PJCE 4WUKH 2RCSH 3QG7L 1ZVHA 2WW8A 1JN6A 3ULVH 1KIRA 4GT7A 4HKXA 4J8RB 2UVFA 4PJFF 4MJIE 4UV7H 4HFUH 4E41D 3BZEB 3DETC 4UTAL 4Y4FC 2IAMC 3IU3A 1QOKA 4LHUB 1PQZA 2D7NA 1JRHI 4LVNB 4M8QB 3VD9A 4PLJD 5BMFL 4XMPL 4HS8L 3SJVD 1JMXA 1A5FL 4RWHA 3NCFB 4XC3L 1SQ2N 3ARFA 5HPOA 4F2MA 2DF3A 4YHPA 1FC1A 2EDQA 1NBZB 2CLZB 4WO4C 5IHZA 3PV6B 3KS0J 4N90D 4NQEE 4MB3A 1QHOA 5EO9A 1JHKH 3OPZL 4POYA 3RY4A 1FL6A 5GZOC 1MFEH 2AK4E 4K94L 1OB1A 2VC2L 1YNLL 2ITDA 4L8CA 3NABL 2Z4QB 4K3DH 5I1EL 4HIEB 1OCWL 1BIHA 3P11H 2QKIA 4JFHE 1PQZB 2GUOB 3BGMA 1WWAX 3BE1L 2JJUA 5JUEL 3HZYA 3BP4B 5I1AB 1KJ3H 4KTYA 3LS5L 5HPMB 4OJFH 1II4E 4U0RB 4Z8FH 3PXHA 3ARFB 1WC7A 3BFOA 2Q7YA 1KELL 4X4XB 5JR1L 5IHZB 4LFHG 1JWMA 1AY1L 3CXDH 5JHDE 4K7PH 3GFUA 4EDXA 3S9DB 1QO3A 4GLRH 1FL6B 3LS4L 3BPLB 2YD9A 3T2PA 1G6RA 3FFCD 3ET9F 2ITDB 4WI7A 4X99B 3BEVA 1FE8L 2AGJL 3MV7E 3SDXE 2VLKD 1C16A 3NIDF 3TV3H 3UTSD 2R69L 5D7SL 3QWQB 1N3NB 2ZCKL 1IKNA 3BGMB 1ZE3C 4YZFE 3V5DA 1IC4L 1IBGL 3L3GB 1OPGL 5CD5C 5H2BA 2OCFD 3EOYG 5L2JA 2VDOL 4HLZG 1T5XB 5F7DB 1G1YA 3FZUC 5JDSA 4X6BA 5IF0B 2Q7YB 2M1KA 3DUUA 2WUBL 1WWCA 4GSDL 1E0OB 3GGWB 1MJJA 2V2TA 1YEGH 3THMH 5GS2H 4RGNE 2CKBH 2R2EB 3IDMA 2V7HA 5K9QI 3BGFB 5HYQA 1A6UH 3MUZ1 1CGUA 4PBXA 2APFA 4U7MA 4ELMA 4K7FA 1G6RB 2BVEA 5EORL 1D6VL 4QXUL 5FF6A 4PP2B 4ZPTB 1TETL 4H8WL 5IBUG 3NCYP 4I9WD 5FA4B 3V5DB 2DIBA 3O2VL 1RZ8A 1DLHB 3HI1A 4NC0B 5H2BB 3FB7B 3TPUA 4FNLH 3DGCR 1UC6A 3VG0H 4HG4J 2X1OA 3MNVA 1VGEH 4ZFZA 5JDSB 3TVMC 4QHKJ 5TFSL 1MJJB 2V2TB 1FG2A 1XH3B 5IBUB 2O61B 1YY8A 4HKJA 5KSBA 2X5PA 4KC3B 4QTHB 3ALPA 2DTMH 4K7FB 4CADA 5HHOD 1EIBA 5IROC 5CD3A 3P3YA 1CTOA 1MCPH 2JE8A 4DAGH 3E0GA 3MCLL 1H3UA 2VKWA 5L0QC 3MV8A 4L3AA 3QUYD 3HI1B 1TJHL 3TPUB 1N7ML 4M43H 1CLZH 1VB9A 1NC4A 4B7IA 3IVKA 3EW3B 3TO2A 3ZHDA 4EDWH 4KTEH 1KEGL 4QRPB 3A67H 4HKJB 5IBLD 3G5XB 4XBEH 3UCRA 2CIIA 2ZUVA 4PJIE 2ERJB 2B39A 2VDKH 2AKRA 4U6VL 1I9IL 4I3RL 3CZFA 1X5KA 3NFSH 2FJGB 2PO6A 3MBEC 1ZA3B 1S5IH 2W0LA 3I02A 4LL9A 3QDHA 3FO0L 4WI2A 1OAQL 1OGAA 4WFFE 5F6HJ 2HKHH 3DMMA 3MRNA 4ZTPH 3D3VB 5J9PB 5FIEA 4QGTA 1DSFL 1WZKA 4FTVD 2RAMA 2HJKA 5LG1A 1A6VH 3RWCB 3IVKB 2Z91B 3TO2B 2RFXB 4GAJL 2HH0H 4YBLC 4J7RA 1F58L 3V0WL 4HMEA 4M7ZB 1FVEB 3STLA 4MX7B 3MRFB 4M61B 3HRZB 3DWTA 4OKVB 1NGQL 3QIBD 3QCTH 2F53A 3JVGC 3BVNB 5T3ZE 3MRMA 1E4KC 4X6CE 2GTWA 3TBTA 3SGEH 1U8OA 2PO6B 2WWMC 2JIXB 3KYMA 1ZLWH 2FBJL 4YNYB 3I02B 4UT9L 5I1KL 1QQDA 4RFEA 4ALAH 1T1XA 3MRNB 3QIUC 1EMTL 2YUXA 4WWID 2BOBB 4RNRA 2Y07L 3KPLA 3P0YL 3TBSB 2A0LC 2KUTA 4HIXL 2OX5A 5INDA 2ZCLH 1BAFH 2B1HH 1IGIH 3D0LB 4Y2DA 3L3KA 3UDWA 5CMAA 2NTSP 5HHVH 4NC1C 3STLB 1T6VN 3DVFA 4FFVD 2LVEA 4FG6C 4JZOA 3WKNA 1MSPA 2W60B 4YLQT 1DQLL 2P44B 4OM1H 4KZDH 4WRLA 4LCUB 2FO1A 3C9NA 1KCLA 2GTWB 3CH1B 1U8QA 1U8OB 4KXZH 1AP2B 2UZYB 3EIFA 4ZNEA 2W9EL 1V7NH 4LVNC 4BZ2L 1XGRA 4H88H 3KYMB 5EOTA 2X40A 1OL0A 3BX7C 3OL2A 3VH8A 5HI4D 4WHTA 5D2NE 5IHUL 2HT2C 1T1XB 2FO4B 1NLBL 1WFNA 3HC4L 4LIQL 5BZDB 3QHZL 4RSVA 3EJYC 3GSVA 3P9MB 4G6AC 4O00A 3EYQC 4OZGF 5INDB 4YBHA 3SKJL 1I1FA 2IAND 3VH8G 3RIFF 5HDQL 4OI9A 4Y2DB 4O2FA 1T6WA 4IHOA 2V5YA 1FAIL 1ZXQA 5ENWA 2DWEA 3MRKA 5CUSH 2ZUUA 1N4XL 1WT5A 1BJ8A 1L7TL 3T08A 4JDZB 3C9NB 3UTZB 4PG2A 4MAYA 3GSXB 1KCKA 2Y5TA 3TBWA 1XGRB 5F96H 1D9KB 4CU8A 5DK0B 3MACH 1BLNB 4LF3A 5DD6B 3VH8B 2A6DA 2DI9A 4MQ7B 2I07B 1YMME 3X14A 1IJ9A 1OQXA 4S10A 4OSUL 2G5RA 2FGWH 4HHAB 4X9GA 1A1OA 1J5OL 5CHNA 3GSVB 4U6XA 2J8UB 2O5ZL 1U8JA 2NY0D 1QLFA 1I1FB 3LIZH 4V2BA 5EPMA 4GH7B 5D71H 1RIHH 5ENWB 3BPLC 3T77A 2DWEB 1NCNA 3MOAL 3GRWL 4HWBH 2PTTA 4DUWA 3BRFA 2BC4A 2JCCB 4KMTH 3TA3D 1TFHA 4FXKA 2D31A 3LKNB 5FM4A 3ZYZA 1ZV5A 3IT8D 2P5EE 2VQ1B 4PGDA 2DMBA 3X14B 1F3JB 5C07D 5JW4Q 2F54D 43C9B 4GKSA 2R1YA 5CHNB 4S1RH 4TVPH 1NDGA 1FVDA 1S7RB 3IJHA 1XGQA 2X89D 4HIJB 3VG9C 2E7CA 4M7KL 1ZT7B 1U8JB 1QLFB 3LKQB 4XGZB 2J8HA 4TN9A 2R0KL 2K3TA 4QHLA 1GGYA 2ARJA 5EPMB 3WIIL 2V9TA 5KANI 4JQVA 2DQJH 1WZMA 3R8QA 1I1RA 3T77B 1K6QH 1XGTB 2LABA 1I1YA 4KI5F 3I2CH 4HWUA 3JV4B 3DX9A 2PCPA 3S97C 2X4UA 4M3KB 1GGBL 2NQCA 2D31B 1P7HL 1K85A 1IKNC 3H9HB 3A6CH 5D8JH 1G9NC 5I1GH 1ACYL 1KJMB 4MZ2A 2EH7L 4PGDB 2QSVA 4XP6H 1ZKAA 3MV9A 3FN0H 3O6LL 5D93B 4P59L 2B2XH 2HLFC 2ATKA 1NDGB 2RB8A 2ZOLA 5IGXL 1XGQB 5I75C 1H3WM 3QSKB 5LGHL 2CUIA 3S35L 1HQ4A 3HC3L 4XVJL 3VXUD 5I1JL 5AWNH 1FL5A 4JQXA 2QSQA 3C8DA 5ALCH 3V52L 3LSOA 3QEGH 1I1YB 1NCCL 2RHEA 1S7UB 1V3LA 4JM2A 3VD5A 2R56H 3DX9B 2PCPB 4HPOH 4ZO6A 1F8TH 5T5FH 5DYOB 1JHTA 4NO0D 1EJOH 1NQBA 4TUKL 4UUJB 4RGOL 2XV6B 3GBMH 5E8EA 1TPXC 1C8PA 2A77H 5BQ7B 3QFDA 1T22A 3VFWA 2VISA 3HLAA 4JKLA 5C09D 1U91B 4M02A 2ZOLB 4W70A 3P2TA 5IB4A 5AUMA 1KJVB 5J13B 3MA7A 1IAIM 2A1WH 5CIPH 2Z31D 1QBMH 4NQUA 2OBGA 4OZIB 3NH7H 2CK0L 2L0DA 4R90H 3QAZC 3CLFL 1D7FA 2DQUH 3LSOB 3VI3E 4JM2B 2WQRA 4S1DC 2X4PB 5CS7A 3BPCB 2PYFB 4JHZA 3RGHA 4ZUUA 4OCYL 3ABZA 3PIQA 4R4BA 3L3OA 5ID0A 2IH1A 3CPLB 3U30C 3BRDA 1CLYL 2VDRH 4OZFH 1WJ3A 4MJIB 1KT2A 2EH8L 4PBWD 5JMOC 4LCWA 4YH6A 5A3ID 3QFDB 4F15B 1T22B 3QDAA 3DVIA 1EHNA 3GI8L 4PREB 3KPSE 4XPAL 5DURB 1CT8A 3U0PB 2ORBH 3ZDYE 4X4ZA 3N0PB 3VRIA 4TTDC 2DD8H 5ID1A 4QOKD 5IEHA 4M6AA 1SYVB 4P9ML 3H9YA 5T1LD 4KUZL 3MA9L 4FP8H 1NC2D 4EI6A 2DQTL 2DDQH 1ITCA 3VXQB 5F9DC 1H0DB 2PO6C 4ZUUB 1E6JH 3IDIB 1EGJA 1QKZL 3BT2H 1IZKA 2AK4B 1QSEE 3U0WL 3HZMB 4P2OC 1RJYA 2XZQH 3H9SA 5FUOH 2J5LB 3DMMC 5IG7A 5HDOA 2NX5D 2YMXH 4ESKA 4HXAL 2Q3AA 3UTTE 1RMFL 1JNHB 2VTFA 3RL1A 1CGXA 4Z7VA 3SGDI 4JDTH 3O6FB 1WISA 1AIFB 1SHMA 2H32H 1ONQB 4J23A 2VNCA 3EYOB 3Q48A 3KWWB 4LOUC 1UACH 3IFOA 1G7QB 5DRXB 1CVRA 5JIHA 1A7RL 3R1GH 4F9PA 5DTFB 5FYKE 1CD0A 1VGKA 1Q9KB 4LLAA 4QHNA 1A6ZA 4EI6B 3EO1A 1HHHA 4GMSL 1ZOXA 3QEQE 5ISZB 3VXRA 1FLRH 2WIIB 5IMLA 5GJSL 3PQYD 4DN3L 2FRGP 4HW6A 2Q86A 3QXUA 4YHOH 3T65B 5IG7B 1NGPL 1HWGB 1SBSL 2W9DL 4QO1A 2VXVH 5D6DA 1ZEAL 3SPVB 4BZYA 4ODVL 3PHOB 3HI6H 4Z7VB 4RMSA 4JZJB 2ZSVA 4LGPB 4LGSB 4Y2DC 4PB9H 3E1F1 4IDJL 2W92A 3EDDA 2GJ6D 3TYGL 4P3DA 5JOEA 1AGFA 1DL7H 3DJ9A 4JFFE 1HQRA 1UWGH 3QIWA 3MR9A 5DJAA 1AD9B 4EOWL 1SYSA 4HCRA 5FUCC 4QHNB 3BN3B 1YPZF 3MJGX 1RZIA 1Z9SA 4BKLA 5AAWA 1UG9A 1MHHA 3VXRB 3CDYA 1JYVA 2IBGA 5IMLB 5IQ7H 5C0AA 1DBBL 5F70A 3KLAA 5K9QG 2DM2A 2VDQH 4GAYA 4PJBF 2IBZX 4RZCA 4MXQC 2VQUA 3AS3A 2D2OA 3FO1A 2YK1H 2Y5EA 1H3PL 1OAYL 1TITA 1Z2KA 1UWXK 1INDL 3D2UB 3BSZH 5F1NA 4PJAE 4N9GB 4J4PC 2W65A 3QIWB 1BZ7B 3MR9B 5DJ0A 4I3SH 5DJAB 1WT5C 4XMLH 1RU9L 5ITBL 4PG2C 4MAYC 4NZTL 2ED8A 2FL5B 4HDIA 2O5YL 1A4JA 1MHHB 1UXWA 5C0AB 4G6KL 1OAUL 3KLAB 3TEUA 4JANB 3QNXB 1BQSA 4HMDA 4GAYB 3ETBF 4X7DC 1UJ3A 2BNQA 3JTTB 5D7JB 4XPBL 3QQ4A 1F3DJ 1A14H 4GO6B 4GW5A 3VJ6B 4WUUD 3L3DB 1EGJH 1DLFL 2NY3D 4JDVB 8CGTA 1MCEA 1RFDL 4CDGC 3QJHB 3QPQD 3GSNB 1PZUB 2W65B 4ZPVA 4TTGA 1XGYL 1ZHLA 4GRWB 3FO2A 5DJ0B 2Y72A 4PR5A 1RUKH 1WAAF 4DZBA 2P7TB 5GSVA 3WUZA 4H5SA 1CDIA 4C59B 5FDYA 3WFCL 4HWEH 3FQTA 3MLVH 1I9EA 1FL3A 2AJYH 1F4XL 1Z9OA 3HC0A 4KJYA 4P2QD 3MRCB 4P4KD 3RL2A 4YHLL 5DSCA 2HAZA 4L5FL 1EERB 5C92A 2X4QA 1IFHL 2VQTA 5I9QB 2MQCA 5D2LF 4XBGA 1NFIA 5BZWA 1DQDL 1VFOA 3BXNA 5D5MA 4PJ8B 3SY0A 2DRUA 1ZHLB 2VXSH 4P2RA 4DKFH 4G6JH 1T2QL 2V9QA 1LO0H 1P4BL 3K74B 5J6HB 3LQAC 4DVRH 3BDYL 2ADFH 1GCFA 1BIIB 4XPFH 3VFOA 4HEPG 3I75A 5DD1L 5KW9H 3UO1L 5HI5D 3MCKB 4NJ9H 3HC0B 3IAGC 2ZUQB 3RL2B 4P23C 5J13C 1IAMA 1UB5A 5C6TL 4LVHC 2R2BA 3VXMD 5F7KC 5HYIA 1NFIB 4E41E 5BZWB 2R29L 3BXNB 2WLYA 4JQXC 2NNAB 5DFVC 4M6MH 3NZ8B 4P2RB 3O8XD 1UXSA 1Y0LA 4AZ8A 1YUHA 4YE4L 5IB5A 4F7CB 4WDIA 1UB6A 2ICWA 1MQKL 5DD3H 3O2WH 4WCYH 4V1DB 4JHBA 1T1WA 4NBYB 5C3TA 3RTQD 5FM5O 2JK5A 4N90E 1DBJH 3AS0A 3OV6A 4Y5VB 3GHEL 4FRWA 3EHBC 1R3KA 1J8HB 4JEGB 4OCMC 4K3GA 3RIAK 1WGOA 4PYHA 1DFBH 3DXAA 2CDFA 1J05A 4PJBA 1FNFA 4PJ7A 1XCTA 3ARWA 4NQDA 2OJZL 1VEMA 5C0IA 1HOCA 5DJYB 4PY7B 2EDEA 4DQOH 2I9TA 1Y0LB 4PV9A 5MI0B 1T0MA 1YUHB 5DS8A 2DYPD 3L5XL 3VGBA 2ICWB 1CXLA 5JXAH 4DGYH 4GG6E 2YPVH 5TQ2L 4X5XA 1T1WB 2PR4L 3R0MA 4OZ4B 5C9JA 1XR8A 4NO3A 5E8PA 4KUCD 4RFNC 1R3KB 1CFSA 3V8OA 1S3KH 1U3JA 4U1SA 5GRYA 1MHCA 1AQDA 3NTCH 2D03L 4NCC2 2J2ZA 3FFCE 2XFXA 3AM8A 2CDFB 1L7IH 3IFLL 3DV6B 2VLKE 3DVGA 4RDQG 3UTSE 5C0IB 2A74A 4OIIL 4NZUH 4Z5RA 5JHLL 2QQNL 5E1AB 4AG4L 3TBVB 3OR7A 4HJJH 1R5IB 4PV9B 4IRJB 5DS8B 4X0KB 4WEUD 1MRCL 1UKSA 2P5WA 5JW4R 1WITA 1WZLA 2Z8VC 1E4WH 5GGTL 4X5XB 1X5ZA 3REWA 4ZS7L 1SEQH 3D39A 3CFEA 3T0ED 5L6YL 3ARSA 2BVQB 2W0FB 2QQKL 5TH2A 1AQDB 3DECA 1CDCA 4L3ED 4XWGL 1LE9A 3OHXA 4XCYA 1WBYA 2GCYB 3DVGB 4LEXL 1Q8MA 3D85D 1UADC 2A74B 5F9OH 3MRGB 4OUOA 4ENED 4I9WE 4F9PC 4NOBA 1F6LL 4IRZL 2EE2A 1B4JH 2VXUH 2X10A 2YZ1A 4G6ML 3SGJA 4G8FA 4UQ3A 1G7MA 3PWUA 5E00A 3GMMB 1JNNL 1MCBA 5KZCB 4BH8A 5L9DH 3O3EA 3IS1X 4RA3A 5KANG 3SE4A 2COQA 2XZZA 5D6DC 1IZJA 1JZ8A 3CFEB 4LP4A 5DEFA 5TH2B 1U3ZA 3VRJA 3MLXH 2FX7L 3QFJD 5JQHC 3WEXA 1LE9B 2OP4L 4XCYB 4DOHE 1WBYB 4JGUA 5HHOE 3W11C 1LO5B 4TRPH 3I3EA 1M71A 1FRGH 4WU5B 4QNPF 3QIWC 4KRPC 4BFBD 4M5YL 4WI4A 4HG4K 5F7LB 5DD5L 1FPTL 1KCUH 5AAMA 2J88L 1EEZA 4BSWA 1YEHH 3N50A 3CU1A 2UWEF 2R0WH 2FIKA 4UQ3B 1G7MB 3EGSA 4D2NA 4PJHE 3PWUB 3KYOB 5E00B 3LPFA 1FZOA 3O3EB 4Y4KD 1I9RL 3PJSB 4H25A 4M6NL 4OCRH 3S4SA 1MFCH 4HUVB 1IT9L 3ESVF 3QG6B 5EFIB 2BRRH 4JHAH 3B6SA 1CGVA 2FDBP 2ESVE 1NMCB 4NRZB 2NXZC 4TQEH 3Q3GB 5JORB 2BSRB 5D1XA 1M71B 1MUJB 3S4SG 2NY6D 4IEFB 3BD5A 4NQCD 5GS0H 1U8KA 3IJSB 4JPWH 1FNSH 1GL4B 4BSWB 2W1NA 1CD1A 3H7BA 3JV5A 4AT6B