3O0RL

Crystal structure of nitric oxide reductase from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
213
structure length
213
Chain Sequence
b'DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structural basis of biological N2O generation by bacterial nitric oxide reductase
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 53
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o0rL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o0rL01
1DANT 2Z8WC 3O6FD 1XGTA 5LQBL 3JTTA 4HWBH 4YHLH 1TDQA 4DJMA 1BEYL 4KUZL 4JAMA 3G04A 2PETA 3G5YA 2RFXB 1JHLL 3MO1B 4NC1E 4XVTL 3SE3A 1OW0A 1MELA 3EZJB 4PG9A 2NY1C 1V3MA 3IXTB 3OKLB 1YY9D 3NPSB 5JHLH 4LKXB 2QSTA 1YNTA 2QQQA 1F11B 1X4YA 4JQVA 2BNRE 3HTLX 3RZCD 1FGVL 5CP3A 3UTTE 5B8CA 3DXAE 3S6CA 3DTXB 2ZUQC 1Q9KB 4E5XB 3QNXA 5J1AB 5EOCJ 4H8WH 5SWQB 1WBZB 4P46C 1VACA 3KWWB 4HBQA 4TUJB 1F3DJ 5DZLA 2FEDC 2FHFA 5L8JB 2P5ED 4G7YL 5DYOB 1I7UB 2A38A 3PWUA 4O9HH 1LEGA 5FO7A 2V2WB 5BQ7A 5D7LE 1HZHH 5DI8B 3LHPH 3VXTB 2GQHA 4F8QA 4XT1C 2ATKA 4LVEA 3UTSB 3QNYB 5F3BB 2ZUYA 3FT2A 3MV7E 5I73C 5C2UB 2EE6A 3FN3A 1YN7A 4PRPD 2Y5TA 2ZCHH 3NN8B 3HE6D 3M8OL 3RNKA 3WHE1 3ARDC 3TCLA 2EKSB 2FHBA 2QHLA 5IB2B 1FPTL 3HG1E 4ZSOB 35C8L 4WHYH 2AK4D 4GUPA 4GW1A 4OLEA 1UENA 4JZOB 1HYSD 3UC0H 2CGRL 2EIZB 3TVMA 2ZCLH 4YDKL 1UQSA 3JWDL 4I3RL 1XF2B 1OTSD 4NGHH 4C55A 4OUUB 5EUOE 3GI8H 5K59E 3GSVB 1U8JB 4XHJC 3BSZH 1HEZA 2EC9T 3KPOB 1I7TA 4UV4H 4PJBA 4NC0B 4UILH 5KVMC 1MEXH 4M93B 2VAAA 2VDLL 5DQJB 4U1LA 1AFVH 2BHZA 5EOTA 4RGOH 2FLRT 3KXFA 5CZKA 1LO2L 1IVLA 1I9JL 1A0QL 1MI5D 2AABH 3MJGX 3V52H 5C6TL 4EQ2A 3B9KA 1YEJL 5JUEH 2Q7NA 1F3JB 1P4LA 4D3CL 1V05A 5GSVA 1N6UA 4XMKH 3ULVH 5DZNA 1KJVB 3KPMA 1C16B 1JYVA 3OZ9H 2W38A 4IOFD 1H3TA 5ACMA 4FFVC 4Z7NF 2WLYA 1DTUA 1DUZA 2NW2A 1A5FL 3FQRA 5EA0L 4NQDA 2FSEB 3VXRA 5CINL 1TXKA 2HAZA 5SWZE 3QH3A 5SX5H 4PJEA 4X4ME 3OAZH 3U7AA 2FL5A 43CAA 5HGHB 1G6VK 2EC8A 1TNMA 1PFCA 1WBYB 2JB6B 1X4XA 3AM8A 3SDCA 1WTLA 3PL6D 2FX7L 2HRPL 3BZFB 4ODUB 3BP5B 3MLWH 1JFQL 4DKFL 4EIGB 4KK6C 5B39A 1G7QB 2XTJD 5IVZB 2ERJB 5F8RC 1JHKL 4JRYA 4X6DE 1HHKA 5JORB 3ULUL 4ZTOH 2NTFB 3NZ8B 1BM3L 1OP9A 3QCUL 1QRNA 1EBPA 3ZKNC 3O3UN 2G5RA 1NBVL 1NC4A 1UH2A 3P9LB 2HVKB 3I9GH 1AO7E 4HFUL 4QXTA 4YX2L 4X0KA 4YPGB 1YNKL 3G6JB 2XQBL 2VDRL 3NCJL 3W0WB 4JM4L 2V5TA 3RVUD 1A6TA 2DQGH 1S7XA 2J7LA 3V4VL 3VGGA 1L6XA 4D94A 2X7LA 1M71A 1MF2H 1TNNA 3GMPB 5I1JH 4L8BB 2CLZA 1F5WA 4G3YL 2YPVL 3RNQB 3RWDB 3VXNB 5E08H 1S7UB 5B8CC 3TT3H 1L4IA 5DK0B 4OZ4B 1NAKH 4G8GA 4WY7H 3PDDA 1ITCA 2NY1B 1SJXA 3JWOH 3MUY1 4C56D 4NZDA 3ARGA 4O5LL 1JNNH 5I8OL 4MQSB 4BZ2L 3UAJC 2IFFL 2C26A 4ZUUA 3MRRA 4PJ8D 2XZQL 2EE9A 3H8NA 3V6OA 2VO5A 3U0WL 3EOBA 2ZUQB 4WEBH 1F4AA 4A2LA 1MUJB 3MRNA 4MCZA 1RMFL 4RMSA 4AH2A 4PD4J 2DQTH 4N1HB 1OP3H 3MOBL 1NMBH 4BH8A 2MPAL 1UWGH 3FQNA 1GZQB 3VI3E 3KDMB 1EA9C 1IGIH 4Y5YA 5TQ2L 3OB0K 4MJIA 4FFWC 3ARQA 4Q9QL 4RFNC 5F70A 1T4KB 3PHOB 5D2LB 2NY4D 5ALBH 4I0KA 5GRVK 3WIFA 3TVMC 1BFSA 1CFSA 1INEH 4LPXA 1C1EH 1MAKA 3BYTA 2VXVL 5HHNA 2BSTA 5IVXF 4OGAD 5JDSA 3ARDB 2FATH 3BHBA 2GUOB 5DJ8B 2Q76B 1F4WL 1JRHH 1Q38A 2YSSA 4PRHA 2VXUH 3MA7B 4PB0H 4G8IB 3GNML 2DLFL 5A40E 1BWMA 1CLYH 5FM8A 2AK4E 2X10A 4UDUA 4F3FA 2BY0A 5JHDB 1WAAF 4YK4C 4PJXB 5DUPH 3KYKL 2VL5A 2BOCB 3GSNA 3B9KC 3QDHA 4P2RD 4BFIB 4JQXC 2LU4A 4TNVK 4ZXBA 5IP4A 3NAAH 1HILB 5M95B 2QKIA 1KJ2H 1UB5A 4GW5A 4QHKJ 5TDNB 3TO4D 1MFAH 3O8XA 3WE6B 2CO7B 5M7QA 1FZOB 3QIWD 5BO1L 1CDJA 1B3JA 1K4DA 1XH3B 5T3ZL 5ICZA 3LN4A 3WJJC 5C07A 1JUFB 4W68A 1X5ZA 1P4IH 4JM2A 4Y0GA 2C3VA 4RBPH 1E4XL 4YE4H 1INQB 4ODHL 3TYFB 1DBMH 4ESKA 3PWPD 4JHZA 4EDWL 4R8WL 2AJVH 4UT9L 3MLXH 2VIRA 3MCLH 3AM8C 3KS0J 3I02B 3SDCC 4NPYB 3S5LA 5HDBE 1WZMA 3WIHL 3MBEA 3DYPA 3CXDH 4QRUA 4K2UH 1UVQB 2NNAB 1ZTXH 2Q3ZA 1IEBB 4JJHA 5JOPD 1BPVA 2A77L 4P23A 5GS3A 4X99A 1R3IH 4NZRL 2GFBB 1KIPB 1L6ZA 5I30H 3IS1X 3QUZA 5DRXA 4LAJH 1LILA 1NFDA 5EZOH 3GUTB 4MD5A 2F5BH 4XTRD 3D48R 4FZEL 4U6YB 2J1KA 1Q1JL 3H3BC 5KTEH 4WWID 1MCDA 4NOFA 3VFOA 1HNFA 2VWEC 1MQKL 3T65A 2XTJE 4L3AA 1SHMA 4LHJB 1S78D 1XGTB 3JTTB 1VCAA 4WEUD 2MHAA 2FIKA 3U4BL 2HTKC 4NNXA 4TSBL 3PXJA 4U1GB 4JAMB 3HS0A 3G04B 3G5YB 4HCRA 1FVEA 5IBLD 3SDAA 1N5AA 3TH3T 5EC2A 2AXFA 1P6FA 1NSNL 4PG9B 4K71B 3ARGC 1VFOA 4M7LL 3IT8D 1CQYA 1YNTB 5KSAC 1BECA 1IAKA 4M6AA 1GIGL 5B8CB 3FO0H 3CX2A 4O4YL 3QNXB 3MRQB 2YD1A 4LHUG 3H9HA 4K9EH 2YC1A 2Z35A 4LASL 4AEHH 1VACB 3K46A 2EDLA 3VXRE 3S35H 4HBCH 2ZJSL 4RISH 3PWUB 1X5XA 2Y06H 4C56E 2F8XC 1FCCA 4PJEE 4Y8AA 2D4DA 5FGCE 5KVGH 4Y5YC 5EBMA 5FO7B 2O5XH 1HKFA 5BQ7B 3EOYG 3UO1L 5DMYA 4MXVF 1M7DA 5HI3C 5IHUL 1CGTA 1IILE 3EDKA 3HUJA 5EU7E 3RFZC 5D4QA 4LSVL 4DW2H 4KTYA 2ATKB 2BHUA 2DWDA 3HNVH 4KVCH 3FT2B 4KRPC 1YEKL 3RVXD 2Y5TB 4K8RD 2F8VA 1S8DA 3KG5A 1KTLA 2WQRA 4JB9L 3RNKB 5L6YL 3GGWA 2IQAB 3TCLB 4V2BA 3D6GA 4J4PA 4RFNB 1QRNE 4HK3N 4GUPB 1ZHKB 4E41D 3FZUC 4N9GA 5DQDH 3T1FB 3U1SL 5EZLA 3C6SB 4JGUA 3TVMB 5ADPL 2LU3A 1UQSB 1YMMA 5F7YC 1J5OH 1FL6A 4RIRA 3QUYC 4HIXL 4R0LC 2WBJA 1X5KA 3I3EA 2PYFA 3IAPA 1HEZB 4H20L 4OD1H 2VLKD 1I7TB 3F7PC 4ZXBC 4PJBB 2EDKA 1VSCA 1T2QL 4ZFZA 1EX0A 4U1LB 5DEFA 4LLVA 3KXFB 3O8XC 3U83A 5AYUL 2VDKH 2EIEA 1UZ6E 4JQIH 2XA8L 4GRMA 4YK4B 4Y7MA 4UAOB 1PD6A 4PFEA 3R1GH 4XWOC 4JZNA 3B9KB 1FORL 3UTPD 6FABL 5B38A 2YBRA 1P4LB 4JM2C 4MA1C 5C3TA 3DJ9A 1SJHA 3HI5H 5GSVB 4KZDH 3KPMB 4P2RE 3MLZH 3V6OE 3P4OB 4AEIH 1KTDA 1UG9A 3MFFA 4TPRH 1DUZB 2NW2B 2B4CL 5SV4A 3MBEC 3FQRB 4U1MA 2BFVL 3OGCA 4MNQD 4NQDB 4RGND 2AKRA 2NX5E 4YWGL 4HPOH 3OKOA 2OP4L 3QH3B 4HWUA 3IB4A 3DARA 4P23C 5HYIA 3VDCA 2XN9A 4JVWA 43CAB 4PGBA 4LVHC 4F8TA 4MCYA 4DN3H 5CSBA 2NCMA 1DBAL 3D39D 3SDCB 4MJIE 3DYMA 3QUZC 3PWPE 4GOSA 5J4MA 4CAGA 4FA8A 5B39B 4H1LG 5L2JA 5FV1L 2JCCA 4JRYB 2HKHL 2NQCA 3LZFL 4NOBA 1D7FA 5IMOA 3EFDH 4W4NA 2UZYB 1R5IA 2KL6A 1LO4L 4MDJA 1NC4B 1QSED 3SGDI 4OTXH 1FNAA 4QXTB 4X0KB 3BGMA 3RBSA 4PRHE 4GQ9H 1OF2A 2BHYA 5GRJL 3SDAC 1A6TB 1S7XB 4N0YH 3T2NH 5DD0H 1S7QB 5F9JA 5DJXA 1J8HA 2X7LB 1M71B 4TUKL 3EHBC 4K94L 4KI5C 2MNUA 2CLZB 3CSGA 3U0PA 1NLBL 1EBAA 4KDTC 4DGVH 5E94A 1J0IA 2KUTA 2WK2A 3GJEA 1OTTD 3NFSH 1HHJA 4G8GB 5A2KH 5D7IF 2PXYD 4FMFA 3ZTNL 4YHIA 3ARGB 1NKOA 4XBEH 3N85H 3VXOA 4ZUUB 3MRRB 4OCNC 1JWMA 4IHOA 5GGQH 3EOBB 5TFSH 5JW3H 4JHAH 3MRNB 4OZIE 1D5IH 4BQBA 4MCZB 3OJMB 1JI1A 3SDXF 3L9RA 1U93B 5FHAL 3ZKMC 4BH8B 1MHCA 3VW3L 1G9MH 3FQNB 3WFEH 4PJ5D 5FYKD 4YQXL 4Y5YB 1NCBH 4MJIB 1MVUA 5E2WL 4HLZH 4J4PC 4B0MM 1J0ZA 2GITA 5IBTL 1Y18B 4JG0H 4KROC 3HMXA 3WIFB 5AWNH 4WNQA 1QQDA 3S3PA 4CDHA 5D1XA 4NKDA 1KXTB 4PJ7A 4PJCE 3HI6L 1CFSB 1BFVH 2I25N 4KRPB 1OAXH 1BZ9A 3PDGA 1KLUA 5D1QA 1Y6NR 2BSTB 5HHNB 4OAWA 3MV8E 5JDSB 5IFAH 3MROA 3BHBB 2CJUH 3K74B 5DT1L 1N3NA 1GJIA 4Q97A 4OZFH 3EYUH 4LQ1A 1K4CA 5LBSL 2YSSB 4PRHB 5BS0D 4DVRL 4ZD3H 1KN4L 4X80L 3QBTB 2D4FA 4JFED 4UDUB 4M5ZH 4E41E 4F3FB 5AG9A 1YJDL 3K3QA 4BZYA 1A3LL 2VL5B 2W0KA 2CO6B 2NYYC 3IU4H 2EECA 4OLWH 4ZXBB 2FR4A 5E9DD 2OJZH 1OAQH 1EGJL 5C0BA 5CP3H 2QKIB 1OARH 1UB5B 2WBKA 3PHSA 1INDH 1LK3L 3O8XB 3QDGA 4M7ZC 2VLKE 4G6JH 5I19H 1I1RA 4HW6A 1DZBA 4WGWB 1K4DB 4HEPG 5ICZB 3LN4B 2XWBA 5CILH 5C07B 1J1XH 4A6YA 4YHKL 1WLHA 4PYGA 2KPNA 3PGFL 4JM2B 4GXVL 3HC3H 4MA1B 4HUWA 3RIAK 3QFDA 3UTPE 3VI4E 5KS9F 5GRWA 5D6DA 2VIRB 2NXZC 4GBXD 4QRRA 4HT1H 3S5LB 3EBAA 1O5DT 5CEYA 4PLJC 2QSVA 3MBEB 3ZO0A 3UMTA 5DLML 3L3JA 1T1ZA 4QRUB 2F53D 5TQ0L 4OJFL 3VFPA 4GRWE 5H37H 1KB5L 4P23B 4YHPA 4Y2OA 2ICWI 4X99B 4JRWA 4LVHB 4YXHH 2L7JA 2VLRE 4EJ1C 3QUZB 5KSVA 2DD8L 5DRXB 2VUYA 1NFDB 1OHQA 4S1DC 4MD5B 2R2HA 1N4XH 4ODTL 3OPZH 2CMRH 1A3RL 3NABL 1JYNA 3ILQD 1QUNA 5CGYD 4QOKD 4Z7OF 3QPXL 1FCGA 1WFUA 4Z7UF 3VFOB 1X44A 1QLRB 3T65B 5I15L 1EEYA 3MLSL 4JR9L 5GGUA 3KPSD 4KRNA 4ZUSA 4CMMA 2MHAB 2FIKB 5JTWA 1U8PA 3MRHA 1HQ4A 4JFDA 4BZ1L 1FVEB 2XFXA 1YPZE 3SDAB 5CSGA 5EC2B 1XGQA 3NH7L 3WFZA 2FHCA 2QSCH 3RX7A 4M5YL 5BOPA 4PS4L 4GQPH 3B9VA 1QBLH 1AR1C 1IAKB 3TJHC 5HDLA 1OOAA 4LIQE 4IMLA 4LCWD 3AMKA 4PBVC 3O41A 4J6RL 1TETL 4XP9H 5GGTH 5DHVH 1IGCH 3CFEA 3H9HB 5DD5L 2YC1B 2F8OA 2Z35B 3I50L 4MXQD 1REIA 4Y4KA 2LAGB 1U8MA 5B3NA 4FHBD 4PGCA 3C9NA 1MRFL 3OB0H 1A7RH 5EBMB 4CVWA 3D3VD 1CGWA 1WWBX 3DGGA 4KY1H 1KXVC 1WZ1H 1M7DB 3JV0A 2DQFA 3L1OH 4P4RA 5D1ZD 4JO2L 3HUJB 3BWAA 4HC1A 4LCUA 3GI9L 2E7CA 1BJ1J 2DWDB 3ZYZA 4HFWA 5E8EA 4F9PA 2XG5A 1YN6A 3FRPG 1UWXK 2DJ4A 1S8DB 2OR9L 1XCQA 1KTLB 1M4KA 1WZLA 3GGWB 4IRJA 4M1CC 1RZJH 3V0WL 1HINH 4CBPA 4PJ5E 2ED7A 4R97B 5FYKE 5DVMA 3AXLA 4KROB 4N9GB 1DQMH 5EZLB 3T77A 2IADA 3RVTD 2EDJA 1YMMB 3ET9F 5SWSD 1FL6B 3GEWB 4RIRB 1CGUA 3ARRA 1HI6A 4RRPG 4TTDD 4YXLH 3VXME 2WBJB 1KCRH 2PYFB 2OZ4A 1YEIL 1PGRB 5GGVY 1P7KA 1IAIL 5DEFB 3FFCD 1EZVY 4TVPD 2ESVE 4HJ0D 4E0RA 5BS0E 5MHSD 4JZNB 3MRKB 4JFEE 5B38B 2YBRB 1RQ5A 5KVDL 1SJHB 4PTUA 4KKNA 2X4SA 3BMWA 4U0QB 3VGAC 3EDJA 4ODBD 4M7ZB 5F21B 4K3EH 3JTSA 5D6DC 5E9DE 1QHOA 1KTDB 1V7NH 3MFFB 1B4RA 2GSGA 3S98A 3DHMA 1JWSA 4YHLL 1A02N 4U1MB 3OGCB 2DAVA 2AKRB 2EDYA 2DN7A 3OKOB 3ELAT 1WC7A 2XN9B 5E03A 4PGBB 1IARB 2DIJA 2W9EH 2E8ZA 3K4ZA 3W11C 4YGVA 3U7WH 4J3OC 2M2DA 1R24A 4OLVH 1BJ8A 3O2VH 2D7TH 2VN4A 4P9MH 2CK0L 2UWEA 3ARED 4F37K 4JCMA 4OFDA 4QF1B 1YUHA 5L2JB 3TM6A 4PJ7E 2JCCB 4OF5A 3HE7A 5IMOB 2F53E 4H8WL 3BKJH 4BKLA 1R5IB 4MDJB 1MY5A 2DOCA 5MI0B 4B53A 1KBGH 2EEAA 1W0YT 3BGMB 5F7EH 4FS0A 1D9KC 4P5TA 1LK2A 4OLZH 4O9HL 1OF2B 3RL1A 5E6ZA 3GSNH 3PGDA 5CKGA 5DDHA 5ITFB 1HZHL 4S1RH 3LHPL 5F9JB 1BP3B 1GC1H 4R7DA 5DJXB 1J8HB 4DUVA 3WS6C 1IGJA 1NEZA 3UTZA 4NHUA 3U0PB 1OCWH 1U8HA 4AIXA 4ZUTA 3TA3D 1YEGH 2YA0A 2ZCHL 2VJXA 3KPSE 1SBSH 2J8UF 4GRLD 5E94B 2C3GA 3BW9A 3GJEB 1HHJB 5CJ8A 5B21A 1MCLA 1FC2D 4NC1C 3DSNA 1OGAA 5HDQL 5AZEH 1XMWA 4YHIB 4LDOB 3O3BA 4Y2DD 3B8SA 2ZCLL 4OIAA 4Y4KC 3VXOB 1JWMB 2P8MA 4IHOB 2DQHH 4NGHL 3S97C 3Q6FA 3GRWH 2WMPA 4PJGF 1GAFL 3GI8L 5F7LB 4MAYA 2BSSA 3MODH 2FECI 2R0LH 2IPKA 4UILL 2QSQA 4LCWE 3L9RB 4NZTH 1MEXL 2GCYA 1AFVL 1FZJA 4DN4L 4X4XB 4K9EC 1GOHA 2W60A 2H8PA 1MVUB 1FFPB 3V52L 4XI5C 1VDGA 5JUEL 3SDYH 2D7OA 4NQVA 2GITB 2BSRA 5IJKA 4XMKL 3D3VE 4WNQB 1QQDB 3ULVL 5D1XB 5FK9A 4UT7H 4NKDB 3OZ9L 3NA9H 1CZ8H 1BZ9B 2DLHA 1KLUB 3O3AA 1T7ZA 2C7UA 5D1QB 4K8RH 4OAWB 3MROB 1TITA 3VFTA 1XCTA 2VZ3A 3N1PC 1K4CB 1P2CA 3NIGE 5DK3A 4R4FH 3ZDYE 3DGCR 4JFDE 2Z31D 3RKPA 1OB1A 4W70A 2PUQT 2AV1A 4KTEL 4O00A 4EXKA 5CGMA 4H0HB 4UOW1 5SWSE 1CL7I 2FR4B 4PRPA 5DVKA 5C0BB 1BOGA 5D8JH 3HE6A 4OLUH 2M1KA 3QISA 1FFRA 3QDGB 3TO2B 5JPNA 4JN2A 3C6LC 4MJ4A 5CP7A 2OL3A 4N90D 2XWBB 4MHHI 3I9GL 3FFCE 3S7GA 4A6YB 4MA8H 5SX4H 4HUWB 4LDEB 1HWHB 3QFDB 5MEND 3VGAB 3SO5A 5JPMA 5L2KD 5GZNC 4IS6A 4OGXH 4QRRB 4ZO8A 1MF2L 1NGYA 1YQ2A 4GRWH 5CEYB 4ELME 3L3JB 4DGYL 1Y0LA 1T1ZB 3FQXA 1KNOA 3VFPB 1MI5A 2NY3D 4YHPB 1U3JA 4NWTH 2VZSA 1NAKL 1JZ6A 4KDWA 3BD4A 5FYKU 1CDUA 3JWOL 4DCQA 5KSVB 1JNNL 3BPCA 2R2HB 5JMRA 4NRZA 2OCFD 2VSCA 3BKYH 3EOTL 4XAKD 2NY2C 1IQWL 1URLA 4WEBL 1BVLB 2W65A 1EEYB 3INUL 2DQTL 5GGUB 4M4PA 4EDXA 4ZUSB 4CMMB 1NMBL 4JREC 4OI8A 1U8PB 3MRHB 1HQ4B 4U49A 2VITA 2KZ1B 4L8CA 4PRID 4JFDB 3OR6A 3PL6A 1IGIL 1N64H 1KN2H 2CSPA 3GB7A 4G8FA 1XGQB 4CJ0A 1H0DA 3EJYD 4C4KO 1SYVA 1Q0YH 4N0CD 4EXPX 4LIQH 5C3LD 1X5HA 1IC5H 4HS8H 3G9VA 5E5MA 1INEL 4TN9A 1C1EL 3D85B 3ILPA 4PRBA 4IMLB 3O41B 3O6FC 3RDTD 4XAWH 5L8KB 1C5DA 1M1SA 4MAYC 2AQ1A 3CFEB 1JRHL 4HKZA 4H0IA 4LSQH 3P4NB 4KXZH 2VXUL 1ZANH 4PB0L 1UGNA 3PQYE 1TVDA 1NANH 4Y4KB 1CLYL 1EJOH 1I1AA 1JPTL 4OF0A 1U8MB 4PGCB 3C9NB 3BGFC 1L7IH 4PY7A 5DUPL 3DGGB 4HK3J 2ICWA 4RX4D 2DQFB 4JFPA 4P4RB 4L4JA 3X3FH 4X6CE 3NAAL 4TRPH 3BWAB 3RZCC 3S35X 4LCUB 3VU2A 5IJKC 1JK8A 4JKKA 5IVOA 1MFAL 4NQCD 4N8VG 4JGJA 1YN6B 2DQEH 2P8PB 1OY3B 5FYKH 4HWZA 3DUSA 4S1SL 1XCQB 1ZA3A 3O2DH 1KCVH 4IRJB 1JF1B 3ZE1F 4LU5H 5TE7L 5IJVB 2AAVA 1FG2A 1P4IL 4YE4L 3AXLB 1DBML 4Z7VE 3T77B 1EVTC 3PIQA 2AJVL 2IADB 3QA3A 3MLXL 3MCLL 1T5XB 1HI6B 5HY9A 3ESVF 2GJZA 5HI5D 3CXDL 4K2UL 4L1HA 3TT1H 5KSBE 1XGRA 1FNHA 2QADD 2YXFA 1P7KB 3HE6C 3WCYA 1R3IL 3D0LA 4XNYL 4N0FA 1RZ7L 2A6JA 5I30L 4PJAA 4E0RB 1HYSC 2WNGA 1IC7H 2F5BL 4LRIA 3IYLW 3G6JF 4HJGB 1H9VA 2DLGA 3WDHA 4PTUB 3G5ZA 4IJ3B 3QQ4B 4UV7H 2R1YB 2PYEB 2X4SB 1UM6L 2BSED 5L88H 3JTSB 4PJIE 1E6JH 4I3SH 2FJHA 3PNWA 5BZDA 2GSGB 1JPGA 2DBJA 3UBXA 1JWSB 1V5JA 1BFOA 3CK0L 3QDJD 4I0PA 3DX6A 1BVZA 1KPVA 1VPOH 1WC7B 1MHEA 1JVKA 4QTIH 1RUPH 3MMEA 3VA2C 4YGVB 3ZTJH 5C8JA 3ZDXE 4GG6E 3O6LL 2B8OT 3KJ4B 2D9QB 2UWEB 1IFHH 5DURB 4I13B 1J0YA 2YD3A 5L2KE 2IANA 3QIWA 4IOFC 1YUHB 1MJJA 4LSDA 3CVHA 1NPUA 5FHBL 3Q0HA 3TJEH 3HE7B 2EH7H 4RMTA 3TBTA 3ES6A 4BKLB 5I1LA 2GKIA 4POUB 4X8JA 3BWUC 3KPNA 3BP6A 4AEHL 3QUMH 2IBGA 2EKJA 3S35L 3L5XH 4W6YB 3IDYC 4HBCL 4RISL 4P5TB 2Y06L 1LK2B 2NY2B 3PL6C 5KVGL 1DQDL 4JFZH 4RMQA 3RL1B 4RZCA 3CAFA 4EUPG 3PGDB 1G0XA 1ORQA 2AV7A 5D2LF 2DQJL 2C4FU 3E3QC 3QIBA 3A67H 2VISA 4MA3A 3VFSA 1PW3A 1PG7X 3KHOA 1IGJB 3PG2A 1NEZB 1KFAH 3ARFA 3STZA 2X89D 4DW2L 3UTZB 4O2EA 1QR4A 3HNVL 4JREB 4NHUB 3WFDH 4KVCL 3QXWA 1B88A 4NHCH 5DTFA 5JXED 1U8HB 4ZUTB 3QG6A 1WBXA 1YC7A 3BW9B 2P7TA 4KJPD 1P84K 5GJSH 5KOVC 4PRIE 4PJFE 2F54A 1OGAB 3B9DA 1TQCC 5DQDL 2ORBH 3F6LA 3RVUC 1UA6H 3O3BB 2VERN 4Y4FA 3RUGA 1I1AC 3K80A 1J5OL 2P8MB 4PJXF 3OF6A 3Q6FB 3FN9A 3O6FB 4KRMB 4MAYB 2BSSB 3L5JA 4MQXD 4OD1L 5EU3A 5F89A 2GCYB 1PKQE 2WW8A 4RSVA 1QFWI 4ETYA 1FZJB 3CU7A 1CF8L 1VFMA 4WW2A 4OQTA 2XKSA 1E27A 2VDKL 3B5HA 4JQIL 4E42A 1JL8A 1UWXH 2W60B 2H8PB 3VE0A 4K3HA 3R1GL 1KENL 2FX8L 3ULUD 4ORGA 3PP4L 4PJ8C 3BFOA 4TULH 4DKDC 3HI5L 4NM8H 1SYSA 3LH2H 4KZDL 1VEOA 5EU7C 4OCWL 5FK9B 3BO8B 3MLZL 3GIVA 1FN4A 2OJEA 4AEIL 4QRSA 4TPRL 3O3AB 2C7UB 3JVGA 5AYQA 3PABB 1FNSH 1OWRM 3VFTB 1JZ2A 1XCTB 1AP2A 4GMTH 4XGZA 5GS0D 1P2CB 5HHPA 2IBZY 4PRDA 1RZJC 3SKJH 3I3BA 3RY5A 5DC0A 2BVYA 4HV8A 4DN3L 2CDGA 1OB1B 3GK8H 4LRNL 4MYWB 2AV1B 1G9EA 2APVA 2B1HH 4LRIC 5I75C 5JMOC 1A14H 4PRPB 4KI1A 2IWGA 2HT2D 1ZHNB 1BOGB 5FIEA 3TFKD 3HE6B 4LSRH 5T1LA 3KLSA 2BVOA 1V7MH 2JLLA 1EEZA 5JPNB 3EFDL 4JN2B 2OBGA 3MA9H 2AJSH 3QIUD 4CU8A 5CP7B 3DX7A 3L5WA 5KAQG 2OL3B 4OFPA 1KLGA 1YEHH 3O81A 1PG7L 4OTXL 2W07A 5FCSH 4YHOH 1XR9A 4ODVH 4MD4A 1I85A 2JJSA 4N0YL 3E8UH 5CD5D 3SEPA 3T2NL 4Y5VA 3V0VA 3WUWG 3E1F1 4KC3B 5DD0L 5KW9L 4IS6B 3MV9A 3DMMD 4A2MA 4P3WA 3SKNA 3TO4C 1Y0LB 3FQXB 5HXMA 1TJIH 1KNOB 3QIWC 4DGVL 1MI5B 4TSAH 1RJZA 2VTFA 2A6DA 2KH2B 5F7DA 3NFSL 3P73A 4CVUA 2MQ0A 4DCQB 1CD1A 3ARVA 1Z9OA 2YD9A 4K55A 3WL9A 3BPCB 4XBEL 1B6UA 3N85L 4NRZB 1T80A 2RB8A 2QTEA 3EYOA 4U1KB 1HSBB 4ISVA 4XNMA 1UYWH 5GGQL 1P5VA 3WJLA 3VXSD 3SO3C 3QDMD 4DGIH 1CT8B 4U3XA 3QIBC 1D5IL 2W65B 1K6QH 1KCUH 4UB0H 5IFHL 4IRSA 3RL2A 5E8PA 4EDXB 3G6DL 3W82A 3BIBX 2BDNH 1NDMA 1T89C 1G9ML 2VITB 3IDYB 3CMGA 4L8CB 3WFEL 1MCHA 3D39A 3OR6B 1LD9A 3PL6B 3QHFH 4WI2A 3GB7B 1NCTA 1H0DB 3IAGC 5HHOA 1AY1L 1SYVB 3RJQB 5HYEA 1DBKH 1XIWD 1KSRA 2Z93A 4JG0L 4CN6A 5AWNL 4M3JA 1ZV5A 3WXWH 1MCCA 4Y4FC 4BK5A 5E5MB 1N6QH 5JIHA 1EFQA 5IF0A 5C1MB 4WI5A 3ILPB 4PRBB 1P1ZA 1QSEA 5IFAL 1C5DB 3ARZA 2WWKT 2CJUL 4PJBF 4YFEA 4HKZB 1D6EA 1QFUL 3EYUL 5AD0A 1BFTA 5IBLC 4NUJA 2EDNA 4ZUWA 1EO8H 4ZD3L 2E7MA 2WUCH 1I1AB 3HMWH 4M5ZL 3CDYA 2ZOKA 2YMXH 4LLWA 4PY7B 4DVBA 2DLTA 4LPVA 3RGVD 2ICWB 3IU4L 4XWGL 3OAYK 1V8HA 3ZYOA 4JFPB 3VFWA 1CIDA 2OJZL 4F80A 4ODWA 1OAQL 2Z8VC 4HH9A 1OARL 1JK8B 5BZWA 3FO9A 4LSUL 4EI5A 1INDL 2IANE 4G6JL 2MKLC 2BXYA 3RJDA 4HWZB 3DUSB 3UJTH 3IJSA 4GAGL 5CILL 4QNPF 1J1XL 4NKQB 1U95A 1FG2B 4Y19E 3HC3L 1RIUL 4PJ8B 1Q9OA 1KLFA 2JJTA 1JTTA 4Y1AD 5HYJD 1TVBA 3BN3B 3PIQB 3QA3B 3U0TA 4Q6IA 4DFHA 4HT1L 4P9HC 1IZJA 2IH3A 2NY0D 5MP6H 5HY9B 3FQUA 2GJZB 1CFVL 3LOWA 1W8NA 1VEMA 2HG5B 4M7LT 5D96C 4YAQA 3RVXC 5DD1H 3X3GL 5JLZA 4K8RC 1XGRB 1ZHLA 2ZUUA 2YPLA 3D0LB 4N0FB 5IK3A 4D9QE 5C0CE 4YXHL 4PJAB 1TZHB 2VDPH 3BUYA 4LLDA 8FABA 2HJFA 1N4XL 4RMRA 2BVTA 3OPZL 1BD2D 3P2TA 5I75B 4OD2A 3FB6B 1J86A 1L9NA 5C2BH 3UDWC 4GAFB 2OK0L 1I85C 4NT6A 3WN5A 4Y5VC 1T04A 1T1YA 2FJHB 3PNWB 5BZDB 2Z92A 5GXBB 1IC4L 2J8HA 3UBXB 2HKFL 4JO1H 3CNKA 2JIXA 1BFOB 3UYOD 2FO1A 5D7KD 1BMGA 3DX6B 2APFA 1KPRA 4I0PB 3FHQA 1U2HA 4M8QA 1KPVB 4BQ6A 4AMKH 4Z7NE 1LO0H 1MHEB 3QNZA 5DO2C 3EW3B 4KMLB 4MA7L 4WO4A 3MLRH 4I1NB 2CLRA 3CCHA 3DNKA 3MJ6A 3GSWA 4BH7A 3T04D 1QBLL 3QIWB 1JPSL 2DM2A 2J6EA 1MJJB 1JIBA 3IDXH 1BQSA 4J3UA 3CVHB 4XXCA 1TJHH 2DIAA 1XGUA 3TBTB 1T7YA 4XP9L 5GGTL 5FYLL 3ES6B 1IGCL 2JK5A 5I1LB 4RGNC 4IRSC 4XPTH 4X8JB 2YZ1A 5EPMA 3KPNB 3BP6B 3LMJL 3ETBF 2CR6A 3UROR 1NQBA 5FB8A 4QXUL 1S7WA 4EN3D 2YD8A 4RZCB 4KY1L 2FGWH 1ORQB 3GJFA 1WZ1L 2AV7B 2GYSA 3QIBB 3U9UA 1A6UH 2VISB 4MA3B 4DTGH 3VFSB 4HG4J 3ARFB 3STZB 2HFGH 4O2EB 1K85A 4WWKD 3QWRA 5DTFB 4AT6A 1EHLH 5FM5M 3QG6B 4GAYA 4I18A 1WBXB 1FLRH 2P7TB 1GYAA 2J3SA 4HS3B 1T2JA 2B2XH 4EOWL 4FTVA 3O0RH 1ED3A 2F54B 3MACH 2NY5C 1IGFH 1DQML 5MEPA 4S0SD 3FOLA 2QHRL 4NKOA 2O5YH 2V5RA 1AKJA 4CW1A 4Y4FB 3PDOA 3RUGB 3H7BA 1B4JL 4QRPD 4YXLL 1H3PL 3BXNA 4MMZC 5KG9A 2AJYH 1KCRL 2XV6B 3QFJE 5L9DH 4UNTA 1YYML 5EU3B 5F89B 3LRGA 1S7RB 3TN0D 1OTTC 1CE1L 4WW2B 1OVZA 4PV8A 2NLJA 4M3KB 2HYMA 1ZAGA 4E42B 4JKLA 3VE0B 4JM2F 3VXUA 1FO0H 2ED9A 2KZWA 4ORGB 4MXWL 1AJ7L 1P9MA 1F90H 1L7TL 1SYSB 2JJTC 2COQA 2Y07H 3GIVB 4K3EL 1FN4B 1W72A 3ZL4H 1A22B 1ZT4A 3KYAA 3MZGB 4P2OD 4WV1C 5KAQF 2P5WE 1AP2B 5C70A 2QLVB 4NKMA 4XGZB 3QT2A 2YD4A 4LLYA 5HHPB 4PRDB 3I6GA 5LGHH 3WXVH 3RY6C 4FP8L 1G7MA 2D3VA 2W9EL 2HWZH 5F7MC 3RA7H 1BEYH 4HV8B 2CDGB 4OLVL 1NFDF 3O2VL 2D7TL 4L4VA 5D7SL 3CH8A 4Y1AE 2FB4H 5DFVD 3IETA 4J23A 1HE7A 5DK2A 5BV7H 2J5LC 3EO9H 3EKCA 5T1LB 1WAAE 5GZOD 3CSBA 4PGZA 1EEZB 1ZVSA 5CBEA 3WN5C 3BKJL 4G9FA 4D2NA 5JR1H 1PY4A 1JJUA 3DX7B 2V9RA 5GS2H 3M17A 3AB0C 1KLGB 1A6WH 1KBGL 1T6VN 1XR9B 4OLZL 3ESUF 4G6KH 4NKIL 4MD4B 2V6HA 3GSNL 1BD2E 3TBSA 5CLTA 4I77L 4Y5VB 4NBZB 4S1RL 2VC2H 3GSOA 3GM8A 4XVSH 3V0VB 4MZ2A 1GC1L 3MV9B 4G7YH 4KI5F 4OGYH 5DMGC 4YDLC 1H8OA 3SKNB 3OKEA 4QRQA 3E2HC 4LCYA 1N8ZB 1OCWL 3QJFA 3QUXD 2GTZA 1YEGL 1RJZB 1SBSL 2A6DB 3EYFB 3MOQA 4XXCC 1YMHA 5D7KE 5F7DB 3P73B 5I9QC 5HGAA 2N4IA 4HUXA 1CD1B 2H32A 2CIKA 1NAMH 3C5JA 1A47A 4HKBA 2OTWA 3IAQA 1P6AB 1Z3GH 3EYOB 3LKSA 4GBXC 4Z7WB 3KLHD 3O2WH 2DQHL 4ISVB 4XNMB 4R26L 4XCNA 35C8H 3GRWL 1PZ5A 4M7KH 4P2QA 1KIQA 2ZG2A 3SE4A 4MNQB 3HUJF 1UJ3A 4IRSB 3JWDH 3RL2B 4I3RH 4NZTL 5E8PB 5K93A 4OCYH 5D7JD 1NDMB 3V79C 5KVFL 2LVCA 2FEEL 5DZOA 4S1QL 3D39B 1Z0MA 1LD9B 3V7MA 2YZ8A 4I18C 4PLKC 5JA9A 3RWFA 3TZVA 4NQEA 1A6ZA 4JY4A 1JGLH 5HHOB 3ILQC 3B5TA 3VH8G 5CGYC 2Z93B 4LVNC 1I9JH 3BH8A 4UT7L 2E7LA 1QR1A 1QFOA 4WFHD 3NZHH 3WYRA 2ADJA 4UDTA 1YEJH 3NA9L 1CZ8L 5IF0B 1RZKC 4JFFD 1P1ZB 4AEEA 4HIIA 4M6NH 3VDAA 1SM3H 3N1GC 1QSEB 2MOVA 5CIPA 2MKWA 1NEUA 4KK5D 1MJUH 1WCBA 2R56H 3ZZ1A 1D6EB 5IWLC 5AD0B 4NUJB 5F7WC 3P77A 1OD7A 2Y72A 1A5FH 2XZAL 4K3DH 1XT5A 5EA0H 2WAHA 3CJJA 2IMNA 4L8SA 2ZOKB 1T3FA 1JZ5A 4LLWB 4L3EA 3SY0A 4DVBB 2YPKA 2E6QA 1EUUA 4X9FA 4YBQC 4HQQH 3VFWB 4G43A 3TA3A 4ODWB 2ADFL 1QSFE 4U7KA 1CGXA 4HH9B 4CKVX 5D8JL 5E7BA 5BZWB 3FO9B 4EI5B 1J11A 1TCMA 3GMLA 4DKFH 4Y88A 5T3XL 5ID0A 4L9LA 4MXVE 3HHRB 1PAMA 3IJSB 4MXQC 2GK2A 3K8KA 5FKAA 3RPKA 1U95B 4MA8L 1BM3H 3K7UA 1Q9OB 4F2MB 5C7XL 1R6VA 5E5UB 1TVBB 1Z9LA 3U0TB 4Q6IB 3L3DA 1CTOA 4QHKI 1S9WA 2LABA 4OGXL 5HVFB 1KCKA 2IH3B 5C08A 4Z9KB 3V7AE 7FABH 3FQUB 3NCJH 4JM4H 4WUUD 1ULVA 5DF0A 4WTWA 4NZJA 1Z2KA 5GS0H 2JCCF 4YAQB 5JW4R 4Z0BH 1X5LA 5JLZB 3T1WA 1ZHLB 3S36H 2GI7A 4NWTL 1ES0B 2YPLB 4LHUA 5IK3B 1DUYA 1KB9K 2ARJA 2OR8A 3BUYB 2YPVH 4CDGC 4LLDB 8FABB 2HJFB 5D2NE 2DYPA 4JHWL 3RVTC 4OD2B 5GJTL 3HNSH 4RWYH 3BKYL 4D0CA 4TTDC 5E8DH 3HAEB 2P47B 4NT6B 4AM0B 1DBJH 5I8OH 3WN5B 4HGWA 2XACC 1T04B 1T1YB 4L4TD 4YEEA 2WWMD 2DM3A 2Z92B 4O2FA 1MAJA 3U0WH 3AB0B 2R39A 3IFLH 5DXWA 5LCVH 2UVEA 5HHME 2V5MA 1KPRB 4M8QB 4XNXL 4HJ0C 4PG2A 3NPZB 1N64L 1JGVH 1KN2L 3PWLA 4NO2A 3IF1A 3QNZB 5E4IA 2Y1VA 2EE2A 3NCEB 3WKML 4XH2A 1Q0YL 4WO4B 2YOCA 2CLRB 1NFIA 4LIQL 3CCHB 3E2HB 3VXUE 5LGJA 1A8JH 3GSWB 1IC5L 4HS8L 4BH7B 1PBYA 3EYQD 1T20A 2VB5A 1FP5A 4LPWA 3FAXA 4XAWL 3VFGH 4OCXH 1GGTA 1XGUB 3SE4C 5I9QB 4F7PA 1CVSC 4HXBH 1UJ3C 2AJUL 1VHPA 1CWVA 2D03H 2PNDA 4LSQL 4LLUA 1ZANL 3ZYIA 5MENA 3U9PH 4G80A 1EJOL 4Z5RA 3D0VA 5DJCA 4DEPB 5FB8B 1ZLVK 3DI2B 1S7WB 3BPOC 1L7IL 1RJLA 3T0ED 1KF9B 4MSWA 3ZKXC 3TZVC 1QEWA 3AREC 3GJFB 3U9UB 3QQ3A 1GRWA 3X3FL 2BRRH 4P3CH 4TRPL 3H42L 4TYUA 1HKLH 4WFFD 1L0YA 3KYKH 1U3ZA 3EJZD 2I5YL 4AT6B 4GAYB 4I18B 1KCVL 5L7XH 4LU5L 3BRFA 3FTGA 3WNPA 5A2IH 4FTVB 1J12A 4WUKL 1ED3B 1U2CA 1I1YA 4LVNB 5MEPB 3FOLB 1MREL 2F74A 4NKOB 4YHYB 1AKJB 4CW1B 3PDOB 3SN6N 3H7BB 1G7PA 4L8SC 5D7IE 1E4XH 4ODHH 1N5YL 3BXNB 3JUZA 1MFDH 4AIOA 4WFHE 1UM5H 3OAYH 4EDWH 5EIVA 1MWAA 3BQUD 1V3KA 3TT1L 4H1LA 3TA3C 2IQ9H 5I16A 1CGSL 3SBWA 1G6RB 3CMOH 2I26N 2VUOA 3H3PH 4PV8B 4XPGH 2NLJB 2H41A 4L9LC 1RZ8B 1CQKA 3SDXE 5IW6A 4UQ3A 3GSXA 1ZSDA 3QCTH 4Y2DC 2AJ3B 1T5WB 3VXUB 2YRLA 4HLZG 4PGEA 5EH1A 4OB5H 1WITA 1NC2D 3RDTA 5F6HJ 4OFVA 5MERA 4OQ1A 1BQHG 4GXUN 3ARBA 5E2JA 4I3SL 4OZGA 3MRMA 3WO3B 1CS6A 3RVVD 1ZT4B 2X4UA 3WKNA 1Q1JH 3Q6GL 5JXAH 2IGFH 2Z8SA 1RK0A 1QKZH 4NKMB 4F9LA 1CL7H 3GHEH 1MQKH 1VPOL 3L3OA 4LLYB 2P8LA 1CLOH 3I6GB 2H26A 3GMMA 1G7MB 5CZXD 4QTIL 4KHXL 1RUPL 4NQSA 3U4BH 4TSBH 4L4VB 3EDEA 1IFHL 5KZCD 4F7EA 3ALXA 3IETB 4NQCA 4Z76A 2EZ0C 5DK2B 3B83A 4KPHH 3TJEL 2EH7L 1ZVSB 5CBEB 1KELL 1RK1A 4G9FB 4FQQA 3NIGF 3AY4C 4QY8A 1LNUA 4NO0D 4HPYH 3M17B 5E8OA 4P5MA 4Z77A 3MLPA 3MRJA 3L5XL 2XTLA 2Z31C 2JB5H 3STLA 1RJYA 3B9EA 1R3KA 4J3VA 4JFZL 1EJ6A 4KFZC 1NBQA 4PR5A 1RVFH 1KGCE 5T5FH 3TBSB 3ISWA 3G08A 2OLDA 1WICA 3A67L 3GSOB 4L5FH 1O0VA 2EICA 1EHNA 4L3EE 3BZ4A 1NJ9A 5E70A 1KFAL 5FGBA 3OKEB 3L6FA 1U8KA 4QRQB 3PUCA 2QQKH 3MRPA 4MVBC 4LCYB 2Q20A 3QJFB 4L4TE 3C5ZA 1PEZA 1X5GA 3IDGA 4XC3H 2GTZB 5H37G 5EDXA 4A6YL 1YMHB 5GJSL 5HGAB 1PVHA 4HUXB 2H32B 1FLTX 2CIKB 3C5JB 3OJ2C 2OTWB 1UA6L 1BGXL 5L6YH 2R0ZH 3HC4H 2C3WA 5I76A 3VFUA 2ZUTA 1VESA 4I4WA 4XCNB 5J56B 1PZ5B 1LEIA 4P2QB 3GDBA 1KIQB 1UXSA 1UJ3B 5ADPH 3V4UH 4LCCC 2R4RH 3VFMA 3DX9A 4Z7OE 4MJ2A 4HXAH 4Z7UE 2O93L 5DR5H 2W59A 4XX1G 4H20H 3RWFB 3TZVB 4F33A 4NQEB 4MNGA 1A6ZB 4ELKA 4JY4B 1IAOA 5TDOA 4TULL 5B3JF 1MOEA 1LQSR 2QR0A 3LH2L 2CD0A 3JV6A 2BNQA 3BH8B 4TUOA 5FV2A 1QR1B 3LKRA 1HWGB 2ADJB 5IT2H 4UDTB 4ZG1A 1FORH 1AR2A 4FXGA 4QRTA 2A83A 4HIIB 4WFFE 2XQYK 5CIPB 2SEBA 2IFGA 1HSAA 4GMTL 3G5XA 1WCBB 3O4LD 1MCJA 4LBEA 3WFBL 5LJYH 3SBWC 3SKJL 3P77B 2B4CH 4C83A 4QGTA 3EJYC 4XRCA 5C0FA 3ZKSD 4L8SB 1T3FB 4N0CC 1FL3B 25C8H 4YWGH 4L3EB 3SY0B 2YPKB 2B1HL 2E9JA 1PZUB 4G43B 1A14L 5JXEA 5CGTA 3TA3B 32C2A 2C5DC 1J7VR 4GAJH 3IXTA 5JOEA 4LSRL 4QCIA 3B9AA 4K7FA 3RDTC 5E99L 4N8CL 3GMLB 4LKXA 3QCVH 5ID0B 3ARBC 5T1KD 3MA9L 2AJSL 5ISZD 4L9LB 2KQMA 1F11A 4DAGH 3SQOH 5FKAB 4Y2DB 1I9IH 3LZFH 1Q9KA 3R8QA 1EFXA 4R4ND 4F9LC 2FBOJ 4ODVL 5SWQA 2EH8H 5DJ0A 3E8UL 3DSFH 3SGKC 2X09A 3L3DB 1S9WB 2NXYB 2UWEF 2E9BA 5C08B 5GRJH 1TJIL 3O9WD 1ADQA 4K3JL 4CVXA 5F96H 3VXTA 4TSAL 1OP3K 1GXEA 4LHUB 3HZMA 1G9NH 1DUYB 3QNYA 3C60A 5F3BA 2ARJB 1BIHA 4Y4HA 2GK0A 3KPRE 4MD0A 5KANI 4UTBH 2DYPB 3RX8A 2ICCA 4D0CB 3V8CA 3F7VA 4CVZA 4U33A 1H8NA 3ZTNH 1GHFH 4LHQB 4DGIL 5HI5C 4HGWB 4NN5C 2OZ4L 1K6QL 2XWTA 1WT5A 1KCUL 4Y8DC 4UB0L 3VJ6A 4WI4A 1XF2A 4O2FB 5FGBC 2QADC 2BDNL 1NCCL 4Q6YA 4ZAKA 3BDXA 5T5NF 4NCDA 2Z31B 1U58A 3B2VH 2FRGP 3AS0A 1U3HA 3FRPA 3MYJA 3QHFL 3R0NA 2D2OA 3PWLB 4NO2B 1U36A 3IF1B 4JY6A 2W0FA 4MS8D 4XH2B 3VW3H 1BX2A 1NFIB 3HFMH 1YEDA 3MJ7B 2I9LA 5LGJB 2K7PA 5HVHC 2ZWLT 3WXWL 5IMKA 1M7XA 1W0VA 1CE6A 3VRLF 1N6QL 1W72H 4RRPA 1QACA 1F3JA 1T20B 3MBXH 2IPUK 4JKWA 4LSTL 3QRFM 4F7PB 4FG6D 2QQNH 3JXAA 3O6MH 3HI6H 2MQCA 4ERSH 3TWCH 4LLUB 1DSFH 5MENB 1I7ZA 1EO8L 1PEWA 3K1DA 2WUCL 5E95B 2F58L 3UTSD 4YNYA 3D0VB 5DJCB 1B6DA 3HLAB 5DT1H 3EO0A 4LARL 2EYRB 2YMXL 3LQAH 1J1PL 1RJLB 1M05A 1UXWA 4MSWB 1QEWB 4DVRH 3QQ3B 1KN4H 4X80H 4LCCB 1WBYA 2RBLA 3VGHA 1IZKA 4NN6C 1W2KT 3BP5A 4NUGH 3HRZA 1FYTE 3JWDC 2R8SL 1G7QA 1U8QA 5IVZA 4IIQC 2HP4A 3C09C 3FTGB 3O4OC 1WFTA 3RWEA 4W6WB 4J7RA 1I1YB 2DJUA 2ZZUT 2F74B 3VDBA 1QFWH 1A64A 2J8UE 3VXSA 3TLRA 5IKCA 4ZFFA 2GT9A 1QBBA 2IAMA 1A4KA 1G7PB 4GLRI 1OP5K 4QHUA 3SGEI 3QPQC 5MP6L 3CIQA 3V4PH 5DRNA 3LEVH 1MWAB 1VADA 1ND0A 5JXEC 3O3DA 4H1LB 2DQCL 4XPFH 5DD1L 5I16B 2BNRD 2NY6D 1SEBA 3BIKA 4MLSA 3UTTD 3O4LE 3S88L 4P99A 4ZNEE 1XIWA 2VDPL 3RNQA 4OJFH 5IW6B 5ECJE 1KB5H 3GSXB 1ZSDB 4HKXA 5FECA 4OZ4A 5JQHC 2AXJA 4PGEB 1AXIB 2GJ6A 5C2BL 3GSQA 3FHAA 1UACH 3RDTB 1JV5A 5MERB 3IFOA 1AE6H 4ODTH 5D7LD 3ARBB 4URTB 4MQXC 4OZGB 3MRMB 2X4UB 4JO1L 3HB3D 1RK0B 2NY7H 5T1MA 4QXWA 5ISZE 3BD5A 3L3OB 2P8LB 4I3GA 3MLSH 2H26B 5F9WC 3GMMB 1LO0L 3S9DB 4P46A 1OSPH 3H6JA 1QPPA 4NQSB 4NZUH 4U6TA 4U1IA 3ULUC 3FT4B 3MLRL 4I48A 4KK9D 2MFNA 4F7EB 4NQCB 4CN4A 2X9WA 4ODSL 4Z76B 3PHOA 1C08A 1QSVA 1N26A 3MRFA 3WS3A 5A2FA 2JE8A 1RK1B 5H35A 4FQQB 5GS0C 3DV4A 5EU4A 1LNUB 5E8OB 4P5MB 4J6RH 4Z77B 4X6FA 5HYJA 3MRJB 3STLB 5INCA 1RJYB 2VKXA 2AGJH 1R3KB 5DD5H 3I2CH 1ZHBA 4POYA 1U8OA 3MRGA 4PR5B 2FGWL 3SKMA 4NN5B 3G08B 3F8UB 3UXFA 1A6UL 5F9DC 4OFYD 4DTGL 2HT2C 1NJ9B 3BZ4B 3R4DA 2GSIA 3F7QA 3ROLA 2NMSA 2QADB 3L6FB 1MRFH 1U8KB 5ACZA 3MRPB 1QO3A 1IM9D 4D0DA 1AH1A 1RU9H 1G0DA 1K9TA 3C5ZB 1EHLL 5F1KC 3IDGB 3QIUC 5GGSA 1FLRL 3DVFA 5IB1A 3O0RL 4QGYA 3P11H 5MEOA 3FKUS 1FZOA 1IGFL 4EKXA 4WRLA 1FFNA 2O5YL 4PGDA 5SWZD 3RI5F 5CD5C 1UEMA 3MX0A 1TCRA 3BD3A 5I76B 5FUCE 1ZLVH 3QWOA 4I4WB 3SKUD 1LEIB 5F6IC 2AJYL 3FB8A 5FOBA 1UXSB 5L9DL 2CPCA 1NL0H 5ITBH 2B5IC 3VFMB 1PJ9A 5GRUH 3ZE2E 1Q9LA 4PJHA 1EUTA 1ZVHA 4JDVA 1YEIH 1CU4H 1IEBA 4F33B 3UJIH 4MNGB 4U6HA 1IAOB 5TDOB 1AO7D 1F45A 2GFBA 4RWHA 5H2BA 1QVOA 1F90L 1CG9B 3QZWG 2QR0B 3ZT6A 4IEFB 3JV6B 5FO9A 2BNQB 1EERB 4TUOB 3LKRB 2Y07L 4ZSOE 3T3MF 3L3HA 3ZL4L 1AGFB 4FXGB 4YLQT 4QRTB 5JHDD 1BQLH 2A83B 4CNIA 3JV5A 1FZKA 3C09B 4P57A 2SEBB 3O4OB 1OAUH 1RIVH 2Q1EA 1HSAB 1CICD 1RSFA 5F9OL 2J8OA 2K1MA 3W9EA 4LBEB 4KJQD 2EDXA 4EN3A 3WXVL 5LGHL 1D5XA 2ITDA 2HWZL 1JGEA 4PJAF 3RA7L 4C83B 4F15C 5E4EC 4XRCB 5C0FB 5F7HA 1YEFL 3FMGH 1XIWC 1OQOA 4NFDA 1M6OA 1ZT7A 2VH5H 3IFNH 2FB4L 4HWEH 2UY7A 1GH7A 4MMXC 32C2B 2R29H 2F19H 5BV7L 3EO9L 4QCIB 4K7PX 4K7FB 4TNVF 4CJ1A 1A1NA 4LNVA 2CK0H 3MXVH 5KN5A 2C3XA 5JR1L 5J13B 1TQBB 2JTDA 2FYYA 3F58H 4JE4B 1ZLSH 1IQDA 5I71B 1A6WL 1F2XK 3PF2A 4KJWD 3ZMRA 1EFXB 3MRQA 4QRPA 2A9MH 2NR6D 2ICES 4G6KL 4S2SA 5DJ0B 3RGVC 3ZE1E 2VC2L 4XVSL 1TJGH 4AENA 4Q9RH 3LPWA 5BMFL 4OGYL 3ARWA 4E9LA 3QHTC 4W81A 3HAEG 4L3CA 3NBNA 4CVXB 2DI9A 4LPUA 4OIIL 1JF5A 5F9WB 8CGTA 4N0RA 5FYJE 4M9OA 3HZMB 3C60B 3SJVA 1NAML 3IDUA 4Y4HB 3ZKND 2GK0B 4MD0B 2IPTH 4TVSa 5DJAB 3J7HA 2IQAA 1Z3GL 1MJ8L 4Q9CA 3S36X 1ZWIA 2JELL 3O2WL 1DQLL 5HDQH 3F7VB 4CVZB 5EU5A 4LMQE 1ZHKA 4M7KL 2NY0C 3T1FA 3C6SA 1KT2A 2HRLA 2XWTB 3PJSA 3R0MA 3PP3K 3VJ6B 3G6JE 5I1HL 3W0WE 4OCYL 2Y36H 5E6ID 1GAFH 3SCMD 4N8VA 4ZAKB 1IEHA 3CFBA 1U58B 4G9DA 1U3HB 3MYJB 4L9DA 3AC0A 2ICEA 4JY6B 4LL9A 4LGPB 1JGLL 2W0FB 4DN4H 5CEZD 3FN0H 2E27H 1BX2B 2Y4SA 1YEDB 3RUGF 2I9LB 5IMKB 3NZHL 1A6VL 1W0VB 5EIIA 1CE6B 4OCLC 3UZQA 3PE9A 4JQXA 4JVPA 1YNLH 1U41A 1VGEL 4OD3H 4M6NL 1SM3L 2VXSH 3LEYH 1CXIA 4Q74A 2BOBA 3MRLB 2OMNA 1MJUL 4U0RC 2DJSA 2R56L 4ZOBA 3P4OA 2D7QA 1NCNA 4WW2F 1D5ZA 1I7ZB 5C09A 2DBLL 4W4OC 5EBWA 3WJJA 4K3DL 4YNYB 4K7PL 4ZQKA 1NGWB 2BVPA 3EO0B 4XNUL 5HD8D 4DOHB 5F6IB 1M05B 1UXWB 2FJGA 5JOFA 3BZEA 5H8DA 4HQQL 3MOAH 4I0CC 4HH8A 2F5AL 4ZMAT 2B5IB 3CVHL 3RHWK 4N9OB 1B90A 3FQWA 1FC1A 1T66D 4KTEH 4YBHA 3HRZB 5D2LE 5DVNA 2QJDA 1A7OH 1U8QB 3P4LA 3T4AA 4D9RE 2B20A 3RWEB 3SOBH 2EXYD 1P84J 1T21A 3TBVA 3VFRA 1KXQE 2ENSA 4EN3C 1J0JA 5GGSY 3VXSB 3K81A 5IKCB 3BVNA 2GT9B 4AL8H 4ZFFB 2IAMB 1A4KB 1R5WA 1ACYH 1XR8A 4QHUB 3SKOA 3MJ9H 1MFBH 7FABL 3RX5A 1EO5A 5DRNB 5D7JA 4WWKC 1SY6A 1VADB 4HGKC 3REVA 1ND0B 5I0DA 2N7AA 1IKFH 3O3DB 5GS0L 4WDIA 5JHDE 2XXCB 1S7QA 4Z0BL 4K23H 4PJXE 1EGJA 1NH6A 3S36L 2H1PH 1SEBB 3BIKB 2DB8A 4AEFA 4DGYH 4KH2A 5FFLA 1AD9A 1XIWB 5D9SB 5EU6A 4HKXB 2B4CC 5DEGA 2Q87A 5FECB 5JW4N 4U1HA 3NIFF 2UUDK 1MCQA 3HNSL 4NQDD 5FYLD 3RWGA 3VXRD 4RWYL 4JFFA 2GJ6B 4C57C 5E8DL 3GSQB 4EUPA 1JV5B 1DBJL 3IFOB 1WIPA 5KSAA 3EOTH 1MLBA 5K9JH 3IFLL 5LCVL 3TN0C 4OQTL 1IQWH 4MNHA 1PDKA 3SPVA 5T1MB 4XNQA 5JQ6H 3NCCB 5DGRA 3INUH 5BJTA 1JGVL 1U93A 5J8OA 4PJHE 4KHTL 4P46B 4TOYL 5E7FA 4WI6A 4JRXA 4U1IB 3OKMA 4I48B 1QRND 3VRJB 1S5HA 1IE5A 2GAZA 2CUHA 2OTUB 5DJYA 3KNBA 2AEWA 5J11C 5HGBB 3KYNA 3HC0A 2WANA 1C08B 4P2OC 5GRYA 5TPWH 3WHE0 1Y18A 3VFGL 3MRFB 4OCXL 3WS3B 3BRGC 1GGCL 4X7CC 5DJZA 3C87A 5H35B 2HJLA 2OXHA 4HXBL 3IJHA 2G2RA 5I73B 2D03L 3DV4B 2N7BA 5EU4B 5ANMB 2EYSA 1X6LA 2X4NA 5CJOH 1FL5A 2VDQH 4K94C 3U9PL 5HYJB 4X6FB 5INCB 4OSUH 5DJ2A 3OKNB 1ZHBB 2BK8A 1U8OB 3MRGB 5DC4B 3SKMB 1HOCA 1L0QA 4WUUA 1I3GH 3OKKA 5DFVC 5IBUG 2BRRL 1DQQA 1JPTH 4ENED 2EXWD 4P3CL 1HKLL 2GSIB 4HIEA 3ROLB 3ARGD 3QUYA 4R0LA 4U6XA 5ACZB 5GZOC 5D71H 5GGRA 1QO3B 4LSPH 4D0DB 4V1DA 3MGTA 1N2RB 2ZSWA 5GGSB 4XP1L 5L7XL 1C5BL 1U91A 4P2YA 5IB1B 5BRZA 3HPLA 1SJEB 5MEOB 2FECL 4OFIA 1FFNB 2NX5D 4PGDB 4S1SH 1PLGL 3BP7A 1NUNB 5CEZE 5TE7H 1TCRB 2AK1H 4OIBA 4KUCD 2FIRT 2ZG1A 3QWOB 4NWUH 2VABA 3BPNC 4OF7A 3WBDA 1CBVH 4QHMA 2DS4A 1MFDL 4MJID 4P49A 2DKUA 1UM5L 3FB8B 5FOBB 5E1HB 4ALAL 2ZSVA 1ADQH 3QUXC 4XPBL 3A6OA 3UYRL 2IQ9L 2QV2A 5FYJU 3CMOL 1Q9LB 4ZPTA 3H3PL 5TE4H 4PJHB 4XPGL 2DLEA 4JDVB 4ZFOA 5JIKA 4PRNA 3REWA 1VFUA 3SDDD 3QCTL 2R2EA 1WVZA 1P4BH 4U6HB 4JG1L 5BW7A 3SJVE 4XNYH 2HA1A 4OB5L 3KLHC 5H2BB 1QVOB 1RZ7H 2FCBA 4PRHD 3IDNA 5FO9B 4Y16D 3WNMA 3WUWA 1OP5H 3L3HB 2ED8A 2X5PA 5EO0A 3S37H 3QXAA 4CNIB 1YJDC 5I8EA 5JXAL 1FZKB 2A0LD 2IGFL 4P57B 5D7JC 1QKZL 2DL2A 1UM6H 1QLRA 1CL7L 3GHEL 2KKQA 3W9EB 1CLOL 4EN3B 3T0EA 3CGTA 1D5XB 4M8VA 1MRDH 2ITDB 1BBDL 3ORJA 1JGEB 3CK0H 1GVIA 4PJBE 3LB6D 4JVUA 1M6OB 1ZT7B 4MLIA 5EZIH 5C07D 3KXFE 3RWCA 2YUWA 2FNBA 2EDHA 1X9QA 3DBXA 3OJDB 2NZIA 4JM2D 1T1WA 4KPHL 3CLFH 3CZFB 3PV7A 1A1NB 3O6LH 4X8XA 1R0AH 5KN5B 4KDTA 2FYYB 4ZS6D 3D1MC 4HPYL 1IQDB 4M9PA 1TZGH 3MBED 4HWBA 5FHBH 5J3HC 5INDA 2E9WA 2JB5L 3JBG7 4QRPB 4X7TA 1LO3H 1GOFA 4S2SB 1DVFD 2FH8A 1RVFL 5T5FL 2PCPA 5FYLE 4L5FL 4NQDE 4AENB 4QNPE 3BQUA 4KAQH 3FAWA 2OTPA 3MGOA 5MEQA 4HSQA 3UTQA 4KU1A 3OXSA 1DQDH 4FRWA 3TN0B 2QQKL 5FYJH 4L3CB 3ZSTA 2DQJH 2UZXB 3V8OA 4XC3L 1G0YR 3MV8D 4XVUD 4FQ2H 3SJVB 2CR3A 5AG8A 3KJ6H 1MFNA 4JRYE 4YBLC 1I8KA 2R0ZL 3HC4L 4IM8A 3WD5H 1ZWIB 3F7RA 3X13A 1BF8A 5CHNA 5EU5B 1G7HA 1OLZA 1JNJA 2DQUH 1KT2B 3EIFA 3V4UL 3GKWH 3PJSB 5BOZG 1NFKA 2R4RL 1K8IA 4Z95L 5IGXH 3MLYH 2VWEE 4N8VB 4HXAL 1QZ1A 3CFBB 5DR5L 4G9DB 1U9KA 4M1DH 3CD4A 4PJDA 2EDOA 3FO1A 4WVRA 2ICEB 4NJ9H 1CF8H 3V5KA 5C0IA 5T3XD 1T83A 2Z4QA 4FQPA 4PTTA 1FHGA 4G8GE 4FQCH 4G7VL 5EIIB 3S96A 5IT2L 1KENH 2FX8H 3MRKA 2L4OA 3B6SA 4NJAL 2X42A 3PP4H 4LFHG 3TP4A 2BOBB 4OCWH 2OMBA 5C92A 1ZGLB 4M6ML 1X4ZA 1D5ZB 5BVJA 1B0RA 5C09B 5KVEL 5EBWB 4JDZA 1LP9A 2BMKA 4G5ZH 5E8NA 4ZQKB 2BVPB 5F7NC 2XPGA 3BPNB 25C8L 2VLRD 2FJGB 5ENWA 3RZWA 5F7UA 5JOFB 3BZEB 5B4MD 4J4PD 5E5RB 3EYQC 5BW7C 5J6HA 3QUXB 1S7TA 2H3NB 1JNLH 1ETZA 2FBJH 4GAJL 1IGMH 1DLHA 4YXKH 4LRNH 2VQ1A 3QULA 3FQWB 2E9IA 3MRDA 3TV3H 2APBA 3QCVL 1YMMD 1AGBA 3D25B 1CFNA 1DN2A 4DAGL 4QF1A 3V6BR 5HI4D 1CK0L 3T4YA 5I1EL 2WBJD 3SQOL 3T4AB 1EHAA 1I9IL 3KYMA 1JTOA 5GGRY 4Y5XC 1T21B 3TBVB 3VFRB 3CX5J 5FXCH 1NGZB 3LN5A 3T0EC 3LIZH 2EH8L 5GRZA 3NIDF 4BSWA 4XPAH 3BVNB 3DSFL 2Z0BA 1PG7H 1R5WB 1XR8B 4WU7A 3SKOB 1TTGA 1F2QA 4RDQG 5D7JB 1QLEL 2NYYD 4FOMA 4HUUA 3REVB 5ITFA 5D5MB 4WDIB 1WZKA 5F96L 5KW9H 4J3TA 1K3IA 5I2IA 3BJLA 1WFNA 5C0ND 1G9NL 1T0MA 1AI1H 4BFBD 2GW5A 2KBGA 1AD9B 5EU6B 3PWNA 1XF3A 3GBMH 4R3SA 4R2GD 4UTBL 4OZHA 3U36B 3D87B 2PO6A 5DEGB 3DIFA 1KV3A 4U1HB 3RWGB 3OAUL 4G6FB 5FDWA 5IHZA 1JBJA 3OG6B 4JFFB 5IFJA 3DROA 1GHFL 1P5UA 4EUPB 5C07E 3DVIA 2XN9D 4ZOAA 3AAZA 4MQ7A 4JFOA 3BYYA 5KSAB 3BQUC 2BVQA 2BVEA 1MLBB 3SQBA 5ETUA 2VDNL 1KUMA 3UCRA 3K1KC 4MNHB 1IM3A 3MRIA 3SPVB 4XNQB 3B2VL 5JIPA 1KYOK 1LE9A 5IFHH 2I07B 5BJTB 4FQLH 1QG3A 1N7MH 3G6DH 5HHXH 3VG9C 4BK4A 2DTMH 4JRXB 4X4XA 3OKMB 4H8WC 1S5HB 3HFML 2GAZB 3IGAB 3CDGA 3K4AA 1FG9C 1FFPA 5DJYB 3PGCA 3KNBB 1W72L 3KYNB 1T7WA 5T1KA 3HC0B 1AY1H 3MBXL 5DRZA 4F37F 3QEQA 1NFDE 4XP4H 3OKDA 3VXMD 5DJZB 2VLJA 2HJLB 2QQNL 3O6ML 3IJHB 2G2RB 2YD6A 3PP3H 4ERSL 3HKFA 3TWCL 2E5EA 4X9GA 2YHGA 2EYSB 1DSFL 1MJ7H 2X4NB 5ADOL 4YBLB 5CCKL 1FL5B 3W5NA 5CZXC 1PKOA 3RKDD 5I66A 1NGXA 5C0RH 1OGTA 2ZNXA 4PLNC 3HZVA 5KBNC 4U1SA 5DJ2B 2Z9TA 5DC9B 3LQAL 1QFUH 4U7MA 3GBNH 2DDQL 2ESVD 3VD7A 1HOCB 4WUUB 3MUZ1 3OKKB 4JY5H 1OSZB 3JZ7A 5C0AA 3O9WA 1DQQB 3GM0A 4HIEB 3QUYB 1T83C 4R0LB 4U6XB 2Z91A 3QQNA 5GGRB 4NUGL 4V1DB 3MGTB 3OB8A 4XWGH 4LP4A 2ZSWB 2J2ZA 5DMKA 4NFCA 4KI5E 4NCC2 3BKMH 2BRQA 5A2JH 1U91B 3V6ZA 1EDQA 1S7VB 4GKNA 5BRZB 2X4QA 3HPLB 3OSKA 4LSUH 3TO2A 2VNCA 4XMPH 5CEZH 2P4AB 1JTPA 3R06A 4XXDA 3VA6A 4GAGH 1QFWL 3BP7B 3J8F7 5T3XE 2IH1A 2VABB 1RIUH 2AEQH 4QHMB 3QO0A 5C0EA 3S34H 3V4PL 3H9SA 3LEVL 2ZSVB 2W9LA 4XPFL 3Q2CA 1KJ2A 1WFOA 2CH8A 5D1XD 3ULVC 4ZPTB 1CFVH 4LDLB 4AIZA 3MJ8A 3HUJE 1ODAA 4ZFOB 5D1QD 4PRNB 3REWB 3X3GH 3ZT5A 3VCLA 1UM4L 3MNZA 3WUZA 2R2EB 4MDIA 3DO7A 2EEBA 3W39A 4I2XA 1QSZA 2VLME 2MMXA 1UACL 3IDNB 4LLAA 5F72S 3ARTA 1MLCA 1AE6L 3WUWB 5A3IC 3DRQA 4RAHA 5EO0B 1JGDA 4H26A 3QXAB 5I8EB 2X1QA 2NY7L 2OK0H 1YMME 5JNYA 1BVLA 2B7DT 2LU7A 1J0HA 5C0BD 1MCFA 3T0EB 5DD6A 5BXFA 1IC4H 2HKFH 4LAQH 3ROOA 1OSPL 4NZUL 1BJMA 3V9FA 2YKLL 1HXMA 4LPYA 1D9KA 4WTZG 1OM3H 3RWCB 2PO6C 3DBXB 2UUDH 1T1WB 5EO1B 4MA7H 3HR5A 3MNVA 3WS6A 2R23A 3BDYH 2LQRA 4GS7C 1U6AH 5DA4A 5TE6H 1JPSH 3D85A 2DWEA 5K9OA 3WIIH 5HTSA 3F62A 5INDB 4X7TB 5FYLH 2AGJL 1D5MA 2G5BA 3I2CL 3P4NA 4QKXB 4LKCA 1EMTH 3LMJH 1J88A 2PCPB 3VH8A 3KPTA 3OKYA 3BQUB 4HAFA 4JFYA 2X1PA 3WO4C 2XOTA 3JWOC 3MGOB 5MEQB 5TDPA 3ME0A 5C6PB 2BNRA 4QXUH 2XN9E 3UBXI 3UTQB 3OXSB 2CIIA 3UTTA 1RU9L 3DXAA 5J89A 5JIIA 4IBLT 2V17H 5E2TH 3IS0X 3VG9B 3BE1H 4XNZC 3P11L 1A4JA 4R4NC 3ALPA 1NC2B 2P8PA 1A1OB 1KB9J 2JCCE 1DQJB 5KJRH 1I8KB 1JF1A 43C9A 5FEBA 1NCAH 5IJVA 3QB7C 4GXUM 4M62L 5D7LA 4EOWH 3X13B 1I1CA 3K2MC 4JFDD 5CHNB 1QNZH 2C4FT 1G7HB 5GRXG 1NGQL 4AG4H 2QHRH 1D5BA 1SY6H 1NL0L 3O9WC 5C6WH 5ITBL 3Q3GA 2PTUA 3MV7A 1B4JH 1K8IB 1A1MA 1T5XA 3CFCH 4YDJA 1H3PH 5GRUL 3NCMA 3ZHLA 1GSMA 4PJDB 1J8HE 1I3VA 1YYMH 3NCYP 3HG1A 4WTXA 1LO5A 3FO1B 1CU4L 5EOQL 3UJIL 2HFFA 4JPWL 2G60H 5KZCB 3B2UD 1CE1H 1WQVT 3V5KB 1H3WM 5C0IB 3PWJA 4L8DA 3L95A 2D7PA 2Z4QB 3ZE0F 4PTTB 1OT2A 4DWHA 3S96B 3B6SB 4MXWH 1XAUA 3ZKQD 1BQLL 2MQ3A 1AJ7H 4HJGA 5IMMA 1DL7H 5TF1H 1L7TH 3NPSC 1U92A 3QQ4A 1MSPA 2R1YA 3VWKD 1OAUL 1Z5LB 2PYEA 1RIVL 4TNWF 5CBAA 4C54A 1UFUA 4RGMC 3C6LA 5BVJB 1B0RB 1KG0A 3ECBA 5EZJA 5LXGH 4JDZB 3X12A 1LP9B 2BMKB 3FRUA 4MS8C 2DRUA 5E8NB 1QA9A 2XPGB 3FMGL 4YJZL 5FUCC 2VH5L 4XB7A 5ENWB 4IRJD 4XI5D 3IFNL 2V9QA 3OHXB 4BSVB 1IM9A 1ORSA 4FP8H 3EDDA 4HWEL 4AZ8A 5J6HB 1S7TB 2NXZB 1ETZB 3THMH 5AAWA 2R29L 3CFKB 2F19L 1DLHB 5D7SH 2FZ3B 2VQ1B 3QULB 1CDCA 3MRDB 3MXVL 4OZGF 2R0KH 4FG6C 3T0BA 1AGBB 1CFNB 3DECA 1BJ1H 1N0LA 4GLRH 1OAZH 1MCPH 3F58L 1ZLSL 1TTUA 3T4YB 5DWUH 5SWZA 3KYMB 4X4MA 2A9ML 2Y23A 3LN5B 2MCG1 4BSWB 4JDTH 1TJGL 4WFED 4Q9RL 2W91A 4WU7B 5J1SC 2WV3A 3TYGH 4N5UA 4KVNL 1I9RH 3EFFA 4NKIH 3C8DA 2W92A 5HHVH 4HUUB 4OFKA 1TTFA 1X5FA 4X6DA 4I77H 3GHBH 5I2IB 1B9ZA 1EEUA 4PP1D 5D70H 4BELD 2FO4A 5C0GA 1T0MB 3P30L 5C0BE 2VZUA 3PWNB 1XF3B 2IPTL 4M93C 4R3SB 2D7MA 4OZHB 3QDGE 1FV1A 1UH3A 2PO6B 3DIFB 3PQYD 4KZEH 5FDWB 5IHZB 3LKPA 5IFJB 3BN9D 3CUPA 3DROB 3HN3A 2VE6B 4HD9A 4GS7B 3AAZB 2W9DH 4MQ7B 4JFOB 4NO3A 2HJKB 1CICA 2BVQB 5DJ6B 1NUDA 5ETUB 1PG7W 2Y36L 3H9SE 2DMKA 4R26H 3X14A 2NY6C 1OT1A 4I8DA 3O6FA 1AC0A 4UU9A 4P5KA 4UBDD 1IM3B 3MRIB 4LPTA 4QRRE 4OV5A 1LE9B 2A6KB 1R3LA 5EWIH 1NMAH 4NM4H 4N0UA 2RAMA 3HE7D 3Q48A 3AS1A 3WO4B 5KVFH 4U05A 5K9QG 3FN0L 4RCAA 2E27L 4S1QH 5D6CA 4PUBH 3CDGB 5FGSA 1RHHB 2VMFA 4XC1H 3PGCB 4MHHG 2CRZA 1EAPA 5T1KB 1YNLL 3QO1A 4P5TD 3RP1A 5DRZB 4OD3L 3QEQB 1TZIA 2VXSL 3RZCA 3LEYL 1R3JA 3OKDB 2VLJB 3BO8A 3RVWD 4XNZB 3VXPA 3I6KB 3NMEA 1D6VH 5EOCL 1RV6X 4ZO7A 1VKXA 4FN0A 3PABA 1KIUA 1MQ8A 2HTLD 5I66B 3TIDA 1NGXB 5HGDA 1OGTB 3HZVB 2P5EA 4U1SB 4KK9C 2ATPB 4XCYA 4HCRH 3U79A 4AK1A 1NCWH 3MOAL 5IQ9A 5C0AB 3O9WB 3FJTA 1NCUA 2XZAH 1U8NA 1XGYH 4O51A 2Z91B 1Q94A 4UINH 1BQHA 3DRTA 3EAKA 2CRIA 3MLVH 2BJMH 5DMKB 3D2UD 3RAJH 1A7OL 1ZHNA 2ADFH 2BERA 3F65A 3U30C 3QQ9D 3V6ZB 1TIUA 4GKNB 2X4QB 4MAYD 4B5EA 4HULB 3SOBL 2HLFC 3T2QA 1ERNA 1JZ8A 4NO5A 3S8WA 3R06B 4XXDB 1M7IB 1KJMA 4OZFA 5T3XH 5A16A 2AK4A 1IKNC 3F5WB 3QEGH 4AL8L 5IHBA 3EUUA 1ACYL 3B4NA 4KDVA 2IH1B 3MJ9L 1MFBL 1PY9A 2FH6A 3QO0B 5E6IA 4TQEH 3G6AA 5C0EB 5C7XH 3H9SB 5F9AC 3SCMA 4FFYH 5AZ2H 1NCDH 1KACB 3CU1A 1IKFL 4RGMB 1T7VA 5KSUA 4K23L 3RRQA 2H1PL 1KJ2B 4Q9BA 3S3SA 5IOPA 1CXKA 4AIZB 3DPBA 3MJ8B 4LFHD 3WNLA 3VCLB 1DLFH 3MNZB 4MDIB 1QOKA 4WI3A 3DO7B 1B0GA 1I1FB 3N1FC 3W39B 4X7SH 4I2XB 5DQ9A 5IEKA 1OPGH 5K33A 5LWYL 2HT4D 1MLCB 3BH9B 4OT1L 4JHWH 4M48H 3DRQB 4KXZI 4U1KA 5GJTH 1JGDB 4H26B 4NDMA 1HSBA 4P0DA 5K9JL 5B3JE 4HDIA 3ZE2F 1NANI 2P43B 4EEEA 5JNYB 1CT8A 3H7LA 3OL2A 4U1NA 5JQ6L 4QHNA 2E8YA 4IDJH 3ULUF 1O7VA 1FAKT 5DD6B 5DFTA 5BXFB 2AW2A 5JDJA 3ROOB 3S37X 1HXMB 1JMXA 5F6HI 3C5SA 3IRPX 1D9KB 2WUBH 3T3PF 4XNXH 1T1XA 5FM4A 5IW3A 3RIFF 4FFZH 1S5IH 4WFEE 3VXQA 5E2VH 1RUQH 2IEPA 3KYOA 3WKMH 3HR5B 3MNVB 3T08A 4P4KD 5TPWL 3QRGL 2R23B 2ZOLA 4C58B 3NA4A 4LSSH 1GZPB 5F1SA 1T7XA 1CICC 4JFHD 4BFEA 4J2XA 2YD5A 2YD7A 3MUGA 3LVEA 4ZODA 4KJQC 2DWEB 5FKPA 2PYEE 5CJOL 5K9OB 2VDQL 1PQZA 1BHGA 3QI9D 2G5BB 1D5MB 4OSUL 3AGVA 2AJUH 3EYVA 5ALCH 4LKCB 5DEZA 1I3GL 1RI8A 3VH8B 5T33L 3V7AG 1D3CA 4JFYB 1N6VA 5TDPB 2BNRB 2NY6B 2OR7A 3T0DA 2CIIB 1YY9C 5D71L 4LSPL 4J8RA 5C0DA 3UTTB 1C7SA 1F13A 3DXAB 2XZZA 2AS5M 4D8PA 1RUKH 4F7CA 2IMMA 3AUVA 3ZSSA 2LTQC 2VZTA 3H42H 2UWEE 1MNUH 4HGMA 3VD5A 5GGTA 4KJWC 2WIIA 5DHVA 4YIQA 1A4JB 2NR6C 2I5YH 4H88H 4C56A 4JHBA 2V2XA 2FD6L 43C9B 4LNRA 2AK1L 1HH9A 4XVJL 5D7LB 2A6IA 1G9MC 4WUKH 4NWUL 4PJ8A 5FM5O 2JF1A 1CBVL 2IG2L 1D5BB 2FWOA 1MREH 1JHTA 1ADQL 4GW4A 3Q3GB 3MV7B 4S0TD 4YDJB 1A1MB 4KTDH 1AQKH 4RFEA 1N5YH 5C86A 2XZCH 5TE4L 4YDVA 1F6FB 2HG5A 1U8IA 3HG1B 1LO5B 4ORZC 1CGSH 2HFFB 1FBIL 4UOW0 1P4BL 3EOAA 3QEHA 1QBAA 3A6BL 1A6AA 2CRMA 4ZTPH 3PWJB 4L8DB 4U1GC 3L95B 1TZHA 4YUEH 4D0BA 5GS2D 1S3KH 3LN9A 4M00A 1JI2A 5EUOB 1I1AD 4HG4K 1OGAE 4FQIH 5GGVH 1OW0C 3SE3C 3V5DA 3FB6A 3S37L 1SEQH 5IMMB 1OTSC 3BIAX 4K71C 5E6IC 3U30B 1U92B 5CBAB 3SCMC 4YDIH 2YRZA 1YZZA 4FABH 3VRLE 5CEXA 4HZLA 3C6LB 4JQVC 3KHQA 4DZ8A 5EZJB 1K8DB 1KG0B 3ECBB 2I9TA 3Q6GH 1MRDL 3VFNA 3X12B 3FRUB 1HHHA 1QA9B 5C9JA 2WP3T 3RI5K 2B1AL 3NCFB 4N0UE 2I24N 3DUHA 4M1GL 4OLXH 5EZIL 4G6AD 1IM9B 1ORSB 2AERT 2VZ1A 4P2RA 4KHXH 2VRAA 3CLFL 3HMXH 1MIMH 3BT2L 2QEJA 3TO4A 1WEJH 1R0AL 4YH6A 1OL0A 2NX5A 1MFCL 1TZGL 5SWZB 1WIOA 1RJCA 1VENA 4PB9H 1KELH 3L3IA 1X5YA 5HD8C 2CRYA 1LO3L 3BJ91 5ESVB 3LEXA 3PWPA 2P5EE 3T8XA 4ZNCD 1ZGLM 2M26A 4KAQL 2LVEA 3TEUA 3EFFB 5FYJL 4FZ8H 1T66C 4X6DB 3AMLA 1B2WH 3DVGB 1EXUA 1FDLL 2XTJC 1U8LA 3SDDA 2FO4B 4GJTB 5C0GB 1T89A 1AO7B 4PRPE 4FQ2L 2EXYC 2OSLA 4M61A 4MWFA 2MJWA 3KJ6L 1F58L 1FV1B 4Y16A 4LGRB 4K07A 4HS3A 4A6YH 4I0PD 3FFDA 3N0PB 3WD5L 4O02H 1EH9A 3DURA 3LKPB 3CUPB 5C71A 4UAOC 3UZVB 4MX7A 3GKZA 2DQUL 2R4SL 4N5ED 1BGXH 4NO3B 1CICB 3GKWL 1GPOL 1L9MA 2P48B 1G7IB 2AEPH 2EO1A 3X14B 1WWWX 4X5LA 5IGXL 3UPCA 3MLYL 4UU9B 3NVQA 4P5KB 1BIIB 5HYSG 4JFHE 2IAND 4M1DL 3Q5OA 3WV0A 3KLDA 4OV5B 3QXDA 2YUXA 1R3LB 1UCTA 1MVFA 2HH0H 4N0UB 1I3UA 1S7RA 1SVZA 3DOSA 4NJ9L 5CSZA 1X7QA 1MI5E 4Y19D 5D6CB 3BGFB 1T03H 4FQCL 2XY1A 3G9AB 4L1DA 1EAPB 4R90H 1VERA 3ZDZF 4OZIA 2D31A 3QO1B 2LTQB 1DDHA 1TZIB 3RZCB 3GRWA 1QFWM 3UJJH 1R3JB 1X5AA 4YFLI 3QIBD 2DIBA 3VXPB 4DUXA 1EHXA 1MAMH 3P0VH 3X11A 3FB7A 3ARFD 1DVFA 4PJHF 1VKXB 5HPOA 3V0AC 3TIDB 4G5ZL 4X5XA 5HGDB 1E28A 3PV6A 4UIMA 2P5EB 1OQXA 4LEXH 4D9QD 3AROA 4BQ8A 5C0CD 4XCYB 2X40A 5JZ7D 3LQZB 3WFBH 5F7KC 3GMRA 3RBGA 5IQ9B 4PJCA 2F54D 1JNLL 2FBJL 1IGML 3KVQA 1U8NB 4YXKL 2NY4C 4O51B 1Q94B 1BQHB 2ZUVA 3TV3L 3DRTB 3E3QE 4Y4FD 3MV8A 2XXMB 3DX8A 3F12A 3OF6D 1QFPA 4MJ5A 5SV3A 1YQVH 1I7RA 2O5ZL 2K7QA 4OGAC 1NMCC 4WI8A 4HKJA 5E99H 4N8CH 3ZHKA 4NO5B 3ULSA 1KJMB 4OZFB 5A16B 2P46B 2AK4B 4MB5A 4YFDB 4E41A 1F4XH 3IKCA 3LIZL 4XPAL 4XX1E 3DV6A 1CXEA 4ENEC 2EXWC 4YZFF 3LS4H 3UDWA 5E6IB 3G6AB 5ICXA 3GZKA 1EK3A 2EDWA 1ZEAH 4LPCA 3S4SG 3SCMB 5KSUB 2VLKA 3V6OC 4KKCD 5IESH 4HC1H 5IOPB 1N59A 2ZP0T 2YK1L 4HIHA 5IQ7L 1XFPA 3QEUA 4KKLD 1AI1L 4AJ0A 4O58H 1N8ZA 2H6PA 2RHEA 4K3JH 2XIDA 4QWWD 3GBML 3NTCH 2B0SL 3IVKA 3EYFA 3MSPA 1A7QL 1XZ0A 3VGFA 5J7CC 5GISH 1B0GB 1X5IA 2XICA 3N9GL 5DQ9B 1AD0A 1LEGB 5IEKB 4RAUA 1HXYA 5IIEA 4ONHA 3MLUH 1R5VA 3VD9A 2MCPH 4NDMB 4Z7WA 1GGIH 4UT6H 1ONQA 1JP5A 4HDIB 5DMJB 4CADA 4R9HA 4U1NB 2OZ4H 4MNQA 1DJSA 1E6OH 1H3VA 1YN7B 4QHNB 5EB9A 3T3ME 1CGYA 4FQLL 2VLRA 4H5SA 4S11A 5T1LD 4M7JH 3SDDC 1N7ML 5HHXL 2DTML 4HUMB 3U7YL 1NCCH 5ACLA 2A9NH 3C5SB 3QXUA 4GW1B 1T1XB 1KIRA 4WCYH 4Y16C 5FUOH 3VXQB 4IOSD 1ZS8A 4PJAE 1GGUA 4XTRC 3KYOB 2XTJB 3M1BA 2ZOLB 3IRZA 4XP4L 5CUSH 5LGKA 1KCLA 2A0LC 4OF3A 1MCWW