3O12A

The crystal structure of a functionally unknown protein from saccharomyces cerevisiae.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
185
structure length
185
Chain Sequence
b'TELSQGTWLNKPKSVFQEAGKVTLETDEKTDFWRETFYGFTRDSGHFLGVETGSAFTAQVRVQGSYESLYDQAGIMVRIDDGHWLKAGIEISDGHAMLSSVLTNGKSDWSTAVYGGNARDFWLRVTVEKGVLRIQVSSDKKTWPLVRLAPFPTSDHYLVGPMACTPERGGLKVTFSEWSLTAPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein YJL217W
publication title The crystal structure of a functionally unknown protein from Saccharomyces cerevisiae.
rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural genomics, unknown function
total genus 42
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07081 DUF1349 Protein of unknown function (DUF1349)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3o12A00
5T5OA 3UJQA 3INAA 2ZA9A 1V6MA 2H0BA 3ILFA 4JC1A 4Q8KA 4Y1UA 1LOFA 1IKQA 1DQ2A 1V6LA 1FATA 3GNEA 5EXOA 1DYKA 4FPLA 2ZGSA 5JOYA 2DURA 1W6PA 2VU9A 5JDBA 2XB6C 4M01A 2GDFA 4UW3A 1GICA 1S0FA 3POWA 5GZFA 4Q27A 4M3CA 2GMMA 1UPSA 2ZHKA 1S0BA 1AX1A 1V6IA 1V00A 3AP9A 4XJWA 2ZABA 1DQ0A 3AZWA 1H9WA 1WD3A 3FFZA 2EALA 4LBQB 2W08A 4FVVA 4LBMA 4P9XA 2RHPA 4Y1VA 3D5OA 3FLTA 5KXEA 4DPNA 2ZMLA 1Z0HA 3TAYA 3ZSMA 1V6NA 5T52A 2SBAA 1KDMA 2TEPA 4XDQA 5GALA 4AGRA 5KXDA 3IPVB 4FOYA 4YG0A 1MS9A 2KM2A 4PBPA 1G8WA 4XBNA 1QDOA 1HLCA 1RIRA 3AXDA 1W6OA 2D6LX 2UWAA 3O0VA 4XTPA 2YMZA 2D43A 2EIGA 2ZGRA 2P34A 3LSEA 3W59A 3WDXA 1WW5A 2NMOA 2NP0A 3SISA 1AZDA 3D4KA 3Q9OA 3V0BA 4D69A 2DUPA 1A3KA 3WG1A 1AF9A 1JHNA 1SBEA 4LBNA 3ZPYA 5AVAA 1H9PA 1C1LA 4Y1ZA 1ENQA 1N1TA 3IM0A 1LCLA 3I4IA 4YFWA 1QNWA 4W65A 2CTVA 1WW7A 4M3CE 2WLQA 3SH5A 2ZGOA 3OBTA 1PZ9A 3RSJA 1R1ZA 1W0PA 2JECA 3AP6A 3DGTA 3H0OA 5IK4A 4YW2A 5CBLA 3M3EA 4H55A 1N1YA 2EXKA 2WQZC 3ZSLA 5DUVA 1DQ4A 3R05A 1GV9A 2LTNA 4YZ1A 1TEIA 1KJRA 1S1AA 1D2SA 4YFZA 1G9FA 5JLVA 3B01A 1J1TA 2DWRA 3AZYA 3OPZA 3FBYA 3KQRA 4Q2FA 1LGBA 2ZGMA 3U4XA 3L2YA 2EXJA 3PVNA 4Y22B 1C57A 1AJOA 1S0JA 2GN7A 1SACA 2ARBA 1G7YA 1YRZA 1MS1A 3WG4A 5IT6A 1MVEA 1FAYA 3PVEA 4YZ4A 1N3PA 3OY8B 1IKPA 1LTEA 1WLWA 3NV1A 2E6VA 2A3WA 4FPKA 4MYEA 3USUB 2P2KA 2ZZJA 4YGCA 4YW3A 4BQ1A 2PHTA 4ISQA 1F31A 4K21A 1YIFA 3N7KA 4GALA 3NWKA 3WHTA 4YGDA 3GALA 1AX0A 5EYYA 3NV2A 1SFYA 1LHUA 1SLBA 1JOJA 1ONAA 1DZQA 1LESA 3DUIA 1MR5A 2OVUA 4WZFA 5L73A 3N3HA 3VKLA 5EWSA 1G9BA 2A6ZA 2VW0A 3WV6A 1N47A 3V0AA 5IUQA 2A6VA 1UZZA 1DGLA 3SH3A 3A4UA 4XXAA 1PZ7A 1ULGA 5KXCA 4ZKTB 2R0FA 3FUQA 5JMCA 3WDUA 3RS6A 4Y26A 3T1MA 1GZCA 3N36A 3PJQA 2NZ9A 2B7YA 1JN2P 1UL9A 4TYSA 2EXIA 3OJBA 4WVWA 1G86A 3NV4A 1SBDA 2FMDA 3A0KA 2E7QA 3M3QA 1LOBA 1Q56A 2A6WA 1JYCA 3ZYRA 1N1SA 2PHRA 1V6OA 4DS0A 3O0WA 1ZA4A 4U2AA 2WJSA 4SLIA 1W6PB 4RA0A 3AK0A 5T5PA 2ZGTA 4CZSA 3O5SA 1SLTA 4GXLA 1HQWA 1DQ1A 4XTMA 3MW4A 5T5LA 4FOVA 2XG3A 2GALA 1AX2A 3RG0A 1GANA 1JW6A 1XQNA 2JD4A 2Z42A 1LHNA 1WW6A 5T50A 1GZWA 3AJYA 2YXSA 2ZHLA 1LULA 3AZXA 4Y20A 2ZAAA 3AX4A 4C1WA 5F5QA 1SLCA 3VKOA 4CTEA 3T1LA 3ILRA 5CB7A 4FQ4A 4I30A 2ZMNA 1KITA 4WV8A 1MS8A 2D6MA 1KQRA 3AYCA 4XIKA 3BIWE 2PHUA 4GA9A 2D3RA 3UL2A 4YW5A 3C2UA 3HMYA 1CPMA 2GMEA 2LALA 4UW6A 2ZHNA 4LBKA 4ATFA 1W6OB 3LSDA 1UAIA 5E88A 3WUCA 5H9RA 3BOPA 4AWDA 1LECA 1MZ5A 2CWMA 4XHBA 3W58A 1V6JA 3VKMA 3I8TA 3SITA 1KDKA 3N7JA 1GSLA 4P14A 1AJKA 4YG3A 3MEPA 1YO8A 1KJLA 4LBQA 3M3CA 1UMZA 2AYHA 1KRIA 3BODA 2ZMKA 3ATGA 1W0OA 5GLVA 2W68A 3JUUA 5GLUA 1QKQA 4M00A 4R9DA 4XBQA 2R1BA 3KM5A 1CQ9A 5IK8A 2WSVA 3MW3A 1EPWA 2DTWA 3IN9A 3AP4A 1DIWA 4ITCA 1LU1A 2AUYA 2WNEA 4UW4A 4FPEA 1LGCA 1MS5A 5FREA 3WCSA 4OZXA 2ZGUA 1DLLA 3ZVXA 4DFSA 4F83A 1ULCA 1W6MA 3ENRA 4XMAA 2DV9A 4GWNA 4Z8BA 4XE9A 4R9CA 1DHKB 4Q1RA 4GKXA 1W6NA 1SLIA 5LK5A 1N1VA 1LGNA 2DVBA 1U0AA 4Y1YA 2E53A 1QU0A 1Q8VA 2A7AA 4XJ8A 1IS5A 1WBFA 4AYUA 2NM1A 3AP5A 1N3OA 2R16A 1Q8QA 2VXRA 3AYEA 2PELA 1UN1A 2BQPA 4Q8LA 1MACA 4Y24A 5DXDA 3ILNA 5H9SA 4XHXA 2WSUA 2PHFA 5KXBA 3PVOA 3WHUA 3WUDA 3N7MA 2P37A 3QLQA 1SCSA 4NOTA 1LU2A 1LODA 2UWBA 1W6QA 1RITA 2Q5TA 3ASIA 1LOFC 4RL7A 2JE9A 3FUOA 4XILA 1LHWA 2DTYA 5DUUA 3OGGA 2ERFA 2GNMA 2E7TA 1HKDA 1FYUA 1FV2A 5T55A 3SNMA 1Q8SA 5HCFA 2PHXA 3D6EA 3OYWB 1HDKA 5DG1A 1IS3A 5GM0A 4BMEA 5T5JA 1VAVA 1Q8PA 1QOSA 2ZACA 1CESA 1G9CA 1ULEA 1S0CA 3OY8A 4YM0A 4WVVA 3ZSKA 2YZ4A 4BMBA 2EAKA 4KBBA 5CA6A 1FNYA 3V0AB 2ZGPA 2PHWA 1QGLA 3IMNA 3POYA 4XXPA 4K1ZA 3USUA 3ZSJA 2G4IA 4ISRA 4XMIA 2V73A 5DZFA 1H30A 1WLDA 4L8QA 2DUOA 1BJQA 2YROA 5GZCA 3AXEA 3POSA 4FPCA 1WBLA 4FPFA 4YM1A 2CY6A 2WT1A 3R4UA 4YW4A 5GZEA 1SLLA 2ENRA 4AGGA 1GNHA 1LOAA 2HYKA 1FX5A 3WLUA 1Z78A 1FNZA 4YM3A 1I1EA 4P9WA 4DRRA 2JDZA 2D3PA 2ZBJA 3N7LA 1AXZA 3B00A 1PZ8A 4XOGA 1F5FA 1LENA 1S0DA 5CNAA 5GLWA 1QMJA 2I2SA 1GNZA 2VW1A 1GLHA 1LJ7A 2ARXA 1RINA 2P3IA 3WDYA 2VY0A 1A78A 4LBQD 2ZHMA 1YXWA 3B9CA 5T54A 5GZDA 1CJPA 1CN1A 2CWSA 1ENSA 2DVFA 4YM2A 1C1FA 2YY1A 2VH9A 2W39A 4M3CB 4LBOA 1A8DA 3QCWA 2EXHA 4ZXKA 1QF3A 1QOTA 1O4YA 4XZPA 4AVVA 5FRAA 2D7FA 2DU0A 2A71A 4FPYA 1AXKA 1YI7A 4JCKA 2WT2A 1DFQA 1WUVA 5DZEA 4FPJA 4PBOA 1OKQA 2GNTA 1G9DA 1JYIA 2VW2A 3AZVA 2D44A 3TB0A 2UWCA 4U36A 4XBLA 3MPPG 4YLZA 5H9PA 1MZ6A 2D6KA 4XJUA 4FPHA 5SV8A 1DYPA 1AVBA 1MS0A 2JE7A 1D0HA 2AH2A 1OFSA 1FV3A 1IS6A 1WD4A 2ZKNA 3WDWA 4Q26A 3ZXLA 1AXYA 4XYXA 1S0IA 5CAZA 4ASMB 4FP2A 4TZDA 1Q8OA 3V0BB 3R4SA 2WKKA 3B69A 4C1XA 4K20A 3ZXKA 4BOWA 4PF5A 1CVNA 4R9BA 4XJ9A 5JOWA 2DVAA 1QDCA 2ZGKA 1JUIA 1IS4A 2ZGQA 4YZ3A 1BKZA 4BPZA 1DBNA 3FLPA 5BYNA 4FP3A 1I3HA 4AVSA 3O12A 4YGEA 1WLCA 1UX6A 3UK9A 3IPVA 1MS3A 1HQLA 2A70A 4M3CF 5E8AA 1LOGA 2EF6A 3WG3A 5DUXA 3ZXJA 2GN3A 1W6MB 1BXHA 1GBGA 2W52A 1BZWA 4LBJA 3ZXFA 1NLSA 4HANA 2R0HA 4Y1XA 2R49A 2AREA 1W6NB 5GLTA 2NMNA 2AR6A 4CRQA 2A6XA 2D6PA 3PMEA 2D3SA 3WCRA 3VUOA 1ZM1A 1WW4A 2A5ZA 3HN1A 1CIWA 2DUQA 4R9AA 1SCRA 3WDVA 2E51A 1OQ1A 1IOAA 1F9KA 2JJ6A 4YG6A 1QNYA 3T2TA 3WDTA 1LOEA 1VLNA 2R1DA 1S0EA 1X50A 2DVDA 1B09A 1JBCA 4YW1A 1VAMA 3A0NA 3RRDA 3ZXEA 1QOOA 4DQAA 1BYHA 2DVGA 3FLRA 3UJOA 3MW2A 2FHRA 1W6QB 4FPGA 1LOCA 1LHOA 2OW4A 1V6KA 3RQ0A 5HCAA 3VV1A 1BQPA 1VALA 2CL2A 2DYCA 3SLIA 3M3OA 1LEDA 4IQPA 3B3QE 3IKWA 2DU1A 1URXA 3CNAA 4LBLA 1CR7A 3ZYPA 3N35A 3RMXA 2AENA 2CYFA 1UKGA 2UURA 5F9TA 4Y22A 4K1YA 1C4RA 1S0GA 4XIOA 2JKBA 4P9YA 3V64A 4DRVA 2A75A 1G9AA 3AYAA 3NV3A 4YZ2A 5GJ6A 1WCSA 2A3XA 3RMYA 3LCPA 2ZGLA 4AGVA 2GNBA 4JRAA 1LHVA 3WNXA 2OUJA 4BLJA 4PCRA 1SBFA 3AZZA 3OBRA 5H9QA 3HR9A 1CONA 1SLAA 2D6OX 3VKNA 1ENRA 2ES3A 2NYYA 5DG2A 1VIWB 4FOQA 1JXNA 4AVTA 3OYWA 3APBA 5IK5A 2V5YA 2SLIA 4BLIA 5DUWA 5DZGA 5GZGA 2YV8A 5JVVA 5HCBA 2AGSA 3AYDA 5JOXA 1YYNA 2C5DA 3M1HA 3AFKA 3VKFC 2P3JA 3BTAA 1UZYA 4YZ5A 3AP7A 4Q1PA 1NXD1 2GMPA 4XJZA 4GWMA 4PQ9A 2UU8A 1GKBA 1ULDA 1GZ9A 5E89A 5JOZA 5EYXA 3WOGA 4GKYA 1MVQA 2VUAA 1APNA 1MS4A 4FOWA 5GLZA 4UW5A 3M2MA 2A6YA 2GNDA 1DQ6A 2NN8A 2P3KA 4FPOB 3WVJA 3SH4A 1Y7BA 3WG2A 4XJAA 2OUHA 4BM8A 1DQ5A 4YGBA 4ATEA 1ULFA 2WT0A 3WZ1A 4FQZA 1GZWB 2D6NA 3JU9A 2CNAA 4Y20B 4NO4A 2C9AA 3AJZA 1CPNA 2ZGNA 1LEMA 1N3QA 4HL0A 1GYKA 5IK7A 2A3YA 3O0XA 3V65A 1O4ZA
chains in the Genus database with same CATH superfamily
3UJQA 1V6MA 5FYHA 1JI6A 2RR12 2VO5A 2QQIA 4XAEA 1O5UA 2YC4A 1PMJX 2TNFA 1IKQA 1W05A 2IXHA 2WWJA 2L9LA 3HNBM 4Y1UA 1DYKA 3SHRA 4D94A 5BNPB 3G7DA 4JHTA 3I59A 2QQNA 4M01A 1RUD2 1XNAA 5A7OA 5KC5A 2GDFA 2OA2A 5FLHA 2XLGA 4Q27A 3OGJA 4IW3A 1W9SA 3JD72 4QD2A 5HXVA 1CAUA 1GQPA 4XJWA 3RJ2X 3VLBB 1H9WA 1WD3A 3FFZA 4E2GA 2W08A 4MSVA 4P9XA 4Y1VA 5FZ0A 5A7WA 5CADA 4DPNA 4Z2AA 4IV1C 4N53C 4AK3A 1UU5A 4IV3A 1V70A 3OUJA 5EP9A 3VBUB 4DY5A 1KDMA 2F6BA 3LKJA 3PU3A 2Y6GA 1PVC3 5FMOL 4PBPA 1NG0A 1QDOA 1HLCA 4BK5A 3HQXA 3WNMA 3O0VA 3KV6A 1W90A 2YMZA 3RNSA 2ZGRA 1Z7S1 2WO1A 2NMOA 2K9ZA 3KS7A 2W95A 1AZDA 2WN3A 3SISA 3PIGA 1H1AA 1OPOA 5FYVA 4UFKA 3ZLIA 4TWTA 1SBEA 3ACFA 1ND3A 3KHCA 1PGW2 4KBZA 2VGDA 1UYPA 2E26A 3KCCA 4IEYA 3AKSA 3O7OA 4Y1ZA 5FZ4A 3VDDA 2QFEA 3I4IA 2WNVC 1QNWA 4W65A 3U07A 3CKHA 3SH5A 4KMQA 2OIIA 3MIEA 3OBTA 4J6GA 1PZ9A 1ULPA 3HD8B 2JECA 3DGTA 1OA2A 3ZFFA 1RVF1 4YW2A 4L97A 1N1YA 2WQZC 3ZSLA 4CP9B 2X05A 5CFCA 2G19A 5DUVA 1IPSA 4AHZA 1NCQA 1OBNA 2LTNA 3MV01 3PUAA 3RZHA 4BU2A 2QZ3A 3B01A 5BNOB 3AZYA 2DWRA 5IAXA 1BVVA 2VD7A 2WR9A 3FBYA 2FDJA 1J3RA 2JDYA 1US2A 2VCBA 2ZGMA 4WVMA 5DAVA 4Q0SA 3T0AA 1R1A2 2I74A 1AJOA 2FQPA 2XXZA 1WLTA 2BFUS 3D82A 3E97A 4IEQA 4A6OA 2ARBA 1G7YA 1YRZA 4CU7A 1MS1A 3NVCA 1R083 4AF9A 1BHGA 1JMUB 3LDRA 5J7MA 2J1UA 1IKPA 3SKVA 3NV1A 1VMHA 2R073 3WW2A 1EAH2 1XNBA 2A3WA 3K48A 5FZOA 1JZ5A 4MX3A 3FN9A 1YJLA 3JXSA 2H6BA 4QQPA 4OHYA 5BNPC 4CUCA 4UFHA 1VPHA 3WP5A 4GB32 1ZRDA 4CDWB 2BNNA 3KQ4B 4J1WA 3VD3A 5LRSA 1NQJA 4B4RA 2WINB 3NJZA 5FTTC 4N90A 3BB6A 4RHV2 3NWKA 4YGDA 5A80A 4V2VA 1AX0A 3K4AA 2BEOA 1SLBA 3WQ7A 2W5FA 1VBA3 1H8TB 1ONAA 1LESA 5C3SA 5L73A 2W1UA 1OF4A 3FMGA 1XU2A 4LO6B 2VMFA 1G9BA 4MXVA 2GH2A 4JTNA 3DKWA 2VW0A 4IERA 3WV6A 4E9KA 5KBFA 2K2SA 3ON7A 3T4VA 1UZZA 1VRH1 1DGWX 3SH3A 3A4UA 2WNUA 3GCWA 2FDKA 1O91A 4KWUA 4DXRA 4ZKTB 2XOMA 4I02A 2X53S 3A22A 3RS6A 3TEZA 1YHFA 3I49A 1AR83 3HWJA 5ACA2 2QQOA 5BNQA 5JMOA 5ABJA 3KHBA 2NZ9A 4IEWA 2HWD3 4QPIC 5K7PA 1KEXA 4XFIA 3T4HB 1JZ4A 3WNOA 1W8WA 1ZZ9A 1SBDA 3A0KA 4IEXA 5FY1A 1Q56A 1HW5A 1N1SA 2PHRA 3QH6A 2RJLA 1CX4A 2B4KA 2HWC1 1AR91 4LMFA 4R52A 2GZWA 3I2IA 5FJKA 2QQLA 1V9U2 4QKNA 1X8EA 4E2QA 4LIVA 1OOPA 4RA0A 4LIUA 3I59B 3O5SA 1DQ1A 2H6CA 4AFAA 4EE2A 1LKNA 5FJHA 3GJBA 5C33A 1NOVA 2J1EA 4AHWA 5T50A 1XQNA 2W1SA 3K51A 3EMRA 3OD0A 5DMYA 1CAUB 3ZFGC 2OPKA 1RUG2 2DCKA 5HV4A 4CTEA 5IJRA 5BNOC 3QACA 1ASJ1 4FQ4A 1W8HA 1P8JA 1KITA 2WZ8A 4P9LA 3WY6A 1NE6A 2D6MA 1KQRA 2RS13 3C7HA 3BIWE 4QT6A 3WW3A 2V72A 4KWKA 4Q4Y1 3BTYA 2PHUA 4GA9A 1W8TA 4MVTA 2MHFA 2R063 5CZKA 2B9UA 2GMEA 4QPGA 5L7OA 4LBKA 3IDEA 1WMEA 2CDPA 4JRLA 4E27A 1W8OA 1GR3A 4N9HA 3B93A 4QXHA 2WS92 3BTXA 5C8CC 1RHI2 1MZ5A 4XHBA 3HPNA 3J4UH 5FMDA 5DAWA 3BALA 3GXUA 1FMD3 4P14A 1VB2A 1AR62 2YC0A 1KJLA 3JQWA 1KRIA 3WNKA 1O8PA 4YVSB 4CXXA 4C90A 4H7MA 1WA6X 5GLVA 5I0TA 1O3TA 1QKQA 4CE8A 3VDDB 3ACGA 1FPN2 1RUF2 1UOFA 3KM5A 4TLGA 2WSVA 5FDBA 3IN9A 3MDPA 3U1XA 1PM7A 1GUIA 3H8XA 2WNEA 4Q29A 1EY2A 1XC6A 3ES1A 4OZXA 3ZFFB 1C3HA 3GZEA 2XBO1 3VBSA 1W6MA 3M70A 5LA1A 2ZAHA 2FCTA 4DY3A 1KD7A 2RS53 4R9CA 1NCQB 4XE9A 1DLCA 3DCQA 1OT5A 5FP4A 1U0AA 3RI8A 3U10A 3IMMA 3LFMA 1Q8VA 1IS5A 1D7PM 4WVMB 2C26A 4GH4A 1UMHA 3AYEA 5J96B 4X8PA 4XHXA 3MPBA 5C5TA 2WSUA 2PHFA 1HIXA 2W87A 4LT5A 1PVC2 1F4HA 5FP7A 3RYKA 1NZCA 4E4SA 2Y26A 5FXVA 3LA7A 4UFIA 5C3PA 1HN0A 2FMYA 1X8MA 4RL7A 2Q5TA 4BQ2A 3FUOA 4FCAA 1GOGA 1LHWA 4XILA 3UKTA 2CGPA 1WWYA 2RMU2 5FZ1A 3B02A 4NIGA 1JU4A 4XURA 3HJRA 4E2SA 1FV2A 3OBAA 4LPLA 1TME1 2CGOA 4P9GA 5BNNB 3L2HA 1V0AA 2MEV2 2IXLA 1UZWA 2CAVA 3CZUA 2D40A 3CZJA 3KGZA 4YWAA 1VAVA 4RR3A 3THDA 4CU9A 2ZEYA 4CDXA 4CCLA 4YM0A 3OY8A 5FYCA 5K0UA 3P3PA 4L9BA 1E5SA 4DZGA 3FE5A 4HZFA 1NA1A 4KBBA 5EPAA 5CA6A 4IV3C 3POYA 4XW3A 4XXPA 2WNUB 3USUA 2ZOEB 4XMIA 5EIYB 4XUNA 1REDA 2YROA 3VB9A 4HKLA 3POSA 5GZCA 5FYBA 2WT1A 1OD5A 1UD1A 3LFIA 2VVEA 4AGGA 2OQ6A 1GNHA 5FPXA 5ABJB 2HYKA 2WZR3 1JH5A 3GM8A 3HOBA 4P9WA 3PHMA 1BCXA 4BQXA 3RGBA 4LK6A 1ND3C 1REEA 1FOD3 5LY2A 1PZ8A 1R082 2VZ1A 3LE0A 4XF9A 3VDDC 1GNZA 2VW1A 3VHOA 4LA2A 2VNGA 1CAXA 2R072 2ZX3A 1ZBA1 5I8SA 2J1TA 3IZOA 1OOPB 1R091 4ASKA 5JAXA 3FC0A 2BV4A 1QJEA 2VQUA 3NJYA 3ZFFC 1EP0A 4K8FA 1W9FA 4URTA 1OH3A 2VVDA 4JZRA 1C1FA 5CVRA 3PUQA 4A2UA 1NY71 4Q4W2 4DEVA 3AMPA 5CFCC 2WNOA 1NCQC 3KV5A 1QOTA 1HXS1 5D1IA 5FRAA 3HBKA 5FZLA 2D7FA 2DU0A 1HB1A 2A71A 4FPYA 4V1PA 5F2WA 4CEYA 1VBA2 1YI7A 2PLV1 1JYWA 2DBNA 2Z5WA 4PBOA 2JKXA 3N4MA 1OKQA 1GFF2 1JYIA 1YUDA 4HVRA 2VW2A 1ENXA 2D44A 1PMHX 2XWJB 3DKQA 4N7IA 1BBT3 2UWCA 2XJUA 2XHNA 4QPGB 3MPPG 4PQQA 5H9PA 5L7OB 1MZ6A 2WAOA 2Q0AA 2G9FA 3FWEA 3IIIA 1MS0A 3NKGA 5E1RA 2AH2A 5FXZA 1FV3A 3JBG1 1IS6A 2HWB1 3ZXLA 1RUJ1 1GQHA 1UU6A 1RUC3 4XFFA 4XYXA 1QJU3 3CJIA 5L36A 1AR82 2GU9A 4QB1A 3IT8A 2D5HA 3R4DB 3R4SA 4C1XA 2HWD2 5KC6A 4XJ9A 2QQVA 1RMU3 4HSJA 1O3RA 2VUDA 3WD5A 1IS4A 5A70A 1CJDA 4FFIA 4CUAA 3FLPA 3EXUA 5BYNA 4FP3A 2WL1A 4CCEA 2FCUA 1L7QA 1OXCA 1HQNA 4AVBA 5DUXA 3JB4C 1ODMA 1W6MB 4PDWA 4LBJA 1BZWA 2VMDA 1DZTA 1NLSA 1JZ2A 2R0HA 2WNUC 1UCXA 3F2ZA 2R49A 3D8CA 2XLAA 5EJZB 3NAPA 5ANQA 2AACA 5GLTA 2D97A 2AR6A 4CRQA 3H3LA 1GP5A 1RB8G 1POV0 3H8UA 2DUQA 4ZU7A 3T08A 3P6BA 2W92A 4CCDA 3THCA 1BMV2 4GH4B 4S2HA 3T2TA 4AL9A 1VBB2 2I07B 5L9VA 3AL5A 1X50A 1US3A 4O61A 1UO9A 4IGPA 1DP0A 4UOJA 5FZ9A 4YW1A 5EJ3A 1QQP2 3E6CC 1XE7A 3O1PA 4BZ4A 4C8DA 2B46X 3PMSA 4NPMA 3UJOA 5IHRA 1MEC1 2WO7A 4WBBA 3N9NA 3I3QA 1V6KA 3RQ0A 1QH6A 4MHRA 5IAVA 1OOPC 3D3AA 3BPSA 3FHAA 4HKOA 1FMD2 4QAWA 4CCKA 5HBAA 3B3QE 3IKWA 2ZX1A 3KD4A 2PA7A 2XDVA 5I0DA 4UBHA 4CUBA 2IC1A 4L2NA 5F9TA 3KWVA 4Y22A 1RUH1 1PK6C 3OPTA 2BYVE 4P9YA 4LO8A 2BU9A 3HQRA 3K4ZA 4XIOA 5FQ0A 5JSPA 2AEYA 2VTXJ 3HNMA 1G9AA 4RR3B 1OKOA 5I93A 1UXZA 4YZ2A 2TBVA 3PURA 5FO7B 2A3XA 4LLOA 3AMHA 3O1RA 3MZHA 4A42A 4JRAA 2P5BA 2V4AA 4TSVA 1UXXX 1SQ4A 4LR4A 1NYWA 3TEXA 3DN7A 4XFGA 3VHNA 3BI3A 4F8AA 3KVAA 3AZZA 2EIBA 1JHJA 3OBRA 2FCVA 4XAAA 5L7OC 4NHLA 4K7JA 4O9GA 1W03A 4FOQA 4LKEA 3OYWA 2V5YA 1UMIA 5DZGA 3KB5A 2XJTA 2YV8A 1OHFA 4UF0B 4A41A 1Z7S3 5HCBA 3W5NA 4D6SA 4DINB 4JQRA 3AFKA 2GMPA 4JGYA 5JIUA 4GWMA 1X36A 4OQ8A 1GP4A 4JQTA 4GJYA 5EYXA 5ISLA 3X29B 4EROA 2P3YA 4IE7A 4XDPA 2Y6FA 4LO7A 4MG2A 3N9LA 3RPQA 3ZMOA 3VBSC 2GNDA 3B5LB 2NN8A 2P3KA 4MXWA 2MNGA 1TVGA 2VZPA 3VBFA 5C5UA 1RVF3 1AR71 5LY1A 2QDNA 3WZ1A 3O14A 4IE0A 4MZUA 1AL21 5FZMA 2CNAA 4INDA 4CEYB 2BTVC 3VBOA 4XF4A 4NO4A 1CPNA 1K5JA 1N3QA 2ZGNA 4HL0A 1GYKA 4EJRA 2P6HA 1NX9A 2VNOA 1STMA 4JC1A 2ZA9A 4GH4C 5EFUA 3V56A 4YW6A 4QQLA 5CIRA 4Q8KA 3I3EA 5FY5A 1TQ5A 5EXOA 1UW8A 2WLPA 3WP3A 2PXJA 4CDQA 2XQRA 5FK7A 5FZ8A 3H3ZA 4WVZA 4QQHA 2OX0A 5JDBA 3AMQA 4UXAA 2FDHA 2ADDA 4UW3A 1S0FA 2VMCA 2IXCA 4B8EA 1UPSA 4COUA 4I0BA 3KZ4C 1UOGA 1V00A 3AP9A 4OUSA 2ZABA 2WZR2 3AZWA 4GQ7A 1Q5OA 4ASLA 3H7YA 4LBQB 3MLLA 4LBMA 3FLTA 2CU5A 5F5IA 5FYSA 4L99A 4LXLA 4BXFA 1FOD2 1CIYA 1COV1 3TAYA 4NHKA 3ZSMA 1V6NA 4AGRA 2SBAA 5GALA 3O1UA 4RYDA 4NMIA 4RR3C 5LATA 3PLQA 4CDXC 1QJZA 1PO21 1L3JA 2VPVA 2Y64A 4CCNA 5K0UC 3AXDA 1EAH3 1VE0A 3Q8FA 4XTPA 2WA4A 1NA1C 5FBJA 3H3UA 3MIFA 5C4WC 2D43A 1DU3D 5C70A 2P34A 5F6KA 1W39A 1WW5A 4QGMA 1ZZ8A 1VRH3 4JKMA 3VHRA 3V0BA 2VTFA 1X82A 4BXSV 5CFDC 4RHV3 2DUPA 1UYYA 2AC1A 2PAKA 2RDQA 1W9TA 1AF9A 1JHNA 1XE8A 2Y0OA 1PGL2 3OUHA 4D3WA 1L7LA 2LS6A 1UKRA 1H2MA 2XMLA 3HVDA 1ENQA 1N1TA 2FDGA 1LCLA 4HFSA 4GMP0 3AB0A 3DEMA 2IFWA 2WLQA 3THTA 1R1ZA 1W0PA 1BBT2 5A7QA 2O14A 5IK4A 1ZZCA 3H0OA 5CBLA 2QVSB 4H55A 3LA2A 2VMGA 5FYMA 2HWC3 1AR93 2C24A 2QDRA 3R05A 3VN4A 4IEPA 1GV9A 4YZ1A 1TEIA 1S1AA 3AVRA 4A45A 1RUC2 4QDSA 1G9FA 1QJU2 3ZFGA 5C8WA 5E16A 1W0NA 4IGQA 2JX9A 4OCTA 1PIV1 3WNNA 1M4WA 2PHDA 3U4XA 2GC1A 3CU7A 4NPRA 4CP0A 1RMU2 4Y22B 4IV1B 1MQTA 4CXYA 4B7EA 4QGNA 4YW7A 5FQ0B 1JODA 2QQUA 2XR4A 1E57A 1YLLA 3LGRA 3PVEA 4QX5A 3SXWA 5CKMA 2WFF2 5CEHA 3THPA 3S7IA 3PDQA 1ASJ3 1CZVA 3MGUA 2JWPA 3LF7A 2BUKA 1D4VB 1JOPA 4KQ7A 1XNKA 1PNGA 1T6GC 3I2JA 4CP1A 4EV0A 2VZQA 3AKQA 2XVLA 3CEWA 4Q4Y3 4CCJA 2VZUA 4AEDC 2PHTA 1AYN2 2PMWB 2E9QA 1YIFA 4GALA 1NZIA 1GOHA 3DL3A 3WHTA 2B9VA 3GALA 3JQXA 1Q3EA 3NV2A 1SFYA 3MUY1 1LHUA 3CJIC 5LW9A 3PTYA 1WCDJ 2WNVB 4LUMA 3I2OA 1MR5A 2WWSA 1LAJA 3BU7A 4WZFA 2ARCA 4YARA 5BY5A 4BIOA 4XABA 3MIDA 1YQ6A 4QX0A 1N47A 3V0AA 2BVVA 1RC6A 1Y3TA 1OSGA 5A6XA 4ARYA 1EV11 4XQDA 4XCAA 3C7OA 2QQJA 2R0FA 3OD4A 3FUQA 4W6WA 5A1LA 2WS93 1J1LA 3WDUA 1SZBA 4MXWB 4PDWC 2DBIA 2E32A 4Y26A 1F2NA 5DAQA 3T1MA 4AG4A 2XVGA 2XBO3 3N36A 4P9JA 3CL1A 3I2DA 2B7YA 3HEIA 3S57A 2Q8CA 3NAPC 1OD3A 3OJBA 2HWF1 5FR3A 1G86A 3NV4A 5FUPA 5DAXA 2FMDA 2E7QA 2A6WA 2JG9C 1NCRC 3LOBA 5J3UA 4DS0A 2VBBA 3GJAA 1S2BA 5L9BA 1QJFA 1QIQA 4E8DA 3SEPA 5HPOA 1Q43A 2B5HA 4SLIA 4LHKA 3AK0A 5T5PA 1SLTA 5KHKA 2B45X 5JXHA 1NLRA 4ONUA 5T5LA 4LO4B 2GALA 5AFEA 4A7ZA 3KLSA 1UOBA 5FZGA 5HXMA 4MADA 3K46A 1B35A 1LHNA 1PVXA 1GZWA 1WW6A 2O0OA 1UNBA 2YXSA 4MGZE 3J7LA 4Z1VA 2ZAAA 1KS5A 3AX4A 5C71A 2VE1A 5F5QA 1SLCA 5C6CA 5A33A 1Z7S2 1O4TA 3ILRA 4TN7A 5EJ1B 4CA9A 5LK7B 3ZYFA 4XUTA 4W8JA 4WV8A 1MPXA 4ZS2A 4XIKA 1TME3 4HT1T 5K8SA 5C9AA 3POFA 5LA9A 4JHZA 1JS9A 4YW5A 4UI9L 2XQXA 3C2UA 2ET1A 1CPMA 1RUE1 4UW6A 4ATFA 3KT4A 3BU0A 3WW4A 4CVUA 2JDHA 5H9RA 1DYOA 4AQ6A 4B7KA 1LECA 3W58A 4NIHA 1V6JA 4EZ4A 2RMU3 2XUMA 1BLZA 4IEZA 4QPIB 4QKBA 3N7JA 1GSLA 4LK7A 1RVF2 2RDSA 2YYOA 1UIKA 3PNAA 3H7JA 4LHSA 4F7ZA 3BODA 4M4RA 4M4PA 2MEV3 2W68A 1VP6A 4CXWA 4M00A 1OFNA 2X5IC 3DF0A 1TMF1 1J84A 3VDBA 4GWIA 2DTWA 3IAPA 1DIWA 4ITCA 1LU1A 3POEA 2EVXA 4XFCA 2Y6KA 1F5JA 3WCSA 4CUGA 4BK4A 5L19A 2ZGUA 3PVBB 1DLLA 4JGYC 3ZVXA 3BIEA 4NAMA 4F83A 3WQ1A 4XMAA 3MIBA 4CEWA 3GZTB 1VMFA 1H0BA 4Z8BA 4M0NA 1OH4A 1O3SA 4URAA 1EUUA 1SLIA 1ZBA3 5LK5A 1LGNA 3ZFGB 2DVBA 4ZHNA 1R093 3ZPOA 2RDNA 2A7AA 5DABA 3RWKX 1XU1A 4I09A 4AYUA 3TBDA 3AP5A 2VCCA 3VBFC 1W28A 3ZX7A 2VXRA 1T6BX 2JE8A 2BQPA 2LM3A 4WZCA 5DXDA 4DUWA 1U5IA 5LB6A 5H9SA 2GH8A 1QY4A 3VBOC 1HB3A 1S2EA 5FKCA 5FO8B 1HXS3 1BEV1 1DG6A 3WHUA 3IDCB 1OVPA 3MLKA 3QLQA 3WUDA 5I8TA 5JSRA 3Q8CA 2ADEA 2RVAA 4NOTA 2PLV3 3ZXGA 4LE3A 1RITA 5C8CB 3O1OA 1VBD1 3S30A 5DN2A 1E5RA 4CDQC 5LRRA 1DZRA 5LZ6A 3ZR5A 3OGGA 2ERFA 2GNMA 5A3MA 2BZDA 1VRH2 2Z2SB 2QZ2A 4AR2A 3PUIA 1DGRA 2X09A 4IDZA 4Q4W3 5SV5A 3HT2A 3OEAA 4NWWA 5KWRA 1H8VA 2DFBA 4COVA 2WYFA 3JBG3 1RUJ3 2XWBB 3LEKA 4OQ9A 3RWNA 4RQPA 5T5JA 3AC0A 4MGSA 2HBTA 1CESA 4Y3OA 3N9QA 3O1TA 2EAKA 3DV8A 5FIXA 3MLJA 1FNYA 3V0AB 3RYRA 3GHMA 2YB7A 4AI2A 5CG9A 3BPZA 4MGIE 3GF6A 5FOBB 4ISRA 2HWC2 2CGNA 1AR92 1H30A 1UYZA 1WLDA 4Y5SA 4OHZA 5LBBA 3T0BA 5JPNB 1K3IA 1VBC1 4YM1A 1HB2A 1MZEA 2ZEWA 4BB3A 1SLLA 5FP3A 2BRTA 2NPIA 3AKPA 3UYJA 1LOAA 3AMNA 2PQQA 2IUWA 1FX5A 2VZRA 2W1WA 1DDLA 3U14A 4AFMA 1I1EA 4DRRA 2VMHA 1AYM1 5AC93 3VGIA 2JDZA 3VD7A 1M06G 1SPPA 4D6QA 5JXIA 4PLNA 1AXZA 2WYSA 2NQYA 3LQCA 1F5FA 5FP8A 1YI9A 4ZS3A 2I2SA 2ZKLA 4OZOA 1QXJA 1LJ7A 5FP9A 3VZLA 1ASJ2 1GQGA 2F17A 5M0TA 3H8OA 3J8F1 1RINA 3WW1A 2P3IA 1C8M1 2VMIA 2ZHMA 1C8NA 1SEFA 3IAQA 1D4M1 4Q4Y2 4CCOA 5APAA 1CJPA 1CN1A 3VZJA 2CWSA 5A3TA 2VH9A 4Q4V1 1MEC3 4Q4X1 2EXHA 1ODNA 1PK6A 4K6BA 4KU8A 3B9IA 5FMBA 5A33B 2BGOA 4JCKA 4N43C 4HKWA 1WUVA 2J1VA 4FPJA 1VBB3 5A7WB 3T2OA 2V09A 3LDBA 4YPJA 1MQTC 4C0HA 4IV3B 5C9AB 3W21A 1QQP3 2ZPXA 3BCWA 4QX3A 1RUH3 5FUIA 2XGXA 1LRHA 4K8RB 3K4DA 3FJSA 5D2AA 2YFUA 2D6KA 3DYPA 3KT1A 4XJUA 5FLJA 5SV8A 3POGA 1DYPA 1AVBA 2ATFA 1OLQA 3DYOA 1OFSA 4W50A 2GC3A 2GC2A 1YEWA 1S0IA 3VBHA 4TZDA 2XBO2 1IPKA 1F35A 2KR2A 1NE4A 4ZZ8A 5FY7A 1CGPA 4B4PA 1ND3B 4LHNA 4EN6B 1QDCA 4Q0UA 2ZGKA 3AM2A 5JOWA 1ACCA 1JUIA 4DNYA 3BGAA 4YZ3A 1W9YA 4BPZA 4HONA 2IZWA 3MF6A 3TN91 3HNYM 4L0PA 3U78A 3O12A 3K2OA 3EYPA 2HWE1 4B3NA 1WLCA 2GC0A 3IPVA 1HQLA 1HRI1 4XACA 1ZRCA 1LOGA 1VR3A 3WG3A 5F5CA 4LITA 4OHWA 2W52A 1XRUA 4CEWB 1CZSA 3FZ3A 3WX5A 5CFCB 1ZZBA 4QGLA 1Y9GA 2OPWA 1HRV1 1C5HA 3KCYA 4B1MA 3OBZA 5JUVA 1WW4A 2A5ZA 3HN1A 4QMAA 3ZM8A 4XF3A 3EQEA 3UGGA 2E51A 1H4HA 5F3EA 2JJ6A 2ZCWA 2OKXA 3WDTA 4BCUA 1AL0G 1LOEA 4JDMA 3Q8AA 1AR73 5FYUA 2ZZQA 1B09A 1TME2 3ZDVA 4FFHA 1VAMA 3A0NA 1YNAA 3ZXEA 1WKYA 5EHDA 4GULA 4GZ9A 3LIHA 1EUTA 2QUOA 4QB2A 2DVGA 5AFBA 1W2AX 4CPBA 4FPGA 4QX8A 5FZOB 3LD8A 2RS31 1VBE1 1BQPA 2JG8A 3RZKA 1JOBA 2DYCA 1YCIA 4H7LA 3M3OA 4ZU5A 4NHXA 1HN1A 3CNAA 5GKAC 1XSRA 4LBLA 1CR7A 3KV4A 3ZYPA 4OI4A 2CYFA 1OLRA 2UURA 1B35C 1C4RA 4JGZC 2YDEA 2D98A 1J3PA 1H6XA 4HK8A 4DRVA 2F4LA 2A75A 3EJKA 4RS5A 4RQPB 1E5IA 1W8NA 4COWA 1WCSA 4QDQA 2A1XA 4GIQA 2ZGLA 3ACIA 2GNBA 5FLIA 3WNXA 4XPVA 5C4WA 3NSTA 1SMVA 4DXTA 5C9AC 3DYMA 4L11A 1W99A 3RJRA 4NVPA 1COV3 1EPZA 5H9QA 4AXOA 2D6OX 1ENRA 5CFDA 4ORFA 2NYYA 5DG2A 5EV7A 1ZBA2 1PO23 1QJY1 1JXNA 4AVTA 3SEEA 1R092 5IK5A 4MO3M 1WCUA 4MGKE 1YQ8A 5ANNA 4XF1A 1XNTA 2FDFA 4NRMA 3D0SA 5JVVA 1VJ2A 3OF1A 2AGSA 1YYNA 1ZVFA 2C5DA 1SPPB 1NY72 3M1HA 3GBWA 1UZYA 4A3XA 4YZ5A 4FTSA 1NXD1 1Y9QA 4UT5A 1TE1B 4IEVA 1HXS2 4KL1A 3I3DA 2IXIA 4PQ9A 4NRPA 4HETA 1ULDA 1GZ9A 4H14A 1UQXA 3S7EA 5JOZA 2PLV2 4DUXA 4FAHA 2HEWF 2J22A 3OTFA 4AI3A 1APNA 1BK0A 1MS4A 2VQAA 2WUHA 4FOWA 2XVKA 4XUOA 4UW5A 3URFA 4YSFA 1UIJA 1Y7BA 1YFXA 2X10A 4N9IA 4XJAA 3WG2A 1DQ5A 2VCAA 4BM8A 1SG3A 3JU9A 1PK6B 2D5FA 4NIAA 4QM8A 5FYZA 3IWZA 4OVEA 3I97A 1IZ3A 3JBG2 2HWB2 1I9RA 1RUJ2 3U0ZA 2JEMA 4XETA 3ZSEA 4BQ3A 2PHXA 5C3OA 4FXKB 5FPZA 1PIV3 2H0BA 3ILFA 2JDAA 1LOFA 1DQ2A 3GNEA 2Y60A 3RZGA 2DURA 1W6PA 2XL7A 5F3IA 5IVJA 4AEDA 5A6QA 4EN0A 4LKSA 2XB6C 3JB8A 4EN9B 4BH9A 1GICA 3POWA 2MPFA 5J98B 4R4XA 4M3CA 4E4DX 5DAPA 4ES9A 2JIJA 2ZHKA 3ORJA 1S0BA 1V6IA 4B4QA 3VBHB 1CAVA 1SHWB 4Q0PA 1ZBE1 3ECQA 1DQ0A 3C7FA 4FBFA 1UU4A 2EALA 4FVVA 2V5DA 2Y8KA 2W46A 1RJ8A 5AC92 2VECA 2VZTA 4META 2BBAA 4PI2A 1XNDA 1XOYA 5HV0A 5IW0A 1QH7A 3LEMA 2G9GA 2ZMLA 4HK9A 5T52A 3UT0A 5KXDA 4JX0A 4XDQA 1W8UA 4RQPC 4HVQA 2CHHA 3IPVB 2WFF3 4FOYA 1MS9A 2KM2A 4YG0A 4QU2A 1G8WA 4QXCA 1RIRA 4LE4A 2D6LX 4NPLA 5K9YA 3VBSB 2EIGA 2IVIB 2G9ZA 4QKFA 2NP0A 3QD6A 5A6ZA 4CDUA 4NWVA 3D4KA 2DCJA 3VL9A 1AYN3 1O6UA 4D69A 1EV13 1WA4A 1MEC2 2XJRA 3R0RA 2ETEA 3WG1A 5KHGA 1HV0A 4LBNA 3ZPYA 5AVAA 4AVAA 1UPIA 1H9PA 2JG9A 1C1LA 1NCRA 1I6XA 1LNSA 5LA2A 3IM0A 4YFWA 1W04A 2RV9A 1WW7A 4M3CE 3VZNA 4EN8B 2Y6LA 4CCMA 1RUH2 2OZ6A 4LORA 5HCHA 2ZXQA 4BQ5A 3HBZA 4S2GA 3T0DA 2Y38A 1GP6A 2EXKA 1IGOA 1NKGA 2CAUA 2JG8B 3KV9A 2Q30A 2KD7A 3ZXDA 1J59A 3A23A 3AKRA 2IXJA 3QBQA 2FDIA 2Z4FA 3L2YA 4HPKA 3ZN4A 2EXJA 3GDBA 1POV1 2DFCA 1C57A 1S0JA 5KHIA 3LA3A 1PO11 1SACA 2GN7A 2VAUA 4P00B 4QHOA 4YRDA 3WG4A 3PTRB 1MVEA 1FAYA 1WZXA 3PJYA 5IYYA 2VNRA 4CDXB 4AQTA 3OY8B 4O9EA 1WLWA 2P6CA 5K0UB 3VZMA 5J48A 3POJA 1NA1B 2E6VA 3JCIA 5FCCA 5C4WB 4MGTA 3CF6E 4W6XA 4COZA 5DPNA 3USUB 2JXAA 2ZZJA 2JDMA 5I0SA 3M8LA 4YW3A 5CFDB 4ISQA 1F31A 5KR7A 1MZFA 1W8ZA 4K21A 2RS11 4I01A 1DCSA 3ZYIB 4EQVA 5F3GA 1U5XA 1UYXA 2GSYA 4P9IA 4YYOA 1X7NA 2X5IA 2W9XA 2R061 2QQKA 3VBHC 1JOJA 1XYPA 4DMIA 2WQ8A 1DZQA 2W0XA 4PIZA 4UYBA 2OVUA 4Z82A 4M0HA 3U75A 1AR72 3N3HA 5AVPA 3KGLA 3VKLA 4I3PA 5JI7A 1PMIA 4FTEA 2EICA 5FZCA 1AL22 4P5YA 4CU8A 2A6VA 5FY9A 5LWBA 3WF4A 5IFPA 1DGLA 4HVOA 1CAXB 4XXAA 1TMF3 1J3QA 1O59A 4A7KA 4KG8A 5F8PA 1SDDB 3ALQA 1YIPA 2JIGA 3A21A 1KXGA 3FBMA 2W94A 4LEJA 5IATA 3FHQA 3VD9A 4DIQA 4ZPIA 1AUYA 4TLFA 3PJQA 4DXZA 3O1SA 3E6BA 1UL9A 4N8MA 4GD4A 2YBKA 2YU1A 5JCTA 1LOBA 5D8AA 3ZYRA 4I3GA 4AEJA 2VOXA 3UV9A 3KT7A 2Q8EA 2RS51 3VDAA 2BJSA 1OLME 3GZAA 4BHPA 3O0WA 3C8XA 4EYUA 4RFT0 3W9AA 4U2AA 2YUEA 1U5ZA 1W6PB 2E63A 4CZSA 4GXLA 2JDNA 2R32A 1RUI1 1HQWA 1COV2 2BP6A 4KGQA 4AEDB 4XTMA 4ET7A 3MW4A 2VR4A 1GOFA 2YHJA 1ZRRA 1BEV3 2XG3A 3OGVA 2ARAA 3SC7X 2QQPA 4XZUG 4A6SA 1JW6A 2Z42A 1PO22 4LHLA 3MFAA 5DDJ1 3CJIB 1DF0A 1VBD3 3AZXA 4Y20A 2JG8C 2ZX4A 3OSDA 5FKBA 3VKOA 5F37A 1UY3A 3T1LA 4S2FA 4UFMA 1W2NA 1QJX1 4CP2A 4ZY9A 1MS8A 4OI1A 4UWDA 5C3QA 3I2KA 2Y6HA 4FT8A 4G3YC 2D3RA 1D0GA 2BOJA 4RS5C 3HMYA 3EBRA 1CWPA 1TZOA 2ZHNA 3MIGA 3LSDA 3RDIA 1UAIA 1YQ5A 1JZ7A 5FBZA 3WP4A 4Y5TA 4E8CA 3O1VA 3BOPA 4PDWB 2XPJA 1RXGA 3VKMA 3I8TA 4CDUB 1KDKA 2UYAA 5I8YA 1AJKA 3NAPB 3QOPA 2OQ7A 1ZZ6A 2UY9A 3M3CA 2QKDA 4X6QB 4DXSA 2E31A 4D7TA 1W0OA 2JG9B 1VBC3 3JUUA 5GLUA 1NCRB 2PAEA 2R1BA 1CQ9A 1SFNA 3KF3A 5FY4A 3MW3A 3VBUA 3ES4A 1PIV2 3AP4A 3H1YA 2AUYA 4MGYE 1KFUL 4UW4A 4O65A 1MS5A 1Y43B 4Y33A 1AYM3 2BWAA 3WXPA 4DFSA 4HG6B 3E1F1 4GWNA 2WAAA 4QB6A 3W5MA 1W3XA 1W2OA 3NNFA 4GKXA 3ZFEA 3J8F3 5C3RA 4Y1YA 3KMHA 1C8M3 3LPGA 4PIYA 4OFGA 4QHBA 3RZZA 4XJ8A 4F3JA 1WBFA 4N43A 1D4M3 3NJXA 4WM7A 2NM1A 4HPKB 3P3NA 2VUJA 1WMFA 1K5MA 1UN1A 4Q8LA 1MACA 2Q1MA 3OPWA 5FOJB 4Q4V3 2WO2A 4Q4X3 3SKJE 2BGCA 2JD9A 4IUGA 4AHXA 4GMP1 3RZJA 1XB9A 4HN0A 2VULA 2WC2A 2IFRA 4AZZA 2P37A 2YGMA 4BA6A 1LODA 2UWBA 1W6QA 2KA3A 2WBKA 3FX3A 1LOFC 3SMHA 4AEKA 2JE9A 4JV4A 3S5AA 1RXFA 2DTYA 4C91A 5J37A 1O8SA 2QTWB 4DO0A 2E7TA 3IBMA 3ZIWA 1YFWA 1HKDA 1FYUA 5T55A 2WA3A 1EV12 1Q8SA 5HCFA 1U5YA 3OYWB 4LNVA 3WQBA 5DG1A 1IS3A 2X5IB 4AFDA 2QJVA 3GCXA 3J9SA 5GM0A 4BMEA 3GBFA 3BKZA 2ZEZA 2BOIA 1QOSA 1JTZX 1G9CA 2FD8A 4OLLA 4WVVA 3VL8A 3ZSKA 4BMBA 4JGYB 1G6NA 1OA4A 1XXNA 2HWF2 3LOIA 2CV6A 4OMDA 1QGLA 2CDOA 3IMNA 2BNOA 3ZSJA 3PIJA 2E7AA 2G4IA 3TN93 4CDWA 5BXXA 4HN1A 2DUOA 1HB4A 5DQ0A 3AXEA 4FPCA 3K75B 4RGGA 1WBLA 1SDWA 4FPFA 1HRI3 2CY6A 5GZEA 2KXLA 4NJ4A 5I0RA 3BTZA 1IQDC 4UBGA 4I0WB 2RJ2A 3VBFB 5FUNA 4QXBA 3DPRC 4CDUC 4LTAA 5G05L 1DGWA 2BBVA 1FNZA 4DEQA 2VNVA 4YM3A 5IVVA 3VBOB 2VBDA 2D3PA 4H3WA 4CU6A 3B00A 3Q8EA 4XOGA 1LENA 1VRBA 1H4GA 1QMJA 2R30A 3MUZ1 1GLHA 3ACLA 4LLFA 4V2WA 3UKVA 4RD7A 2BPA2 2B8MA 1GWKA 1FT9A 4NHYA 3J7NA 4CDQB 2R041 2OXBA 2YPJA 3DECA 1A78A 2C1FA 2IVJA 4JTOA 4LBQD 4YVWA 3B9CA 3I2HA 4CSWA 2XJSA 2RM21 4Y4RA 5GZDA 3RFRA 5A3PA 4A4AA 3P5BA 1ENSA 2P17A 4DB5A 1OUXA 4J25A 3R6SA 1RUE2 2Q1FA 2YY1A 2W39A 1A8DA 2WZEA 2YC2A 3K3OA 2JDKA 4JGZA 1QF3A 4QX2A 1O4YA 3NKTA 4ZXKA 3WEZA 3ZKYA 3SQOA 2RS33 1VBE3 1AXKA 1XBFA 3H1WA 1XYOA 1DFQA 4BDVB 1HJGA 3I7DA 1G9DA 2ORZA 3AZVA 3HN3A 5LCWL 4U36A 1RTVA 4YLZA 1XYNA 1TMF2 4EWDA 4FPHA 5F39A 2C9KA 1W06A 2DCTA 2JE7A 4WM8A 3WDWA 4Q26A 5CAZA 1AXYA 2PFWA 2WN2A 5TSWA 3U4SA 5FY0A 2XONA 4AAPA 1Q8OA 3V0BB 3B94A 2RR11 1LR5A 5CISA 4R4ZA 2LW8A 1FPN3 4PF5A 1ZRIA 4A3ZA 4NIDA 3CDZB 2VOVA 4QM9A 3WT3A 1D2QA 1QJY3 1VB4A 1BKZA 2WO3A 1ZREA 2ID4A 3J26N 1ND2A 1I3HA 1RUD1 4AVSA 4YGEA 3UK9A 4HMZA 4M3CF 5E8AA 2XHKA 3H1MA 5L9RA 2EIDA 1A8MA 3JD71 4PIXA 3I2FA 1F15A 1GBGA 3KSCA 2PAMA 3CIHA 5FPVA 1BEV2 3I3BA 5A3UA 1WMDA 4AI1A 2AREA 4G4FA 4KWJA 5FXXA 3ZFEB 3GGLA 1TNFA 4XEZA 2A6XA 3PMEA 5A7SA 3VUOA 1VBD2 4YVSA 2ZX0A 2BW8A 1CIWA 4BWOA 3L9JT 4N43B 4WM7B 2HYXA 3OGSA 3ZKUA 2R7EB 1F9KA 1YC61 3T09A 4YG6A 1QNYA 3I2GA 4P5HA 1K5MB 3BUCA 1VLNA 4W6YA 1MQTB 2R1DA 5JI9A 1GWLA 2O8OA 2J1RA 3KF5A 2BVBA 3VD5A 4D6RA 1HJFA 1C28A 1JBCA 1OMIA 4ZU4A 1K42A 3ME2A 5D8AC 5IVCA 3IIAA 3NNGA 4JDOA 4RGKA 1ALYA 1BYHA 3UETA 5FZEA 3UNPA 1W6QB 1LOCA 2V4VA 2VCMA 3SCHA 3LB9A 3VV1A 1PGW1 1YWKA 2QE3A 4DUVA 5HCAA 2K46A 2CL2A 1S55A 2YFZA 3EB7A 1LEDA 4XC9A 1JYXA 2DU1A 1URXA 4PJYA 3WF0A 3N35A 4LA3A 2AEZA 2GAUA 1UKGA 2YU2A 3TOJA 3N9MA 3KVBA 1S0GA 4K1YA 1VBC2 2HWB3 4KWLA 4AOCA 3LEGA 3AYAA 3NV3A 4D8MA 1ZBE3 5GJ6A 4FAGA 3AFGA 2Y6JA 5FPLA 3LCPA 4AGVA 4AE2A 3J7HA 1LHVA 2OUJA 1AYM2 3MF9A 3HQUA 2BGPA 3AMMA 1PGSA 5FWEA 2UY8A 3HIFA 2GP5A 4NROA 1CONA 1SLAA 2Y33A 5CG8A 1R1A1 1E5HA 2VOKA 4AFBA 1XE0A 5FPUA 5A3OA 3K3NA 1H6YA 4MOAA 2Y34A 3J8F2 5C7GA 5JXGA 2B42B 1A6CA 1C8M2 3E5XA 5BNNA 4BLIA 4D7YA 5DUWA 2J1SA 1OQEA 2PQSA 1D4M2 4TXWA 1C5IA 1EAH1 4ZXEA 4XDOA 5JOXA 3VKFC 4Q4V2 1OI6A 4Q4X2 3ROUA 3EHKA 4Q1PA 5A6YA 4GB31 2W1QA 2IWGB 2J1AA 2OZJA 3CLPA 3OEBA 3JZVA 4HXCA 3VBUC 4RHV1 3OB8A 5IVEA 1ZRFA 1QHDA 2IXKA 1MVQA 4FFGA 3WQ0A 2Q1ZB 2JENA 4S2DA 4YVWB 3ZYBA 3ZN5A 2GP3A 3M2MA 2A6YA 3OCPA 1DQ6A 4FPOB 4PI0A 3WVJA 5I91A 2BWCA 3I54A 1BVP1 4YGBA 1R64A 4ATEA 5JSOA 1B35B 4IEOA 1GZWB 2D6NA 3N9PA 1O3QA 4JGZB 3ZFEC 4AVCA 2VXJA 4PLOA 5IK7A 2Z69A 4C0BA 2A3YA 5FZ7A 3O0XA 3V65A 1O4ZA 4WM7C 5IVBA 1IHMA 5T5OA 3INAA 3PL0A 5JWPA 4OI2A 1K5MC 2WZPP 1V6LA 1FATA 1POV3 2VQTA 4OUMA 4FPLA 1YFYA 2ZGSA 4K40A 1JU3A 3SCFA 5JOYA 2UYBA 1W2TA 1PO13 2HLEA 2VU9A 5ACA1 5IWFA 2LRPA 3RYPA 3TN92 2Q4SA 3CMGA 5JIAA 1NQDA 3RZLA 2HWE2 3KCXA 5GZFA 4WM8B 4HLTA 2GMMA 1HRI2 3FHIB 5F2SA 3NJVA 1AX1A 3ST7A 5FY8A 4IESA 4FI9A 1NUKA 2RJKA 4BYYA 3TEWA 2C4XA 1K12A 2CSGA 3WP6A 1V9U1 3G6JB 2RHPA 3D5OA 3M4FA 2VL4A 4JVAA 4J1XA 1UZ0A 4JDNA 5A7NA 1HRV2 5KXEA 5CYYA 1XJAA 2QCSB 1Z0HA 3AL6A 1ND2B 3CBNA 1ZYBA 2LUWA 2I45A 2TEPA 4OUEA 4PF1A 2XH6A 2OT7A 1XNCA 4KH9A 1FI2A 5IVYA 5FPBA 2G1MA 3OG2A 4XBNA 1SFPA 4QPYA 1W6OA 2YBSA 5A32A 1GNYA 2UWAA 1ST8A 1UY4A 1RUG1 1IG3A 2J42A 3LSEA 1ZA7A 3W59A 2P4EA 4HOOA 5FXWA 3RVHA 3WDXA 1WCKA 4CDWC 3Q9OA 3ZO0B 5B4NA 4LKFA 2N7GA 1A3KA 1H2NA 3NNMA 2FZ2A 3MO4A 4COYA 1U12A 1VBE2 2RS32 2R6QA 2RG4A 2W47A 3F95A 4QX1A 5FO9B 1PNFA 4L92A 5LEJA 1H8TC 1WMXA 2CTVA 3CO2A 2WS91 1J83A 2ZGOA 3LIGA 5FZHA 1RHI1 3Q8BA 5BV6A 3NNLA 1AL23 4IL7A 1WGPA 3RSJA 2HBUA 3VD4A 1UY1A 3IDAA 3AP6A 4Q5OA 4KGGA 1QXRA 5FZIA 3TNPB 3M3EA 1AR61 4JKKA 5BPXA 4NUBA 5FZKA 3P1IA 4AFCA 1DQ4A 1PM4A 5LASA 1KJRA 4NE9A 4X6RB 1D2SA 1VAKA 4YVWC 3ZDSA 4YFZA 4QX7A 1CAWA 1FPN1 1RUF1 3ZOIA 5JLVA 1VMJA 1J1TA 4OULA 5J36A 3OPZA 2VC9A 1RUI3 3KQRA 2FZ1A 1LGBA 3MFCA 4Q2FA 4QKDA 3NL1A 5FPAA 4ZONA 4KNCA 3PVNA 4AI8A 4XUPA 3QH7A 1L7RA 1H2LA 4E4ZA 4LULA 1QJY2 1K45A 5DDJ3 5EQUA 5IT6A 4YZ4A 2RDRA 1N3PA 1LTEA 3T30A 3ZN6A 2QQWA 3WINE 1QJX3 3GYDA 3UGHA 4FPKA 4MYEA 3WR0A 3BN6A 2P2KA 4GJZA 3I3MA 2XL9A 3FFQA 4YGCA 5B4XA 4BQ1A 4JAAA 3OGRA 2BDRA 3N7KA 4BQYA 1RGSA 2XKOA 4WM8C 5EYYA 4IE4A 1YQCA 1PVC1 4CYDA 1YQ2A 4ZZ5A 3DUIA 1J58A 5FZ3A 5EWSA 5A1AA 1UWWA 4OYUA 2A6ZA 2RMU1 5A3WA 1QWRA 5IUQA 3E5QA 2DCYA 3OUIA 3LDKA 1ND2C 3VBRA 3ZMNA 1PZ7A 2DF7A 1ULGA 5KXCA 1A34A 3U37A 2J7MA 1RUNA 2MEV1 4NHMA 1IG0A 5JMCA 2W91A 5FZBA 4XFBA 5I0UA 1GZCA 4RFRB 3EO6A 2VZSA 4UF0A 5F3CA 5B2GB 1JN2P 4TYSA 2EXIA 5EZWA 4EWEA 4WVWA 1OUSA 2E33A 2OYZA 4YVSC 3M3QA 5K4LA 2VMEA 1JYCA 2BFUL 1ZBE2 1OVSA 1QXPA 1V6OA 4GWJA 5KHHA 3WNLA 4BE3A 2ZTNA 3FL7A 5CU1A 3CHXA 1ZA4A 3UGFA 2WJSA 3ZYHA 2ZGTA 3LEIA 4KU7A 4BISA 1DGRN 4GMP3 4FOVA 4GAZA 3NMBA 2P1BA 1AX2A 3VHPA 4OI0A 3RG0A 4HSLA 1GANA 2JD4A 3POBA 2XLFA 3AJYA 4ES8A 2ZHLA 1LULA 1R081 1WCQA 3WF1A 4C1WA 1UOJA 5FAXA 3W20A 1X9TA 2R071 5CB7A 1W3VA 2JB8A 3BVCA 4I30A 5A1FA 5E6HA 2ZMNA 5LA0A 1JYNA 2W2IA 3AYCA 5BUVA 4XF0A 1S2KA 3UL2A 1OF3A 4PHZA 3VZKA 2LALA 1PX3A 4Q4W1 2QQMA 4A44A 1W6OB 3BYWA 5E88A 5A32B 4XUQA 3WUCA 4RGAA 3GHNA 4AWDA 5F32A 2CWMA 1KFXL 1VBA1 4AQSA 2BNMA 5D21A 2Q8OA 4Z2WA 3SITA 2BERA 3DPRA 3ITQA 1YJKA 1IQAA 4XVHA 3MEPA 4YG3A 1YO8A 2W3JA 4DOUA 3S0MA 4LBQA 2D93A 4MHUA 1UMZA 2AYHA 4AEMA 3TWIA 2ZMKA 2YGLA 3ATGA 5LBEA 5BNNC 3H9AA 4EZHA 4R9DA 4XBQA 5IK8A 5JZGA 4NAOA 1NLQA 3H8RA 1EPWA 4YNIA 4XCBA 3ETQA 1ZX5A 5A3LA 3T2PA 1OPMA 3WNPA 4FPEA 1LGCA 4O7XA 4QXKA 5FREA 2HWF3 1EYBA 1AR81 2X8KA 1PO12 4AI0A 2LROA 1ULCA 3ENRA 2DCZA 2HWD1 2DV9A 3H50A 2HH9A 4P08A 5AC91 1DHKB 4Q1RA 3O1MA 5F1RA 2Y0IA 1W6NA 2ZS6B 1N1VA 1CAWB 4IXLA 3LZZA 4MUVA 2R043 2E53A 1QU0A 3WF2A 4LKDA 4UAPA 1BK1A 1TNRA 2RM23 1IPJA 1UF2C 2ILMA 5ABJC 1N3OA 2ORXA 1Q8QA 2R16A 2Q8DA 1CX1A 4X8NA 1X9PA 1Y4WA 2EA7A 2PELA 3NW4A 3MV11 4Y24A 4AAXA 2RS12 5J1XA 4JKLA 3ILNA 3S6PA 2O8QA 4RS5B 4IE5A 1I5ZA 5KXBA 5F6LB 3PVOA 1POQA 2O1QA 2R062 3N7MA 1AHSA 3T3YA 3ZN6B 1SCSA 5G04L 1LU2A 5JXJA 4P02B 3ASIA 1FXZA 1F8VA 2VJXA 5LEKA 3CQOA 1H1MA 4LUKA 2RE9A 3ZXAC 1BMV1 5DUUA 3TEYA 2VTXA 3HAGA 4BJ0A 1VBB1 1OQDA 1RUE3 3SNMA 4QU1A 1OLMA 3D6EA 5FV3A 1QQP1 1HDKA 1XPWA 4IV1A 2JB4A 4N53A 3ZYGA 2ZEXA 4SBVA 5FYIA 3E5UA 5A3NA 2PN5A 1Q8PA 2ZACA 1JYTA 4CEWC 2ZX2A 4K9SA 1ULEA 1S0CA 2JDUA 2RR13 3AKTA 2YZ4A 2VBPA 3POIA 1H1IA 3TRSB 2WDBA 1NT0A 2ZGPA 1FMD1 2PHWA 4W4ZA 4FO9A 3VBRB 4K1ZA 2V73A 4QPGC 5DZFA 1RUD3 1JZ6A 4L8QA 2RS52 1BJQA 2DDUA 1X33A 3PUSA 3E6DA 1UY0A 4AW7A 3R4UA 4RSUA 4YW4A 2ENRA 3JD73 2ZJCA 2A73B 1RUI2 2WNVA 3WLUA 1Z78A 4PT6A 4MH0E 1KGYA 4Z92B 4IETA 1CD3G 4MV2A 2WWUA 2ZBJA 5DDJ2 2VQ0A 2XUEA 3N7LA 2PYTA 4Y5Z0 5FMOS 1S0DA 3MBWA 4LOTA 5CNAA 5GLWA 1OURA 4KI5M 1HX6A 4EN7B 2TUNA 1LB2A 4B1LA 2ARXA 1HV1A 3UESA 1QJX2 3WDYA 1O5LA 2VY0A 5T54A 1YXWA 2HEYF 4QQ2A 2DVFA 1KS4A 3BOWA 4YM2A 4HBNA 4M3CB 1XSQA 4LBOA 3J7MA 3H42B 3QCWA 5HI0A 1CAVB 4XZPA 4AVVA 5FYYA 4A7YA 1OC1A 5KHJA 2YG0A 3AVSA 2WT2A 2QNKA 4IGOA 5DZEA 4UFLA 4D7SA 2GNTA 3NRUA 3NO8A 1GU3A 3M7AA 3TB0A 5BNPA 1OA3A 4XBLA 4IEUA 3DXUA 4OMCA 3MYXA 5IFTA 2HKXA 1TG7A 1ULOA 1D0HA 2QBXA 5CKNA 2ZKNA 1WD4A 3B7MA 1PX4A 3ELNA 4I0AA 4ASMB 4FP2A 2C6SA 4R8HA 2HJIA 3DPRB 4NIIA 4D0QA 5JR2A 4G9SB 2WKKA 3B69A 4NRQA 4K20A 3IDBB 2X29A 4OHVA 5LBCA 4OHXA 2OS2A 3ZXKA 1CVNA 4R9BA 4BOWA 1R1A3 4AI9A 2DVAA 4Z07A 5FWJA 4CPBD 5F5AA 1I5PA 3WSOA 2ZGQA 5JZGB 5FZ6A 2PHLA 1DBNA 2WFPA 2VM9A 1UX6A 3ABZA 5FFOC 1MS3A 2JICA 2A70A 2EAAA 2EIEA 1JZ8A 1RYYA 2EF6A 4XQWA 4N7UA 3S5QA 3ZXJA 2GN3A 1BXHA 2WZR1 3ZXFA 2F4PA 3UKNA 4GB33 4HANA 4H2AA 3VBRC 4QWNA 4Y1XA 4QPIA 3ETPA 1W6NB 1GWMA 2YPDA 3NQHA 2NMNA 5ERLA 1FOD1 1NXMA 4K3UA 2D6PA 2VOTA 2D3SA 3K77A 4QPWA 3WCRA 1ZM1A 4EWAA 4R9AA 4FSJA 5FZDA 2FBEA 3SCGA 2VZOA 1SCRA 2Z79A 3PU8A 3WDVA 2WRAA 1OQ1A 3MIHA 1IOAA 3DXTA 4NN0A 2PTMA 3PUHA 4LQRA 1S0EA 1REFA 3T2QA 2DVDA 3ZIXA 4E4HA 5A7PA 3RRDA 2YBPA 1QOOA 1UY2A 4DQAA 2VZVA 3FLRA 3VZOA 3MW2A 2FHRA 5F7UA 1QEXA 2VOWA 2OW4A 1LHOA 2XJVA 4ARXA 4CP9A 4XQ4A 1PGL1 4AQ2A 3GBGA 4FTBA 4LJHA 4IE6A 5FMCA 1S4CA 1RUOA 5J09A 1VALA 4QDRA 3CJXA 3NNJA 3SLIA 2WQ4A 4IQPA 3C3VA 3WF3A 5BNOA 2HEVF 5ACA3 5IVFA 2VUCA 5T3NA 4Q0QA 3RMXA 2AENA 4MLOA 4N53B 1BBT1 1RL3A 2JKBA 3LWCA 1RJ7A 3V64A 4CEYC 4QQOA 4FXGB 4FFFA 5LBFA 3M3IA 3ACHA 3MHZA 4KG0A 1O7FA 2WIIB 3GZUC 4Q0VA 3RMYA 3USSA 1V9U3 2WABA 2VG9A 1RUC1 3LAGA 1QJU1 5C8CA 4BLJA 3A7QA 4RN5A 4PCRA 1SBFA 3ZR6A 3HT1A 2H0VA 2XJPA 1W8FA 1W9WA 3HR9A 1RMU1 3VKNA 2ES3A 2HWE3 1T2XA 5FZFA 1VIWB 3TYJA 2ET7A 4BQ4A 2R042 3APBA 5JPMB 4XFHA 2SLIA 1ZNPA 1RUG3 5GZGA 4XFAA 2WFF1 2RM22 4UFJA 4TTGA 1H8TA 5FZAA 1ZZ7A 4Y4YA 1GZTA 2JDPA 3AYDA 3LPFA 3MICA 2C0ZA 2VVFA 5CKQA 5FK8A 2P3JA 1HRV3 1PHMA 2XJQA 3BTAA 3AP7A 3OOXA 4LO5B 5D8AB 3U11A 4BIFA 4BQWA 3C7EA 2XKPA 4XJZA 3RZMA 3IB3A 3TNQA 2UU8A 1GKBA 3VDCA 5JZGC 1CZTA 1AYN1 2VZ3A 3MI8A 1H2KA 4LOSA 5E89A 5JR7B 4NR1A 4B29A 3WOGA 4CCCA 1JUHA 1F4AA 4GKYA 2VUAA 4AHYA 3N9OA 1UZVA 1YFUA 1RHI3 3C7GA 5GLZA 2NLRA 1Y9MA 3SH4A 1GMMA 2OUHA 4MGQA 1AR63 1ULFA 2K0GA 2WT0A 3D0JA 4FQZA 1JYVA 4I2OA 1UX7A 2B39A 4Y20B 4PLMA 4QHZA 2C9AA 3AJZA 1LEMA 1JZ3A 3RI9A 1NAEA 5FYTA 2AZ5A 1RUF3 3ZYJB 1W2UA
chains in the Genus database with same CATH topology
3UJQA 1V6MA 2RR12 1O5UA 4Y1UA 2TNFA 5BNQA 1IKQA 2IXHA 3SHRA 1DYKA 4D94A 5BNPB 3G7DA 3I59A 4M01A 1RUD2 5KC5A 2GDFA 2OA2A 5FLHA 2XLGA 4Q27A 3OGJA 3JD72 4QD2A 5HXVA 1CAUA 4XJWA 3RJ2X 3VLBB 1H9WA 1WD3A 3FFZA 4E2GA 2W08A 4MSVA 4P9XA 4Y1VA 5CADA 4DPNA 4IV1C 4N53C 4AK3A 1UU5A 4IV3A 1V70A 3VBUB 4DY5A 1KDMA 2F6BA 3LKJA 1PVC3 5FMOL 4PBPA 1NG0A 1QDOA 1HLCA 3HQXA 3O0VA 2YMZA 3RNSA 2ZGRA 1Z7S1 2NMOA 2K9ZA 3KS7A 3SISA 1AZDA 1H1AA 1OPOA 4TWTA 1SBEA 1ND3A 1PGW2 2VGDA 3KCCA 4IEYA 3VDDA 3AKSA 3O7OA 4Y1ZA 2QFEA 3I4IA 2WNVC 1QNWA 4W65A 3U07A 3SH5A 2OIIA 3MIEA 3OBTA 4J6GA 1PZ9A 3HD8B 2JECA 3DGTA 1OA2A 3ZFFA 1RVF1 4YW2A 4L97A 1N1YA 2WQZC 3ZSLA 5CFCA 5DUVA 4AHZA 1NCQA 2LTNA 2QZ3A 3B01A 5BNOB 3AZYA 2DWRA 1BVVA 3FBYA 1J3RA 2ZGMA 4WVMA 4Q0SA 1R1A2 2I74A 1AJOA 2FQPA 4IEQA 1WLTA 2BFUS 3D82A 3E97A 2ARBA 1G7YA 1YRZA 1MS1A 3NVCA 1R083 4AF9A 5J7MA 1IKPA 3NV1A 2R073 3WW2A 1EAH2 1XNBA 2A3WA 3K48A 4MX3A 1YJLA 2H6BA 4QQPA 4OHYA 5BNPC 3WP5A 4GB32 1ZRDA 4CDWB 2BNNA 4J1WA 5LRSA 1NQJA 4B4RA 2WINB 3NJZA 5FTTC 4N90A 3BB6A 4RHV2 3NWKA 4YGDA 1AX0A 2BEOA 1SLBA 3WQ7A 1VBA3 1H8TB 1ONAA 1LESA 5L73A 3FMGA 1XU2A 4LO6B 1G9BA 4MXVA 2GH2A 4JTNA 3DKWA 2VW0A 4IERA 3WV6A 4E9KA 5KBFA 2K2SA 1UZZA 1VRH1 1DGWX 3SH3A 3A4UA 2WNUA 1O91A 4ZKTB 4I02A 2X53S 3RS6A 1YHFA 1AR83 3HWJA 5ACA2 5ABJA 2NZ9A 4IEWA 2HWD3 4QPIC 5K7PA 4XFIA 1ZZ9A 1SBDA 3A0KA 4IEXA 1Q56A 1HW5A 1N1SA 2PHRA 3QH6A 2RJLA 1CX4A 2HWC1 1AR91 4R52A 2GZWA 1V9U2 1X8EA 4E2QA 1OOPA 4RA0A 3I59B 3O5SA 1DQ1A 2H6CA 4AFAA 1LKNA 5C33A 1NOVA 4AHWA 5T50A 1XQNA 3K51A 3OD0A 1CAUB 3ZFGC 2OPKA 1RUG2 2DCKA 4CTEA 5BNOC 3QACA 1ASJ1 4FQ4A 1KITA 4P9LA 3WY6A 1NE6A 2D6MA 1KQRA 2RS13 3BIWE 4QT6A 3WW3A 4KWKA 4Q4Y1 2PHUA 4GA9A 4MVTA 2MHFA 2R063 2B9UA 2GMEA 4QPGA 5L7OA 4LBKA 3IDEA 1WMEA 4JRLA 4E27A 1GR3A 4N9HA 3B93A 2WS92 5C8CC 1RHI2 1MZ5A 4XHBA 3J4UH 3BALA 1FMD3 4P14A 1VB2A 1AR62 2YC0A 1KJLA 3JQWA 1KRIA 4YVSB 4C90A 4H7MA 5GLVA 5I0TA 1O3TA 1QKQA 3VDDB 3KM5A 1FPN2 1RUF2 2WSVA 5FDBA 3IN9A 3MDPA 1PM7A 2WNEA 4Q29A 1EY2A 3ES1A 4OZXA 3ZFFB 1C3HA 2XBO1 3VBSA 1W6MA 3M70A 2ZAHA 4DY3A 1KD7A 2RS53 4R9CA 1NCQB 4XE9A 1U0AA 3RI8A 3U10A 1Q8VA 1IS5A 4WVMB 4GH4A 3AYEA 5J96B 4X8PA 4XHXA 3MPBA 2WSUA 2PHFA 1HIXA 4LT5A 1PVC2 3RYKA 1NZCA 4E4SA 2Y26A 3LA7A 2FMYA 1X8MA 4RL7A 2Q5TA 3FUOA 4FCAA 4XILA 1LHWA 3UKTA 2CGPA 2RMU2 3B02A 4E2SA 1FV2A 1TME1 2CGOA 4P9GA 5BNNB 3L2HA 2MEV2 2IXLA 2CAVA 2D40A 3KGZA 1VAVA 4RR3A 4CDXA 4YM0A 3OY8A 5K0UA 3P3PA 4L9BA 4DZGA 3FE5A 4HZFA 1NA1A 4KBBA 5CA6A 4IV3C 3POYA 4XW3A 4XXPA 2WNUB 3USUA 2ZOEB 4XMIA 1REDA 2YROA 5GZCA 4HKLA 3POSA 2WT1A 1OD5A 1UD1A 2VVEA 4AGGA 5FPXA 1GNHA 5ABJB 2HYKA 2WZR3 1JH5A 4P9WA 3PHMA 1BCXA 1ND3C 1REEA 1FOD3 1PZ8A 1R082 4XF9A 3VDDC 1GNZA 2VW1A 3VHOA 4LA2A 2VNGA 1CAXA 2R072 2ZX3A 1ZBA1 5I8SA 1OOPB 1R091 5JAXA 3FC0A 3ZFFC 1EP0A 4K8FA 4URTA 2VVDA 1C1FA 5CVRA 4A2UA 1NY71 4Q4W2 5CFCC 3AMPA 1NCQC 1QOTA 1HXS1 5D1IA 5FRAA 4CEYA 2D7FA 2DU0A 2A71A 4FPYA 4V1PA 1VBA2 1YI7A 2PLV1 2Z5WA 4PBOA 3N4MA 1OKQA 1GFF2 1JYIA 1YUDA 4HVRA 2VW2A 1ENXA 2D44A 2XWJB 4N7IA 1BBT3 2UWCA 2XJUA 4QPGB 3MPPG 5H9PA 5L7OB 1MZ6A 2Q0AA 2G9FA 3FWEA 1MS0A 3NKGA 5E1RA 2AH2A 1FV3A 3JBG1 1IS6A 2HWB1 3ZXLA 1RUJ1 1GQHA 1UU6A 1RUC3 4XFFA 4XYXA 1QJU3 3CJIA 5L36A 1AR82 2GU9A 3IT8A 2D5HA 3R4DB 3R4SA 4C1XA 2HWD2 5KC6A 4XJ9A 1RMU3 4HSJA 1O3RA 3WD5A 1IS4A 1CJDA 3FLPA 3EXUA 5BYNA 4FP3A 2WL1A 1HQNA 4AVBA 5DUXA 3JB4C 1W6MB 4PDWA 4LBJA 1BZWA 1DZTA 1NLSA 2R0HA 2WNUC 1UCXA 2R49A 3D8CA 2XLAA 3NAPA 5GLTA 2D97A 2AR6A 4CRQA 1RB8G 1POV0 3H8UA 2DUQA 4ZU7A 1BMV2 4GH4B 4S2HA 3T2TA 1VBB2 2I07B 1X50A 4YW1A 5EJ3A 1QQP2 3E6CC 1XE7A 4BZ4A 2B46X 3PMSA 3UJOA 1MEC1 4WBBA 1V6KA 3RQ0A 1QH6A 1OOPC 4HKOA 1FMD2 5HBAA 3B3QE 3IKWA 2ZX1A 3KD4A 2PA7A 4UBHA 2IC1A 4L2NA 5F9TA 4Y22A 1RUH1 1PK6C 4XIOA 2BYVE 4P9YA 4LO8A 5FQ0A 5JSPA 1G9AA 4RR3B 5I93A 4YZ2A 2TBVA 5FO7B 2A3XA 4LLOA 3AMHA 3MZHA 4JRAA 4TSVA 1SQ4A 4LR4A 1NYWA 3VHNA 3DN7A 4XFGA 4F8AA 3AZZA 3OBRA 5L7OC 4NHLA 4K7JA 4O9GA 4FOQA 3OYWA 2V5YA 5DZGA 3KB5A 2XJTA 2YV8A 1OHFA 1Z7S3 5HCBA 4DINB 4JQRA 3AFKA 2GMPA 4JGYA 5JIUA 4GWMA 1X36A 5EYXA 3X29B 4EROA 4LO7A 3RPQA 3ZMOA 3VBSC 2GNDA 3B5LB 2NN8A 2P3KA 4MXWA 2MNGA 3VBFA 1RVF3 1AR71 2QDNA 3WZ1A 3O14A 4MZUA 1AL21 2CNAA 4INDA 4CEYB 2BTVC 3VBOA 4XF4A 4NO4A 1CPNA 2ZGNA 1N3QA 4HL0A 4EJRA 1GYKA 2VNOA 4JC1A 2ZA9A 4GH4C 5EFUA 3V56A 4QQLA 5CIRA 4Q8KA 1TQ5A 5EXOA 1UW8A 2WLPA 3WP3A 4CDQA 3H3ZA 4WVZA 4QQHA 5JDBA 3AMQA 4UXAA 4UW3A 1S0FA 2IXCA 4B8EA 1UPSA 4COUA 4I0BA 3KZ4C 1V00A 3AP9A 4OUSA 2ZABA 2WZR2 3AZWA 4GQ7A 1Q5OA 4ASLA 3H7YA 4LBQB 3MLLA 4LBMA 3FLTA 4L99A 1FOD2 1COV1 3TAYA 4NHKA 3ZSMA 1V6NA 4AGRA 2SBAA 5GALA 4RR3C 3PLQA 4CDXC 1QJZA 1PO21 1L3JA 2VPVA 5K0UC 3AXDA 1EAH3 4XTPA 2WA4A 1NA1C 3H3UA 3MIFA 5C4WC 2D43A 1DU3D 2P34A 5F6KA 1W39A 1WW5A 4QGMA 1ZZ8A 1VRH3 3VHRA 3V0BA 1X82A 5CFDC 4RHV3 2DUPA 2PAKA 2Y0OA 1AF9A 1JHNA 1XE8A 1PGL2 4D3WA 1UKRA 1H2MA 1ENQA 1N1TA 1LCLA 4HFSA 4GMP0 3AB0A 2IFWA 2WLQA 3THTA 1R1ZA 1W0PA 1BBT2 5IK4A 1ZZCA 3H0OA 5CBLA 2QVSB 4H55A 3LA2A 2VMGA 2HWC3 1AR93 2QDRA 3R05A 3VN4A 4IEPA 1GV9A 4YZ1A 1TEIA 1S1AA 1RUC2 1G9FA 1QJU2 3ZFGA 5C8WA 5E16A 2JX9A 1PIV1 1M4WA 2PHDA 3U4XA 2GC1A 3CU7A 4NPRA 4CP0A 1RMU2 4Y22B 4IV1B 1MQTA 4B7EA 4QGNA 5FQ0B 1E57A 1YLLA 3LGRA 3PVEA 4QX5A 3SXWA 2WFF2 3THPA 3S7IA 1ASJ3 3MGUA 2BUKA 1D4VB 4KQ7A 1XNKA 1PNGA 1T6GC 4CP1A 4EV0A 3AKQA 2XVLA 3CEWA 4Q4Y3 4AEDC 2PHTA 1AYN2 2E9QA 1YIFA 4GALA 3WHTA 3DL3A 3GALA 3JQXA 1Q3EA 3NV2A 1SFYA 1LHUA 3CJIC 3PTYA 1WCDJ 2WNVB 4LUMA 1MR5A 2WWSA 3BU7A 4WZFA 4YARA 4BIOA 3MIDA 1N47A 3V0AA 2BVVA 1RC6A 1Y3TA 1OSGA 1EV11 4XQDA 2R0FA 3OD4A 3FUQA 4W6WA 2WS93 1J1LA 3WDUA 4MXWB 4PDWC 4Y26A 4AG4A 3T1MA 1F2NA 2XVGA 2XBO3 3N36A 4P9JA 3CL1A 3I2DA 2B7YA 3NAPC 3OJBA 2HWF1 1G86A 3NV4A 2FMDA 2E7QA 2A6WA 2JG9C 1NCRC 3LOBA 5J3UA 4DS0A 1S2BA 1Q43A 2B5HA 4SLIA 4LHKA 3AK0A 5T5PA 1SLTA 5KHKA 2B45X 1NLRA 4ONUA 5T5LA 4LO4B 2GALA 5AFEA 4A7ZA 3KLSA 1B35A 1LHNA 1PVXA 1GZWA 1WW6A 2O0OA 2YXSA 4MGZE 4Z1VA 2ZAAA 1KS5A 3AX4A 5F5QA 5C6CA 1SLCA 5A33A 1Z7S2 1O4TA 3ILRA 5LK7B 4WV8A 4XIKA 1TME3 4HT1T 5K8SA 5C9AA 4YW5A 3C2UA 2ET1A 1CPMA 1RUE1 4UW6A 4ATFA 3KT4A 3WW4A 5H9RA 4AQ6A 4B7KA 1LECA 3W58A 1V6JA 2RMU3 2XUMA 4IEZA 4QPIB 3N7JA 1GSLA 1RVF2 2YYOA 1UIKA 3PNAA 3H7JA 4F7ZA 3BODA 2MEV3 2W68A 1VP6A 4M00A 1OFNA 2X5IC 3DF0A 1TMF1 2DTWA 1DIWA 4ITCA 1LU1A 2EVXA 4XFCA 1F5JA 3WCSA 5L19A 2ZGUA 3PVBB 1DLLA 4JGYC 3ZVXA 4F83A 3WQ1A 4XMAA 3MIBA 4CEWA 3GZTB 1H0BA 4Z8BA 4M0NA 1O3SA 1SLIA 1ZBA3 5LK5A 3ZFGB 1LGNA 2DVBA 1R093 2A7AA 1XU1A 4I09A 4AYUA 3TBDA 3AP5A 3VBFC 3ZX7A 2VXRA 2BQPA 2LM3A 4WZCA 5DXDA 1U5IA 5H9SA 2GH8A 1QY4A 3VBOC 5FO8B 1HXS3 1BEV1 1DG6A 3WHUA 3IDCB 3WUDA 3MLKA 3QLQA 5JSRA 5I8TA 4NOTA 2PLV3 3ZXGA 4LE3A 1RITA 5C8CB 1VBD1 3S30A 4CDQC 5LRRA 1DZRA 3OGGA 2ERFA 2GNMA 5A3MA 2Z2SB 1VRH2 2QZ2A 4Q4W3 1DGRA 5SV5A 3HT2A 4NWWA 5KWRA 1H8VA 2DFBA 4COVA 3JBG3 1RUJ3 2XWBB 3RWNA 4RQPA 5T5JA 1CESA 2EAKA 3DV8A 3MLJA 1FNYA 3V0AB 3RYRA 3GHMA 4AI2A 5CG9A 3BPZA 4MGIE 3GF6A 5FOBB 4ISRA 2CGNA 1AR92 1H30A 1WLDA 2HWC2 5JPNB 4OHZA 1VBC1 4YM1A 1MZEA 1SLLA 3AKPA 2NPIA 1LOAA 3AMNA 2PQQA 1FX5A 1DDLA 4AFMA 1I1EA 4DRRA 2VMHA 1AYM1 5AC93 3VGIA 2JDZA 1M06G 4PLNA 1AXZA 2NQYA 1F5FA 1YI9A 2I2SA 2ZKLA 1QXJA 1LJ7A 3VZLA 1ASJ2 1GQGA 3J8F1 1RINA 3WW1A 2P3IA 1C8M1 2VMIA 2ZHMA 1C8NA 1SEFA 1D4M1 4Q4Y2 1CJPA 1CN1A 3VZJA 2CWSA 2VH9A 4Q4V1 1MEC3 4Q4X1 2EXHA 1PK6A 4K6BA 4KU8A 3B9IA 5A33B 4JCKA 4N43C 4HKWA 1WUVA 4FPJA 1VBB3 2V09A 1MQTC 4C0HA 4IV3B 5C9AB 1QQP3 2ZPXA 3BCWA 1RUH3 2XGXA 1LRHA 3FJSA 2D6KA 5FLJA 3KT1A 4XJUA 5SV8A 1DYPA 1AVBA 2ATFA 1OLQA 1OFSA 2GC3A 2GC2A 1S0IA 3VBHA 4TZDA 2XBO2 1IPKA 1NE4A 1CGPA 4B4PA 1ND3B 4LHNA 4EN6B 1QDCA 4Q0UA 2ZGKA 3AM2A 5JOWA 1JUIA 4DNYA 4YZ3A 4BPZA 2IZWA 3MF6A 3TN91 4B3NA 3O12A 2HWE1 1WLCA