3O16A

Crystal structure of bacillus subtilis thiamin phosphate synthase k159a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
219
structure length
208
Chain Sequence
TRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiamine-phosphate pyrophosphorylase
publication title Crystal Structure and Kinetic Characterization of Bacillus subtilis Thiamin Phosphate Synthase with a Carboxylated Thiazole Phosphate
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 75
structure length 208
sequence length 219
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3o16A00
1BKSA 2CZ5A 1LOLA 1ME8A 4HPJA 4O57A 4E2BA 3DI0A 3CM4A 3G1XA 3ZFHA 3MYPA 5G5IA 3NQCA 4JYEA 2QKFA 1MO0A 3EWXA 1L2UA 4DO6A 4R53A 3GZ3A 1H7NA 3G0SA 4K8EA 3G8RA 4FNSA 4HNNA 2QJGA 3S5ZA 4PEKA 2QCGA 4ADUA 4BFAA 3BW4A 5HWNA 2W0UA 4S1FA 1YLVA 1H7RA 4UMCA 2E09A 1JCYA 2G97A 1GVRA 2DJLA 4IX2A 1OX5A 4PTNA 2NUWA 1A53A 3MHUA 4YXGA 3PAJA 4GC4A 3QJAA 2ZRVA 3EWYA 3RMJA 3A23A 5DY3A 1OYCA 2VOMA 4Q4KA 3G3MA 5LHFA 4O54A 2X16A 1FQ0A 5L9FA 3GB6A 1HTIA 3KVMA 4AH7A 3N73A 1VRDA 3L5MA 3HG4A 4OU1A 3U6WA 4XKYA 3OIXA 4LVDA 2TRSA 1VQTA 4IMDA 1DHPA 3KOFA 1VC4A 3BVJA 4O18A 1JUKA 4RX0A 4LRTA 4P2VA 3QZEA 1RQEA 4NJHA 2R8WA 2ZQ0A 3TH6A 1Q3NA 4O12A 3WJSA 1ZAHA 2PRMA 3PB0A 1Q6OA 1SSGA 4FXRA 4YMZA 1S3HA 1SW0A 1IXNA 1OHLA 3W7KA 4HIBA 3NM3A 3C61A 3LXCA 3ATZA 1GWJA 4FNTA 8TIMA 3SGUA 4IXXA 1O5KA 1QOPA 2EF9A 4PODA 1LBLA 1A5BA 3KHJA 4CQAA 1XC4A 3W74A 3MO7A 4HKPA 1GVFA 1ZAJA 2B7OA 3F4WA 4Y96A 1ME9A 5FEZA 3B05A 1AW2A 5H2ZA 1ICQA 2A21A 1X7FA 5DY2A 2A7RA 1LRTA 4NJJA 4XUGA 1ICSA 3NNTA 3ABSA 4CLMA 1XXXA 3BV4A 4A3UA 2XFWA 3JR2A 4Z1AA 2DZXA 5D37A 5AC7A 3P74A 3CC1A 1PV8A 4QSHA 4XBKA 1SZFA 4AHPA 4RV8A 1PCKA 3W2KA 2V2DA 3S5NA 5CKSA 4JTUA 2CLHA 2X30A 4UTKA 1QO2A 4IX0A 3W7LA 4NVTA 2JKEA 2YYUA 1ZJIA 2ZDRA 3USBA 3K30A 3CB8A 2QUTA 2OMAA 4AB4A 3G1VA 2VEKA 1BEUA 3HG5A 4BK9A 3O07A 4K37A 2R94A 3ZWSA 2R91A 3EWBX 3P61A 5I3IA 5F1VA 1KBJA 2TPSA 3DHFA 3FLUA 4IMFA 4JTLA 3M1ZA 4DBDA 1D9EA 1H7WA 3P8IA 3SY5A 3LRLA 1W5MA 4JTKA 3N2MA 1TTJA 2GOUA 2XN1A 4CNPA 5KITA 1F7BA 4FHAA 3NO5A 3W2JA 1W54A 1IF2A 1VLWA 2QCLA 4JN6A 2P0OA 5FEWA 4MYXA 4OWGA 3EX1A 1KM5A 1GVOA 3L2IA 1FY6A 1ME7A 4UR7A 1K8XA 4UMAA 2QCDB 1QO5A 2PRLA 1M7OA 1JQVA 3W75A 2V5LA 4XQ6A 1G4EA 3G1AA 5G1TA 5D2TA 5E93A 2DORA 4CNNA 4DF0A 3QQ0A 2I9EA 3GR7A 3TW7A 3OA3A 1X1ZA 3GKAA 1OFBA 2GVJA 1SW3A 1OX6A 1Q6RA 1L6WA 1UBSA 3NOEA 4FX7A 1F74A 1S5VA 4NNBA 1WDWA 3CT7A 4W9TA 4LNYA 2YW4A 3TKFA 5D2XA 4GUIA 1TQJA 3FA5A 2HS6A 3IEBA 4HNTA 3TC7A 1TPVA 5E1QA 1W1ZA 3R13A 4UTTA 3PVFA 1V5XA 1I4NA 1LM1A 3B04A 4TU1A 3O06A 1TTPA 5CSRA 3U2OA 1I2RA 3UZ5A 2RFGA 1LRQA 3I6RA 1GZGA 3TAOA 5D02A 5D33A 1QPOA 3A5VA 1F73A 3TNOA 2J9XA 5D04C 5G4WA 1SR9A 4TIMA 1VH7A 2RKXA 3LI0A 4OBTA 4MFEA 4Q33A 2Y61A 3BGGA 3R5EA 3GKFA 2QDGA 3P82A 3SIZA 4N6FA 5D05A 3W85A 2FIQA 2W6RA 3UWUA 2OT0A 3GDTA 5ABTA 5AC8A 4O11A 3HQ1A 5E0KA 4JTFA 3L0KA 3G1FA 3EWWA 1H1YA 1VGAA 1FWSA 4NUWA 1DV7A 5LKYA 3GVGA 3NQDA 1RQHA 1X1OA 4RZ5A 2C16A 2DJXA 2Y62A 1FCBA 4EWND 3C3NA 4RKAA 5K9CA 1MXSA 3CTLA 3CPRA 3DKJA 3E9AA 1YDVA 3SI9A 4Z1BA 3UPBA 3WK1A 2QJIA 3LBMA 3P84A 4O13A 1KA9F 2A7PA 1P1XA 3QC3A 3LCIA 6TIMA 1KFKA 1K3UA 3W71A 2X2GA 1GPWA 4JY8A 4DO5A 3PC0A 1ADOA 3LHWA 3PR2A 3Q2DA 1Q6QA 3MWAA 5C2XA 4LVFA 1G4SA 1TV5A 2RDWA 1JCNA 3G24A 2LLEA 2VFIA 1IGSA 3B8DA 3BLFA 3MHGA 4DPPA 3TFXA 1B3OA 2QCEA 1W5QA 4BWLC 3RF9A 5FF3A 2FDSA 5FESA 1VS1A 2VFHA 5I3GA 4LWWA 1PL9A 2VFGA 4O19A 1LZOA 3W23A 2O7QA 3P5ZA 3N14A 5DBUA 4N9DA 1LROA 4JTTA 4O28A 1H7XA 3NQ8A 1LDCA 4Z1CA 3P62A 4GUJA 2Q8ZA 4Z08A 2ISSA 1JUEA 1PIIA 2NWRA 3B03A 3TW6A 3QYQA 1O4UA 5DCEA 3PB2A 4NXKA 2VEMA 3MMTA 4X2RA 4O1AA 5CZJA 1TV7A 2Y63A 2ZRXA 3RFAA 1I2NA 4AF0B 2CLKA 1G67A 2ZFAA 5G1YA 3LI1A 5CPOA 3UYCA 1T8XA 3M9YA 3O6CA 5F2IA 1QPNA 1NSJA 1WAUA 5K4XA 4WZHA 4AXKA 1IIHA 1HUVA 1ZFJA 2E6AA 1QAPA 1XBVA 2VXNA 1WYIA 4JR5A 4O10A 4JY9A 2J6XA 2A1YA 1SFLA 4DPQA 4IPJA 3CWOX 1HL2A 3RLUA 2O7SA 4GFSA 1GYLA 2QCDA 4MY8A 2A85A 1VYRA 1KFCA 1THFD 3NQ2A 2YDAA 5DXYA 5HWJA 5I3KA 1R46A 2Z0IA 1K03A 1GT8A 4MJMA 2B7PA 1SU5A 4LUIA 2JBMA 4GUFA 1EB3A 2FB3A 3SR7A 4M5PA 2Z6JA 2WOQA 2V0TA 3S9YA 3N3MA 4AWUA 3L67A 1I45A 5LNSA 4NJKA 4NZJA 4E38A 5H91A 3GNDA 4YCPA 1F05A 3C6CA 3M44A 1J2WA 1OVDA 1JJKA 1KFBA 1GG1A 4JYFA 1KM1A 4ORMA 2X1RA 1JCXA 4NJGA 3NL2A 5AYXA 3IIZA 4JD4A 1XDMA 3GXTA 1FWNA 3MHFA 3Q94A 5KMYA 1F76A 5BRBA 5DELA 3W73A 3P81A 2ABAA 3LHVA 3IGSA 4FX6M 2A6NA 1TIMA 4AWTA 4EF9A 1LORA 3CLMA 4NXSA 3C56A 3LHUA 3R12A 1YTEA 4EIVA 5CPMA 6ALDA 1SO6A 5G2IA 3DFTA 5KZEA 2AAMA 5FF7A 2G5WA 1W31A 3W1PA 4MUZA 2JKPA 4WOQA 3W7EA 4NT0A 4TO8A 4I7VA 4ICNA 3VE7A 3ABQA 2E6FA 4TMBA 3W72A 3G0XA 3CIWA 3NG3A 2JGQA 4DBEA 1G6CA 2DU2A 1OYBA 2CZEA 4JDBA 1R2SA 3BARA 1O95A 1Z48A 4N4PA 4QNWA 1G7VA 4FNPA 3GK0A 3NPXA 5HR7A 3GYEA 5D03A 5MHBA 3I7SA 4FF7A 1PE1A 1WOAA 1I8JA 3NVTA 2E6DA 2NXGA 2HSAA 4WY0F 3LM7A 3S1WA 4PA8A 4ZQCA 1WBHA 3F4NA 4LUJA 5AHFA 3W2MA 5EMUA 2TSYA 5A8GA 4QAIA 1LLWA 3NQGA 2A7NA 2ZYFA 5D32A 5DCBA 5HR6A 2NX1A 3TJXA 2ZBTA 1LYXA 3PF3A 4A29A 4LV4A 1VJIA 3S1VA 1A5SA 2QCHA 2B7QA 3OVRA 4RZ4A 1TREA 4WOZA 4NX5A 1NEYA 4UFIA 1XM3A 3QFEA 2VEIA 1SSDA 3W1AA 4LS2A 2NWSA 4O1BA 1YADA 1EX5A 1KM3A 1TRIA 3W7JA 4OV9A 4HN4A 3KFTA 3W6YA 4K8HA 3W2LA 4JICA 3BGJA 4WQ6A 3L9CA 1LLZA 3VNDA 4ZZ9A 3DAQA 3ABRA 2P1FA 3W07A 3HO8A 4O1DA 2Y88A 2DZSA 4FO4A 3W7DA 2GJLA 3STGA 3OHIA 4PFMA 4UR8A 3WJZA 3TCEA 2IQTA 1DQWA 4HT3A 2V30A 3DFOA 1H5YA 3DU0A 3MJYA 1OG0A 1JCMP 3P8JA 1VLIA 3W1NA 2ZTKA 1RD5A 4NU7A 3O1NA 4FIQA 4AF0A 4H6KA 1EP2A 2WSQA 3NM1A 4K6AA 2QAFA 3NR0A 1D3GA 2CLEA 4CNOA 3KVLA 2YW3A 1NAL1 1VCFA 3JRKA 5CGQA 1SZEA 5FEXA 1HG3A 2EGZA 3W87A 5FF0A 2FPVA 3LV5A 3S5OA 3C8FA 1OFOA 1FBAA 2NUXA 1TMHA 3LB0A 1O94A 5F4XA 4O17A 3SECA 2YZRA 4JYDA 3B4UA 1XL9A 5C55A 1EIXA 4G1KA 3W2NA 5BNKA 3NYZA 1EEPA 1Z44A 3HG2A 3P60A 3GX9A 5D2YA 4O4WA 4WXZA 1KLZA 3HGJA 1QPQA 1LBMA 1R47A 3N34A 1K7EA 1JUBA 1TRDA 1W5NA 3EXRA 3GNNA 1P0NA 2GQAA 3NZ1A 2H90A 3W86A 4S2CA 3TMLA 4CQ9A 3OVPA 3D0CA 4C1LA 3FOKA 2KZHA 1C29A 1OK6A 3HPSA 2C18A 3NQ7A 4Q32A 3S6DA 3LCLA 3S1UA 1T96A 3R2GA 1AW5A 1AG1O 3DI1A 2C3ZA 1VHCA 1RPXA 4LY8A 3HIJA 4PH6A 5GVJA 1LP6A 1DL3A 3UD6A 4FNQA 4DQWA 5LNRA 2H8ZA 1VPXA 2FPYA 3Q37A 3DFPA 5TBOA 2EPHA 4UTLA 4N02A 1MEHA 2QDHA 4JX6A 4QNEA 2HTMA 4JTSA 3UWQA 4A21A 1FCVA 3FFSA 1YPIA 1OFRA 1OX4A 5C54A 3A9IA 5LHEA 3L68A 2TMDA 4LTSA 3BK0A 3IGUA 3M5YA 3YPIA 3DXIA 3T7VA 1QNVA 3ABOA 4OV4A 1J4EA 3EX6A 3LGEA 3R89A 1FCQA 3NDOA 3HB9A 1G69A 4XZ9A 1SO3A 1WV2A 3BLIA 4PCFA 3PUEA 4FNRA 3W7IA 3LOTA 3QMSA 1B9BA 4MFDA 3TAKA 2J27A 3KVKA 5SWUA 4M19A 5F1UA 5IM51 1U83A 5TIMA 2A6LA 3MI6A 2Y7FA 3TXVA 3THAA 1KTCA 5BOOA 1OFDA 3SFKA 3L21A 2NUYA 5I3FA 1TJPA 3F1QA 2DZVA 2ZCGA 4AAJA 4Z0JA 3CIXA 3W22A 1DVJA 2WQPA 1EWEA 1JCLA 1UB3A 5FF2A 2ZZ4A 3QM3A 4O50A 5CSSA 4MZ8A 1H61A 1I2QA 4K7YA 1M5WA 4N4QA 3R8RA 1MEWA 4M7TA 4LVAA 3Q58A 1YDNA 3EKLA 3T40A 2ZRWA 4D2JA 3V75A 5FI8A 3O6DA 3NQAA 3KX6A 5KZDA 4JTEA 1KM0A 3TA6A 3LTYA 3T55A 4NQ1A 3ATYA 3HPXA 3TE9A 3C2EA 2ZZ5A 3ELFA 1UASA 2H8XA 1N8FA 3L0GA 4MJZA 3PM6A 2E5DA 5U7SA 4DO4A 4KKXA 1FX6A 4JIQA 1WBJA 1LBFA 3MP4A 3ZWTA 7TIMA 5K7JA 2YPIA 4IPIA 4XTDA 1K02A 3CHVA 2WNZA 3W84A 5G2HA 2OX1A 3QMTA 3M5ZA 1SPQA 3DBPA 3HGRA 4IMCA 4P61A 2GVLA 1EWDA 4FB7A 4H4IA 2YX0A 4LS0A 2ZZ1A 4I7UA 1TO3A 4UCGA 3PUOA 3IIVA 4MLJA 3W7RA 2A4AA 1B4KA 3CQ0A 2HS8A 2ZZ7A 4UTUA 3GXPA 4MZ1A 2C0AA 1WA3A 3SSJA 2X1SA 3M6YA 3C2RA 1AW1A 3W3OA 4K38A 4HPXA 4MPQA 3DFSA 4N9BA 3THQA 3PG9A 1PVNA 3ZS4A 1C9DA 1EPXA 1TPFA 3NL3A 3LHYA 3IIXA 4JS3A 4BR1A 1CX9A 3HOJA 1KV8A 3O05A 1AL7A 3G0UA 4O16A 3WJYA 1VCVA 3G1HA 2FFCA 2VEPA 3BW3A 3W7CA 3O15A 4RXFA 2PE4A 3UXDA 1IXQA 1DQXA 2ZRUA 5F4WA 1LOQA 5KTLA 1DJNA 3N19B 1NF0A 2ISWA 2VELA 1QFEA 4MYAA 3KRSA 2DZPA 1S5WA 3UZJA 4UFHA 3HJZA 3UWVA 4LW7A 2QCCA 1RV8A 2VC6A 3PULA 5CZTA 3SW6A 3IVUA 2BWGA 3RK8A 1IXPA 3W88A 2OZ0A 4K39A 3GDKA 3MW7A 5AOUA 2XN2A 1Z41A 4GRSA 3M0ZA 4UTWC 3S42A 2YCEA 1UUMA 3GAKA 5AC6A 1JQXA 3MBDA 3LERA 3IGXA 3W76A 4LS1A 2RDTA 2QF7A 4BWLA 4I7WA 1MZHA 3UY7A 5DN1A 1CW2A 1C8VA 3GIYA 2X1TA 5J5DA 1XUZA 3LDVA 5HUPA 2H3BA 1YYAA 1FWWA 2Y6ZA 4DF2A 2G96A 4B5NA 2ISVA 1ALDA 3TMQA 3TX9A 2WO5A 2CZFA 3OBKA 3G22A 1R2RA 4X3ZA 1EUNA 4M6QA 1KM6A 3TR2A 5AYZA 1SUXA 5IBXC 4GXMA 2ZA1A 2CLOA 3TQVA 2TYSA 4WJEA 3RNDA 1XUUA 1PS9A 2CZDA 2ZRZA 3FJ6A 4GE8A 3STFA 4I9AA 3WFAA 3OG3A 2CWNA 1KTNA 3G3DA 3TV8A 4HSNA 3M43A 5AB3A 5DBTA 4UTIA 4ML9A 1YDOA 3QW4B 5AFDA 3GDMA 1OFPA 2C19A 3A22A 4ZQMA 5I3JA 1T99A 3TSMA 1YXDA 4RCXA 3NPUA 1RZMA 3NPVA 2YXGA 2FLIA 1W37A 3H55A 1P5BA 4DF1A 3LLDA 2VKZG 5EBUA 2C6QA 2PCQA 3P7YA 1BWKA 1W3TA 1P0KA 1SFJA 2WSRA 3O8AA 5FEPA 4QQ3A 3W7PA 5HUOA 3IIPA 3OEXA 3JS3A 3LX9A 4MLRA 1PHWA 3BW2A 1EP3A 1VYSX 4GUHA 1H7OA 5FF4A 4UNKA 5LGXA 1ZAIA 3DHDA 2B7NA 3DFQA 1KW1A 4RZ6A 4HNUA 2GPTA 5CZSA 3W7HA 3LHTA 3FYOA 1K8ZA 3EXSA 5D2VA 4KWWA 3W7OA 3IV3A 3S8HA 1P4CA 4RR4A 3QPYA 4Y8FA 1O60A 4DXVA 5CZ0A 3DFNA 1LCOA 2YFOA 4GNJA 3FEMA 1XBZA 3ANYA 2NLIA 4O14A 1XBYA 2VFEA 3M16A 1TQXA 2ALDA 4QISA 4ZQNA 3P67A 3LCXA 1JULA 3C2FA 3NEVA 2V82A 1YXYA 4NNCA 2CLIA 1OX4B 5CG7A 4ALDA 1FDZA 5D30A 3WJXA 1KM2A 1R2TA 3TQKA 5F4SA 1B57A 4ZQRA 4U28A 2GJNA 1ONRA 2ZA3A 3MBFA 5D38A 4FEZA 1QCWA 3S0CA 3STEA 3GLCA 5HINA 2QUVA 3VE9A 4UFMA 1O5XA 3BG9A 4GWEA 1KFLA 3L0NA 2YSWA 4PC8A 1GJPA 4UNLA 3W1RA 3C2OA 4ZMGA 1F2JA 2ZA2A 1T0OA 1TJRA 4UTHA 4OGZA 1L9WA 1DORA 4Y9AA 4AVFA 5EPDA 3M5VA 1TB3A 3EWZA 2J9YA 2V8ZA 3L65A 1A5AA 2AGKA 1NVMA 1F5ZA 1QOQA 3NL6A 3NQMA 4JX5A 3QQ1A 2NV2A 3VFLA 2PC4A 3DENA 1DJQA 4RXGA 1CI1A 3KRZA 3BO9A 3E49A 3MUXA 4YCOA 2C15A 3CEPA 2I1OA 5D2WA 4OHQA 1KLYA 3NAVA 1YTKA 1FDYA 3L5AA 2EAWA 1FDJA 5AHEA 1IIGA 4HSOA 1TPDA 3LCWA 4KFNA 4IMEA 3NZRA 3IVTA 3DGRA 2E68A 2X1UA 1LTDA 2QEZA 5EY5A 1W0MA 4ZVJA 2E6YA 3LBCA 4MOZA 3G8EA 1XCFA 1OYAA 3UXAA 1GYNA 4JDYA 1EA0A 3HMJG 3TK7A 1TV8A 1J5TA 3M5XA 4AEOA 4WY0A 1H51A 5LGZA 4QJ1A 2GVGA 1QMLA 4OE7A 4BI7A 1UJPA 4LVGA 1X6UA 2DZUA 3W1MA 4IQLA 1DOSA 2A0NA 4BF9A 4IXHA 4R7JA 3FIGA 1OF6A 4YLWA 3AO0A 2DZWA 1VHNA 2J88A 1H1ZA 2V2CA 1Y0EA 5F2LA 4Z0SA 3FKKA 3LLFA 2I14A 2NZLA 4POCA 2J24A 5K2ZA 1SO5A 3TC6A 1TPWA 3W9ZA 3BLEA 2ZTJA 3IVSA 1YTDA 5A5WA 5C5YA 1JRCA 2V2HA 4N6EA 3I68A 1W3IA 3A21A 4R34A 3I7QA 1R30A 3N2XA 1TCDA 3LXBA 1OFQA 4BI6A 5K3VA 3TQ0A 4EVZA 4A22A 5AHIA 3W1XA 3QRHA 5EL1A 3MP3A 1ICPA 2FQIA 4O8RA 2R14A 2AQWA 4AWSA 2RHGA 3PY2A 4RJEA 5G4EA 1ZY9A 2NX3A 1MEIA 4IUOA 1I2OA 3UPWA 3QEZA 3KRUA 2FJKA 1HO1A 1OABA 2YR1A 1G4PA 4QIUA 4FIRA 4UUIA 2ZRYA 3B06A 3PBVA 4JTJA 2CLMA 4WX2A 5D09A 4UMBA 4DEFA 2BTMA 5HJLA 1W5OA 5EA9A 2OJPA 4LC6A 4XWUA 3TJLA 1HO4A 3W7MA 5DXXA 2NX9A 1SQ7A 3W70A 1EUAA 2WNQA 1TTIA 1XFBA 4LC8A 1GTEA 1VR6A 3N9SA 3G18A 1F6KA 4LOCA 1WX0A 4IOTA 2B4GA 5LNUA 1GG0A 2CW6A 2DZTA 4PL1A 4IGHA 4JIPA 3MI3A 4FX8A 1KTBA 1JR1A 4XTIA 3GR8A 3LTSA 5U4NA 1TPEA 2VFDA 2WSYA 1FWTA 3L5LA 3QW3A 4O15A 4TR9A 1ZCOA 3E0IA 2BX7A 2CLFA 4L4MA 1ZHAA 1L6SA 2BXVA 3HPZA 5LNVA 3F03K 3NQFA 3I65A 4JGDA 4M7SA 4U4MA 2GQ8A 2F7FA 2QCFA 4ZQOA 3HBLA 3LTPA 3QPZA 3C2VA 1RR2A 3FYPA 1EP1A 3TSBA 1XBXA 1QR7A 1LOSA 1GTHA 3UNDA 1H7PA 4N9EA 2Y7EA 5K9DA 4UTTC 1PHQA 3QH2A 3EB2A 4JX4A 4LVBA 1GVQA 2CLLA 2ATSA 4HNVA 3LRMA 5J5RA 5AHNA 4NJIA 3DH7A 1ZENA 2QCNA 3WK0A 3STCA 1H50A 1U5JA 3L66A 2V81A 4XBSA 2HMCA 5LZLA 3I7RA 2D73A 4UTMA 1BTMA 1Q6LA 4H3DA 4IMGA 1ZNNA 3SGZA 4MKNA 3S1XA 3C52A 4WD0A 3T44A 2WPBA 1HFBA 3KXQA 4QM1A 4X9SA 3W1LA 2JKAA 4YWIA 1G4TA 3PBUA 4O4VA 3TU9A 1A5CA 5BMXA 4UFJA 4C1KA 4GUGA 2CFFA 4R33A 3UY8A 5EKYA 2YFNA 3NQEA 1ML1A 2WNNA 3NA8A 3DKLA 3NQVA 4MY9A 4NX0A 4UFKA 5HULA 3IRDA 3G1YA 3LRKA 3TFCA 2YGYA 3A24A 5LNWA 1KFJA 5L6UA 3MI2A 1ZALA 3W7GA 3B0VC 2OT1A 4NZFA 2VFFA 3G1DA 3QMRA 4EOUA 3PUDA 3LCGA 1WXJA 4O0KA 2GQ9A 5LSMA 4L4LA 2BZNA 3PG8A 1N55A 3ZR4A 3O16A 4ADTA 5HMSA 2VENA 4LT9A 2A2IA 3DZ1A 2Q8LA 2DP3A 2QAPA 1RVGA 3TIMA 5DLCA 3H54A 2Z2UA 4AHOA 4KFOA 1XDLA 4UIOA 5C6MA 1N7KA 3QSRA 4GJ1A 4K36A 4ONVA 5KSWA 4BI5A 1UUOA 3NQ6A 1KFEA 3E02A 2WKJA 1OFAA 2ABBA 3P80A 2A5HA 2F84A 2C1HA 1GEQA 4M6PA 4FNUA 2QUUA 2Z6IA 3CU2A 3MYOA 3LCHA 1XKYA 2WJZA 3G1SA 1AMKA 4WXYA 2XN0A 3PWAA 3UWZA 1GOXA 1YPFA 4QITA 4TX9A 1OF8A 1WQ5A 1VYPX 1BWLA 4K7VA 1GQNA 2RDUA 2Y89A 1M7PA 2FPTA 3EEGA 3GDLA 1VZWA 3TSDA 4Z1DA 1W56A 3MP5A 3TROA 1X8FA 3EWUA 3PBYA 3TUUA 4JTGA 3RU6A 4UC5A 1K7XA 4RLIA 2E77A 5K9XA 1M6JA 2Y7GA 2FB2A 1Q45A 1B4EA 1TPH1 3OVQA 2QCMA 3INPA 4JNMA 2GUUA 5AYYA 4N9CA 4LRSA 4EF8A 2OCZA 2H3DA 2B0MA 5AHLA 1FCUA 1I2PA 3V1PA 3LHZA 1W8SA 4LU0A 4WY0B 4OQVA 3IIOA 2ATMA 4UFLA 4O0ZA 2Y7DA 4WUIA 1OJXA 2YYTA 3P5YA 3AJXA 4UTWA 1NFBA 3M7WA 4PL2A 3VI2A 3CEUA 2NV1A 2V9DA 4E0CA 3C4UA 1OK4A 4MIMA 1W3NA 4ADSA 3EX2A 5KINA 1QWGA 3NPWA 3GDRA 2ZZ6A 2P10A 1JRBA 3HG3A 4CCCA 5BW6A 4IJBA 2BLEA 3W1TA 3LV6A 3VKJA 3QSTA 3W7QA 3BG5A 4XKYB 4JTIA 1SZGA 4IWWA 4MZYA 1OFEA 5IBXA 5HNRA 1NF7A 1JVNA 3E12A 5CPNA 4CCEA 1JCJA 1V7YA 4A2RA 1TPC1 1FUYA 3M47A 1DBTA 3EX3A 1F6PA 2G95A 4X22A 1XI3A 4GBUA 4ZQPA 1FXPA 1KM4A 1MSSA 1AK5A 2BSLA 4M6VA 1H63A 1D3HA 3W1UA 4MVAA 3NXFA 3CWNA 4O53A 3N9RA 1Z42A 5AN7A 2Q3RA 3FJLA 5CPLA 3W83A 5I3HA 3TXZA 2E1DA 3HGSA 4E2DA 2V5BA 4DELA 2W79A 4Y6GA 4YL2A 4MY1A 3PSVA 4O1CA 3UWWA 3B0PA 2Q3OA 2Y70A 1S5TA 1QPRA 3QF0A 3O63A 3H53A 5DCDA 2NXHA 3EXTA 1H62A 3GXNA 3LXAA 3UQNA 4JEQA 1K8YA 1FXQA 2EHHA 3W7NA 3PS7A 4RK8A 4A2SA 3EX4A 3FS2A 1DKWA 1TSIA 1QDSA 4KFPA 3HGOA 5BMWA 3NGJA 1SZNA 1K7FA 3HF3A 5T26A 1KV5A 3PBWA 1H60A 3EKZA 1WOBA 2E5CA 2EKCA 3VCRA 1TPB1 5G2WA 1VCGA 1PCWA 1AL8A 3TDFA 3SZ8A 1E51A 5EYWA 4UTJA 3W2UA 2C13A 3KVJA 4N2YA 4NNAA 2J9ZA 4JTHA 1YXCA 2Y85A 2JGYA 2RH9A 4FXSA 1UCWA 2C14A 4Y90A 3WK2A 2UV8G 3LCFA 4S2BA 4O52A 1LRNA 4KWVA 2WV8A 2QR6A 1SW7A 4LV9A 1IXOA 4UXDA 3WJWA 3M41A 2H6RA 1KBIA 3RLVA 3T78A 2PURA 3B0UX 3A5FA 2NXIA 1L6YA 4AMAA 3SJ3A 1SO4A 2Z1BA 1TTQA 4AHQA 3GAYA 2QJHA 4ORIA 3WK3A 2CU0A 3E96A 5AHMA 2FTPA 4OT7A 3W1QA 4TMCA 3U8GA 3BPWA 3KAOA 1FWRA 4ZL1A 2E5BA 2PRHA 3O6YX 5K4ZA 1RQBA 1TPUA 5F2MA 4J9JA 3T4CA 1TYGA 4CQ8A 2JK2A 2ZZ2A 5TQLA 3BG3A 3NL5A 5HQEA 4HHPA 3PSWA 5F2GA 3UWYA 1A50A 5KZMA 1GVSA 3FKRA 5HWMA 1G7UA 4CCDA 4JXCA 1W5PA 2ZZ3A 3C0JA 3S5YA
chains in the Genus database with same CATH superfamily
4GY0A 3R58A 1BKSA 1K6AA 1LOLA 4CD8A 3DI0A 3G1XA 4D8ZA 1NELA 3MYPA 3LD5A 1FWDC 1TJ2A 1GVYA 4JYEA 3RX4A 2QKFA 1B0IA 2QDEA 5CPTA 1L2UA 1H7NA 3G0SA 5FACA 5CXPA 3SRFA 1R3RA 1VPYA 3GC2A 3S5ZA 4ATWA 2HZGA 2QCGA 3BW4A 3A64A 3H26A 4F3HA 3WMLA 1O5RA 3VZXA 2E09A 2DJLA 3WNLA 2Q09A 1RP9A 3JVAA 4HYWA 4TVUA 2NUWA 2QIWA 3QJAA 2BGQA 4XZMX 1S2CA 1OYCA 5DY3A 4Q4KA 3LK6A 1S39A 3VUPA 2ZOXA 5L9FA 2EG8A 1OC6A 3RRAA 1CEOA 4NIRA 4AU0A 3SCNA 3GXDA 5BROA 2CIPA 1P6WA 2A3BA 2ODOA 1C8YA 3K4DA 1EGZA 1R9XA 3GU9A 4IMDA 4UNIA 1DHPA 5LIXX 3KOFA 1VC4A 1VFSA 3SRHA 2I56A 3QY7A 3UJRA 4RX0A 4MSSA 4KBXA 4P2VA 4NJHA 2ZQ0A 3TH6A 2CETA 1Q3NA 2H9AA 1ZAHA 3DESA 1UR4A 1EZ2A 1UKPA 1SSGA 1BXBA 2PF0A 3TYUA 3AMKA 4FXRA 3DFYA 1XYAA 1SW0A 1IXNA 1C7TA 2EPKX 4HIBA 2MANA 4C6MA 3SGUA 2YXXA 1CTNA 4C7DA 1GOOA 1LBLA 3EA2A 4DUWA 1Y5WA 2FGBA 1WDSA 4D1JA 4F0SA 2Q01A 2O55A 1TWSA 3NOYA 1C8QA 5BWAA 1AW2A 3T2QA 1X7FA 1SM9A 2XFWA 4Z1AA 1V6VA 4S23A 4OZOA 3R0DA 3CC1A 1PV8A 3W2KA 3S5NA 3N12A 4F40A 1KRMA 4ZBCA 3BLKA 4F2UA 5FJTA 3EDFA 1RCOB 1ZQ5A 3RJYA 3AYRA 3H24A 1I0DA 4F2TA 3NZGA 4MB3A 1CXKA 2ZDRA 3FVMA 2J7HA 3T81A 3IACA 1BEUA 1Q6FA 4AW7A 4IQDA 4E4UA 4M1RA 4BK9A 1PAMA 1PTAA 1TX2A 2R91A 4LPCA 3EMZA 3FLUA 4WSJA 5HNNA 4F0KA 3PTQA 2Z7GA 3AIBA 3LBOA 3S47A 4AYSA 1W5MA 4JTKA 1PYMA 3CAKA 1TTJA 1ZSXA 1F7BA 4FHAA 3NO5A 3W2JA 1EYEA 3PWGA 5M3WA 4XD5A 2VT0A 4ERIA 2HK1A 1OT1A 3EX1A 5E5CA 1GVOA 3L2IA 4UR7A 3F4CA 4B5WA 3IWPA 4UMAA 1M7OA 4JHMA 3VOJA 2OZTA 4ZB2A 3VKCA 5D2TA 4OJYA 5E93A 4CNNA 5FJPA 2PDWA 1UBPC 2I9EA 3AMDA 3VCNA 4GINA 2VGBA 4LGXA 2GVJA 1CYGA 1EH9A 4FX7A 1V3LA 2XU2A 4GUIA 1TQJA 3M0KA 1W6TA 3TC7A 3HN3A 5E1QA 4UTTA 1V5XA 1LM1A 3B04A 2PTXA 3O06A 1H0GA 1VJSA 1Z9AA 2PAJA 3UZ5A 3EOOA 4M80A 1GZGA 5MKGB 1HXJA 3N4FA 4D1IA 2PWFA 1X8CA 2G0WA 4MFEA 1XLFA 3WLPA 1DWAM 2VYOA 3O9NA 4N6FA 3G6MA 4BF7A 3UWUA 4IJCA 3NSMA 4ZXLA 4KT2A 5E0KA 1PZ2A 3MSDA 4HOWA 1GORA 3G1FA 3M0VA 1VGAA 1F07A 3WBXA 1UZ1A 3UJFA 1SGJA 2ZXDA 1BF6A 1ZJHA 3IJLA 2Y62A 3BQ5A 2ZX5A 3CAWA 1WPCA 4KW2A 3C3NA 4OBRA 1VKFA 4DM2A 4RKAA 3CTLA 2AMGA 2HBVA 3CPRA 3DKJA 4HSHA 4Q4QA 3SI9A 4Z1BA 3S3GA 4O13A 1P1XA 3PBMA 3LCIA 4H1ZA 1BGGA 3LMYA 3HTWA 1K3UA 4NAFA 1XR2A 2FH6A 4WDWA 5CJ5A 1XIEA 3MWAA 4LVFA 1G4SA 1TV5A 1EKOA 3KLKA 5B7YA 3G24A 2LLEA 4HNOA 4QCEA 3RCMA 1P0DA 3BLFA 2E40A 1ODZA 2D1ZA 4ROQA 4ZGYA 2PLJA 2OO6A 2HPMA 3WYZA 5FF3A 3C0LA 5BYWA 3LY0A 5DEZA 1KRBC 1VS1A 2VM8A 4YTTA 5E0FA 4QP0A 4J2MA 3WNMA 3BH4A 1LZOA 4IIEA 1YW1A 2F6KA 2O7QA 3DG7A 1ENUA 5DBUA 1XH1A 1LROA 2ZKMX 3NQ8A 3JU2A 3SQLA 3OODA 2XZ7A 3RX2A 1HKWA 1E6XM 1V6YA 1CGYA 4AX7A 1JUEA 1PIIA 1O4UA 1UOKA 2RDXA 4QHRA 1J8VA 1BVNP 3MUZ1 2I9UA 4FMVA 3WKZA 4DZIA 4KF1A 3CMGA 5G1YA 5DX7A 1A49A 4DJDD 1HZYA 1P1MA 3F5JA 1MI3A 1QPNA 1NSJA 2BHUA 5K4XA 4B4FA 2AL1A 1HUVA 3WF4A 2E6AA 1QAPA 2E28A 4M29A 1V3MA 1XBVA 1WYIA 4R9XA 2EJAA 2A1YA 4DPQA 4PB3A 4Q4PA 1RCXB 4MY8A 3ANVA 2G8ZA 5I3KA 2Z0IA 4B3ZA 1SU5A 4V1XA 3R8HA 3VM7A 3UW6A 3SR7A 2FB3A 2Z6JA 2WOQA 3WLIA 4WJ8A 1RY0A 4AWUA 1JYVA 2G41A 2X8RA 4KRZA 3WH6A 1I45A 2D24A 2DIKA 4NJKA 1JJKA 5HJYA 3QZAA 1G5AA 4DJDC 5I23A 1JCXA 3KCOA 3GXTA 3H2MA 1UP3A 1G1YA 1UP0A 2VX6A 3FVDA 1LORA 3E38A 4NXSA 3EOSA 3C56A 4A35A 3E5PA 2HROA 2QMKA 1OADA 4KETA 1SO6A 3ZT7A 2DT2A 2GVEA 2Z1WA 2G5WA 3T9PA 4MUZA 2JKPA 3KZSA 3W7EA 4TO8A 1BQGA 2E6FA 1W91A 1OC5A 3SCRA 2EG6A 3NG3A 4DBEA 4JDBA 1R2SA 1JF6A 4QNWA 4NAEA 1RPKA 4FNPA 3NPXA 1EXPA 1FTXA 5MHBA 3I7SA 1XYCA 3FJNA 1N8WA 3LM7A 1FWGC 2PD9A 1WBHA 3F4NA 1TE1A 3W2MA 1RA0A 3LZ3A 5CLTA 1LLWA 5D32A 5DCBA 2ZUTA 2ZBTA 4I3GA 1VF8A 1VBUA 5CAHA 1GGOA 1XRSA 1A5SA 2QCHA 2B7QA 4PCTA 3RPTA 4UOQA 2VMFA 3BCJA 3HQOA 3AIEA 1NEYA 1XM3A 5ABFA 1X96A 3EB4A 2NWSA 5A6BD 1XQKA 2WVUA 1EX5A 1L6FA 3W7JA 2ZX9A 3LPOA 2Y5JA 3EZ4A 4K8HA 1R3TA 1DWJM 3OG2A 1LLZA 2PGWA 3FXGA 3DAQA 4GJJA 4CN4A 1R9YA 2YZ5A 4FO4A 1UR0A 5DRIA 2ZXQA 3W7DA 3STGA 1EC8A 4PFMA 3WJZA 4GI8A 4LX4A 3UCQA 2TODA 2YDRA 2NQZA 1JCMP 3OZOA 4K1WA 3F4DA 1A3HA 4NU7A 1KBBA 4H6KA 2WSQA 1US3A 3NM1A 1W3HA 3WLNA 1BGAA 1JDDA 3VOIA 3NR0A 2Z7KA 1NAL1 2GYIA 3W6LA 5CGQA 3AS1A 4PCSA 1UJQA 1ONXA 1HG3A 3U4FA 3ZM8A 3OJGA 4NZ1A 4B92A 4ZE5A 1OFOA 3G2GA 5ECUA 4JFVA 3CAQA 6PTDA 5C55A 4FSAA 3W2NA 1EEPA 3GX9A 5KETA 1FP8A 5FSDC 1QPQA 1S2WA 1R47A 5TNVA 5J8LA 1XLKA 3T0DA 1Z32X 4S3CA 3GNNA 4U31A 3W86A 2DSZA 4I9MA 1MNSA 3ZXWA 2PDHA 3FOKA 4N0RA 1C29A 4RE2A 4NYYA 3NQ7A 1IZCA 2WZHA 3S6DA 2Y24A 2HVMA 3KTSA 1BF2A 3S1UA 2RJHA 4PTMA 2VWSA 1QW9A 1VHCA 4C6OA 1RPXA 2PDCA 3XISA 4YVPA 2VX5A 4FNQA 1HIZA 3FA4A 1PPIA 4DQWA 4X0NA 3VAVA 2H8ZA 3AMGA 4G9PA 1TV4A 1N2VA 6A3HA 3WSUA 2CPUA 4BQ4A 3COTA 3L4WA 2YOCA 1OX4A 5FD0A 2PC8A 4XUYA 2VCAA 4B3KA 3BK0A 3M5YA 1GJWA 4ZODA 4CU8A 4BF5A 3ABOA 4OV4A 4L6HA 3LGEA 3R89A 3VGFA 1FCQA 4XZ9A 1AH3A 4PCFA 1M68A 5HJXA 4FNRA 4W89A 4HU0A 4WEVX 1AZ1A 2NW0A 1TCMA 1JGIA 7TAAA 2BODX 3THAA 1KTCA 2REQA 1OFDA 3SFKA 1YNYA 4KGJA 2BG5A 3M7SA 1TJPA 3F1QA 2XGZA 4AAJA 5EBAA 4EXBA 2DY3A 4RE3A 4PTXA 2HVNA 2WQPA 1T40A 2ZZ4A 4C5YA 2J7CA 3WQ5A 2Y5SA 3KBNA 4LVAA 3A4XA 3EKLA 2OEJA 4D2JA 3N17A 1EQPA 1A4LA 2Y5EA 3MV11 4OOUA 4AVNA 4JTEA 4L6OA 1KM0A 3LTYA 3VD7A 1QHPA 2I17A 4NQ1A 3AU6A 1K9DA 1N8FA 1XLHA 2XFFA 4MJZA 2E5DA 2DSWA 4A8NA 4DO4A 1WBJA 3ARQA 2YPIA 1MXGA 3CHVA 1AQMA 4J27A 4H9YA 1BLIA 2GGGA 5G2HA 1GW9A 2OX1A 1UZ4A 4DBUA 1SPQA 3L23A 4L9YA 1TMLA 3U57A 3CAVA 4XZWA 1LL4A 2GVLA 1FH7A 1Q4WA 4LS0A 2ZZ1A 1TO3A 4PSRA 1DXFA 4LBUA 2HS8A 2RGLA 1NU5A 2GSJA 2C0AA 1DTNA 1E9YB 3KW3A 2MUCA 1RLDA 4QG9A 4HPXA 2OGJA 1CXIA 4PMJA 3GE7A 4HCDA 3IIXA 1CX9A 2I7GA 4EXQA 3ZSTA 1AL7A 2OPJA 2WC7A 2FFCA 1CGTA 2GFTA 3O15A 3QTPA 3EBVA 1DQXA 2ZRUA 2W4XA 2INZA 2QNEA 3N19B 1QFEA 4H9UA 4NG3A 1S5WA 4WK9A 3MSRA 3HJZA 3UWVA 1DTUA 4GY1A 1V03A 1RV8A 3PULA 1JDEA 5CZTA 3VNMA 2ZVIA 3RK8A 4YS1A 3LMZA 3M0ZA 1UUMA 2TAAA 4ZB5A 2ZC8A 4LS1A 1YDYA 4I7WA 2PS2A 3GIYA 2X1TA 1XWYA 5M17A 6REQA 4WHBA 3GH7A 4DF2A 1T8QA 3GO2A 1MFVA 3T07A 3SGGA 3TMQA 1HKIA 2WO5A 3OBKA 1R2RA 4M6QA 3GXMA 4S3FA 1CIUA 1MRAA 2UWFA 3CTTA 3O0KA 4AZIA 2QJMA 3RNDA 2CZDA 2RAGA 4J40A 4GE8A 2VCBA 2DUZA 2WZMA 1G94A 3KE0A 3R8GA 1UZDA 3G3DA 4A8LA 4RL3A 5AB3A 3LUTA 3QW4B 1QTWA 2C19A 3A22A 4J3XA 4JHOA 3TSMA 1YXDA 3FCPA 3NPVA 1J11A 1W37A 1I75A 4DJED 3APGA 2VKZG 2BBFA 2C6QA 3SCSA 4MNKA 4H2HA 3W7PA 2WSRA 3JS3A 4MLRA 3BW2A 4IP7A 1VYSX 3ZYZA 4GUHA 4JNZA 5BU9A 2GSHA 5LGXA 1ZAIA 3DFQA 1KW1A 4BS0A 3M0LA 4IIGA 1UA7A 3ONCA 3PZOA 1K8ZA 3W7OA 3S8HA 1P4CA 1PDZA 1Q2RA 1H09A 4YNGA 1O60A 2PWEA 4J5NA 1E1CB 4GNJA 1VBGA 2QV5A 3ANYA 1PBGA 4DJDA 3S4TA 3TYZA 1TQXA 1A5KC 3EWCA 3P67A 3EOLA 3LCXA 3BL3A 4MUPA 3NEVA 2PGRA 4QG8A 2V82A 2CLIA 5CG7A 3V0UA 1FDZA 2WCGA 2R82A 1ADSA 4HA3A 2GJNA 5D38A 3PJTA 3S0CA 4JQ2A 3K13A 3TTSA 4GMEA 2XIJA 3BMVA 2WAGA 4V15A 4DHGA 3A3XA 4LUYA 1XX1A 4UNLA 3C2OA 1WKFA 5AY7A 1YIXA 1DIOA 1JD7A 1TJRA 3V0TA 3HU7A 2D3NA 4KCUA 4Q8PA 4G2DA 4AVFA 3M5VA 1TB3A 3EWZA 4PUNA 2V8ZA 1J5SA 4HZ7A 2VO5A 1Q13A 1PKNA 3NQMA 1VBHA 4LCQA 4JX5A 4JTDA 1CXFA 2PC4A 4JIEA 1E0UA 2I1OA 5CC6A 1GQLA 2ZDSA 3VPLA 3NAVA 4GGHA 2E9LA 1FDYA 4HSOA 3W38A 3QY6A 3NZRA 3IVTA 3DGRA 2XIBA 1UKSA 1W0MA 4ZVJA 2ACUA 1PSCA 2C8NA 1E70M 2WMHA 3E0FA 3NO3A 2OLHA 3V36A 1J5TA 3M5XA 5LGZA 4W85A 4QJ1A 1JZ2A 4K1GA 1QMLA 1SMAA 1V93A 3PZGA 4IQLA 1OF6A 2W3ZA 2V2CA 1PZ0A 4Z0SA 2QUMA 2FHBA 2NT1A 1J18A 3OTRA 1DWIM 1IEQA 4POCA 4IPLA 3DX5A 4K2SA 1YTDA 3PZTA 5A5WA 5C5YA 1JRCA 3DOPA 3ARRA 3SCOA 4KGLA 4P7RA 3A21A 4AZ6A 3EKGA 1AQFA 3N2XA 3ICJA 5A6BA 1OFQA 1UQZA 1MW1A 4BI6A 3JUGA 4GI4A 4I8YA 4Y2WA 5K3VA 4DWSB 5A3HA 4ZO8A 5AHIA 1PWLA 2OQLA 3ZO9A 3QRHA 4RDWA 4FLRA 2POTA 2VZOA 2AQWA 4AWSA 5AECA 4F79A 4H7ZA 1MEIA 4W88A 4HHLA 2HK0A 3QY8A 5C9RA 1I2OA 2FJKA 3FYYA 3CASA 1OABA 2CKRA 1G4PA 1YBQB 1JZ6A 4QTGA 1GOQA 4JTJA 5EMKA 4Q22A 3WFZA 2OLAA 1MUMA 4XWUA 3TJLA 4PZVA 2PDPA 2NX9A 1SQ7A 1KCZA 4CD7A 3IJ8A 4QLLA 4JN8A 4H9XA 1VR6A 1MVYA 1RA5A 4S3GA 4MG4A 2J13A 1HW6A 4HB7A 2B4GA 3LNMA 1GG0A 2XGBA 2CW6A 2DZTA 4PL1A 4EAMA 4LH8A 1VD6A 1GK8A 4JIPA 2OWWA 3TOYA 4GY7A 1RD6A 4S3DA 4ZCWA 3GR8A 4X0VA 1K9TA 5U4NA 4Y8EA 3L5LA 3QW3A 4O15A 3SQMA 4O8AA 2PSNA 3QHOA 4WSHA 3I65A 4M7SA 2GQ8A 2PD5A 1JXKA 4ZQOA 3HBLA 2AQOA 3VD9A 3KP1A 3D47A 4KESA 3IGHX 4V28A 1ISVA 4WDTA 4JX4A 4LVBA 2ATSA 4PUKA 1TUFA 4NJIA 3DH7A 4OKDA 4PBFA 3N4AA 2HPIA 1ITUA 2AL2B 1EJRC 2V81A 4XBSA 2OYKA 5LZLA 2D73A 4YVVA 3CO8A 1ZNNA 4AY1A 3T44A 1LG2A 2JEPA 1MQPA 1BWVA 2EJ1A 4JN7A 4MWAD 1W3JA 1G4TA 2BVDA 1VENA 2WJFA 3PBUA 4PBEA 3TU9A 5DFAA 4UFJA 4YHEA 4R33A 5EKYA 2YBUA 1R0MA 2ADAA 3GY1A 4UFKA 4NX0A 3G1YA 3LRKA 1KFJA 1OCJA 3ITOA 5L6UA 1ZALA 2V3GA 4PE8A 1X6NA 3KL5A 2OT1A 2VFFA 3G1DA 4I9TA 4EOUA 5T9BG 1GKPA 3PUDA 4RDVA 2WHLA 4MJ4A 3V35A 1WXJA 4O0KA 3WH8A 2GQ9A 3PG8A 3UPMA 1XHGA 4HA4A 2YL5A 5HMSA 2A2IA 3DZ1A 1OG6A 2DP3A 1JI1A 5DLCA 2O0TA 4IIDA 1YNQA 3H54A 1ZGDA 1RJRA 4ZTXA 1S2UA 5C6MA 1N7KA 5FJJA 3BSMA 4MWAC 4BI5A 1BKHA 3T08A 1KFEA 4JKLA 4GA8A 3BTNA 2ABBA 4AUBA 2D0HA 2A5HA 4WJXA 1OSEA 4M6PA 3LGGA 2QUUA 3VFCA 4H6RA 2CXEA 3NSXA 2XN0A 2HDJA 3GTIA 1YPFA 4L7ZA 2L5HA 1UWIA 1AFSA 2GDQA 1GQNA 2RDUA 2Y89A 3EEGA 3GW0A 4GX8A 1W56A 2I5QA 2IPGA 4DWDA 2DSUA 1ZP4A 3WL0A 1IWAA 3VDBA 2CC0A 4L1WA 3OVQA 4M3PA 3UJSA 4AZCA 4A8RA 3GHSA 1W9PA 2GUUA 1KR0A 5REQA 4EF8A 3PANA 2H3DA 3GVVA 3CLWA 1PB0A 2INFA 4DAIA 4XAPA 4AXNA 3WQ4A 2V6AA 4I6KA 4O0ZA 2W9MA 4FS9A 4MDOA 1OJXA 2VTFA 3CYVA 3AJXA 3VINA 3UVAA 3M7WA 5TAOA 3VI2A 4XAZA 4H9VA 2V9DA 1RVKA 4KEZA 3UXKA 3ISIX 1HVQA 3CHCA 1TIWA 5BW6A 3BQ6A 4LEFA 5A8MA 3PZQA 3I6EA 3W1TA 3VKJA 3QSTA 3W7QA 4JTIA 3KWSA 2PDKA 1MQQA 1DJYA 1TPC1 3M47A 2P3ZA 1XI3A 3CBWA 1AK5A 2BSLA 1QRQA 1LUCB 4IL0A 2H9AB 3W1UA 2BFGA 2KAUC 4U10A 4QSFA 1Z42A 3W83A 2V5BA 4MM1A 4YL2A 1JDCA 4MY1A 4O1CA 4NHVA 2VEGA 1OT2A 4WIWA 2OZ8A 3HFYA 3EXTA 3ALFA 3BOXA 4GHRA 1KWKA 2BGNE 1FXQA 4EPEC 4Q8WA 4GZEA 4ATDA 4GZJA 1FFRA 3HGOA 2GL5A 1LLOA 3NGJA 2PDJA 1K7FA 4AD4A 1UUQA 1H60A 2E5CA 4IPNB 4X2PA 2EKCA 1ZPTA 1TPB1 4XG1A 2PZ0A 4A4AA 4IFOA 1VCGA 4IHCA 1PCWA 1AL8A 1E51A 2OO0A 4UTJA 3N2BA 4X63A 4HMEA 3W2UA 2C13A 4N2YA 2UY3A 2OSWA 2J9ZA 2D69A 4LUSA 5H8MA 5JH1A 1IEXA 1IEIA 2Y85A 2RH9A 4G1NA 3AOFA 3WK2A 2X0HA 3KBWA 1C92A 3UYIA 4GZ7A 3M41A 4A3YA 1VFOA 3HPFA 3NZQA 4GJIA 3B0UX 1W1YA 1J10A 1L6YA 2YL8A 4IH3A 4AMAA 3QZ6A 1A5LC 1U22A 3H2AA 4EK7A 1IZKA 2Z1BA 3AYSA 3GAYA 4IFKA 4CNTA 2QXWA 3SRKA 2FTPA 1IZJA 4OUIA 4ZEPA 5GPRA 3O6YX 4XD4A 5K4ZA 4Q6XA 1RQBA 1TPUA 4J9JA 2JIWA 5E9XA 3WLQA 5TQLA 2A3LA 3PSWA 3RR1A 4Q6JA 3QKEA 3SRDA 1ZL1A 4JXCA 3S5YA 4CVUA 4HJWA 5CJMA 5LA1A 4E2BA 3WUEA 3CM4A 3BC9A 3VOHA 2JALA 1YNPA 1MO0A 3BAXA 4US5D 4DXKA 1W3LA 3EWXA 3GZ3A 3G8RA 4FNSA 4JPGA 2QJGA 1MDRA 4BFAA 5HWNA 1R3QA 1WZMA 2W0UA 1YLVA 3T0CA 1H7RA 4UMCA 3FDKA 4HYVA 1EC9A 1RH9A 2AKZA 4IX2A 1OX5A 2GOKA 3GIPA 1A53A 2BOEX 2OVLA 3DERA 3VGHA 3ZR5A 4YXGA 3PAJA 4GC4A 1O5QA 1V08A 3OIHA 2ZRVA 3RMJA 4H9ZA 4C6KA 1DQUA 2CCRA 2DT1A 3AXMA 3DECA 3TTOA 1J12A 3HM7A 1FQ0A 5BRQA 4CD4A 3WO8A 3T1GA 3WF1A 5I0DA 3GB6A 4AH7A 2VX4A 1CENA 1M03A 1F61A 5B7ZA 4E8DA 4OU1A 2J77A 4XKYA 2YA1A 3T0BA 5I79A 1EXBA 1VQTA 5CBJA 2G3IA 4AD3A 2Z2BA 1XIHA 5M03A 1JD9A 2C79A 1XIFA 4ECLA 3MCMA 4O18A 1JDFA 1RQEA 2ZX6A 4DY1A 3WJSA 2PRMA 4LAOA 2VJXA 1EPVA 5A6AA 2OQYA 1XLCA 2WKLA 3MUY1 1V0MA 3W01A 3G6LA 2NVCA 3MC5A 3C61A 2AQVA 3NM3A 4LY4A 1GWJA 4IXXA 4NAFB 2DIJA 4CQAA 3MO7A 3ORWA 2NQ5A 1MMFA 2B7OA 2BMBA 3F4WA 4Y96A 2QS8A 4CD6A 1E1EA 5BOEA 1NOUA 1ICQA 1UWAA 1F8MA 3WDQA 1LRTA 1RJPA 2OX4A 1JFXA 2FVLA 3BV4A 4A3UA 3TLLA 4UQDA 1FWCC 5CQ1A 1MRQA 4J3VA 5D37A 5AC7A 4X60A 4GVIA 4DYJA 1QNOA 4PUJA 1POKA 4QSHA 4H7CA 1PCKA 4F0HA 4C6IA 1XG4A 3IJIA 3U2ZA 1PTDA 3ID7A 5J04A 1QO2A 1JDAA 1OD0A 3W7LA 3Q4DA 3W6MA 3GNOA 4ZA0A 4F9DA 3USBA 3BCDA 3K46A 2QUTA 2OMAA 4AB4A 4M0XA 2R94A 3L2MA 3EWBX 3RR4A 1XGZA 1ISZA 2AMXA 5F1VA 1IR1A 2HQAA 5IXEA 4U3AA 3H2EA 5GJNA 3N2MA 2NVDA 4A3HA 1Y7VA 1LL6A 3H70A 3PFMA 4CD5A 2YB4A 1W54A 2QCLA 3GC4A 4UOZA 5HNTA 5LA2A 1GVIA 1FY6A 1ME7A 1V3IA 1K8XA 1AJZA 8XIAA 1QO5A 4P7LA 2PRLA 3PPHA 2Q8XA 1G4EA 1HP5A 1BSIA 3WF2A 3QQ0A 1VPQA 1AH0A 3CHFA 1RY8A 3AUOA 2CZVA 1X1ZA 3AALA 1SW3A 1Q6RA 1XLGA 4L4PA 1BG4A 3V0SA 4NNBA 1WDWA 3TKFA 3VKAA 4J3TA 1DXIA 2Z00A 3M46A 4HNTA 1KKOA 2DQXA 1W1ZA 3LN3A 4JQ3A 2WNWA 3PVFA 2QJNA 2PUZA 1VBRA 1B3VA 1BD0A 1TWIA 1YMYA 1TTPA 1KGWA 3U2OA 3WMCA 4NZ3A 3I6RA 1O66A 4B5VA 5A2AA 3AHYA 1TZZA 3U2CA 3MCNA 4IZGA 3TNOA 2J9XA 4C1NB 5G4WA 1SR9A 3IS4A 5AVHA 1VH7A 3LI0A 4OBTA 4Q33A 2VUYA 2Y61A 3BGGA 2OWXA 1IYXA 4DBWA 1XIDA 3TTEA 3P82A 4KPLA 3JZUA 5D05A 2PB1A 3W85A 4XIAA 4IT1A 1PJ9A 2OT0A 3GDTA 4ZE4A 4O11A 3P0XA 3WN6A 4EPKA 1E55A 2DUXA 1DV7A 5C2CA 1FWAC 4ZENA 3GVGA 5LIUX 1ESWA 1RQHA 1X1OA 2C16A 2DJXA 1WO2A 1FCBA 1ZRQA 4NAEB 3VNKA 1MXDA 1E43A 2IKJA 3AHVA 5IHSA 1F3TA 5K9CA 1MXSA 2J7EA 1WZAA 3IAQA 1XCXA 5ABHA 2E8YA 3DYPA 1JIBA 4E5TA 3WK1A 5CBBA 3LBMA 4QG6A 2HNHA 2XZ9A 1KFKA 2E9MA 3GU1A 4DO5A 4R5EA 1HP4A 2FGZA 3LHWA 3PR2A 3Q2DA 5XINA 4TV6A 1Q6QA 5C2XA 1JCNA 3EA1A 3VM5A 5D9PA 3D6NA 4DPPA 1WCGA 3TFXA 1B3OA 1UROA 3UEQA 2FYMA 4BWLC 5ABFB 4MWAA 3XIMA 3GZAA 4HD5A 3FSUA 2IKGA 1SVDA 1TG7A 3W23A 1SZRA 5GNZA 1K9EA 4RW5A 3N14A 3K4AA 2XINA 2PA6A 4QE5A 1CDGA 1LDCA 2WK2A 3I3DA 3CL6A 3P62A 4GUJA 4DUVA 2Q8ZA 2ISSA 2NWRA 1D2KA 4F8XA 4W7VA 2DDXA 5DCEA 3PB2A 4Y7EA 4NXKA 2VEMA 4X2RA 3EDDA 4HK5A 3OYZA 3N11A 8CGTA 4Z2GA 3RFAA 3DYOA 2GGHA 4XAGA 4C91A 2ZFAA 4ZO6A 1W8GA 3UYCA 3M9YA 5F2IA 2F2HA 1NOWA 4WZHA 4AXKA 4J28A 6ENLA 4XO6A 4JR5A 2VXNA 4O10A 2NQLA 5C0QA 1UMLA 2WPGA 1A0CA 2P53A 3KTCA 1VB9A 3S5SA 4GFSA 3UZXA 1KFCA 3AXKA 1FOBA 3QPEA 1RHCA 2PWVA 5ABGA 4XZHA 2JBMA 3MUCA 3QGKC 3M0IA 3N3MA 4DBSA 1WE5A 3L67A 5LNSA 4E38A 3F7JA 1F05A 4WKHA 3FHQA 4WR3A 3M44A 3VXGA 2YDQA 2XIQA 1HKMA 1QUMA 3GHRA 4GQGA 1R86A 5FIPA 4YU1A 4UTFA 1XDMA 1FWNA 5BRBA 4DX3A 3LHVA 4FX6M 5T9CE 3M0XA 1TIMA 1JXJA 2XDFA 2Q71A 5HPCA 2VHLA 3GHTA 3G5EA 1UWQA 3VA8A 2PLCA 3R12A 1YTEA 3R79A 1EDQA 3WQOA 5G2IA 5KZEA 4LCSA 3W1PA 5JH2A 4N42A 1V3KA 4NT0A 3L4YA 1AJ0A 1QT1A 4TMBA 3RPMA 5PTDA 2J78A 3RG6A 3CUZA 4DLMA 3LSCA 3B0YA 1W9VA 1G7VA 1BAGA 3RM9A 4GXPA 3QGVA 3GYEA 4HA1A 4BEUA 3TWAA 1WOAA 4C6CA 2WVVB 4WY0F 3S1WA 4PA8A 2DIEA 4ZQCA 3VMPA 1Q2SA 2EPLX 5AHFA 3RITA 1CECA 3NQGA 2ZYFA 1TVNA 2VQTA 5HR6A 2NX1A 4FOUA 1J96A 2PPGA 1XYZA 2BXZA 4LV4A 1VJIA 3VZZA 2E1WA 4PUEA 4E2OA 4PUWA 1TV3A 4RZ4A 2YCIX 1FHUA 4WOZA 4NX5A 3QFEA 3T4WA 3W1AA 3ITTA 3L7RA 2BASA 1A5NC 5DRCA 3K1GA 2VZUA 1EGVA 1PX3A 4S3AA 1RBOB 1AODA 2PU1A 4WQ6A 3L9CA 2CYGA 4PMVA 4O1DA 1MWOA 2GJLA 1F3WA 4UR8A 1MUCA 1DQWA 3KL3A 2YCJA 4FXJA 2PGFA 1OG0A 5I2UA 3P8JA 4Z2IA 4AX6A 1VLIA 4IGNA 3PPCA 2YBTA 3ZJ6A 2X42A 2QV4A 4AF0A 4FIQA 1OCNA 3DHPA 4K6AA 1S1PA 4CQBA 2GGEA 1VCFA 3I10A 1VFMA 1NQKA 1SZEA 4HU3A 3AHZA 3A4WA 2E0PA 3W87A 3N2OA 3BOFA 4QQUA 4H2CA 4D6CA 2FPVA 3OBAA 5I7GA 1UOZA 1FWFC 3C8FA 1TJ1A 4H9TA 4HU8A 3B4UA 4AIEA 3FHAA 4G1KA 3WMSA 1SMDA 3HG2A 5D2YA 4WXZA 1XSKA 4M1BA 2F6XA 3UR7A 4QS6A 3VKDA 2G3MA 3EGJA 2O4MA 1P0NA 2GQAA 2H90A 3TMLA 4US5A 2GJXA 2KZHA 3M6DA 1YPXA 3DFHA 4W4QA 2NV9A 3R2GA 3WQGA 1AW5A 5C71A 1AG1O 1QVBA 1Z7AA 1TWZA 1A80A 4CQDA 3HIJA 1EFZA 4PH6A 3SDOA 4DIAA 4QDPA 4P8UA 1RXOB 2CHRA 4S3JA 4BA0A 4N02A 4BZYA 1MEHA 2PDFA 4IG2B 2QVHA 1IE7C 4JX6A 1OZMA 4JTSA 1P6CA 1GQKA 5DT5A 4IQJA 1UMYA 1G0CA 2BY1A 3OGSA 6REQB 1GOKA 2WB5A 2V67A 3UESA 3YPIA 3VIJA 3DXIA 3QV7A 1J4EA 3EX6A 1NDVA 4BHYA 3NDOA 1SO3A 2Z28A 1H0IA 5I5RA 4TV5A 3SN0A 1W17A 3KVKA 2P0IA 4M19A 3PTMA 3MI6A 4E8GA 4MKSA 3TEVA 3C0SA 2WC3A 3VUSA 2J7GA 1CZ1A 2DZVA 3AZTA 3AIQA 1DVJA 1N82A 3GVWA 3ZOAA 2BXYA 1JCLA 3DDMA 3WX7A 2QDDA 5CSSA 1H61A 4AEEA 1I2QA 1D7KA 3A12A 3QYSA 3RU8X 2GSEA 4ICMA 1MQRA 3WQVA 1MEWA 4M7TA 2VNCA 1GZ1A 3ABXA 2FTWA 2DW7A 3O6DA 3IJ9A 3ME3A 2V5KA 3I3BA 3G77A 4RUBA 1EEXA 2R1KA 3HPXA 1OCQA 1W1B1 3C2EA 3ELFA 4Q8NA 3SM0A 2P76A 3L0GA 3TLQA 4LNCA 4GQBA 5K7JA 4IPIA 3S6TA 1K02A 3I6TA 3K2GA 5HOSA 5ENLA 5ECVA 5I02A 3DBPA 3HGRA 3BICA 3B9AA 3W37A 1M01A 1EWDA 4X9YA 4I7UA 4UCGA 4MLJA 3CO4A 1MUWA 3CQ0A 2ZZ7A 1DJZA 3SSJA 1TWDA 2WBGA 3BZJA 3E6EA 1J6PA 2Y8UA 4IJRA 5DO8A 2ZUNA 3AXIA 3PG9A 1OD8A 1EJ7L 1FH8A 2ISFA 4XAYA 4GNKB 2NVAA 3IJ7A 2Y0FA 2XVNA 3NL3A 5EFFA 3LHYA 1DIDA 5KEZA 3HOJA 3R11A 3O05A 1EJWC 3TQPA 5D9OA 3WENA 3OPSA 3G0UA 1VCVA 4E3VA 4B9YA 2WWCA 3LU2A 3R7MA 1V0NA 3BW3A 5BZAA 3W7CA 4RXFA 2PE4A 2WC4A 1RCQA 1H41A 1Q63A 2DFAA 1X7IA 1DJNA 2QF8A 2ISWA 4EX4A 4XSLA 1AD4A 3UZJA 4PGLA 4LW7A 3KTXA 2VC6A 5C9WA 1XLLA 3UERA 1TR9A 2GWGA 3WLTA 1JZ3A 3NSNA 1AJ2A 3W88A 3GH4A 4GRSA 1DJXA 7XIMA 1QW7A 3SFWA 3MBDA 3B8WA 2GJPA 2QF7A 4BWLA 4FAMA 4GI9A 1WDRA 1L8NA 1CPUA 2ACQA 5HUPA 3NTYA 1DJIA 3WLHA 4DXXA 1YYAA 1XDJA 3NZPA 3WBEA 4ZFMA 2ISVA 1CXLA 2CZFA 3UR2A 3G22A 4X3ZA 3KCLA 3FK4A 3FAWA 3OB8A 4QJ4B 1RJQA 1ECQA 3RCNA 2EXOA 3T8LA 4B9ZA 3TQVA 5E6YA 1UP2A 4WJEA 2WMJA 2ZRZA 1QK0A 5D8WA 4I9AA 3OG3A 1NP2A 2CWNA 3UU0A 1ITXA 1XW8A 4HSNA 2V5CA 1YRRA 1HGWA 3M43A 2BGSA 2ICSA 3VIPA 5DBTA 3ENLA 4ML9A 5A8NA 3VX0A 1XLBA 2BHYA 4RCXA 2J47A 3H55A 4D8AA 5AYBA 3P7YA 1P0KA 4QQ3A 4B90A 2QULA 1HJSA 4IM4A 1GKQA 1AVAA 5DANA 1H7OA 3B8VA 1DIKA 1QATA 3W27A 1X38A 3GG8A 4UNKA 3UG4A 1QHOA 1L0PA 3ARSA 4RZ6A 2BVWA 2GPTA 3SY8A 5CZSA 3EPMA 3LHTA 3CYJA 5CCZA 2YA0A 2DVUA 3FY1A 4EP8C 4LXFA 5D2VA 5CLWA 4UQ9A 1FHDA 4GQ0A 3IV3A 1KBKA 3P6LA 3CIVA 5CZ0A 4EANA 4ASTA 2O4QA 4HGXA 3VKBA 3L2LA 4QISA 2ALDA 1E9ZB 4LALA 2PTDA 3U3HA 4H01A 3PJUA 3A4AA 1YXYA 4C6NA 2NT0A 4ALDA 1HJQA 4AY7A 1B57A 3B9EA 4U28A 1QU4A 3POCA 1ONRA 1N8IA 2PLMA 3STEA 2ZVRA 3R0UA 3CHEA 4UFMA 1O5XA 3BG9A 1DEDA 3VVGA 4KMQA 2GUBA 2YSWA 3BAYA 4ZMGA 1F2JA 2ZA2A 3PZUA 3H4XA 3THUA 3RXZA 3WIJA 3EA3A 4ENLA 1L9WA 1DORA 1E71M 5A69A 4DUOA 1NVMA 1QOQA 1XLEA 3NL6A 3OGRA 1UH4A 3QQ1A 1UW9A 2NV2A 2WHKA 3I3EA 3MKKA 3BO9A 3E49A 5C8BB 4I8DA 4MF4A 5D2WA 4OHQA 4HZ8A 1YTKA 3AXXA 3O7UA 3EOUA 5T8GA 1KRCC 4WRHA 4AC1X 1FDJA 1XF0A 2QLYA 1Y8BA 4OBSA 3LCWA 4KFNA 2X1UA 1LTDA 5CEWA 1ZTVA 4KRUA 4EKJA 3LBCA 3C2YA 3G8EA 2OODA 1XCFA 1GYNA 3HMJG 1FWHC 2X05A 1V6WA 3DEQA 2GVGA 1XICA 4OE7A 2FZ8A 4A3QA 1UJPA 3UR5A 4LVGA 2O9OA 1X6UA 4HP5A 3LSBA 1I9CB 4BF9A 4HOXA 4R7JA 3QN3A 2DZWA 3E5BA 3V18A 3GH5A 1Y0EA 3FKKA 1I6NA 1B5TA 1Z8AA 3TYDA 2VDHA 5BRPA 4BEQA 4J2PA 2UY4A 4ACZA 4BQ5A 2J24A 5K2ZA 4GQQA 5A2CA 1Q8AA 3EOEA 3TC6A 1JGMA 4ZB0A 7REQB 3W9ZA 4MKVA 4U33A 2CITA 4R34A 1R30A 2EPNA 1TCDA 2PWDA 3PBGA 1OY0A 3CQJA 1REQB 3RN6A 5FJOA 3SO7A 1LUCA 5EL1A 4RE4A 4NZ5A 3AMLA 1ICPA 3MP3A 3PP7A 2R14A 2VUNA 4HNLA 1EBGA 1XLIA 5CJNA 4FLSA 1ZY9A 2NX3A 4LBSA 3GFZA 4GKLA 4HPNA 2HJPA 3UPWA 1KD0A 1LJYA 4GH1A 3KOXA 1RK6A 4U5KA 4UUIA 3WLSA 4TQTA 3IV8A 3NCOA 3GC5A 1C7SA 4IFRA 4Q7IA 5EA9A 2OJPA 5DXXA 3K1DA 3OZYA 3W70A 2BHZA 3A4JA 1EUAA 3ZZ1A 3N6HA 3NDZA 1MZRA 2XM2A 4LC8A 4AZCB 4PMNA 3CJPA 3UZZA 2WJEA 2YCKX 5REQB 3MMDA 3M64A 4GZIA 4P7OA 4L64A 4IGHA 4I9JA 3W25A 3V3WA 4FX8A 1VRXA 3W82A 3QBUA 1J0ZA 3PAOA 4XSMA 2A3HA 3E0IA 4H8HA 2CLFA 1XPYA 1L6SA 2BXVA 5LNVA 2PU0A 2QCFA 3E2VA 1RBLA 1UA3A 1EJTC 3URNA 3FYPA 3TNBA 3AQUA 3V5CA 1BRLA 1EP1A 1JFHA 1E3XA 1S5MA 3WLMA 1A5OC 3H4WA 1MW2A 3PN8A 1QR7A 3EPNA 3WQEA 1GTHA 2IUZA 1H7PA 4N9EA 2C1IA 5K9DA 4MAZA 1J9YA 3QH2A 3EB2A 1GVQA 3LRMA 5HANA 5AHNA 2VCCA 4IMAA 1UD8A 3OLIA 1WXZA 2VR4A 3BZGA 3WK0A 2D20A 1U5JA 3L66A 2HMCA 4HVXA 2W67A 1KCKA 1OGGA 1T5AA 5LXEA 3S1XA 1U33A 4R7WA 3LG3A 1HFBA 1I1WA 3KXQA 4QM1A 4XVEA 4A8IA 5BMXA 4C1KA 4GUGA 2CFFA 4QS5A 1YQ2A 2WNNA 4GCAA 3NA8A 3NQVA 5HULA 1AMYA 3R6IA 2FZDA 3A24A 1J0IA 4C6PA 5LIYX 5LNWA 3GIQA 2GGJA 1GEHA 4Q8MA 1HQTA 1R5YA 5EMJA 2OOGA 4OOZA 3SUVA 1QBAA 5EFDA 2V38A 2WW5A 2Y8KA 2GZXA 3ZLFA 1UWUA 5AKQA 3AWNA 3F5LA 5LSMA 4LUSB 2E8ZA 1UYQA 3GTXA 1YHTA 3SCPA 2VEFA 4LT9A 3CUHA 4YTSA 3TIMA 1RVGA 4K3ZA 2Z2UA 4KFOA 2WANA 1XDLA 3NJ3A 4KIRA 3FSTA 3QSRA 4GJ1A 4K36A 5E0CA 3SN4A 4GCXA 4HPGA 4INFA 2WKGA 4NYUA 3GWQA 3E02A 2WKJA 1OFAA 2DVXA 3CQIA 3PNUA 4IFKB 5DMNA 2C1HA 5IFPA 3BLOA 2Z6IA 3LA4A 3QHMA 2ZADA 4I5RA 1GNXA 4WXYA 3UGRA 1R85A 4QITA 2BDQA 1OF8A 2XIMA 2YJQA 3RHGA 2ZZ3A 4REQA 4K7VA 1Y65A 3TN4A 3PZVA 3UZYA 1M7PA 1VZWA 3TSDA 4V1YA 4Z1DA 1S2TA 1X8FA 2XSXA 3EWUA 3PBYA 3TUUA 4JTGA 4UC5A 5DF0A 5K9XA 3CZ8A 2Y7GA 1ADDA 4LYQA 1B4EA 1TPH1 1WDQA 2QCMA 5A8OA 1UH3A 3PHAA 3ZJKA 4MB1A 3V1PA 1E72M 1KFWA 4LU0A 4WY0B 1EGMA 3IIOA 1RSCA 1BYAA 2YYTA 3P5YA 4MPKA 4J3WA 2HV5A 4PL2A 3W4RA 1W9DM 1NDZA 1F8IA 4H19A 5DT7A 5AC5A 1VEPA 1HKKA 1KNWA 5BWFA 4ADSA 5KINA 1JRBA 4W86A 2BB0A 5BXRA 3HG3A 4W7WA 4CCCA 4JQ1A 3RAOA 4PMQA 2OYMA 2BLEA 1E6NA 3LV6A 3W53A 3T2PA 4XKYB 3BMXA 2CBIA 4FP1A 1UWRA 1OFEA 5B80A 4JQAA 1NF7A 3E12A 5D9NA 4A2RA 3MSGA 4MTVA 1DBTA 1F6PA 1IT8A 4GG9A 3OQEA 3V5OA 4ZQPA 4Y9MA 1MSSA 2WMKA 4B5XA 4MNLA 2GQ3A 3UA4A 3DUGA 2XUCA 3BURA 3CWNA 4O53A 2DH3A 4JZ5A 4QRNA 5AN7A 5FA5A 4D6GA 3UETA 3TXZA 3GHUA 3REQA 4DELA 1OZQA 2W79A 4Y6GA 1E15A 1JAKA 3UWWA 2Q3OA 2Y70A 1QPRA 2W61A 3RM4A 3H53A 4ERAA 2NXHA 4L56A 3GXNA 4C90A 1O1ZA 4GLEA 1D7FA 4LAKA 1Q65A 4A2SA 3WBYA 1ISXA 4C1NA 4KFPA 1Y5VA 2FZBA 2PBGA 3S2NA 1HNYA 5T26A 1KV5A 1FRBA 4E2VA 3EKZA 4E4PA 3VCRA 3BUVA 1LG1A 2X2YA 2QJJA 3OGVA 3KVJA 4AWEA 1A0EA 4JTHA 1V6TA 1GOWA 4R27A 2C71A 1YXCA 4AQLA 4FXSA 3H8AA 4Y90A 2HVOA 2UV8G 2V68A 3VC5A 3NURA 3VIOA 4O52A 4WVXA 4HMDA 3WJWA 3PWIA 2H6RA 4TVCA 2Z24A 3QOKA 1EQCA 3AMCA 1ZCCA 3APTA 3A5FA 2JF6A 2R9RA 3SN1A 1PKYA 2X7VA 1SO4A 4AHQA 4ORIA 2CU0A 3WQ8A 1VFHA 3BPWA 3KAOA 1FWRA 1BYDA 4F48A 4GC3A 5F2MA 3CWHA 5D9MA 2ZZ2A 3NL5A 1ZP3A 4ZOBA 2VD8A 5F2GA 1A50A 5D8ZA 4B91A 5KZMA 1GVSA 5HATA 5HWMA 1G7UA 3AUJA 3CV7A 3C0JA 4IUGA 1BTCA 1DHKA 4O57A 2INEA 1F4HA 3ZFHA 5A6LA 3ZMRA 3NQCA 1FA2A 1VIZA 3SCVA 3SJNA 2FTYA 1EIBA 2QMJA 3LQGA 5GJMA 1CGXA 4L9ZA 4C6LA 4KIEA 2G97A 4ZTYA 4GBDA 1J93A 1CXHA 2XVLA 3MHUA 3EWYA 3CV2A 2Z1SA 3WF0A 4JTAA 3PZMA 5IDIA 2VOMA 1J2BA 1TKKA 5C2GA 3G3MA 5LHFA 2X16A 3C5QA 4HZ6A 1BQCA 3CZGA 1HTIA 3KVMA 4NI3A 1QNPA 3L5MA 3U6WA 1R8LA 4RDZA 4LYRA 4E3TA 1IT0A 3OIXA 4LVDA 3FDGA 3P3BA 4OTKA 4QE4A 4LYKA 1C8XA 1DJHA 3BVJA 3ZIZA 4PCPA 3H2CA 3VILA 1JUKA 4LRTA 3QZEA 2R8WA 4F66A 1C9WA 2Z26A 1LQAA 1Q6OA 2OR2A 1QNRA 1KB3A 4JHZA 2PODA 3DIPA 1OHLA 3W7KA 3ATZA 4FNTA 4NZCA 1O5KA 4ACYA 4PODA 4NILA 1TE6A 4EACA 4HTYA 3W74A 1GVFA 1ZAJA 2PDBA 1JF5A 2YIHA 5AC4A 3B05A 1BVWA 3RGTA 1NFPA 5DY2A 4NJJA 4XUGA 4MWAB 1ICSA 4KEVA 2R24A 1XXXA 3FV9A 1QNSA 4YHGA 4GIYA 3JR2A 3URQA 2AAAA 5IOBA 4D6HA 5CC5A 4XBKA 4AHPA 4RV8A 3FX4A 4U3CA 3VNIA 2V2DA 3KCJA 3TTQA 1ZBKA 2CLHA 2X30A 1EO5A 1LF1A 4IX0A 3QR3A 2JKEA 1EDGA 1ZJIA 3VX1A 4PTDA 3GBDA 3RM8A 3K30A 1DJGA 3A3HA 3HG5A 2VEKA 1UH2A 4KCVA 3WELA 3O07A 4PMXA 4NRRA 1LQ0A 1W9BM 5A6KA 3KOWA 2HE5A 2F9RA 2WVVA 2TPSA 5ABEA 4IMFA 1S2AA 3M1ZA 3QGAC 1H7WA 3SY5A 3LRLA 3ITCA 1TMQA 2NQHA 3R4IA 2GOUA 3D3FA 4GVGA 4CNPA 5KITA 4HA0A 2BNJA 1VLWA 2P0OA 3E2SA 5FEWA 2QGHA 4MYXA 3BSHA 4OWGA 2WMIB 4YWSA 5AZ1A 3H7RA 3B40A 5M5DA 4MAVA 4CN6A 1B1YA 3WQCA 1JQVA 3W75A 2GDVA 2V5LA 4XQ6A 3CNYA 5G1TA 4YPJA 4D6JA 1IWBA 2JQXA 2V5DA 2J7BA 3GR7A 4GVFA 3OA3A 3TW7A 1HKJA 4LB4A 5T91A 3SCWA 1OFBA 9XIAA 4DI9A 3QV9A 1UBSA 1UIPA 3NOEA 3KS6A 3CB3A 1F74A 3UCCA 1S5VA 3CT7A 4LNYA 2YW4A 5I3DA 2IPJA 4FALA 1K70A 3ZT5A 3AXHA 1SYTA 1ZUAX 1TPVA 4HCLA 4MWAE 1I4NA 1HKVA 4RV3A 6XIAA 1US0A 2O92A 5FAJA 3KUMA 4NF7A 5D02A 5FJIA 2WZTA 1QPOA 1TVLA 3GG0A 1F4AA 3A5VA 1F73A 2JFEX 5I24A 4TIMA 2RKXA 3N2TA 1A5MC 3CUFA 4RW3A 5I07A 2QDGA 4L80A 2FIQA 2W6RA 2DW6A 5AC8A 5ABTA 4JTFA 4PRRA 3L0KA 3TA9A 3EWWA 1H1YA 1FWSA 1R7OA 4NUWA 4GYKA 1KRAC 3DG6A 3LLXA 4KERA 4HK6A 3NQDA 3BOLA 2G37A 4NI8A 4RZ5A 1JPHA 4EWND 3H7UA 1ONEA 1TWWA 3E9AA 3IUHA 3UPBA 1P7TB 3P84A 3AI0A 1HX0A 4RPPA 6TIMA 4FR1A 2X2GA 1GPWA 1UQYA 3PC0A 1ADOA 4J3UA 2XIOA 1V0KA 4C65A 2HRWA 1W3KA 1IGSA 1JNDA 2WZEA 3BGAA 4V27A 3RF9A 3R25A 1JNEA 2FDSA 4E4FA 3ITLA 1P43A 4H7VA 2NSXA 2VFHA 1PL9A 3TP4A 4ERGA 3ABZA 4D6EA 4N9DA 4PMUA 3GNXA 4XKMA 1VEOA 1H7XA 4IG2A 3N15A 5CSYA 3N18A 1UD6A 5I00A 2WMGA 2VRJA 3GXFA 4PULA 3MMTA 4O1AA 5CZJA 1TV7A 2ZRXA 1M9HA 1I2NA 4AF0B 3VYLA 1G67A 2ZXAA 4JCLA 3LI1A 2CEQA 4FOJA 4YN5A 1M7JA 3CGTA 5CPOA 1NJJA 3O6CA 1S2VA 1WAUA 2UY2A 4XZBA 1ZFJA 3U5UA 2NLYA 5BOFA 1UR2A 1U1JA 4JY9A 1NQ6A 2OQHA 2G3NA 2J6XA 1Z89A 4LAUA 5IDZA 3BJFA 1JCTA 1HL2A 3DYMA 1EDTA 1GYLA 2QCDA 2MNRA 2A85A 4GNVA 1THFD 3NQ2A 4ZO9A 1Q4NX 3ONBA 2C1GA 1R46A 4ZSUA 1K03A 4C6QA 4MJMA 3HQNA 4GUFA 4MB5A 1FWJC 3MZ2A 2V0TA 3S9YA 2HCVA 5H91A 1QOXA 5JIWA 3CV1A 1J2WA 3S2MA 1OVDA 1KFBA 1GG1A 2GJXB 4DZHA 1M65A 4IIHA 1TJ0A 4ORMA 3NL2A 5AYXA 5C7VA 1S5NA 1EHNA 1I1XA 3MHFA 3Q94A 3MS8A 1F76A 5DELA 4E6MA 3P81A 3IGSA 2A6NA 2EG7A 2IKIA 3H2NA 1PX4A 4PMDA 1DPMA 4ATLA 3CLMA 1XPGA 3LHUA 1W9XA 2XJ7A 4XISA 6ALDA 2J62A 3DFTA 2ZUSA 3SB0A 4C7FA 3C86A 5FF7A 4S38A 1T6MA 4QEEA 1KQYA 4I7VA 4ICNA 3VE7A 1NWRA 3W72A 4PEEA 3CIWA 2JGQA 3TJIA 2DSVA 4IP5A 2DU2A 1Q85A 2CZEA 4JIRA 3BARA 4OFCA 1Z48A 4N4PA 1P48A 1GW1A 2XPKA 4DJEC 5HR7A 5D03A 4FF7A 1PE1A 2E7FA 2PGEA 1I8JA 1YX1A 2E6DA 2NXGA 2HSAA 1ZU8A 3VIIA 4LUJA 4LUTA 3QR1A 5A8GA 1IGWA 3TJXA 4G5DA 1LYXA 3PF3A 4A29A 3S1VA 3W28A 3WQ6A 1IQ8A 1FHVA 1TREA 1W1TA 4JFSA 4UFIA 2VEIA 3JW7A 3CL7A 3L4TA 1XLMA 2FDMA 3UXIA 4HTBA 3QLDA 3QXBA 1YADA 3MWCA 3P93A 2I5IA 1KM3A 1TRIA 2D3LA 4FR6A 4HN4A 3W6YA 3ARVA 1XLDA 3VKKA 4CU7A 3BGJA 1EHAA 4PBGA 4Z1YA 1SJDA 1XIBA 3VNDA 1UKQA 2P1FA 3W07A 4QAWA 1R7AA 2DZSA 2IXVA 4ZR8A 2NQJA 1R3VA 4D6IA 3UF9A 2WSPA 1HN1A 3TCEA 2PTYA 4HT3A 3DU0A 3MJYA 4JIHA 3ZLHA 3GBEA 3MDWA 2ZTKA 1RD5A 3O1NA 1GQJA 4Z2HA 3H22A 1E40A 3E0VA 1D3GA 1QW8A 2CLEA 4CNOA 2C7FA 5FJUA 2W62A 3WZ0E 2YW3A 2FZNA 3VMNA 3KBJA 4O0QA 1XRTA 2EGZA 5FF0A 4B5UA 3S5OA 4UOJA 1NOFA 3T0AA 4Q7BA 4NASA 2NUXA 1TMHA 2ZUWA 3T42A 3LB0A 1M7XA 5F4XA 1ISWA 3SECA 3VOFA 3FXYA 1EIXA 3D46A 3NYZA 2V3EA 1GZJA 3P60A 4O4WA 1KLZA 3GG7A 3TYAA 3HGJA 1EA9C 2VD9A 3N34A 4Q4SA 1K7EA 4CU6A 2HNEA 1TRDA 3EXRA 1J0KA 3ECQA 1JAEA 3OVPA 4BQ2A 2CBUA 3GD6A 1OK6A 2GVYA 3L4UA 4L4OA 1JEZA 3LCLA 1DJWA 1W1VA 1T96A 3UR8A 3SUWA 2PCEA 3DI1A 4L6DA 1E6PA 2C3ZA 4HNCA 2ZIDA 3VMOA 1LP6A 3GNPA 3EB3A 2ZE3A 3UD6A 3WDRA 1S38A 5LNRA 4GXWA 1VPXA 3DFPA 5EMYA 3PTDA 1V6XA 2EPHA 2PDGA 3OBEA 3U7VA 3P0WA 2QDHA 1XJBA 2HTMA 1OGBA 3UWQA 4QXIA 5JBEA 1FCVA 2WCAA 2HEJA 2XVGA 3UNTA 1SJAA 1YPIA 1VP5A 1ELSA 4Q8TA 1OFRA 4B15A 1E9LA 1XRFA 3A9IA 5LHEA 2TMDA 7PTDA 1E0WA 4YIWA 3WH9A 3KOYA 3T7VA 1QNVA 1HJWA 1G69A 3CUXA 1WV2A 3PUEA 3W7IA 3TAKA 2EPMX 4WCJA 3V7PA 5F1UA 5IM51 1UR3M 3F4VA 3IAPA 2Y7FA 4OECA 5BOOA 4LBRA 5CG0A 2NUYA 5I3FA 4HOZA 4UQCA 2J8FA 6XIMA 3W26A 3AYVA 1AD1A 3CIXA 3W22A 1J6OA 3C3UA 3BAWA 1EWEA 3AC0A 1FKXA 2OGYA 3NO1A 2OOFA 4N4QA 3R8RA 4IIBA 3UBPC 1XSJA 1Q6GA 1V6UA 1YDNA 1UR1A 2ZRWA 1GJUA 3ITXA 3URBA 4HQVA 2FGLA 3NQAA 5KZDA 3GRIA 2PP1A 4AIBA 3T55A 3ATYA 3SIMA 2H8XA 4RZBA 5TD4A 3R10A 4IISA 2VDGA 3PM6A 4MGGA 4KKXA 4C5ZA 1LBFA 3MP4A 7TIMA 2AGTA 1KO0A 1KR1A 3SAZA 1B3ZA 2PDQA 4B16A 1YKWA 3CZKA 2QZRA 3ITYA 3GDBA 1DIEA 4IMCA 4P61A 1WUEA 4QEHA 4FB7A 1V3JA 2YX0A 3N4EA 3PUOA 2A4AA 1B4KA 3U9IA 4UTUA 3HJEA 1WA3A 2C0HA 3M6YA 2OSYA 3C2RA 7REQA 1R9ZA 5BCAA 1LL7A 3AS0A 2Y2WA 2R1LA 1LWIA 1PVNA 3QV8A 3ZS4A 4DVOA 1EPXA 3CMFA 4AIOA 1TPFA 1PZ1A 1REQA 5HNUA 3BLDA 3K4WA 1J79A