3O1SA

Iron-catalyzed oxidation intermediates captured in a dna repair dioxygenase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
202
structure length
202
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLCLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-catalysed oxidation intermediates captured in a DNA repair dioxygenase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
total genus 48
structure length 202
sequence length 202
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2010-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3o1sA00
3O1TA 3T4HB 3O1UA 2FDJA 4NIDA 4CXWA 4QKFA 3BTYA 4MGTA 4QHOA 4ZS2A 3O1RA 3O1PA 4NROA 3RZLA 5F8PA 3RZKA 4NRQA 3S57A 3RZJA 4O7XA 4IE4A 3I3MA 4ZHNA 4CXXA 3RZHA 3S5AA 4IE0A 5DABA 2FDHA 3H8XA 3I49A 4NIIA 4MG2A 3BTZA 4RFRB 3BU0A 2IUWA 4JHTA 3I3QA 3BUCA 4CXYA 3KHCA 2FDIA 3BTXA 4NIHA 3O1VA 4NRMA 4NPMA 3T4VA 3KHBA 4NRPA 3T3YA 4OCTA 3O1SA 4IE7A 3H8OA 2FDFA 4NIGA 4QKNA 4IE5A 4IDZA 3H8RA 4NPLA 3O1MA 2FDKA 4IE6A 4QKDA 4O61A 4NJ4A 4ZS3A 3O1OA 3I2OA 3BI3A 3RZGA 2FDGA 2FD8A 3RZMA 3BKZA 3BIEA 3LFMA 4QKBA
chains in the Genus database with same CATH superfamily
5HV0A 1E57A 1GU3A 2ZXQA 1GQHA 4GH4A 1RIRA 4Q4X2 4MGTA 1O4ZA 2Y6HA 3FWEA 3ZXGA 2LALA 5E89A 1C4RA 1XOYA 1HJFA 4HT1T 5DDJ1 4ATFA 3V0AA 3I2HA 1DZQA 2EA7A 1QNWA 2HWB1 4COVA 4RHV2 1PGSA 2ARBA 5A6ZA 3B00A 5HCHA 3T1MA 1NUKA 4QHBA 3ZSEA 3A7QA 4WM8C 4L0PA 5T3NA 3UETA 1RUG1 5AVAA 4COWA 5B4XA 2C24A 5FPUA 4BIOA 2X5IB 4ASMB 2CHHA 4UF0A 4MXWB 5CNAA 1XXNA 1QQP1 1Q43A 3AZVA 3FHQA 3LEMA 1MZ5A 1TMF2 3HAGA 4IV1B 3RZMA 2XVKA 1OQDA 3P3NA 4GB32 4H7LA 5FCCA 2WYFA 2XVGA 3EYPA 1SDDB 4GWIA 2Y60A 4Q29A 2A70A 4RS5A 2RHPA 4CDXA 1XSQA 1ENSA 3DPRB 3OYWA 4RFRB 4Z1VA 5I91A 4A3ZA 2BTVC 1NCQA 1AJOA 1DZRA 2D98A 5H9RA 4XW3A 1OLQA 1K5JA 3ATGA 3O12A 2C4XA 5DG2A 3G7DA 3N35A 2F4LA 4BMEA 2R0HA 5I0TA 1VP6A 1CAXB 3VHOA 4CYDA 1QDOA 1PZ9A 3SNMA 5F39A 3DCQA 2JDNA 1W9FA 1H6YA 2NN8A 3J7LA 3LZZA 2VW2A 3VKFC 3T4HB 2EAKA 1ND3A 5FQ0A 3M3CA 4DNYA 4BE3A 5JDBA 2V72A 4KQ7A 1OOPB 2WT1A 3S57A 4XF4A 2WRAA 4XACA 1FPN1 2VMEA 2WAOA 2XLAA 4EJRA 3RYPA 3JBG3 2VOVA 4OUMA 3WG2A 3VZNA 3ZXAC 3I49A 2MEV1 4GB33 2XHKA 4K21A 1JOPA 2H6BA 5FDBA 1F5FA 3VBUC 4LBJA 1VBA3 1XYOA 3LEKA 4ZU5A 1GFF2 1KDKA 2VJXA 2ZABA 1GLHA 5FMDA 4W6WA 4CCMA 4F3JA 2ZEWA 1AR82 1PO22 2ZKLA 4B4QA 2VULA 1NCRC 2WZR1 3RQ0A 1UMZA 1LRHA 1YWKA 1OKOA 2AYHA 2CSGA 2QJVA 4RL7A 3S0MA 3J7MA 2HBUA 4N53C 1RUF2 4QAWA 3POJA 3BOPA 1BEV2 4PQQA 1QJZA 2QBXA 5JR7B 1IQAA 2WNUA 5TSWA 2IFWA 5CBLA 3MDPA 1OOPC 1UOFA 2Y6JA 4LBNA 5BNNA 5A32B 2VCAA 2QUOA 3AJZA 4QPGB 3VHPA 4S2GA 1RUJ1 3WHTA 1XE7A 3O1VA 2GP3A 4BLJA 3CQOA 4ZZ5A 4RD7A 1JODA 5AVPA 2WS91 1C8M3 1GQPA 1Y9MA 2KR2A 3CHXA 4B4RA 5FBJA 4TLGA 3OGRA 2XUEA 2J7MA 2P3JA 4A42A 1JMUB 4YZ4A 2GC0A 2VL4A 1W8NA 4E27A 4JZRA 1JZ4A 3GZAA 1RHI2 5JWPA 1JZ3A 5F3CA 4HN0A 4M3CB 2FZ1A 4XHBA 2W95A 1NCRA 3OUHA 3V0BA 3MIGA 4DIQA 5FYSA 5FZIA 4JVAA 1BVP1 1HIXA 4A41A 4O7XA 4JC1A 1VBB1 3TEZA 1RVF3 4Y24A 3WX5A 2JG8B 3MLJA 4BK5A 4MGKE 4CDWA 2SBAA 1RUH3 2Z69A 4Q4X3 3FZ3A 1W06A 4HXCA 4O65A 3USUB 2RE9A 4XJUA 2BWAA 4LA2A 1QJY3 2YZ4A 3MLLA 4JTNA 3VD3A 4Q4W1 4FSJA 3A0KA 3ZKYA 3ZLIA 3THCA 1CX4A 1WKYA 4WM8B 5JSOA 2LM3A 1BBT1 3OBRA 3FLPA 4FQZA 4WZFA 1D2SA 2YG0A 4FPEA 4ARXA 1VBD1 4Y1XA 4YLZA 4TTGA 1HQWA 1ZZ9A 2BGOA 2LW8A 1GZWA 3N9NA 3CL1A 2X05A 4IUGA 2QQWA 1OLMA 4K1ZA 1HB3A 4ONUA 4NHMA 4CUBA 1IS5A 1HXS3 2V09A 3AM2A 4OYUA 4YW7A 5LK7B 2ZGMA 1KJRA 1ZA7A 2HEVF 2YYOA 1CR7A 2WA4A 4W4ZA 5DZFA 3T08A 2QKDA 2A3XA 4BQWA 3FC0A 4AAXA 2R062 4LTAA 4FCAA 1GOHA 3JCIA 2CGNA 1VBE2 4QB6A 3O1OA 3K2OA 4D6QA 1STMA 5DPNA 1UKGA 1NOVA 2XLGA 4MYEA 4HK9A 2QQPA 3D0JA 3VD9A 4UW3A 3MUZ1 2W87A 3O1TA 3BTYA 3PUAA 2FZ2A 1TMF1 1XU1A 3FLTA 2PAEA 4FOQA 3O0WA 4FPOB 1WMFA 1QIQA 2HWF3 2UURA 2R32A 1PVC1 4AVTA 4MUVA 2VNRA 1W99A 3VBFC 3HD8B 3M7AA 1PO12 5L9VA 2ERFA 3QD6A 4FPGA 1UZZA 1OFSA 1Y3TA 4MZUA 3X29B 5C3SA 1ND3B 2DV9A 3C7HA 2EIEA 1SQ4A 4XFGA 1GUIA 1RINA 3E5QA 5D8AC 3OGGA 3IDAA 1W9SA 1JU3A 2ZPXA 3BTAA 3POYA 1N3OA 1GKBA 1R1A3 4BIFA 3OSDA 3HIFA 4Q4X1 1UIJA 4JGZB 4PI2A 5FYMA 4Q8KA 3QH7A 3LA7A 3GZEA 3ZYGA 2ZZJA 1YNAA 3WW2A 1ENXA 4DXSA 1K42A 2YGMA 3MPBA 3ASIA 5IVJA 2CGOA 5IK7A 1CAUB 2BNNA 4PJYA 3J8F3 5A3TA 3VLBB 4QM9A 5DAWA 1FMD1 3WDWA 1SFYA 2LROA 3BOWA 2ZMNA 3I2KA 3N3HA 5FZOA 4CDQC 5K4LA 4XUOA 3BTZA 3AL5A 2VGDA 3O0VA 4BM8A 1LGNA 2VQAA 2XDVA 5J48A 3PHMA 1N47A 3BU7A 1TVGA 3LGRA 5FMBA 5JMOA 1T6BX 1PGW1 1CJDA 2VC9A 1XYNA 3AYDA 4DUVA 3ZR6A 1HQNA 3FUQA 4QGLA 1UIKA 3AMMA 1VMFA 2AACA 4XCBA 1R081 3CMGA 4V2WA 4FP3A 2RDSA 5I8SA 1EUUA 5GZEA 2WFF1 4DXZA 1BHGA 4XUTA 5GLUA 4D69A 5IYYA 4X6QB 5FTTC 4YVSB 3F2ZA 3H3ZA 2VCBA 4H14A 3TN93 3AP9A 3ZYIB 1S2KA 4CDWB 2VY0A 3ITQA 4B8EA 1SDWA 1GP6A 1DU3D 1O91A 3WLUA 5C9AB 4B1MA 1NG0A 2GSYA 4FVVA 1SBFA 3ZFGB 4OCTA 3IMNA 1KXGA 1IQDC 3KT4A 1LCLA 2PMWB 4OHXA 1BYHA 4QMAA 5DUVA 2UWBA 3SKVA 1W0PA 5K8SA 1RYYA 1W03A 1YQCA 5KC5A 4YRDA 5A3NA 5D2AA 5LEKA 2R7EB 3EMRA 1OMIA 1JOBA 3MIFA 5KBFA 1PIV3 1U0AA 4ZONA 3URFA 5IVEA 1ZA4A 1ZBE3 5CFCA 5C3OA 1XE0A 5FXXA 1NYWA 1REFA 2SLIA 3L9JT 5EV7A 3UT0A 3UJOA 1ZRDA 1ZZBA 4BB3A 1XNDA 3J7HA 2KXLA 4EN6B 4Z2AA 1YO8A 4UAPA 2WZPP 4D0QA 4CU6A 1GV9A 3JXSA 1G6NA 5EYXA 1CAVA 4XBQA 4J1XA 3ELNA 3J8F1 4FOYA 3MO4A 4IW3A 3VD5A 5F7UA 2BRTA 3HNBM 3KV6A 1RUD2 3GNEA 1R1ZA 1PMJX 3JBG2 4AW7A 3AKRA 3LPGA 2Z79A 3Q8EA 1UW8A 2IXIA 4C1XA 3VKLA 5SV8A 1LOFC 2RR13 4LO7A 5AC93 1WW6A 1XYPA 3GZUC 5L7OB 2BOJA 1ND2C 2HH9A 3ZSMA 3U78A 4AEJA 2XJTA 4XF0A 4LO8A 1V6NA 1X8MA 2JD9A 1YCIA 3S7IA 1JH5A 2P2KA 2WJSA 1UCXA 2XL7A 3VHNA 4CZSA 5JUVA 1I9RA 1AVBA 3ZMNA 2GDFA 4XETA 4ES8A 1DQ5A 3IZOA 5T5OA 1S0CA 4QHZA 1UX7A 4HKWA 1GNYA 5ISLA 4ASKA 2GU9A 1GOFA 1W6PA 2O1QA 1IPJA 5LRRA 3ZN5A 1YQ5A 2D93A 4XZPA 5C3RA 2IVJA 2P17A 3DECA 4XEZA 5FYVA 2ZAAA 5BPXA 3MIDA 4CEWB 2JG8C 1JXNA 1VBA2 5CYYA 3OBAA 5BNNC 4IXLA 1SBEA 1OLME 2WQ4A 2XG3A 4K8RB 4XMIA 1DGRA 4AQ6A 3LKJA 2C9KA 2GC1A 3N7JA 4UFKA 4V1PA 1EP0A 1G9FA 5CU1A 2ZA9A 1COV3 1R082 4XFHA 3AZXA 1ST8A 3CLPA 1PVC3 3AYCA 4E4DX 3RZJA 1OVSA 1S0FA 2ORXA 2UU8A 4CCCA 1ASJ1 4L2NA 2NP0A 1NY72 1NQJA 4Y5Z0 1SBDA 1VPHA 4EWDA 4YW4A 3NO8A 4AXOA 4OULA 1AXZA 3EXUA 4E2SA 4LBLA 3MLKA 1X9TA 5FBZA 1L7RA 1LHVA 1OQ1A 1SMVA 3AP7A 3BPZA 4COYA 2WR9A 3PJYA 1S0IA 4PDWB 2RS11 2WAAA 3MF6A 2HJIA 4XFIA 4ZU4A 1ENQA 2Y6LA 3CJIC 4K1YA 2ZHNA 5JSRA 1JYNA 1PK6C 3ZM8A 4C91A 2PA7A 1IHMA 2RR12 4CCKA 1AR91 4NPRA 4XZUG 4BQXA 2ADDA 5JR2A 3RPQA 1ND3C 5DZGA 3KHCA 3D0SA 3L2HA 2P6HA 1YI9A 2J22A 4ZXEA 5T55A 3WVJA 4AHWA 4Z07A 5BYNA 1WA6X 3Q8CA 4A6OA 5C4WB 2DDUA 1AHSA 1MEC2 4O61A 2ENRA 4XVHA 2FDGA 2OX0A 3UL2A 2A73B 1Q8SA 1HKDA 3INAA 4KI5M 1DQ1A 3ZFFC 4AEKA 4XJ9A 4BQ1A 4CRQA 5JOZA 2IXKA 5IVYA 4EROA 1VBC3 2ZHKA 3ZIWA 5BV6A 2DYCA 1A3KA 3P3PA 2DVAA 4HANA 4A45A 1M4WA 1HN1A 1OXCA 5FJHA 3ZFEA 4YZ2A 3WG4A 4GKYA 5JAXA 1BBT2 4YZ3A 1QJY2 4BZ4A 2GAUA 1GICA 1RUH1 4BQYA 1OLRA 1S55A 2NMOA 4NIAA 5C70A 5HV4A 3PLQA 1O8PA 3ENRA 3THDA 2QQMA 4KWLA 1HV1A 3R4UA 3KHBA 2ZGRA 4Z82A 4E8DA 3CBNA 4M01A 1G7YA 2ORZA 2VZ1A 1BEV3 2QCSB 3NNJA 5FZAA 4BQ5A 5C8CC 3T1LA 2NZ9A 5LY1A 5J37A 3N9MA 4QKDA 4YNIA 2BYVE 1BJQA 4SBVA 3ES4A 2PAKA 1O3TA 1KD7A 1EAH3 1A8DA 4QDRA 4YGCA 3QH6A 1XNAA 2CV6A 5ANNA 2PHTA 5IWFA 1X7NA 2VUJA 2QQIA 2ZBJA 1AX0A 1D7PM 1UYXA 3GXUA 1H2NA 3DL3A 4AOCA 4BISA 1Z7S1 4YW1A 4HONA 4XFFA 1AXYA 4COZA 3PUSA 3LWCA 1HRV2 2BJSA 3GJAA 5FY0A 2XJVA 4GZ9A 3MFCA 5FK7A 2BVBA 4INDA 4BH9A 5A6QA 5KWRA 4NN0A 4IV3A 5JIAA 3ZMOA 1RUI3 1LOAA 2OIIA 3FFQA 4PIYA 3IAPA 5CEHA 1FX5A 1F2NA 3HOBA 2HWC2 2J1SA 3H3UA 2VVDA 3WINE 1DQ2A 1BKZA 3E5XA 4IV1C 3IAQA 4GWMA 2R073 2XJSA 2BWCA 4AVBA 3WG1A 5GALA 4NUBA 3GBFA 4XQWA 4DS0A 2IC1A 1C1FA 2BEOA 1UXXX 2JKBA 3AYEA 5J96B 3LSDA 2UWCA 4R9BA 2VCMA 4CP9A 1H2MA 5L73A 3KCCA 3VB9A 2Q1MA 1RJ7A 4AEDA 2TBVA 2V5YA 1LTEA 3C7FA 4AEMA 1F8VA 1JZ5A 4YWAA 4EN7B 3IPVA 4YM0A 1L7LA 1K5MA 1FYUA 2L9LA 2ZX3A 3GHNA 4LOTA 2HYKA 1TNFA 2YU1A 4AAPA 4QPGC 2Z5WA 4YG6A 3W9AA 4NO4A 3KCXA 3DUIA 3VBRA 3J8F2 2IZWA 1MS1A 2RS12 3IT8A 3ZFEC 2JICA 2RJKA 3M3QA 1C8NA 3VZKA 2WO3A 5A7SA 1JYWA 3U10A 2ZMLA 3VBOB 4OUEA 5A80A 3RDIA 1XNBA 3ZFGA 4I3PA 1B35C 1W6PB 5FMOL 1IKPA 3PTRB 3MGUA 2WLQA 4JDOA 1BXHA 2WLPA 3K75B 3MIBA 1UY1A 4XF9A 4AI9A 3E5UA 5F1RA 4Q0PA 1QOTA 3I59A 4YW2A 3KV4A 2VQTA 4WBBA 4Q1RA 4GJZA 4I3GA 1LOCA 1OUSA 2R072 4EV0A 1W28A 1DP0A 1VIWB 2JE8A 1DGRN 4CP0A 3BI3A 1RTVA 2PHWA 4M3CF 4Q26A 3HVDA 2JX9A 3WF2A 4B3NA 2OQ7A 3HPNA 3IWZA 2C0ZA 2PYTA 3WNKA 3WEZA 2RS31 1I6XA 1C5HA 5KXDA 3TNQA 4DRVA 3BCWA 4HETA 5T54A 2W1SA 2RS13 2HWB3 1S0DA 4FFGA 4FPHA 1SHWB 2B42B 1ZBE1 3AKQA 1XNCA 1PZ8A 2VZOA 2RM22 1AYM3 3BODA 5A7WA 3T4VA 4EWAA 4LBQB 3S30A 3SCHA 2VNGA 3B5LB 1SFNA 2VBPA 2VBDA 3K4AA 4Q4V1 4X6RB 3AP6A 1Q56A 4QX5A 3PL0A 2WWSA 4Y22B 4LKSA 1QEXA 3TRSB 2Y6FA 4AQ2A 1VRBA 2YY1A 3N7MA 5FKBA 2K0GA 3VBFA 4GWNA 5F3IA 1W6QB 2W5FA 1FMD2 1AR92 1N1TA 3AZWA 4META 2WNUB 1YXWA 1XRUA 4PT6A 2W91A 1B35B 3HN1A 1POQA 2ZACA 4LO6B 1D4M2 1O3SA 4GWJA 4QPIC 2PHLA 1EY2A 1QJY1 5F5AA 3DXUA 2IFRA 4O9GA 1KRIA 1EAH2 2EF6A 1RUJ3 2E9QA 2ZX1A 3AXDA 2W1WA 3U75A 4TXWA 2VBBA 2VECA 2Q30A 3IN9A 4FPYA 4GMP1 1O6UA 1PM7A 2VMCA 3SMHA 3THPA 4CCLA 2DTWA 4TLFA 3T0AA 5HBAA 5LA1A 2ZHMA 1LB2A 4XUQA 3LCPA 2ZTNA 3VBFB 1FXZA 1ODMA 2FDJA 4Q8LA 2O0OA 1LOFA 4HN1A 3TEYA 1CGPA 3MF9A 5KHGA 4XDPA 1SG3A 1IZ3A 1UX6A 1V6LA 2C26A 3WDXA 3Q8FA 4N8MA 2W94A 3NVCA 4H55A 3NAPB 4W6XA 3D82A 3KVAA 1VBA1 4Q4W2 1W2OA 3GCXA 1KEXA 1KQRA 3GJBA 1CZSA 2WT0A 4CUGA 5CFDB 3VDCA 3WDVA 3W21A 4ISRA 4BQ4A 1HB1A 1M06G 4S2FA 4BK4A 2DVFA 1Y7BA 3MV11 4YYOA 1D0HA 4XAAA 5BNOC 1H9PA 2B9UA 4GKXA 4UFMA 2WZR2 2HWF1 5A7WB 5A1LA 1MZ6A 4C0HA 2WFPA 2VZVA 1UOJA 3HN3A 4XXPA 4P08A 5KXBA 2VPVA 3IDBB 3V0AB 4RR3B 2XXZA 1YIPA 4QDQA 1HW5A 1Q8OA 1VBE3 3LE0A 4XE9A 2DWRA 5D1IA 4JHTA 3B93A 1PZ7A 1CWPA 1OKQA 4MXVA 4FPCA 4OMCA 4FBFA 1W3VA 1BVVA 1LHUA 3DGTA 4ZY9A 3MYXA 3VBOA 2NPIA 1VJ2A 2ZEXA 1TME3 1QGLA 4WVMB 4XDOA 5IAXA 2WC2A 2EXHA 2XHNA 2PN5A 2D6MA 5SV5A 1R64A 4I30A 4Z92B 2YBSA 3ACHA 4JHZA 1W6MB 2VZTA 2IXHA 3I8TA 5FY5A 5GKAC 4IEOA 2JDMA 1X33A 5A33A 4FPFA 5BNPC 1UN1A 1VAKA 2BERA 5JMCA 2Q1ZB 4EQVA 2HEWF 3PIJA 1TNRA 2BDRA 5CFCB 4LE4A 4CCDA 4N53A 5C8CB 3AP5A 4DQAA 2WQZC 1J1LA 4YVWB 3I3QA 3PTYA 1EPWA 5A3WA 4DOUA 4KG8A 5G04L 5FZ0A 4DFSA 1YYNA 5H9QA 5DDJ2 5H9PA 1CAVB 1SZBA 1G9DA 2BQPA 5KXCA 2R16A 3SCFA 5K0UB 2VUDA 1Z7S3 4NHLA 2JB4A 5DAQA 1EV13 5FFOC 1KFUL 4KWJA 1DFQA 1VRH1 3TN92 2O14A 1I3HA 3KM5A 1C8M1 4QGNA 4KBZA 3PUIA 1LOGA 2XMLA 1PM4A 5HPOA 3DF0A 2B45X 2YU2A 2FCTA 3O1SA 5FYCA 3I2JA 3BIWE 2UYAA 1UU6A 4B7KA 4P9GA 2D43A 1MR5A 2PTMA 4DY3A 5A1FA 5D8AA 2WWUA 2WZ8A 3OGSA 1AR72 3ZSLA 4LHSA 2ZX0A 2OZ6A 3HEIA 2VOWA 2E7QA 5DAVA 2XGXA 1AX1A 1EYBA 1T2XA 5LW9A 3DYOA 1RUC3 1AR93 2WNVA 3KQ4B 1AUYA 1JYXA 3J7NA 3ZFGC 5C33A 2WSVA 1UD1A 2ZEZA 3UGGA 3B3QE 3J4UH 4NHKA 2JG9A 3RZGA 1LULA 4AK3A 4JDMA 1R083 1U12A 1HV0A 1HRV3 1KS5A 2XUMA 3GF6A 1WW4A 3KQRA 3ORJA 4FOWA 2WO2A 4NOTA 3WNOA 4BA6A 3TEXA 2QTWB 2R6QA 5BNPB 4LHLA 3UESA 3D3AA 4AI0A 1I5ZA 1T6GC 1DDLA 2WNEA 4LULA 1JYIA 1H8VA 4YGBA 4XABA 2RS51 2R1DA 3O0XA 4HPKA 4UYBA 5C6CA 3ZYPA 1UZ0A 3VDDB 1W6NA 4MHRA 4CEWC 4PLOA 1BLZA 4JQTA 5H9SA 1V9U1 4ISQA 4YGDA 2XH6A 1AYN2 1OA4A 4PQ9A 3WR0A 2D6NA 1LGBA 4IE5A 5GLVA 4DXTA 5DMYA 2CDPA 4Q0QA 1ULDA 1UZYA 1LJ7A 2V4AA 4L9BA 2GP5A 4YARA 2I45A 2VH9A 1RXGA 2E31A 4IV1A 1ZZ7A 4RSUA 5F2WA 5FPXA 1V70A 4EYUA 4Y3OA 5T50A 3IIAA 5GZFA 2P37A 4GAZA 4IGQA 5CADA 4FFHA 2WA3A 4GULA 3PVOA 3WW1A 1AR62 4UXAA 3VDDA 3H8XA 2G4IA 3AJYA 1JZ2A 3WDTA 2FMDA 2J1EA 3HJRA 4AEDB 2WIIB 5FZBA 2WZR3 3MFAA 1EPZA 3UK9A 1LU2A 5LRSA 1N1VA 2W9XA 4LO4B 2YBKA 2DF7A 4IE6A 5J09A 3MW2A 1VBD3 4A7ZA 4HG6B 4Y1VA 2W39A 2BUKA 1JZ6A 1RMU2 1GZWB 3ILNA 1C57A 3ALQA 3HWJA 4OVEA 1WCDJ 4FXKB 5E1RA 2VXRA 5HI0A 3FLRA 2QQVA 3ON7A 2CAVA 1YFUA 4NMIA 1H8TC 1V9U2 2A75A 1CAXA 3AKSA 3BB6A 3VZMA 2P4EA 2VNOA 3PVEA 5CZKA 3AZYA 4HSLA 5LASA 2R043 1NZIA 3HNMA 3NAPC 4CCEA 2AR6A 2QQLA 2PHXA 3UV9A 2CWMA 1NA1B 2XR4A 4K6BA 5I8TA 3R4DB 2RDQA 2HWE2 2WWJA 4YZ5A 1D2QA 1ZX5A 1OA3A 5ACA3 2E63A 4FI9A 3MBWA 5FYYA 1RXFA 2AGSA 2R063 4ZKTB 1AJKA 3OUIA 2Y6GA 2WABA 3OG2A 1LESA 1DZTA 5KR7A 1XSRA 2FDHA 3FJSA 4WV8A 5CKNA 5C9AC 4LUKA 1SFPA 1CZVA 4QX7A 1IKQA 5F6LB 2PHFA 4KGQA 4JAAA 4AFCA 2HWD2 1D4M1 1XQNA 4AR2A 2E51A 5A6YA 4URTA 3LA3A 1A34A 4RYDA 3RJ2X 1REEA 1DHKB 2ZGSA 4LEJA 4Q4Y2 4UFIA 1O4TA 1YI7A 3I7DA 4IESA 2ID4A 5IJRA 2AEZA 4HVOA 1LU1A 1QJEA 4P02B 5F5IA 1RUD3 3HNYM 3TWIA 3ZYHA 3ZXKA 2JB8A 1EV12 2C9AA 1G86A 3W58A 1GOGA 4N7UA 3I3MA 1YQ6A 4ZZ8A 2W68A 1XJAA 2WINB 2R1BA 2DVBA 3E6BA 4SLIA 4YVWA 2J1AA 4X8NA 3KS7A 2QFEA 4ASLA 5FZ3A 2JDUA 2BNOA 2A7AA 3ZFFB 3R0RA 5CG8A 3AK0A 1CESA 1Y9QA 3SEPA 1QJX1 2F6BA 4E4SA 1RUC1 1RUE3 1N3PA 3J9SA 3N9QA 2ILMA 4RA0A 4L97A 5FO9B 1YHFA 1HB2A 3WV6A 2DFBA 5A3UA 3M3OA 4IGPA 3Q8BA 5FZMA 4YW6A 5I0RA 4JGZC 4XQDA 1UPIA 1POV0 2HWD3 5A3OA 4ZPIA 4JTOA 2OPWA 4N53B 4XTMA 3WQ7A 4DZGA 2Q8CA 2G1MA 2ZJCA 1QJFA 4LUMA 4XUPA 4OHVA 4DUWA 4Y22A 4WM8A 1HXS1 2FHRA 3I4IA 4YM1A 3S6PA 1IPKA 4ATEA 3VDBA 3E97A 5EJ3A 1COV1 1UU5A 4CEYA 4QM8A 1IG3A 4P9LA 1POV3 4BDVB 5HXVA 5JSPA 1UWWA 3MEPA 4YVSA 5FWEA 4P9XA 4YZ1A 4JRAA 2B7YA 1NLRA 3LDKA 3OY8A 4HKOA 3U11A 4BCUA 4YVWC 4KH9A 2ZEYA 4QPYA 4D3WA 3USUA 4R4XA 5C5TA 5FZ6A 3NMBA 4Q0SA 3SC7X 1VAMA 1WCUA 3N9PA 4MVTA 1HRI3 1NZCA 4ZS2A 4YW5A 3S5QA 4BMBA 3TYJA 3BYWA 3VBHC 2EICA 2NYYA 4XFBA 4HZFA 3FUOA 1KDMA 4RR3A 3RVHA 3VZOA 1E5RA 3MW4A 3AVSA 1HRI1 4QQLA 1HX6A 1OD3A 2DFCA 2ZGNA 3KZ4C 3OD0A 4MLOA 2BV4A 3AX4A 1VMHA 4JCKA 3LQCA 2ARAA 4DPNA 1J84A 3Q9OA 1LR5A 5LB6A 4O9EA 4YFWA 3POSA 3H1MA 1BZWA 3T2OA 1F9KA 3THTA 2Q8DA 4GMP0 3PU3A 3UYJA 2W47A 4A4AA 4HBNA 5JOWA 3N9LA 2VG9A 4NHXA 4S2HA 3ROUA 2X10A 3H1YA 3RNSA 2ZZQA 2F17A 2DUPA 3VGIA 1CPNA 4EZ4A 2VZSA 2DUOA 1B35A 3ZYJB 2DUQA 3VKMA 1VBC2 4C0BA 1AR61 3MIEA 4JRLA 1J83A 1SLLA 3M2MA 5ABJB 4IEWA 4OI1A 1UAIA 2JDYA 1NA1C 5L19A 4XFAA 4CP1A 2OUJA 3FFZA 3POGA 1O4YA 3AP4A 1VALA 4LBOA 3TB0A 3HBZA 3T30A 2VVEA 2HWB2 4F8AA 3OBTA 1HLCA 1F5JA 1URXA 2YC2A 1VE0A 4JX0A 1AYN1 1PMHX 1WBLA 1QH7A 2JG9B 4L11A 1TME2 4YSFA 1SPPB 4LITA 1WCQA 1RITA 1QOOA 2WUHA 2ZAHA 4R8HA 3RGBA 3ACLA 2G9FA 2MEV2 4XURA 2HWE1 1UYYA 3RZZA 5JVVA 4QQPA 1WA4A 3WF3A 2VQ0A 5FP9A 1GZ9A 4TZDA 1QNYA 4DEVA 3VBHA 1CQ9A 2CWSA 3WF4A 2ARXA 2XQXA 5FYTA 3QCWA 2JDZA 1YIFA 4BJ0A 2D6KA 5CKQA 1J59A 3N4MA 2I2SA 2HYXA 1KITA 2VAUA 2QDNA 3AZZA 3T0BA 2D6PA 3NW4A 1NT0A 4N9IA 5F3EA 1RUF1 3HQRA 1K3IA 2ZOEB 2OVUA 5FP3A 4RS5B 1OC1A 2P1BA 4KWUA 4R52A 3VKOA 5EZWA 4CEYC 2ZS6B 5B4NA 4Q4V2 1AR81 1PO21 4QPIB 2OQ6A 4FFIA 3IBMA 5DZEA 4FTBA 2WNVB 4JQRA 3VBUB 4AFBA 1UMIA 3I2GA 1RUF3 1W8HA 2XQRA 1H9WA 3AKTA 1QH6A 5DQ0A 1CAWB 3POIA 5EYYA 1DCSA 2GZWA 1RL3A 1Q8PA 4E9KA 3VD4A 1D0GA 1LAJA 5ABJC 1VLNA 5C8CA 4FT8A 1KJLA 1S4CA 3I2DA 5KHHA 2D97A 1AR63 2WS92 4JGZA 1UYZA 1MVQA 3WQBA 2E53A 2OXBA 2GH2A 3JZVA 2GNBA 4FAHA 3LDBA 4Q4Y1 3KCYA 4JDNA 4IEPA 4LKDA 1Z7S2 4M0NA 1QQP2 4L92A 1ZZCA 2QE3A 4K40A 4XJWA 4BOWA 3ST7A 1QU0A 2I07B 3OUJA 4IGOA 5F37A 1WMEA 3NQHA 4JGYB 4LHKA 4UT5A 1O3QA 4ZXKA 2IUWA 2ES3A 5EWSA 3I97A 4CP2A 3TEWA 1OPOA 3N7KA 4RHV1 4J1WA 5GJ6A 3A4UA 2WNVC 4MV2A 2JJ6A 5EHDA 4LOSA 2FDKA 4A44A 1YEWA 4P00B 2IXLA 1ULGA 4QDSA 2PLV1 2ZGTA 2ZGKA 1OI6A 1OBNA 4N9HA 1EV11 4LHNA 4HVRA 1K5MB 2WBKA 5JCTA 3RYKA 5F2SA 2LRPA 4PDWA 2ET1A 5F9TA 5FV3A 2XWBB 3KVBA 3CJIA 2H0BA 3EJKA 1JZ7A 3DPRA 4C8DA 2XJRA 2ZGUA 5ACA2 3SQOA 4PHZA 5KHIA 4CXYA 1DLCA 5EP9A 1AYM1 1ZBA1 2PHDA 2A5ZA 3ZFEB 1OT5A 2PLV3 3LFIA 5A3MA 1WD4A 2EIGA 3GBGA 1YQ8A 2ZCWA 4GALA 5FZFA 5FO7B 4E4ZA 5IW0A 3WW3A 4OQ8A 4NIDA 4YGEA 4CCJA 1O8SA 5L9BA 4YW3A 1SCSA 1ODNA 2CTVA 2E26A 4CU9A 1YFYA 4A7YA 1X36A 1QF3A 2ZGLA 1GWLA 4EWEA 1JHNA 4CXWA 1SLIA 2W92A 2YPJA 4QD2A 1SLCA 5CG9A 4Q0VA 5BNPA 3JUUA 1FOD2 1UOBA 2ZGOA 3TOJA 2WS93 1H6XA 2J42A 4LKEA 2K9ZA 5ANQA 4QX8A 3K46A 3RFRA 1MQTA 3ZSJA 2JG8A 4Q4Y3 3T0DA 2FDFA 2GC3A 1JYTA 1SCRA 1FPN2 2CU5A 2Z42A 3WCRA 5FZLA 3ZXJA 3U0ZA 2CY6A 5FYHA 3KD4A 4K7JA 4AG4A 4AFAA 4LK7A 4BQ2A 1D4M3 2H6CA 4B7EA 2Y64A 1SEFA 2YROA 4IEXA 4I2OA 2VU9A 2CAUA 3EO6A 1CVNA 3ZX7A 1VMJA 3LFMA 3D8CA 1F15A 1V6IA 1V6OA 5EIYB 2R042 3M3EA 4U36A 2O8QA 2WO1A 3R4SA 1PHMA 5FZKA 3RZLA 3U4SA 4W65A 1O5LA 4TWTA 1RJ8A 1XB9A 3PNAA 2Y38A 5LA2A 3WY6A 1GNZA 3G6JB 3UKTA 5FLJA 1CPMA 1DYKA 1LENA 1GZCA 5FYBA 3FMGA 3A23A 5D21A 4GH4B 4Y1YA 4ET7A 1N1YA 2Q4SA 3VDDC 4N43C 2E6VA 5JXGA 5K0UA 5KC6A 1HRV1 3IIIA 1WBFA 4D7YA 4GMP3 1W04A 2DU1A 4LPLA 1YQ2A 4YG3A 4R4ZA 1PO13 1U5IA 2FMYA 4CCOA 5GLZA 1VB2A 3D5OA 1J3RA 3SKJE 3AB0A 4IQPA 5FMOS 1MZFA 2HWE3 2G9ZA 1AL0G 1BEV1 3PVNA 2CL2A 3B02A 2RMU1 1ACCA 2KM2A 1U5ZA 2XB6C 1UYPA 3KLSA 3RSJA 3H8UA 5KHKA 1GZTA 3BGAA 1XNTA 4MHUA 2DCKA 1W9YA 4RS5C 4CEWA 5K7PA 1BBT3 1OH3A 5FY4A 4JKMA 4WVMA 4OI2A 3H8RA 2VZRA 4K9SA 5F3GA 1UO9A 2XVLA 5EPAA 1RUNA 4CDXB 5EJZB 2GNDA 1UNBA 3ACGA 4QPIA 1C28A 4IEYA 2XL9A 2OUHA 1S0EA 2YXSA 4AGRA 3D6EA 2LUWA 2PQSA 4QHOA 5T5LA 4WM7A 3VBSA 2JG9C 4BXFA 3U4XA 3RZKA 1WUVA 3CJIB 4QX0A 4Y20B 1H4HA 4MXWA 2WT2A 5IHRA 5FY1A 5FY8A 3RMXA 2DVGA 4A2UA 4D6SA 2D40A 3H3LA 2J1VA 4EN9B 1VR3A 2Y34A 1RUOA 4QXBA 5M0TA 3I59B 4IEZA 1W0OA 2JD4A 4FOVA 4CSWA 1J3QA 3O14A 3WSOA 4RN5A 2XKPA 1H8TB 3VL9A 1WW7A 4QKNA 5FKCA 1PIV2 3DEMA 1X82A 2VXJA 5I93A 2R0FA 2IXJA 3AKPA 4CP9B 5K9YA 1QOSA 3QACA 2W1QA 2JE9A 3K3NA 2A71A 4QX1A 2A3WA 3WHUA 2ADEA 4CDQA 4W8JA 1A6CA 5FOBB 1ZZ6A 2D6LX 4CXXA 2QZ3A 3M8LA 4OLLA 3VBRB 4KL1A 2BZDA 4BYYA 4QQOA 4LLFA 2DU0A 4FAGA 1QXJA 3K51A 2JECA 3BTXA 3LEGA 1R1A1 3ETQA 5GZGA 2FCUA 4M4RA 3POBA 2ZMKA 3WXPA 4EN8B 4JKLA 1ZBE2 5A7NA 3SHRA 1QDCA 2RM21 1OA2A 3NNMA 1C5IA 1RGSA 3NJVA 5J1XA 5JZGA 5FP4A 1OSGA 5A1AA 5C8WA 2OW4A 2VD7A 4UW5A 5F5CA 2ZGPA 4NROA 2GC2A 2ARCA 3U1XA 5DAXA 4QXCA 4UFJA 4CU8A 5FPLA 5FZOB 4AI1A 4LQRA 2YFUA 2VUAA 1RUD1 4XJ8A 4B4PA 3W5MA 2D5HA 3OJBA 3FE5A 2LS6A 3P5BA 3VBRC 1VRH3 1MS5A 3I2IA 1RHI3 4PI0A 4LBQA 3WCSA 5BXXA 5IK4A 4AI2A 2JIJA 2UY9A 5EQUA 2VR4A 1XU2A 4HOOA 4FO9A 3W20A 3VBHB 1ND2B 2E33A 4NE9A 2LTNA 4Q4V3 4AVCA 1IPSA 3CKHA 4F7ZA 4LLOA 1W2NA 5IVVA 1RUG3 2QQKA 3N9OA 3D4KA 2QQNA 1CIWA 1W8FA 4QKFA 3E6CC 5CB7A 3KT1A 1X9PA 4CDUA 4QB1A 3H9AA 2BP6A 2YUEA 1PO11 1SPPA 3JD71 4OZOA 5FP8A 3UKVA 4NIIA 3GCWA 4DY5A 1H2KA 5FP7A 3V64A 4XBNA 3HMYA 1BMV1 4M3CA 1J3PA 2PFWA 1ULEA 1WLTA 2C5DA 4I01A 2RR11 1GWMA 1EUTA 1FAYA 3ILRA 4LBKA 5FREA 1NXMA 1DQ0A 2F4PA 1DGLA 1GQGA 3WNPA 4S2DA 1JYVA 2TUNA 1QQP3 4CVUA 2FBEA 4P9WA 5J36A 1LOBA 4N43A 4QX2A 2WQ8A 5APAA 4J6GA 1W2TA 2VZPA 5CAZA 1S2BA 5FJKA 1PNGA 5DUUA 4LBQD 3SISA 3N7LA 4NAOA 4YVSC 3RRDA 5JOYA 1DYPA 5JXHA 1WLWA 3LD8A 2PLV2 4MSVA 2HWC3 4Y4YA 1XC6A 3HQXA 1YFXA 4YPJA 1RUI2 3RG0A 3I3EA 4CPBA 1FNYA 1ULPA 4D7SA 2K46A 1ULCA 4V2VA 4DXRA 2E32A 1AL21 3PMSA 3LOIA 3UGHA 1QHDA 1RUE1 4M00A 5HCBA 3AMHA 3BALA 2BU9A 1OQEA 1SLBA 3KF5A 1OHFA 2V73A 4GB31 4IV3B 5DN2A 2AH2A 4R9CA 2XLFA 5CISA 3P1IA 3T2TA 5F32A 3LF7A 2ZGQA 2Y6KA 4H2AA 1ASJ3 5A32A 5FY9A 1G9BA 5FZ9A 5FPVA 4LE3A 4AZZA 3HQUA 2EAAA 5FZ7A 1GNHA 1MQTC 5FZ8A 2VMDA 3AXEA 3PMEA 2OYZA 2D6OX 1DF0A 1AXKA 1OOPA 1BK0A 1OH4A 3FN9A 3ILFA 4ORFA 2NMNA 3S5AA 3B9CA 1W90A 2A6YA 4HSJA 5ERLA 5DXDA 2P6CA 3DN7A 3HT1A 1D4VB 2VE1A 3NV3A 3JB8A 2ET7A 2XBO1 4OFGA 3OEAA 5J98B 2DBNA 3RYRA 1HB4A 1NAEA 3L2YA 3RI8A 2UYBA 4Y4RA 1MACA 5LCWL 2YB7A 3TBDA 5BNQA 5CKMA 4CCNA 3JQXA 1UF2C 3KSCA 1ZBA2 2D7FA 3K4ZA 1WCKA 1WLDA 1UY2A 1W8WA 4XC9A 3WQ1A 3OBZA 4IEVA 3IMMA 3T2QA 3B7MA 3WDYA 3OYWB 4RQPC 4DEQA 1HDKA 2MHFA 2VW0A 3VZLA 3IKWA 1RUH2 1C8M2 4XIKA 2WFF3 3LA2A 2UWAA 1J58A 1J1TA 1O59A 1W8UA 1UU4A 1W9TA 4MGYE 1GANA 1Q8VA 1IS3A 3M1HA 4UFLA 1UY3A 3A0NA 2ATFA 1KFXL 4OHZA 3AL6A 3BU0A 3C8XA 1H1AA 3KGLA 3ABZA 1Z0HA 4NIHA 3ECQA 4E4HA 2P5BA 1UY4A 2PXJA 1CAUA 5FAXA 1IS4A 4XPVA 5FZGA 4QU2A 3BVCA 2AZ5A 1HXS2 2A3YA 2V5DA 4N7IA 2WSUA 3RWNA 1COV2 3EBRA 3LOBA 3OF1A 3GYDA 4XCAA 1GP5A 2Q0AA 1NCQC 2K2SA 1XBFA 3WP3A 1A78A 4CPBD 2RS33 4RQPB 3ZXFA 1H30A 3H50A 1EAH1 5FK8A 4R9AA 4CDXC 5BNNB 2VQUA 3MV01 3NAPA 4E2QA 5FYUA 4QU1A 2JWPA 1LKNA 5JZGB 1JOJA 1RUE2 2QQJA 5C5UA 4YM3A 2WO7A 5CVRA 4XILA 3F95A 2B5HA 2JDHA 1PMIA 1JYCA 1V6KA 1US2A 1JU4A 1YRZA 1W6OA 3OB8A 4I02A 4A3XA 4NIGA 2OS2A 5HCFA 4AFMA 3R05A 4CTEA 3SEEA 5IVFA 3MPPG 2JDKA 4KG0A 1Z78A 5KXEA 4KU8A 3C2UA 4I0AA 2WNOA 4AGVA 1LEMA 1X8EA 4P5YA 1OFNA 1Q5OA 2RJLA 2TNFA 1Q8QA 5FZDA 1ZRFA 4XJZA 5JI7A 3RI9A 3POWA 2G9GA 2FQPA 1UL9A 1US3A 4ZHNA 1AR83 1PO23 1PGW2 1AZDA 2KD7A 4FQ4A 4P14A 5A3PA 1RB8G 2KA3A 3B94A 1QJX3 1UQXA 1BQPA 4QWNA 4GD4A 5IFPA 5CFDC 3WQ0A 4CDUB 4XFCA 2RDRA 5FLIA 3NKGA 3VZJA 4K3UA 4MGSA 2VUCA 1H2LA 1WZXA 4LO5B 2P3IA 1XPWA 1AX2A 2YDEA 3UKNA 4NVPA 4LNVA 5JPNB 2QQUA 3AYAA 3ZN6B 2HWD1 1MS3A 3U37A 1MVEA 3MIHA 1AR73 2Y0IA 4XQ4A 5A6XA 2J1TA 4UW6A 4CEYB 1NE4A 3FHAA 5FZ1A 3O1PA 1W39A 4OI0A 1W2UA 5F6KA 1R1A2 2RG4A 4HLTA 1GSLA 2JDAA 3POEA 4FPLA 4P9YA 1NLSA 3WDUA 4E2GA 4CUCA 1KS4A 5FXVA 3T2PA 2BBVA 3C7GA 5LBEA 5A7PA 1PGL2 4LR4A 3PDQA 1PVXA 5J3UA 5T5JA 5DUXA 3JU9A 5FQ0B 5A7OA 5FOJB 5LA9A 3KT7A 1WW5A 2DVDA 1NA1A 1RVF2 3PJQA 1SLAA 2O8OA 4DRRA 4WZCA 4BPZA 4MOAA 5EJ1B 4AHZA 2E7AA 1MZEA 1ZNPA 1YFWA 2Q8EA 5HXMA 3IDEA 1QJX2 1DQ6A 3JD72 4FFFA 4TYSA 1AYN3 3ZFFA 5F8PA 4AQTA 2RDNA 4N90A 1JW6A 2WN2A 1LEDA 2PELA 4UFHA 2PQQA 1F4HA 1JTZX 1S0BA 5FUPA 1TQ5A 3OGVA 3PUHA 3ZPOA 4NPMA 3FL7A 1H1MA 3RMYA 3V65A 4MG2A 3NSTA 3NV1A 4JV4A 4C1WA 3SH5A 1PK6A 4Q5OA 3H7YA 4QXHA 4YG0A 3I2FA 2B8MA 3AMNA 1MS0A 2AREA 3LB9A 4U2AA 4RQPA 1DIWA 3JQWA 4DMIA 1UPSA 1RUC2 2GMEA 1NQDA 2UY8A 4Y5SA 4B29A 4I0BA 3ZN4A 1VBC1 2D3RA 2YFZA 2R061 3DYMA 3RZHA 4AVAA 5DABA 3GDBA 4EZHA 2CNAA 3OPWA 2P3KA 1N3QA 3OD4A 4M4PA 3VN4A 1DG6A 1RMU3 1QMJA 4UI9L 2VOTA 3BUCA 1PIV1 3AMPA 4KNCA 2A6WA 4X8PA 1UXZA 1W6OB 4WM7B 1H1IA 3VBSB 2Z2SB 1CAWA 1V6MA 2R49A 4LBMA 5FUNA 5I0DA 1U5XA 3H0OA 2VZ3A 2XBO2 4UBHA 2W46A 3LIGA 4JGYC 3ZDVA 1ZRIA 2B9VA 4ZU7A 1WWYA 4ZS3A 3GGLA 2HWF2 4AVSA 1LODA 3BN6A 4BWOA 1F31A 3M4FA 3BKZA 3ZXEA 2VOXA 1YUDA 1BCXA 1W6NB 4FPKA 3NL1A 3ZYRA 5HCAA 4I09A 4WVVA 2VVFA 4G4FA 4Y26A 1ULOA 3I3BA 4XXAA 3V56A 1G8WA 5CIRA 3VBOC 1Y43B 5FIXA 1U5YA 2VTXA 3IB3A 3OY8B 2DCTA 2W2IA 5LWBA 2GH8A 2RVAA 3H7JA 3LSEA 5IUQA 1X50A 1DQ4A 4P5HA 1GMMA 4NHYA 4PIXA 4A7KA 3E1F1 1VBB2 1OF3A 4XDQA 1G9AA 3UNPA 3PIGA 5DUWA 3O7OA 5I0UA 5GZCA 3WNLA 2QZ2A 1RHI1 2VTFA 2IWGB 1Y4WA 4AI3A 4IETA 3BPSA 4Y5TA 3KWVA 2VMFA 2B46X 3S7EA 3ZXDA 4C90A 1Q3EA 2XJUA 5FXZA 4OMDA 4B1LA 1LHOA 4Q2FA 4QT6A 1JUHA 5G05L 1K45A 3WP4A 3FBYA 5E88A 3J26N 2X5IA 5IAVA 1LHNA 4H7MA 1TE1B 3ZVXA 4CU7A 3IDCB 4YM2A 1CX1A 3WP5A 3ZOIA 3APBA 1WCSA 1YLLA 1JN2P 2GMPA 3JB4C 4OUSA 2JE7A 3OOXA 4WVWA 1SACA 3OEBA 3ZYBA 2CGPA 1ZBA3 1RVF1 2Z4FA 1I5PA 4G3YC 4LKFA 4XUNA 3CU7A 4GA9A 4AI8A 3IPVB 2X09A 4Q27A 4P9JA 5K0UC 5GM0A 5FLHA 1HQLA 5AFEA 1GBGA 4FP2A 5FZHA 4PBOA 3VHRA 5LY2A 4CDUC 4LIVA 4Y33A 4OZXA 3R6SA 1LOEA 1GP4A 4CDWC 4FTSA 1YJLA 1B09A 2VNVA 5FPZA 5A70A 4DINB 1GWKA 1XNKA 3GBWA 2WZEA 3WNMA 2RV9A 3W5NA 1V0AA 1NLQA 4ARYA 2B4KA 4NRQA 5FYIA 5A33B 2YV8A 1QJU2 3PU8A 4PBPA 1QXRA 2JIGA 4BU2A 4PF1A 4N43B 2WL1A 1IS6A 1O7FA 1W2AX 2RS52 3ACFA 3CJXA 2YGLA 2NQYA 3VL8A 4HK8A 1FOD3 2BVVA 2XONA 3CEWA 4UOJA 3SITA 5DAPA 4MADA 1MS4A 4D7TA 3WOGA 4CDQB 5JOXA 3A21A 3AVRA 1H0BA 2OZJA 2XJQA 3KMHA 2JEMA 1ENRA 2GN3A 5JI9A 4IEQA 3WUCA 3CNAA 4BQ3A 5FPBA 1FOD1 3O1UA 1REDA 5T5PA 4M0HA 4OQ9A 5JZGC 1OF4A 4COUA 4HFSA 2P3YA 4LORA 3RWKX 4Y1ZA 4PLMA 2BOIA 5BY5A 3ES1A 2XPJA 1YC61 1JS9A 2R041 4URAA 3HR9A 4NR1A 1JUIA 1E5IA 2OA2A 3ZYFA 3POFA 1MPXA 1JI6A 1NCQB 4AL9A 5L7OC 3JD73 3DKQA 4BLIA 1R091 1WGPA 2JXAA 4NRMA 4GXLA 5GLWA 1ZRRA 1ZRCA 3GALA 3MZHA 4IERA 4NPLA 5FZEA 3O1MA 3RJRA 3KB5A 5IK5A 3ZN6A 3KGZA 1F4AA 3O5SA 4Q4W3 1UKRA 2RJ2A 3K77A 2OT7A 3BIEA 5FMCA 2NLRA 3GM8A 5LBFA 5JIUA 5DG1A 3VUOA 4LJHA 4QGMA 4XF1A 1WD3A 4PDWC 1XE8A 4AYUA 4ITCA 4F83A 2EXIA 1R093 1V00A 4IE4A 2Y26A 3B01A 3MICA 4MO3M 5JXIA 1W8ZA 5LA0A 1PGL1 1CD3G 2BFUS 1ASJ2 4WVZA 2W0XA 3CIHA 2AUYA 4FTEA 2EVXA 3H42B 4BXSV 3WW4A 1ZYBA 4KBBA 5FWJA 5FXWA 2WKKA 4XMAA 2RMU2 1OVPA 2D44A 1APNA 2JENA 2D5FA 4LMFA 1AF9A 1NKGA 1FV2A 1QWRA 3OTFA 3NNFA 4AHXA 4D6RA 2FD8A 3QLQA 1UY0A 3NNLA 3WP6A 2W1UA 4WM7C 3VBSC 2RS53 1FI2A 3NKTA 3U07A 4KGGA 4XHXA 4NWVA 4PCRA 4LXLA 3ZIXA 1VRH2 3TN91 1UOGA 1UZWA 3M3IA 4H3WA 1WMXA 2A6VA 5DDJ3 4AHYA 4QXKA 1K5MC 5CFCC 5IK8A 3ZR5A 4MX3A 5LK5A 1FV3A 4UBGA 4AEDC 1MEC3 2YBPA 5LBBA 5IFTA 1ZVFA 4W50A 3VDAA 3C7OA 2EALA 2G19A 4GIQA 1W6QA 2J1UA 4AE2A 3VV1A 1LECA 4NWWA 4PF5A 2PHRA 2VTXJ 3ZO0B 2XWJB 3LEIA 3PUQA 3ZPYA 4XAEA 5B2GB 4XOGA 3I2OA 3HT2A 2EIDA 3UGFA 3Q8AA 2VCCA 1V9U3 1UMHA 4XF3A 5A7QA 4A6SA 1QY4A 4K8FA 1ONAA 4LA3A 1LHWA 2HWC1 3OPZA 4IV3C 5FYZA 3WF0A 2YC0A 1L3JA 3ZDSA 4AWDA 5KHJA 4RGAA 2MEV3 2Q8OA 1ZZ8A 2E7TA 2X29A 4GH4C 1CONA 5CFDA 1TMF3 2C1FA 1H4GA 3AMQA 2WN3A 3UJQA 1FATA 3LDRA 3DYPA 5BUVA 1TZOA 4IEUA 3CO2A 5IVBA 5IVCA 1ULFA 4Y1UA 3NJXA 3SXWA 1W8TA 1CIYA 5D8AB 5FZCA 3VKNA 1NY71 2VMGA 2NM1A 1W05A 3FBMA 4QB2A 2BFUL 1E5HA 2VZQA 1F35A 4I0WB 3WG3A 2X53S 5L7OA 1NXD1 1A8MA 5J7MA 5C4WC 5LATA 1IOAA 1W9WA 5AFBA 1AR71 5C71A 1N1SA 3QOPA 4AF9A 3HBKA 2ETEA 2EIBA 1BK1A 2AENA 3CZUA 4AQSA 2TEPA 5FRAA 2BW8A 4RGKA 3JBG1 5GZDA 4XBLA 3K3OA 2BPA2 1AL23 1FMD3 5CA6A 2IVIB 1NCRB 3T09A 1ALYA 5FZ4A 4LIUA 4NRPA 1CN1A 4Q0UA 2PAMA 2BGPA 1GYKA 3P6BA 4Z8BA 3NRUA 3OCPA 5FO8B 5IATA 4RFT0 1BMV2 4XTPA 5FR3A 5LBCA 2WNUC 3K48A 3MUY1 3SH4A 2B39A 4FXGB 2RM23 1TME1 5FUIA 1VBB3 1QXPA 4QQHA 2W08A 3KF3A 2ZX2A 1DYOA 3SLIA 2HEYF 3SCGA 3EHKA 1POV1 1O3RA 1RMU1 2DURA 4MGIE 2DTYA 2W52A 5IT6A 4MH0E 1CZTA 2YPDA 2Y8KA 5E16A 3GZTB 3VBUA 5LEJA 3ACIA 4D94A 4AGGA 5BNOA 2H0VA 2PHUA 2JKXA 2R30A 4J25A 1HRI2 3DPRC 4OI4A 3VD7A 3I54A 4L99A 1W0NA 3B69A 1PX4A 2N7GA 3FX3A 2VOKA 5AC91 1C3HA 1ZM1A 2QQOA 4YFZA 1FPN3 2ZKNA 4Z2WA 1OUXA 2XKOA 4RR3C 1OD5A 1LGCA 1DBNA 4QPWA 3DV8A 4BHPA 1RUJ2 2RMU3 3NV4A 4LK6A 3H1WA 3USSA 5JXJA 2X8KA 4NAMA 3WT3A 2BGCA 5E8AA 3CZJA 2A6ZA 1RUG2 2X5IC 4EE2A 2GNTA 1YJKA 3WUDA 2EXJA 2FDIA 2J1RA 5BNOB 2WDBA 1IG0A 1MEC1 3MHZA 3MW3A 5I8YA 5JLVA 4MGQA 3V0BB 3MI8A 1DGWX 1OURA 4IDZA 4TSVA 5T52A 2Q5TA 1FT9A 5FPAA 4NJ4A 4QQ2A 2VMIA 2GMMA 4HPKB 4AFDA 4KWKA 1I1EA 4QKBA 2Y33A 3QBQA 4RHV3 4CE8A 4HVQA 2EXKA 3TAYA 3I3DA 2WYSA 2XOMA 4G9SB 4ES9A 1MS9A 2MPFA 2I74A 5F5QA 3U14A 5ABJA 3TNPB 3EB7A 3NV2A 2GALA 3RS6A 2R071 3KV5A 4HL0A 4UWDA 3NNGA 2CYFA 4XJAA 1GR3A 3W59A 5E6HA 4PLNA 4XIOA 1RUI1 3K4DA 3WNXA 2HKXA 2MNGA 3DKWA 1QJU3 1FNZA 4P9IA 3N36A 3SH3A 2IXCA 2V4VA 4IL7A 3A22A 3NJYA 1ND2A 3ETPA 4JGYA 2YMZA 4PIZA 4UF0B 1VAVA 4XYXA 4HKLA 2W3JA 1PVC2 2CDOA 3PVBB 1W8OA 1PX3A 2DBIA 4GJYA 1MS8A 4Q1PA 2GN7A 1G9CA 1CJPA 2VM9A 3C3VA 2A6XA 1W3XA 2BBAA 3LIHA 1AYM2 5GLTA 5LZ6A 2AC1A 4FPJA 1TEIA 2QNKA 4L8QA 1VB4A 1WLCA 2YHJA 1NX9A 2YC4A 3IM0A 5C3PA 5C7GA 3AFGA 1VBE1 2P34A 5JPMB 2QDRA 3ZKUA 2Y0OA 2DCYA 1LNSA 4IE7A 1HJGA 1L7QA 3PURA 4EN0A 2XJPA 1QKQA 2WFF2 1R092 2QVSB 2OKXA 5FY7A 4JKKA 5C9AA 2FCVA 1MQTB 2VMHA 3CDZB 3CF6E 4M3CE 4UW4A 2VO5A 4W6YA 1WMDA 4MGZE 4R9DA 1HN0A 2JDPA 4DB5A 5I0SA 1V6JA 1W6MA 3O1RA 1DGWA 4D8MA 1E5SA 1VBD2 1K12A 1SLTA 2D3PA 4IE0A 2VW1A 4E8CA 3WZ1A 2HLEA 4DUXA 3DXTA 1KGYA 2BNMA 2HBTA 3E6DA 3FHIB 1JZ8A 4GQ7A 1ZREA 1IGOA 3B9IA 3GHMA 2C6SA 5L9RA 5AC92 3H8OA 1JHJA 3LAGA 1C1LA 4Y20A 3NWKA 1NE6A 4QX3A 1S0GA 2DCJA 4QPGA 3WF1A 3ME2A 1TG7A 2D3SA 1O5UA 3EQEA 1AL22 3AC0A 2A1XA 1RC6A 4DO0A 2GNMA 1H8TA 5EXOA 3C7EA 3KV9A 1S1AA 1QJU1 5EFUA 1PNFA 1S2EA 4OHYA 4HMZA 1UZVA 3M70A 4K20A 4KU7A 4KMQA 5C4WA 2XBO3 4OHWA 4LT5A 4AVVA 4CUAA 2OPKA 5A3LA 5C3QA 1OPMA 2Q1FA 1DLLA 3OPTA 3WD5A 2AEYA 2RS32 4CA9A 3AFKA 3NJZA 3T3YA 5ACA1 2ZX4A 3ZXLA 3OGJA 3LPFA 5L36A 3ZSKA 1Y9GA 1PK6B 1P8JA 4RGGA 2DCZA 4TN7A 1S0JA 3WNNA 1JBCA 2VZUA 2ZHLA
chains in the Genus database with same CATH topology
3O1TA 3T4HB 3O1UA 2FDJA 4NIDA 4CXWA 4QKFA 3BTYA 4MGTA 4QHOA 4ZS2A 3O1RA 3O1PA 4NROA 3RZLA 5F8PA 3RZKA 4NRQA 3S57A 3RZJA 4O7XA 4IE4A 3I3MA 4ZHNA 4CXXA 3RZHA 3S5AA 4IE0A 5DABA 2FDHA 3H8XA 3I49A 4NIIA 4MG2A 3BTZA 4RFRB 3BU0A 2IUWA 4JHTA 3I3QA 3BUCA 4CXYA 3KHCA 2FDIA 3BTXA 4NIHA 3O1VA 4NRMA 4NPMA 3T4VA 3KHBA 4NRPA 3T3YA 4OCTA 3O1SA 4IE7A 3H8OA 2FDFA 4NIGA 4QKNA 4IE5A 4IDZA 3H8RA 4NPLA 3O1MA 2FDKA 4IE6A 4QKDA 4O61A 4NJ4A 4ZS3A 3O1OA 3I2OA 3BI3A 3RZGA 2FDGA 2FD8A 3RZMA 3BKZA 3BIEA 3LFMA 4QKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O1T A;  3T4H B;  3O1U A;  2FDJ A;  4NID A;  4CXW A;  4QKF A;  3BTY A;  4MGT A;  4QHO A;  4ZS2 A;  3O1R A;  3O1P A;  4NRO A;  3RZL A;  5F8P A;  3RZK A;  4NRQ A;  3S57 A;  3RZJ A;  4O7X A;  4IE4 A;  3I3M A;  4ZHN A;  4CXX A;  3RZH A;  3S5A A;  4IE0 A;  5DAB A;  2FDH A;  3H8X A;  3I49 A;  4NII A;  4MG2 A;  3BTZ A;  4RFR B;  3BU0 A;  2IUW A;  4JHT A;  3I3Q A;  3BUC A;  4CXY A;  3KHC A;  2FDI A;  3BTX A;  4NIH A;  3O1V A;  4NRM A;  4NPM A;  3T4V A;  3KHB A;  4NRP A;  3T3Y A;  4OCT A;  3O1S A;  4IE7 A;  3H8O A;  2FDF A;  4NIG A;  4QKN A;  4IE5 A;  4IDZ A;  3H8R A;  4NPL A;  3O1M A;  2FDK A;  4IE6 A;  4QKD A;  4O61 A;  4NJ4 A;  4ZS3 A;  3O1O A;  3I2O A;  3BI3 A;  3RZG A;  2FDG A;  2FD8 A;  3RZM A;  3BKZ A;  3BIE A;  3LFM A;  4QKB A; 
#chains in the Genus database with same CATH topology
 5HV0 A;  1E57 A;  1GU3 A;  2ZXQ A;  1GQH A;  4GH4 A;  1RIR A;  4Q4X 2;  4MGT A;  1O4Z A;  2Y6H A;  3FWE A;  3ZXG A;  2LAL A;  5E89 A;  1C4R A;  1XOY A;  1HJF A;  4HT1 T;  5DDJ 1;  4ATF A;  3V0A A;  3I2H A;  1DZQ A;  2EA7 A;  1QNW A;  2HWB 1;  4COV A;  4RHV 2;  1PGS A;  2ARB A;  5A6Z A;  3B00 A;  5HCH A;  3T1M A;  1NUK A;  4QHB A;  3ZSE A;  3A7Q A;  4WM8 C;  4L0P A;  5T3N A;  3UET A;  1RUG 1;  5AVA A;  4COW A;  5B4X A;  2C24 A;  5FPU A;  4BIO A;  2X5I B;  4ASM B;  2CHH A;  4UF0 A;  4MXW B;  5CNA A;  1XXN A;  1QQP 1;  1Q43 A;  3AZV A;  3FHQ A;  3LEM A;  1MZ5 A;  1TMF 2;  3HAG A;  4IV1 B;  3RZM A;  2XVK A;  1OQD A;  3P3N A;  4GB3 2;  4H7L A;  5FCC A;  2WYF A;  2XVG A;  3EYP A;  1SDD B;  4GWI A;  2Y60 A;  4Q29 A;  2A70 A;  4RS5 A;  2RHP A;  4CDX A;  1XSQ A;  1ENS A;  3DPR B;  3OYW A;  4RFR B;  4Z1V A;  5I91 A;  4A3Z A;  2BTV C;  1NCQ A;  1AJO A;  1DZR A;  2D98 A;  5H9R A;  4XW3 A;  1OLQ A;  1K5J A;  3ATG A;  3O12 A;  2C4X A;  5DG2 A;  3G7D A;  3N35 A;  2F4L A;  4BME A;  2R0H A;  5I0T A;  1VP6 A;  1CAX B;  3VHO A;  4CYD A;  1QDO A;  1PZ9 A;  3SNM A;  5F39 A;  3DCQ A;  2JDN A;  1W9F A;  1H6Y A;  2NN8 A;  3J7L A;  3LZZ A;  2VW2 A;  3VKF C;  3T4H B;  2EAK A;  1ND3 A;  5FQ0 A;  3M3C A;  4DNY A;  4BE3 A;  5JDB A;  2V72 A;  4KQ7 A;  1OOP B;  2WT1 A;  3S57 A;  4XF4 A;  2WRA A;  4XAC A;  1FPN 1;  2VME A;  2WAO A;  2XLA A;  4EJR A;  3RYP A;  3JBG 3;  2VOV A;  4OUM A;  3WG2 A;  3VZN A;  3ZXA C;  3I49 A;  2MEV 1;  4GB3 3;  2XHK A;  4K21 A;  1JOP A;  2H6B A;  5FDB A;  1F5F A;  3VBU C;  4LBJ A;  1VBA 3;  1XYO A;  3LEK A;  4ZU5 A;  1GFF 2;  1KDK A;  2VJX A;  2ZAB A;  1GLH A;  5FMD A;  4W6W A;  4CCM A;  4F3J A;  2ZEW A;  1AR8 2;  1PO2 2;  2ZKL A;  4B4Q A;  2VUL A;  1NCR C;  2WZR 1;  3RQ0 A;  1UMZ A;  1LRH A;  1YWK A;  1OKO A;  2AYH A;  2CSG A;  2QJV A;  4RL7 A;  3S0M A;  3J7M A;  2HBU A;  4N53 C;  1RUF 2;  4QAW A;  3POJ A;  3BOP A;  1BEV 2;  4PQQ A;  1QJZ A;  2QBX A;  5JR7 B;  1IQA A;  2WNU A;  5TSW A;  2IFW A;  5CBL A;  3MDP A;  1OOP C;  1UOF A;  2Y6J A;  4LBN A;  5BNN A;  5A32 B;  2VCA A;  2QUO A;  3AJZ A;  4QPG B;  3VHP A;  4S2G A;  1RUJ 1;  3WHT A;  1XE7 A;  3O1V A;  2GP3 A;  4BLJ A;  3CQO A;  4ZZ5 A;  4RD7 A;  1JOD A;  5AVP A;  2WS9 1;  1C8M 3;  1GQP A;  1Y9M A;  2KR2 A;  3CHX A;  4B4R A;  5FBJ A;  4TLG A;  3OGR A;  2XUE A;  2J7M A;  2P3J A;  4A42 A;  1JMU B;  4YZ4 A;  2GC0 A;  2VL4 A;  1W8N A;  4E27 A;  4JZR A;  1JZ4 A;  3GZA A;  1RHI 2;  5JWP A;  1JZ3 A;  5F3C A;  4HN0 A;  4M3C B;  2FZ1 A;  4XHB A;  2W95 A;  1NCR A;  3OUH A;  3V0B A;  3MIG A;  4DIQ A;  5FYS A;  5FZI A;  4JVA A;  1BVP 1;  1HIX A;  4A41 A;  4O7X A;  4JC1 A;  1VBB 1;  3TEZ A;  1RVF 3;  4Y24 A;  3WX5 A;  2JG8 B;  3MLJ A;  4BK5 A;  4MGK E;  4CDW A;  2SBA A;  1RUH 3;  2Z69 A;  4Q4X 3;  3FZ3 A;  1W06 A;  4HXC A;  4O65 A;  3USU B;  2RE9 A;  4XJU A;  2BWA A;  4LA2 A;  1QJY 3;  2YZ4 A;  3MLL A;  4JTN A;  3VD3 A;  4Q4W 1;  4FSJ A;  3A0K A;  3ZKY A;  3ZLI A;  3THC A;  1CX4 A;  1WKY A;  4WM8 B;  5JSO A;  2LM3 A;  1BBT 1;  3OBR A;  3FLP A;  4FQZ A;  4WZF A;  1D2S A;  2YG0 A;  4FPE A;  4ARX A;  1VBD 1;  4Y1X A;  4YLZ A;  4TTG A;  1HQW A;  1ZZ9 A;  2BGO A;  2LW8 A;  1GZW A;  3N9N A;  3CL1 A;  2X05 A;  4IUG A;  2QQW A;  1OLM A;  4K1Z A;  1HB3 A;  4ONU A;  4NHM A;  4CUB A;  1IS5 A;  1HXS 3;  2V09 A;  3AM2 A;  4OYU A;  4YW7 A;  5LK7 B;  2ZGM A;  1KJR A;  1ZA7 A;  2HEV F;  2YYO A;  1CR7 A;  2WA4 A;  4W4Z A;  5DZF A;  3T08 A;  2QKD A;  2A3X A;  4BQW A;  3FC0 A;  4AAX A;  2R06 2;  4LTA A;  4FCA A;  1GOH A;  3JCI A;  2CGN A;  1VBE 2;  4QB6 A;  3O1O A;  3K2O A;  4D6Q A;  1STM A;  5DPN A;  1UKG A;  1NOV A;  2XLG A;  4MYE A;  4HK9 A;  2QQP A;  3D0J A;  3VD9 A;  4UW3 A;  3MUZ 1;  2W87 A;  3O1T A;  3BTY A;  3PUA A;  2FZ2 A;  1TMF 1;  1XU1 A;  3FLT A;  2PAE A;  4FOQ A;  3O0W A;  4FPO B;  1WMF A;  1QIQ A;  2HWF 3;  2UUR A;  2R32 A;  1PVC 1;  4AVT A;  4MUV A;  2VNR A;  1W99 A;  3VBF C;  3HD8 B;  3M7A A;  1PO1 2;  5L9V A;  2ERF A;  3QD6 A;  4FPG A;  1UZZ A;  1OFS A;  1Y3T A;  4MZU A;  3X29 B;  5C3S A;  1ND3 B;  2DV9 A;  3C7H A;  2EIE A;  1SQ4 A;  4XFG A;  1GUI A;  1RIN A;  3E5Q A;  5D8A C;  3OGG A;  3IDA A;  1W9S A;  1JU3 A;  2ZPX A;  3BTA A;  3POY A;  1N3O A;  1GKB A;  1R1A 3;  4BIF A;  3OSD A;  3HIF A;  4Q4X 1;  1UIJ A;  4JGZ B;  4PI2 A;  5FYM A;  4Q8K A;  3QH7 A;  3LA7 A;  3GZE A;  3ZYG A;  2ZZJ A;  1YNA A;  3WW2 A;  1ENX A;  4DXS A;  1K42 A;  2YGM A;  3MPB A;  3ASI A;  5IVJ A;  2CGO A;  5IK7 A;  1CAU B;  2BNN A;  4PJY A;  3J8F 3;  5A3T A;  3VLB B;  4QM9 A;  5DAW A;  1FMD 1;  3WDW A;  1SFY A;  2LRO A;  3BOW A;  2ZMN A;  3I2K A;  3N3H A;  5FZO A;  4CDQ C;  5K4L A;  4XUO A;  3BTZ A;  3AL5 A;  2VGD A;  3O0V A;  4BM8 A;  1LGN A;  2VQA A;  2XDV A;  5J48 A;  3PHM A;  1N47 A;  3BU7 A;  1TVG A;  3LGR A;  5FMB A;  5JMO A;  1T6B X;  1PGW 1;  1CJD A;  2VC9 A;  1XYN A;  3AYD A;  4DUV A;  3ZR6 A;  1HQN A;  3FUQ A;  4QGL A;  1UIK A;  3AMM A;  1VMF A;  2AAC A;  4XCB A;  1R08 1;  3CMG A;  4V2W A;  4FP3 A;  2RDS A;  5I8S A;  1EUU A;  5GZE A;  2WFF 1;  4DXZ A;  1BHG A;  4XUT A;  5GLU A;  4D69 A;  5IYY A;  4X6Q B;  5FTT C;  4YVS B;  3F2Z A;  3H3Z A;  2VCB A;  4H14 A;  3TN9 3;  3AP9 A;  3ZYI B;  1S2K A;  4CDW B;  2VY0 A;  3ITQ A;  4B8E A;  1SDW A;  1GP6 A;  1DU3 D;  1O91 A;  3WLU A;  5C9A B;  4B1M A;  1NG0 A;  2GSY A;  4FVV A;  1SBF A;  3ZFG B;  4OCT A;  3IMN A;  1KXG A;  1IQD C;  3KT4 A;  1LCL A;  2PMW B;  4OHX A;  1BYH A;  4QMA A;  5DUV A;  2UWB A;  3SKV A;  1W0P A;  5K8S A;  1RYY A;  1W03 A;  1YQC A;  5KC5 A;  4YRD A;  5A3N A;  5D2A A;  5LEK A;  2R7E B;  3EMR A;  1OMI A;  1JOB A;  3MIF A;  5KBF A;  1PIV 3;  1U0A A;  4ZON A;  3URF A;  5IVE A;  1ZA4 A;  1ZBE 3;  5CFC A;  5C3O A;  1XE0 A;  5FXX A;  1NYW A;  1REF A;  2SLI A;  3L9J T;  5EV7 A;  3UT0 A;  3UJO A;  1ZRD A;  1ZZB A;  4BB3 A;  1XND A;  3J7H A;  2KXL A;  4EN6 B;  4Z2A A;  1YO8 A;  4UAP A;  2WZP P;  4D0Q A;  4CU6 A;  1GV9 A;  3JXS A;  1G6N A;  5EYX A;  1CAV A;  4XBQ A;  4J1X A;  3ELN A;  3J8F 1;  4FOY A;  3MO4 A;  4IW3 A;  3VD5 A;  5F7U A;  2BRT A;  3HNB M;  3KV6 A;  1RUD 2;  3GNE A;  1R1Z A;  1PMJ X;  3JBG 2;  4AW7 A;  3AKR A;  3LPG A;  2Z79 A;  3Q8E A;  1UW8 A;  2IXI A;  4C1X A;  3VKL A;  5SV8 A;  1LOF C;  2RR1 3;  4LO7 A;  5AC9 3;  1WW6 A;  1XYP A;  3GZU C;  5L7O B;  2BOJ A;  1ND2 C;  2HH9 A;  3ZSM A;  3U78 A;  4AEJ A;  2XJT A;  4XF0 A;  4LO8 A;  1V6N A;  1X8M A;  2JD9 A;  1YCI A;  3S7I A;  1JH5 A;  2P2K A;  2WJS A;  1UCX A;  2XL7 A;  3VHN A;  4CZS A;  5JUV A;  1I9R A;  1AVB A;  3ZMN A;  2GDF A;  4XET A;  4ES8 A;  1DQ5 A;  3IZO A;  5T5O A;  1S0C A;  4QHZ A;  1UX7 A;  4HKW A;  1GNY A;  5ISL A;  4ASK A;  2GU9 A;  1GOF A;  1W6P A;  2O1Q A;  1IPJ A;  5LRR A;  3ZN5 A;  1YQ5 A;  2D93 A;  4XZP A;  5C3R A;  2IVJ A;  2P17 A;  3DEC A;  4XEZ A;  5FYV A;  2ZAA A;  5BPX A;  3MID A;  4CEW B;  2JG8 C;  1JXN A;  1VBA 2;  5CYY A;  3OBA A;  5BNN C;  4IXL A;  1SBE A;  1OLM E;  2WQ4 A;  2XG3 A;  4K8R B;  4XMI A;  1DGR A;  4AQ6 A;  3LKJ A;  2C9K A;  2GC1 A;  3N7J A;  4UFK A;  4V1P A;  1EP0 A;  1G9F A;  5CU1 A;  2ZA9 A;  1COV 3;  1R08 2;  4XFH A;  3AZX A;  1ST8 A;  3CLP A;  1PVC 3;  3AYC A;  4E4D X;  3RZJ A;  1OVS A;  1S0F A;  2ORX A;  2UU8 A;  4CCC A;  1ASJ 1;  4L2N A;  2NP0 A;  1NY7 2;  1NQJ A;  4Y5Z 0;  1SBD A;  1VPH A;  4EWD A;  4YW4 A;  3NO8 A;  4AXO A;  4OUL A;  1AXZ A;  3EXU A;  4E2S A;  4LBL A;  3MLK A;  1X9T A;  5FBZ A;  1L7R A;  1LHV A;  1OQ1 A;  1SMV A;  3AP7 A;  3BPZ A;  4COY A;  2WR9 A;  3PJY A;  1S0I A;  4PDW B;  2RS1 1;  2WAA A;  3MF6 A;  2HJI A;  4XFI A;  4ZU4 A;  1ENQ A;  2Y6L A;  3CJI C;  4K1Y A;  2ZHN A;  5JSR A;  1JYN A;  1PK6 C;  3ZM8 A;  4C91 A;  2PA7 A;  1IHM A;  2RR1 2;  4CCK A;  1AR9 1;  4NPR A;  4XZU G;  4BQX A;  2ADD A;  5JR2 A;  3RPQ A;  1ND3 C;  5DZG A;  3KHC A;  3D0S A;  3L2H A;  2P6H A;  1YI9 A;  2J22 A;  4ZXE A;  5T55 A;  3WVJ A;  4AHW A;  4Z07 A;  5BYN A;  1WA6 X;  3Q8C A;  4A6O A;  5C4W B;  2DDU A;  1AHS A;  1MEC 2;  4O61 A;  2ENR A;  4XVH A;  2FDG A;  2OX0 A;  3UL2 A;  2A73 B;  1Q8S A;  1HKD A;  3INA A;  4KI5 M;  1DQ1 A;  3ZFF C;  4AEK A;  4XJ9 A;  4BQ1 A;  4CRQ A;  5JOZ A;  2IXK A;  5IVY A;  4ERO A;  1VBC 3;  2ZHK A;  3ZIW A;  5BV6 A;  2DYC A;  1A3K A;  3P3P A;  2DVA A;  4HAN A;  4A45 A;  1M4W A;  1HN1 A;  1OXC A;  5FJH A;  3ZFE A;  4YZ2 A;  3WG4 A;  4GKY A;  5JAX A;  1BBT 2;  4YZ3 A;  1QJY 2;  4BZ4 A;  2GAU A;  1GIC A;  1RUH 1;  4BQY A;  1OLR A;  1S55 A;  2NMO A;  4NIA A;  5C70 A;  5HV4 A;  3PLQ A;  1O8P A;  3ENR A;  3THD A;  2QQM A;  4KWL A;  1HV1 A;  3R4U A;  3KHB A;  2ZGR A;  4Z82 A;  4E8D A;  3CBN A;  4M01 A;  1G7Y A;  2ORZ A;  2VZ1 A;  1BEV 3;  2QCS B;  3NNJ A;  5FZA A;  4BQ5 A;  5C8C C;  3T1L A;  2NZ9 A;  5LY1 A;  5J37 A;  3N9M A;  4QKD A;  4YNI A;  2BYV E;  1BJQ A;  4SBV A;  3ES4 A;  2PAK A;  1O3T A;  1KD7 A;  1EAH 3;  1A8D A;  4QDR A;  4YGC A;  3QH6 A;  1XNA A;  2CV6 A;  5ANN A;  2PHT A;  5IWF A;  1X7N A;  2VUJ A;  2QQI A;  2ZBJ A;  1AX0 A;  1D7P M;  1UYX A;  3GXU A;  1H2N A;  3DL3 A;  4AOC A;  4BIS A;  1Z7S 1;  4YW1 A;  4HON A;  4XFF A;  1AXY A;  4COZ A;  3PUS A;  3LWC A;  1HRV 2;  2BJS A;  3GJA A;  5FY0 A;  2XJV A;  4GZ9 A;  3MFC A;  5FK7 A;  2BVB A;  4IND A;  4BH9 A;  5A6Q A;  5KWR A;  4NN0 A;  4IV3 A;  5JIA A;  3ZMO A;  1RUI 3;  1LOA A;  2OII A;  3FFQ A;  4PIY A;  3IAP A;  5CEH A;  1FX5 A;  1F2N A;  3HOB A;  2HWC 2;  2J1S A;  3H3U A;  2VVD A;  3WIN E;  1DQ2 A;  1BKZ A;  3E5X A;  4IV1 C;  3IAQ A;  4GWM A;  2R07 3;  2XJS A;  2BWC A;  4AVB A;  3WG1 A;  5GAL A;  4NUB A;  3GBF A;  4XQW A;  4DS0 A;  2IC1 A;  1C1F A;  2BEO A;  1UXX X;  2JKB A;  3AYE A;  5J96 B;  3LSD A;  2UWC A;  4R9B A;  2VCM A;  4CP9 A;  1H2M A;  5L73 A;  3KCC A;  3VB9 A;  2Q1M A;  1RJ7 A;  4AED A;  2TBV A;  2V5Y A;  1LTE A;  3C7F A;  4AEM A;  1F8V A;  1JZ5 A;  4YWA A;  4EN7 B;  3IPV A;  4YM0 A;  1L7L A;  1K5M A;  1FYU A;  2L9L A;  2ZX3 A;  3GHN A;  4LOT A;  2HYK A;  1TNF A;  2YU1 A;  4AAP A;  4QPG C;  2Z5W A;  4YG6 A;  3W9A A;  4NO4 A;  3KCX A;  3DUI A;  3VBR A;  3J8F 2;  2IZW A;  1MS1 A;  2RS1 2;  3IT8 A;  3ZFE C;  2JIC A;  2RJK A;  3M3Q A;  1C8N A;  3VZK A;  2WO3 A;  5A7S A;  1JYW A;  3U10 A;  2ZML A;  3VBO B;  4OUE A;  5A80 A;  3RDI A;  1XNB A;  3ZFG A;  4I3P A;  1B35 C;  1W6P B;  5FMO L;  1IKP A;  3PTR B;  3MGU A;  2WLQ A;  4JDO A;  1BXH A;  2WLP A;  3K75 B;  3MIB A;  1UY1 A;  4XF9 A;  4AI9 A;  3E5U A;  5F1R A;  4Q0P A;  1QOT A;  3I59 A;  4YW2 A;  3KV4 A;  2VQT A;  4WBB A;  4Q1R A;  4GJZ A;  4I3G A;  1LOC A;  1OUS A;  2R07 2;  4EV0 A;  1W28 A;  1DP0 A;  1VIW B;  2JE8 A;  1DGR N;  4CP0 A;  3BI3 A;  1RTV A;  2PHW A;  4M3C F;  4Q26 A;  3HVD A;  2JX9 A;  3WF2 A;  4B3N A;  2OQ7 A;  3HPN A;  3IWZ A;  2C0Z A;  2PYT A;  3WNK A;  3WEZ A;  2RS3 1;  1I6X A;  1C5H A;  5KXD A;  3TNQ A;  4DRV A;  3BCW A;  4HET A;  5T54 A;  2W1S A;  2RS1 3;  2HWB 3;  1S0D A;  4FFG A;  4FPH A;  1SHW B;  2B42 B;  1ZBE 1;  3AKQ A;  1XNC A;  1PZ8 A;  2VZO A;  2RM2 2;  1AYM 3;  3BOD A;  5A7W A;  3T4V A;  4EWA A;  4LBQ B;  3S30 A;  3SCH A;  2VNG A;  3B5L B;  1SFN A;  2VBP A;  2VBD A;  3K4A A;  4Q4V 1;  4X6R B;  3AP6 A;  1Q56 A;  4QX5 A;  3PL0 A;  2WWS A;  4Y22 B;  4LKS A;  1QEX A;  3TRS B;  2Y6F A;  4AQ2 A;  1VRB A;  2YY1 A;  3N7M A;  5FKB A;  2K0G A;  3VBF A;  4GWN A;  5F3I A;  1W6Q B;  2W5F A;  1FMD 2;  1AR9 2;  1N1T A;  3AZW A;  4MET A;  2WNU B;  1YXW A;  1XRU A;  4PT6 A;  2W91 A;  1B35 B;  3HN1 A;  1POQ A;  2ZAC A;  4LO6 B;  1D4M 2;  1O3S A;  4GWJ A;  4QPI C;  2PHL A;  1EY2 A;  1QJY 1;  5F5A A;  3DXU A;  2IFR A;  4O9G A;  1KRI A;  1EAH 2;  2EF6 A;  1RUJ 3;  2E9Q A;  2ZX1 A;  3AXD A;  2W1W A;  3U75 A;  4TXW A;  2VBB A;  2VEC A;  2Q30 A;  3IN9 A;  4FPY A;  4GMP 1;  1O6U A;  1PM7 A;  2VMC A;  3SMH A;  3THP A;  4CCL A;  2DTW A;  4TLF A;  3T0A A;  5HBA A;  5LA1 A;  2ZHM A;  1LB2 A;  4XUQ A;  3LCP A;  2ZTN A;  3VBF B;  1FXZ A;  1ODM A;  2FDJ A;  4Q8L A;  2O0O A;  1LOF A;  4HN1 A;  3TEY A;  1CGP A;  3MF9 A;  5KHG A;  4XDP A;  1SG3 A;  1IZ3 A;  1UX6 A;  1V6L A;  2C26 A;  3WDX A;  3Q8F A;  4N8M A;  2W94 A;  3NVC A;  4H55 A;  3NAP B;  4W6X A;  3D82 A;  3KVA A;  1VBA 1;  4Q4W 2;  1W2O A;  3GCX A;  1KEX A;  1KQR A;  3GJB A;  1CZS A;  2WT0 A;  4CUG A;  5CFD B;  3VDC A;  3WDV A;  3W21 A;  4ISR A;  4BQ4 A;  1HB1 A;  1M06 G;  4S2F A;  4BK4 A;  2DVF A;  1Y7B A;  3MV1 1;  4YYO A;  1D0H A;  4XAA A;  5BNO C;  1H9P A;  2B9U A;  4GKX A;  4UFM A;  2WZR 2;  2HWF 1;  5A7W B;  5A1L A;  1MZ6 A;  4C0H A;  2WFP A;  2VZV A;  1UOJ A;  3HN3 A;  4XXP A;  4P08 A;  5KXB A;  2VPV A;  3IDB B;  3V0A B;  4RR3 B;  2XXZ A;  1YIP A;  4QDQ A;  1HW5 A;  1Q8O A;  1VBE 3;  3LE0 A;  4XE9 A;  2DWR A;  5D1I A;  4JHT A;  3B93 A;  1PZ7 A;  1CWP A;  1OKQ A;  4MXV A;  4FPC A;  4OMC A;  4FBF A;  1W3V A;  1BVV A;  1LHU A;  3DGT A;  4ZY9 A;  3MYX A;  3VBO A;  2NPI A;  1VJ2 A;  2ZEX A;  1TME 3;  1QGL A;  4WVM B;  4XDO A;  5IAX A;  2WC2 A;  2EXH A;  2XHN A;  2PN5 A;  2D6M A;  5SV5 A;  1R64 A;  4I30 A;  4Z92 B;  2YBS A;  3ACH A;  4JHZ A;  1W6M B;  2VZT A;  2IXH A;  3I8T A;  5FY5 A;  5GKA C;  4IEO A;  2JDM A;  1X33 A;  5A33 A;  4FPF A;  5BNP C;  1UN1 A;  1VAK A;  2BER A;  5JMC A;  2Q1Z B;  4EQV A;  2HEW F;  3PIJ A;  1TNR A;  2BDR A;  5CFC B;  4LE4 A;  4CCD A;  4N53 A;  5C8C B;  3AP5 A;  4DQA A;  2WQZ C;  1J1L A;  4YVW B;  3I3Q A;  3PTY A;  1EPW A;  5A3W A;  4DOU A;  4KG8 A;  5G04 L;  5FZ0 A;  4DFS A;  1YYN A;  5H9Q A;  5DDJ 2;  5H9P A;  1CAV B;  1SZB A;  1G9D A;  2BQP A;  5KXC A;  2R16 A;  3SCF A;  5K0U B;  2VUD A;  1Z7S 3;  4NHL A;  2JB4 A;  5DAQ A;  1EV1 3;  5FFO C;  1KFU L;  4KWJ A;  1DFQ A;  1VRH 1;  3TN9 2;  2O14 A;  1I3H A;  3KM5 A;  1C8M 1;  4QGN A;  4KBZ A;  3PUI A;  1LOG A;  2XML A;  1PM4 A;  5HPO A;  3DF0 A;  2B45 X;  2YU2 A;  2FCT A;  3O1S A;  5FYC A;  3I2J A;  3BIW E;  2UYA A;  1UU6 A;  4B7K A;  4P9G A;  2D43 A;  1MR5 A;  2PTM A;  4DY3 A;  5A1F A;  5D8A A;  2WWU A;  2WZ8 A;  3OGS A;  1AR7 2;  3ZSL A;  4LHS A;  2ZX0 A;  2OZ6 A;  3HEI A;  2VOW A;  2E7Q A;  5DAV A;  2XGX A;  1AX1 A;  1EYB A;  1T2X A;  5LW9 A;  3DYO A;  1RUC 3;  1AR9 3;  2WNV A;  3KQ4 B;  1AUY A;  1JYX A;  3J7N A;  3ZFG C;  5C33 A;  2WSV A;  1UD1 A;  2ZEZ A;  3UGG A;  3B3Q E;  3J4U H;  4NHK A;  2JG9 A;  3RZG A;  1LUL A;  4AK3 A;  4JDM A;  1R08 3;  1U12 A;  1HV0 A;  1HRV 3;  1KS5 A;  2XUM A;  3GF6 A;  1WW4 A;  3KQR A;  3ORJ A;  4FOW A;  2WO2 A;  4NOT A;  3WNO A;  4BA6 A;  3TEX A;  2QTW B;  2R6Q A;  5BNP B;  4LHL A;  3UES A;  3D3A A;  4AI0 A;  1I5Z A;  1T6G C;  1DDL A;  2WNE A;  4LUL A;  1JYI A;  1H8V A;  4YGB A;  4XAB A;  2RS5 1;  2R1D A;  3O0X A;  4HPK A;  4UYB A;  5C6C A;  3ZYP A;  1UZ0 A;  3VDD B;  1W6N A;  4MHR A;  4CEW C;  4PLO A;  1BLZ A;  4JQT A;  5H9S A;  1V9U 1;  4ISQ A;  4YGD A;  2XH6 A;  1AYN 2;  1OA4 A;  4PQ9 A;  3WR0 A;  2D6N A;  1LGB A;  4IE5 A;  5GLV A;  4DXT A;  5DMY A;  2CDP A;  4Q0Q A;  1ULD A;  1UZY A;  1LJ7 A;  2V4A A;  4L9B A;  2GP5 A;  4YAR A;  2I45 A;  2VH9 A;  1RXG A;  2E31 A;  4IV1 A;  1ZZ7 A;  4RSU A;  5F2W A;  5FPX A;  1V70 A;  4EYU A;  4Y3O A;  5T50 A;  3IIA A;  5GZF A;  2P37 A;  4GAZ A;  4IGQ A;  5CAD A;  4FFH A;  2WA3 A;  4GUL A;  3PVO A;  3WW1 A;  1AR6 2;  4UXA A;  3VDD A;  3H8X A;  2G4I A;  3AJY A;  1JZ2 A;  3WDT A;  2FMD A;  2J1E A;  3HJR A;  4AED B;  2WII B;  5FZB A;  2WZR 3;  3MFA A;  1EPZ A;  3UK9 A;  1LU2 A;  5LRS A;  1N1V A;  2W9X A;  4LO4 B;  2YBK A;  2DF7 A;  4IE6 A;  5J09 A;  3MW2 A;  1VBD 3;  4A7Z A;  4HG6 B;  4Y1V A;  2W39 A;  2BUK A;  1JZ6 A;  1RMU 2;  1GZW B;  3ILN A;  1C57 A;  3ALQ A;  3HWJ A;  4OVE A;  1WCD J;  4FXK B;  5E1R A;  2VXR A;  5HI0 A;  3FLR A;  2QQV A;  3ON7 A;  2CAV A;  1YFU A;  4NMI A;  1H8T C;  1V9U 2;  2A75 A;  1CAX A;  3AKS A;  3BB6 A;  3VZM A;  2P4E A;  2VNO A;  3PVE A;  5CZK A;  3AZY A;  4HSL A;  5LAS A;  2R04 3;  1NZI A;  3HNM A;  3NAP C;  4CCE A;  2AR6 A;  2QQL A;  2PHX A;  3UV9 A;  2CWM A;  1NA1 B;  2XR4 A;  4K6B A;  5I8T A;  3R4D B;  2RDQ A;  2HWE 2;  2WWJ A;  4YZ5 A;  1D2Q A;  1ZX5 A;  1OA3 A;  5ACA 3;  2E63 A;  4FI9 A;  3MBW A;  5FYY A;  1RXF A;  2AGS A;  2R06 3;  4ZKT B;  1AJK A;  3OUI A;  2Y6G A;  2WAB A;  3OG2 A;  1LES A;  1DZT A;  5KR7 A;  1XSR A;  2FDH A;  3FJS A;  4WV8 A;  5CKN A;  5C9A C;  4LUK A;  1SFP A;  1CZV A;  4QX7 A;  1IKQ A;  5F6L B;  2PHF A;  4KGQ A;  4JAA A;  4AFC A;  2HWD 2;  1D4M 1;  1XQN A;  4AR2 A;  2E51 A;  5A6Y A;  4URT A;  3LA3 A;  1A34 A;  4RYD A;  3RJ2 X;  1REE A;  1DHK B;  2ZGS A;  4LEJ A;  4Q4Y 2;  4UFI A;  1O4T A;  1YI7 A;  3I7D A;  4IES A;  2ID4 A;  5IJR A;  2AEZ A;  4HVO A;  1LU1 A;  1QJE A;  4P02 B;  5F5I A;  1RUD 3;  3HNY M;  3TWI A;  3ZYH A;  3ZXK A;  2JB8 A;  1EV1 2;  2C9A A;  1G86 A;  3W58 A;  1GOG A;  4N7U A;  3I3M A;  1YQ6 A;  4ZZ8 A;  2W68 A;  1XJA A;  2WIN B;  2R1B A;  2DVB A;  3E6B A;  4SLI A;  4YVW A;  2J1A A;  4X8N A;  3KS7 A;  2QFE A;  4ASL A;  5FZ3 A;  2JDU A;  2BNO A;  2A7A A;  3ZFF B;  3R0R A;  5CG8 A;  3AK0 A;  1CES A;  1Y9Q A;  3SEP A;  1QJX 1;  2F6B A;  4E4S A;  1RUC 1;  1RUE 3;  1N3P A;  3J9S A;  3N9Q A;  2ILM A;  4RA0 A;  4L97 A;  5FO9 B;  1YHF A;  1HB2 A;  3WV6 A;  2DFB A;  5A3U A;  3M3O A;  4IGP A;  3Q8B A;  5FZM A;  4YW6 A;  5I0R A;  4JGZ C;  4XQD A;  1UPI A;  1POV 0;  2HWD 3;  5A3O A;  4ZPI A;  4JTO A;  2OPW A;  4N53 B;  4XTM A;  3WQ7 A;  4DZG A;  2Q8C A;  2G1M A;  2ZJC A;  1QJF A;  4LUM A;  4XUP A;  4OHV A;  4DUW A;  4Y22 A;  4WM8 A;  1HXS 1;  2FHR A;  3I4I A;  4YM1 A;  3S6P A;  1IPK A;  4ATE A;  3VDB A;  3E97 A;  5EJ3 A;  1COV 1;  1UU5 A;  4CEY A;  4QM8 A;  1IG3 A;  4P9L A;  1POV 3;  4BDV B;  5HXV A;  5JSP A;  1UWW A;  3MEP A;  4YVS A;  5FWE A;  4P9X A;  4YZ1 A;  4JRA A;  2B7Y A;  1NLR A;  3LDK A;  3OY8 A;  4HKO A;  3U11 A;  4BCU A;  4YVW C;  4KH9 A;  2ZEY A;  4QPY A;  4D3W A;  3USU A;  4R4X A;  5C5T A;  5FZ6 A;  3NMB A;  4Q0S A;  3SC7 X;  1VAM A;  1WCU A;  3N9P A;  4MVT A;  1HRI 3;  1NZC A;  4ZS2 A;  4YW5 A;  3S5Q A;  4BMB A;  3TYJ A;  3BYW A;  3VBH C;  2EIC A;  2NYY A;  4XFB A;  4HZF A;  3FUO A;  1KDM A;  4RR3 A;  3RVH A;  3VZO A;  1E5R A;  3MW4 A;  3AVS A;  1HRI 1;  4QQL A;  1HX6 A;  1OD3 A;  2DFC A;  2ZGN A;  3KZ4 C;  3OD0 A;  4MLO A;  2BV4 A;  3AX4 A;  1VMH A;  4JCK A;  3LQC A;  2ARA A;  4DPN A;  1J84 A;  3Q9O A;  1LR5 A;  5LB6 A;  4O9E A;  4YFW A;  3POS A;  3H1M A;  1BZW A;  3T2O A;  1F9K A;  3THT A;  2Q8D A;  4GMP 0;  3PU3 A;  3UYJ A;  2W47 A;  4A4A A;  4HBN A;  5JOW A;  3N9L A;  2VG9 A;  4NHX A;  4S2H A;  3ROU A;  2X10 A;  3H1Y A;  3RNS A;  2ZZQ A;  2F17 A;  2DUP A;  3VGI A;  1CPN A;  4EZ4 A;  2VZS A;  2DUO A;  1B35 A;  3ZYJ B;  2DUQ A;  3VKM A;  1VBC 2;  4C0B A;  1AR6 1;  3MIE A;  4JRL A;  1J83 A;  1SLL A;  3M2M A;  5ABJ B;  4IEW A;  4OI1 A;  1UAI A;  2JDY A;  1NA1 C;  5L19 A;  4XFA A;  4CP1 A;  2OUJ A;  3FFZ A;  3POG A;  1O4Y A;  3AP4 A;  1VAL A;  4LBO A;  3TB0 A;  3HBZ A;  3T30 A;  2VVE A;  2HWB 2;  4F8A A;  3OBT A;  1HLC A;  1F5J A;  1URX A;  2YC2 A;  1VE0 A;  4JX0 A;  1AYN 1;  1PMH X;  1WBL A;  1QH7 A;  2JG9 B;  4L11 A;  1TME 2;  4YSF A;  1SPP B;  4LIT A;  1WCQ A;  1RIT A;  1QOO A;  2WUH A;  2ZAH A;  4R8H A;  3RGB A;  3ACL A;  2G9F A;  2MEV 2;  4XUR A;  2HWE 1;  1UYY A;  3RZZ A;  5JVV A;  4QQP A;  1WA4 A;  3WF3 A;  2VQ0 A;  5FP9 A;  1GZ9 A;  4TZD A;  1QNY A;  4DEV A;  3VBH A;  1CQ9 A;  2CWS A;  3WF4 A;  2ARX A;  2XQX A;  5FYT A;  3QCW A;  2JDZ A;  1YIF A;  4BJ0 A;  2D6K A;  5CKQ A;  1J59 A;  3N4M A;  2I2S A;  2HYX A;  1KIT A;  2VAU A;  2QDN A;  3AZZ A;  3T0B A;  2D6P A;  3NW4 A;  1NT0 A;  4N9I A;  5F3E A;  1RUF 1;  3HQR A;  1K3I A;  2ZOE B;  2OVU A;  5FP3 A;  4RS5 B;  1OC1 A;  2P1B A;  4KWU A;  4R52 A;  3VKO A;  5EZW A;  4CEY C;  2ZS6 B;  5B4N A;  4Q4V 2;  1AR8 1;  1PO2 1;  4QPI B;  2OQ6 A;  4FFI A;  3IBM A;  5DZE A;  4FTB A;  2WNV B;  4JQR A;  3VBU B;  4AFB A;  1UMI A;  3I2G A;  1RUF 3;  1W8H A;  2XQR A;  1H9W A;  3AKT A;  1QH6 A;  5DQ0 A;  1CAW B;  3POI A;  5EYY A;  1DCS A;  2GZW A;  1RL3 A;  1Q8P A;  4E9K A;  3VD4 A;  1D0G A;  1LAJ A;  5ABJ C;  1VLN A;  5C8C A;  4FT8 A;  1KJL A;  1S4C A;  3I2D A;  5KHH A;  2D97 A;  1AR6 3;  2WS9 2;  4JGZ A;  1UYZ A;  1MVQ A;  3WQB A;  2E53 A;  2OXB A;  2GH2 A;  3JZV A;  2GNB A;  4FAH A;  3LDB A;  4Q4Y 1;  3KCY A;  4JDN A;  4IEP A;  4LKD A;  1Z7S 2;  4M0N A;  1QQP 2;  4L92 A;  1ZZC A;  2QE3 A;  4K40 A;  4XJW A;  4BOW A;  3ST7 A;  1QU0 A;  2I07 B;  3OUJ A;  4IGO A;  5F37 A;  1WME A;  3NQH A;  4JGY B;  4LHK A;  4UT5 A;  1O3Q A;  4ZXK A;  2IUW A;  2ES3 A;  5EWS A;  3I97 A;  4CP2 A;  3TEW A;  1OPO A;  3N7K A;  4RHV 1;  4J1W A;  5GJ6 A;  3A4U A;  2WNV C;  4MV2 A;  2JJ6 A;  5EHD A;  4LOS A;  2FDK A;  4A44 A;  1YEW A;  4P00 B;  2IXL A;  1ULG A;  4QDS A;  2PLV 1;  2ZGT A;  2ZGK A;  1OI6 A;  1OBN A;  4N9H A;  1EV1 1;  4LHN A;  4HVR A;  1K5M B;  2WBK A;  5JCT A;  3RYK A;  5F2S A;  2LRP A;  4PDW A;  2ET1 A;  5F9T A;  5FV3 A;  2XWB B;  3KVB A;  3CJI A;  2H0B A;  3EJK A;  1JZ7 A;  3DPR A;  4C8D A;  2XJR A;  2ZGU A;  5ACA 2;  3SQO A;  4PHZ A;  5KHI A;  4CXY A;  1DLC A;  5EP9 A;  1AYM 1;  1ZBA 1;  2PHD A;  2A5Z A;  3ZFE B;  1OT5 A;  2PLV 3;  3LFI A;  5A3M A;  1WD4 A;  2EIG A;  3GBG A;  1YQ8 A;  2ZCW A;  4GAL A;  5FZF A;  5FO7 B;  4E4Z A;  5IW0 A;  3WW3 A;  4OQ8 A;  4NID A;  4YGE A;  4CCJ A;  1O8S A;  5L9B A;  4YW3 A;  1SCS A;  1ODN A;  2CTV A;  2E26 A;  4CU9 A;  1YFY A;  4A7Y A;  1X36 A;  1QF3 A;  2ZGL A;  1GWL A;  4EWE A;  1JHN A;  4CXW A;  1SLI A;  2W92 A;  2YPJ A;  4QD2 A;  1SLC A;  5CG9 A;  4Q0V A;  5BNP A;  3JUU A;  1FOD 2;  1UOB A;  2ZGO A;  3TOJ A;  2WS9 3;  1H6X A;  2J42 A;  4LKE A;  2K9Z A;  5ANQ A;  4QX8 A;  3K46 A;  3RFR A;  1MQT A;  3ZSJ A;  2JG8 A;  4Q4Y 3;  3T0D A;  2FDF A;  2GC3 A;  1JYT A;  1SCR A;  1FPN 2;  2CU5 A;  2Z42 A;  3WCR A;  5FZL A;  3ZXJ A;  3U0Z A;  2CY6 A;  5FYH A;  3KD4 A;  4K7J A;  4AG4 A;  4AFA A;  4LK7 A;  4BQ2 A;  1D4M 3;  2H6C A;  4B7E A;  2Y64 A;  1SEF A;  2YRO A;  4IEX A;  4I2O A;  2VU9 A;  2CAU A;  3EO6 A;  1CVN A;  3ZX7 A;  1VMJ A;  3LFM A;  3D8C A;  1F15 A;  1V6I A;  1V6O A;  5EIY B;  2R04 2;  3M3E A;  4U36 A;  2O8Q A;  2WO1 A;  3R4S A;  1PHM A;  5FZK A;  3RZL A;  3U4S A;  4W65 A;  1O5L A;  4TWT A;  1RJ8 A;  1XB9 A;  3PNA A;  2Y38 A;  5LA2 A;  3WY6 A;  1GNZ A;  3G6J B;  3UKT A;  5FLJ A;  1CPM A;  1DYK A;  1LEN A;  1GZC A;  5FYB A;  3FMG A;  3A23 A;  5D21 A;  4GH4 B;  4Y1Y A;  4ET7 A;  1N1Y A;  2Q4S A;  3VDD C;  4N43 C;  2E6V A;  5JXG A;  5K0U A;  5KC6 A;  1HRV 1;  3III A;  1WBF A;  4D7Y A;  4GMP 3;  1W04 A;  2DU1 A;  4LPL A;  1YQ2 A;  4YG3 A;  4R4Z A;  1PO1 3;  1U5I A;  2FMY A;  4CCO A;  5GLZ A;  1VB2 A;  3D5O A;  1J3R A;  3SKJ E;  3AB0 A;  4IQP A;  5FMO S;  1MZF A;  2HWE 3;  2G9Z A;  1AL0 G;  1BEV 1;  3PVN A;  2CL2 A;  3B02 A;  2RMU 1;  1ACC A;  2KM2 A;  1U5Z A;  2XB6 C;  1UYP A;  3KLS A;  3RSJ A;  3H8U A;  5KHK A;  1GZT A;  3BGA A;  1XNT A;  4MHU A;  2DCK A;  1W9Y A;  4RS5 C;  4CEW A;  5K7P A;  1BBT 3;  1OH3 A;  5FY4 A;  4JKM A;  4WVM A;  4OI2 A;  3H8R A;  2VZR A;  4K9S A;  5F3G A;  1UO9 A;  2XVL A;  5EPA A;  1RUN A;  4CDX B;  5EJZ B;  2GND A;  1UNB A;  3ACG A;  4QPI A;  1C28 A;  4IEY A;  2XL9 A;  2OUH A;  1S0E A;  2YXS A;  4AGR A;  3D6E A;  2LUW A;  2PQS A;  4QHO A;  5T5L A;  4WM7 A;  3VBS A;  2JG9 C;  4BXF A;  3U4X A;  3RZK A;  1WUV A;  3CJI B;  4QX0 A;  4Y20 B;  1H4H A;  4MXW A;  2WT2 A;  5IHR A;  5FY1 A;  5FY8 A;  3RMX A;  2DVG A;  4A2U A;  4D6S A;  2D40 A;  3H3L A;  2J1V A;  4EN9 B;  1VR3 A;  2Y34 A;  1RUO A;  4QXB A;  5M0T A;  3I59 B;  4IEZ A;  1W0O A;  2JD4 A;  4FOV A;  4CSW A;  1J3Q A;  3O14 A;  3WSO A;  4RN5 A;  2XKP A;  1H8T B;  3VL9 A;  1WW7 A;  4QKN A;  5FKC A;  1PIV 2;  3DEM A;  1X82 A;  2VXJ A;  5I93 A;  2R0F A;  2IXJ A;  3AKP A;  4CP9 B;  5K9Y A;  1QOS A;  3QAC A;  2W1Q A;  2JE9 A;  3K3N A;  2A71 A;  4QX1 A;  2A3W A;  3WHU A;  2ADE A;  4CDQ A;  4W8J A;  1A6C A;  5FOB B;  1ZZ6 A;  2D6L X;  4CXX A;  2QZ3 A;  3M8L A;  4OLL A;  3VBR B;  4KL1 A;  2BZD A;  4BYY A;  4QQO A;  4LLF A;  2DU0 A;  4FAG A;  1QXJ A;  3K51 A;  2JEC A;  3BTX A;  3LEG A;  1R1A 1;  3ETQ A;  5GZG A;  2FCU A;  4M4R A;  3POB A;  2ZMK A;  3WXP A;  4EN8 B;  4JKL A;  1ZBE 2;  5A7N A;  3SHR A;  1QDC A;  2RM2 1;  1OA2 A;  3NNM A;  1C5I A;  1RGS A;  3NJV A;  5J1X A;  5JZG A;  5FP4 A;  1OSG A;  5A1A A;  5C8W A;  2OW4 A;  2VD7 A;  4UW5 A;  5F5C A;  2ZGP A;  4NRO A;  2GC2 A;  2ARC A;  3U1X A;  5DAX A;  4QXC A;  4UFJ A;  4CU8 A;  5FPL A;  5FZO B;  4AI1 A;  4LQR A;  2YFU A;  2VUA A;  1RUD 1;  4XJ8 A;  4B4P A;  3W5M A;  2D5H A;  3OJB A;  3FE5 A;  2LS6 A;  3P5B A;  3VBR C;  1VRH 3;  1MS5 A;  3I2I A;  1RHI 3;  4PI0 A;  4LBQ A;  3WCS A;  5BXX A;  5IK4 A;  4AI2 A;  2JIJ A;  2UY9 A;  5EQU A;  2VR4 A;  1XU2 A;  4HOO A;  4FO9 A;  3W20 A;  3VBH B;  1ND2 B;  2E33 A;  4NE9 A;  2LTN A;  4Q4V 3;  4AVC A;  1IPS A;  3CKH A;  4F7Z A;  4LLO A;  1W2N A;  5IVV A;  1RUG 3;  2QQK A;  3N9O A;  3D4K A;  2QQN A;  1CIW A;  1W8F A;  4QKF A;  3E6C C;  5CB7 A;  3KT1 A;  1X9P A;  4CDU A;  4QB1 A;  3H9A A;  2BP6 A;  2YUE A;  1PO1 1;  1SPP A;  3JD7 1;  4OZO A;  5FP8 A;  3UKV A;  4NII A;  3GCW A;  4DY5 A;  1H2K A;  5FP7 A;  3V64 A;  4XBN A;  3HMY A;  1BMV 1;  4M3C A;  1J3P A;  2PFW A;  1ULE A;  1WLT A;  2C5D A;  4I01 A;  2RR1 1;  1GWM A;  1EUT A;  1FAY A;  3ILR A;  4LBK A;  5FRE A;  1NXM A;  1DQ0 A;  2F4P A;  1DGL A;  1GQG A;  3WNP A;  4S2D A;  1JYV A;  2TUN A;  1QQP 3;  4CVU A;  2FBE A;  4P9W A;  5J36 A;  1LOB A;  4N43 A;  4QX2 A;  2WQ8 A;  5APA A;  4J6G A;  1W2T A;  2VZP A;  5CAZ A;  1S2B A;  5FJK A;  1PNG A;  5DUU A;  4LBQ D;  3SIS A;  3N7L A;  4NAO A;  4YVS C;  3RRD A;  5JOY A;  1DYP A;  5JXH A;  1WLW A;  3LD8 A;  2PLV 2;  4MSV A;  2HWC 3;  4Y4Y A;  1XC6 A;  3HQX A;  1YFX A;  4YPJ A;  1RUI 2;  3RG0 A;  3I3E A;  4CPB A;  1FNY A;  1ULP A;  4D7S A;  2K46 A;  1ULC A;  4V2V A;  4DXR A;  2E32 A;  1AL2 1;  3PMS A;  3LOI A;  3UGH A;  1QHD A;  1RUE 1;  4M00 A;  5HCB A;  3AMH A;  3BAL A;  2BU9 A;  1OQE A;  1SLB A;  3KF5 A;  1OHF A;  2V73 A;  4GB3 1;  4IV3 B;  5DN2 A;  2AH2 A;  4R9C A;  2XLF A;  5CIS A;  3P1I A;  3T2T A;  5F32 A;  3LF7 A;  2ZGQ A;  2Y6K A;  4H2A A;  1ASJ 3;  5A32 A;  5FY9 A;  1G9B A;  5FZ9 A;  5FPV A;  4LE3 A;  4AZZ A;  3HQU A;  2EAA A;  5FZ7 A;  1GNH A;  1MQT C;  5FZ8 A;  2VMD A;  3AXE A;  3PME A;  2OYZ A;  2D6O X;  1DF0 A;  1AXK A;  1OOP A;  1BK0 A;  1OH4 A;  3FN9 A;  3ILF A;  4ORF A;  2NMN A;  3S5A A;  3B9C A;  1W90 A;  2A6Y A;  4HSJ A;  5ERL A;  5DXD A;  2P6C A;  3DN7 A;  3HT1 A;  1D4V B;  2VE1 A;  3NV3 A;  3JB8 A;  2ET7 A;  2XBO 1;  4OFG A;  3OEA A;  5J98 B;  2DBN A;  3RYR A;  1HB4 A;  1NAE A;  3L2Y A;  3RI8 A;  2UYB A;  4Y4R A;  1MAC A;  5LCW L;  2YB7 A;  3TBD A;  5BNQ A;  5CKM A;  4CCN A;  3JQX A;  1UF2 C;  3KSC A;  1ZBA 2;  2D7F A;  3K4Z A;  1WCK A;  1WLD A;  1UY2 A;  1W8W A;  4XC9 A;  3WQ1 A;  3OBZ A;  4IEV A;  3IMM A;  3T2Q A;  3B7M A;  3WDY A;  3OYW B;  4RQP C;  4DEQ A;  1HDK A;  2MHF A;  2VW0 A;  3VZL A;  3IKW A;  1RUH 2;  1C8M 2;  4XIK A;  2WFF 3;  3LA2 A;  2UWA A;  1J58 A;  1J1T A;  1O59 A;  1W8U A;  1UU4 A;  1W9T A;  4MGY E;  1GAN A;  1Q8V A;  1IS3 A;  3M1H A;  4UFL A;  1UY3 A;  3A0N A;  2ATF A;  1KFX L;  4OHZ A;  3AL6 A;  3BU0 A;  3C8X A;  1H1A A;  3KGL A;  3ABZ A;  1Z0H A;  4NIH A;  3ECQ A;  4E4H A;  2P5B A;  1UY4 A;  2PXJ A;  1CAU A;  5FAX A;  1IS4 A;  4XPV A;  5FZG A;  4QU2 A;  3BVC A;  2AZ5 A;  1HXS 2;  2A3Y A;  2V5D A;  4N7I A;  2WSU A;  3RWN A;  1COV 2;  3EBR A;  3LOB A;  3OF1 A;  3GYD A;  4XCA A;  1GP5 A;  2Q0A A;  1NCQ C;  2K2S A;  1XBF A;  3WP3 A;  1A78 A;  4CPB D;  2RS3 3;  4RQP B;  3ZXF A;  1H30 A;  3H50 A;  1EAH 1;  5FK8 A;  4R9A A;  4CDX C;  5BNN B;  2VQU A;  3MV0 1;  3NAP A;  4E2Q A;  5FYU A;  4QU1 A;  2JWP A;  1LKN A;  5JZG B;  1JOJ A;  1RUE 2;  2QQJ A;  5C5U A;  4YM3 A;  2WO7 A;  5CVR A;  4XIL A;  3F95 A;  2B5H A;  2JDH A;  1PMI A;  1JYC A;  1V6K A;  1US2 A;  1JU4 A;  1YRZ A;  1W6O A;  3OB8 A;  4I02 A;  4A3X A;  4NIG A;  2OS2 A;  5HCF A;  4AFM A;  3R05 A;  4CTE A;  3SEE A;  5IVF A;  3MPP G;  2JDK A;  4KG0 A;  1Z78 A;  5KXE A;  4KU8 A;  3C2U A;  4I0A A;  2WNO A;  4AGV A;  1LEM A;  1X8E A;  4P5Y A;  1OFN A;  1Q5O A;  2RJL A;  2TNF A;  1Q8Q A;  5FZD A;  1ZRF A;  4XJZ A;  5JI7 A;  3RI9 A;  3POW A;  2G9G A;  2FQP A;  1UL9 A;  1US3 A;  4ZHN A;  1AR8 3;  1PO2 3;  1PGW 2;  1AZD A;  2KD7 A;  4FQ4 A;  4P14 A;  5A3P A;  1RB8 G;  2KA3 A;  3B94 A;  1QJX 3;  1UQX A;  1BQP A;  4QWN A;  4GD4 A;  5IFP A;  5CFD C;  3WQ0 A;  4CDU B;  4XFC A;  2RDR A;  5FLI A;  3NKG A;  3VZJ A;  4K3U A;  4MGS A;  2VUC A;  1H2L A;  1WZX A;  4LO5 B;  2P3I A;  1XPW A;  1AX2 A;  2YDE A;  3UKN A;  4NVP A;  4LNV A;  5JPN B;  2QQU A;  3AYA A;  3ZN6 B;  2HWD 1;  1MS3 A;  3U37 A;  1MVE A;  3MIH A;  1AR7 3;  2Y0I A;  4XQ4 A;  5A6X A;  2J1T A;  4UW6 A;  4CEY B;  1NE4 A;  3FHA A;  5FZ1 A;  3O1P A;  1W39 A;  4OI0 A;  1W2U A;  5F6K A;  1R1A 2;  2RG4 A;  4HLT A;  1GSL A;  2JDA A;  3POE A;  4FPL A;  4P9Y A;  1NLS A;  3WDU A;  4E2G A;  4CUC A;  1KS4 A;  5FXV A;  3T2P A;  2BBV A;  3C7G A;  5LBE A;  5A7P A;  1PGL 2;  4LR4 A;  3PDQ A;  1PVX A;  5J3U A;  5T5J A;  5DUX A;  3JU9 A;  5FQ0 B;  5A7O A;  5FOJ B;  5LA9 A;  3KT7 A;  1WW5 A;  2DVD A;  1NA1 A;  1RVF 2;  3PJQ A;  1SLA A;  2O8O A;  4DRR A;  4WZC A;  4BPZ A;  4MOA A;  5EJ1 B;  4AHZ A;  2E7A A;  1MZE A;  1ZNP A;  1YFW A;  2Q8E A;  5HXM A;  3IDE A;  1QJX 2;  1DQ6 A;  3JD7 2;  4FFF A;  4TYS A;  1AYN 3;  3ZFF A;  5F8P A;  4AQT A;  2RDN A;  4N90 A;  1JW6 A;  2WN2 A;  1LED A;  2PEL A;  4UFH A;  2PQQ A;  1F4H A;  1JTZ X;  1S0B A;  5FUP A;  1TQ5 A;  3OGV A;  3PUH A;  3ZPO A;  4NPM A;  3FL7 A;  1H1M A;  3RMY A;  3V65 A;  4MG2 A;  3NST A;  3NV1 A;  4JV4 A;  4C1W A;  3SH5 A;  1PK6 A;  4Q5O A;  3H7Y A;  4QXH A;  4YG0 A;  3I2F A;  2B8M A;  3AMN A;  1MS0 A;  2ARE A;  3LB9 A;  4U2A A;  4RQP A;  1DIW A;  3JQW A;  4DMI A;  1UPS A;  1RUC 2;  2GME A;  1NQD A;  2UY8 A;  4Y5S A;  4B29 A;  4I0B A;  3ZN4 A;  1VBC 1;  2D3R A;  2YFZ A;  2R06 1;  3DYM A;  3RZH A;  4AVA A;  5DAB A;  3GDB A;  4EZH A;  2CNA A;  3OPW A;  2P3K A;  1N3Q A;  3OD4 A;  4M4P A;  3VN4 A;  1DG6 A;  1RMU 3;  1QMJ A;  4UI9 L;  2VOT A;  3BUC A;  1PIV 1;  3AMP A;  4KNC A;  2A6W A;  4X8P A;  1UXZ A;  1W6O B;  4WM7 B;  1H1I A;  3VBS B;  2Z2S B;  1CAW A;  1V6M A;  2R49 A;  4LBM A;  5FUN A;  5I0D A;  1U5X A;  3H0O A;  2VZ3 A;  2XBO 2;  4UBH A;  2W46 A;  3LIG A;  4JGY C;  3ZDV A;  1ZRI A;  2B9V A;  4ZU7 A;  1WWY A;  4ZS3 A;  3GGL A;  2HWF 2;  4AVS A;  1LOD A;  3BN6 A;  4BWO A;  1F31 A;  3M4F A;  3BKZ A;  3ZXE A;  2VOX A;  1YUD A;  1BCX A;  1W6N B;  4FPK A;  3NL1 A;  3ZYR A;  5HCA A;  4I09 A;  4WVV A;  2VVF A;  4G4F A;  4Y26 A;  1ULO A;  3I3B A;  4XXA A;  3V56 A;  1G8W A;  5CIR A;  3VBO C;  1Y43 B;  5FIX A;  1U5Y A;  2VTX A;  3IB3 A;  3OY8 B;  2DCT A;  2W2I A;  5LWB A;  2GH8 A;  2RVA A;  3H7J A;  3LSE A;  5IUQ A;  1X50 A;  1DQ4 A;  4P5H A;  1GMM A;  4NHY A;  4PIX A;  4A7K A;  3E1F 1;  1VBB 2;  1OF3 A;  4XDQ A;  1G9A A;  3UNP A;  3PIG A;  5DUW A;  3O7O A;  5I0U A;  5GZC A;  3WNL A;  2QZ2 A;  1RHI 1;  2VTF A;  2IWG B;  1Y4W A;  4AI3 A;  4IET A;  3BPS A;  4Y5T A;  3KWV A;  2VMF A;  2B46 X;  3S7E A;  3ZXD A;  4C90 A;  1Q3E A;  2XJU A;  5FXZ A;  4OMD A;  4B1L A;  1LHO A;  4Q2F A;  4QT6 A;  1JUH A;  5G05 L;  1K45 A;  3WP4 A;  3FBY A;  5E88 A;  3J26 N;  2X5I A;  5IAV A;  1LHN A;  4H7M A;  1TE1 B;  3ZVX A;  4CU7 A;  3IDC B;  4YM2 A;  1CX1 A;  3WP5 A;  3ZOI A;  3APB A;  1WCS A;  1YLL A;  1JN2 P;  2GMP A;  3JB4 C;  4OUS A;  2JE7 A;  3OOX A;  4WVW A;  1SAC A;  3OEB A;  3ZYB A;  2CGP A;  1ZBA 3;  1RVF 1;  2Z4F A;  1I5P A;  4G3Y C;  4LKF A;  4XUN A;  3CU7 A;  4GA9 A;  4AI8 A;  3IPV B;  2X09 A;  4Q27 A;  4P9J A;  5K0U C;  5GM0 A;  5FLH A;  1HQL A;  5AFE A;  1GBG A;  4FP2 A;  5FZH A;  4PBO A;  3VHR A;  5LY2 A;  4CDU C;  4LIV A;  4Y33 A;  4OZX A;  3R6S A;  1LOE A;  1GP4 A;  4CDW C;  4FTS A;  1YJL A;  1B09 A;  2VNV A;  5FPZ A;  5A70 A;  4DIN B;  1GWK A;  1XNK A;  3GBW A;  2WZE A;  3WNM A;  2RV9 A;  3W5N A;  1V0A A;  1NLQ A;  4ARY A;  2B4K A;  4NRQ A;  5FYI A;  5A33 B;  2YV8 A;  1QJU 2;  3PU8 A;  4PBP A;  1QXR A;  2JIG A;  4BU2 A;  4PF1 A;  4N43 B;  2WL1 A;  1IS6 A;  1O7F A;  1W2A X;  2RS5 2;  3ACF A;  3CJX A;  2YGL A;  2NQY A;  3VL8 A;  4HK8 A;  1FOD 3;  2BVV A;  2XON A;  3CEW A;  4UOJ A;  3SIT A;  5DAP A;  4MAD A;  1MS4 A;  4D7T A;  3WOG A;  4CDQ B;  5JOX A;  3A21 A;  3AVR A;  1H0B A;  2OZJ A;  2XJQ A;  3KMH A;  2JEM A;  1ENR A;  2GN3 A;  5JI9 A;  4IEQ A;  3WUC A;  3CNA A;  4BQ3 A;  5FPB A;  1FOD 1;  3O1U A;  1RED A;  5T5P A;  4M0H A;  4OQ9 A;  5JZG C;  1OF4 A;  4COU A;  4HFS A;  2P3Y A;  4LOR A;  3RWK X;  4Y1Z A;  4PLM A;  2BOI A;  5BY5 A;  3ES1 A;  2XPJ A;  1YC6 1;  1JS9 A;  2R04 1;  4URA A;  3HR9 A;  4NR1 A;  1JUI A;  1E5I A;  2OA2 A;  3ZYF A;  3POF A;  1MPX A;  1JI6 A;  1NCQ B;  4AL9 A;  5L7O C;  3JD7 3;  3DKQ A;  4BLI A;  1R09 1;  1WGP A;  2JXA A;  4NRM A;  4GXL A;  5GLW A;  1ZRR A;  1ZRC A;  3GAL A;  3MZH A;  4IER A;  4NPL A;  5FZE A;  3O1M A;  3RJR A;  3KB5 A;  5IK5 A;  3ZN6 A;  3KGZ A;  1F4A A;  3O5S A;  4Q4W 3;  1UKR A;  2RJ2 A;  3K77 A;  2OT7 A;  3BIE A;  5FMC A;  2NLR A;  3GM8 A;  5LBF A;  5JIU A;  5DG1 A;  3VUO A;  4LJH A;  4QGM A;  4XF1 A;  1WD3 A;  4PDW C;  1XE8 A;  4AYU A;  4ITC A;  4F83 A;  2EXI A;  1R09 3;  1V00 A;  4IE4 A;  2Y26 A;  3B01 A;  3MIC A;  4MO3 M;  5JXI A;  1W8Z A;  5LA0 A;  1PGL 1;  1CD3 G;  2BFU S;  1ASJ 2;  4WVZ A;  2W0X A;  3CIH A;  2AUY A;  4FTE A;  2EVX A;  3H42 B;  4BXS V;  3WW4 A;  1ZYB A;  4KBB A;  5FWJ A;  5FXW A;  2WKK A;  4XMA A;  2RMU 2;  1OVP A;  2D44 A;  1APN A;  2JEN A;  2D5F A;  4LMF A;  1AF9 A;  1NKG A;  1FV2 A;  1QWR A;  3OTF A;  3NNF A;  4AHX A;  4D6R A;  2FD8 A;  3QLQ A;  1UY0 A;  3NNL A;  3WP6 A;  2W1U A;  4WM7 C;  3VBS C;  2RS5 3;  1FI2 A;  3NKT A;  3U07 A;  4KGG A;  4XHX A;  4NWV A;  4PCR A;  4LXL A;  3ZIX A;  1VRH 2;  3TN9 1;  1UOG A;  1UZW A;  3M3I A;  4H3W A;  1WMX A;  2A6V A;  5DDJ 3;  4AHY A;  4QXK A;  1K5M C;  5CFC C;  5IK8 A;  3ZR5 A;  4MX3 A;  5LK5 A;  1FV3 A;  4UBG A;  4AED C;  1MEC 3;  2YBP A;  5LBB A;  5IFT A;  1ZVF A;  4W50 A;  3VDA A;  3C7O A;  2EAL A;  2G19 A;  4GIQ A;  1W6Q A;  2J1U A;  4AE2 A;  3VV1 A;  1LEC A;  4NWW A;  4PF5 A;  2PHR A;  2VTX J;  3ZO0 B;  2XWJ B;  3LEI A;  3PUQ A;  3ZPY A;  4XAE A;  5B2G B;  4XOG A;  3I2O A;  3HT2 A;  2EID A;  3UGF A;  3Q8A A;  2VCC A;  1V9U 3;  1UMH A;  4XF3 A;  5A7Q A;  4A6S A;  1QY4 A;  4K8F A;  1ONA A;  4LA3 A;  1LHW A;  2HWC 1;  3OPZ A;  4IV3 C;  5FYZ A;  3WF0 A;  2YC0 A;  1L3J A;  3ZDS A;  4AWD A;  5KHJ A;  4RGA A;  2MEV 3;  2Q8O A;  1ZZ8 A;  2E7T A;  2X29 A;  4GH4 C;  1CON A;  5CFD A;  1TMF 3;  2C1F A;  1H4G A;  3AMQ A;  2WN3 A;  3UJQ A;  1FAT A;  3LDR A;  3DYP A;  5BUV A;  1TZO A;  4IEU A;  3CO2 A;  5IVB A;  5IVC A;  1ULF A;  4Y1U A;  3NJX A;  3SXW A;  1W8T A;  1CIY A;  5D8A B;  5FZC A;  3VKN A;  1NY7 1;  2VMG A;  2NM1 A;  1W05 A;  3FBM A;  4QB2 A;  2BFU L;  1E5H A;  2VZQ A;  1F35 A;  4I0W B;  3WG3 A;  2X53 S;  5L7O A;  1NXD 1;  1A8M A;  5J7M A;  5C4W C;  5LAT A;  1IOA A;  1W9W A;  5AFB A;  1AR7 1;  5C71 A;  1N1S A;  3QOP A;  4AF9 A;  3HBK A;  2ETE A;  2EIB A;  1BK1 A;  2AEN A;  3CZU A;  4AQS A;  2TEP A;  5FRA A;  2BW8 A;  4RGK A;  3JBG 1;  5GZD A;  4XBL A;  3K3O A;  2BPA 2;  1AL2 3;  1FMD 3;  5CA6 A;  2IVI B;  1NCR B;  3T09 A;  1ALY A;  5FZ4 A;  4LIU A;  4NRP A;  1CN1 A;  4Q0U A;  2PAM A;  2BGP A;  1GYK A;  3P6B A;  4Z8B A;  3NRU A;  3OCP A;  5FO8 B;  5IAT A;  4RFT 0;  1BMV 2;  4XTP A;  5FR3 A;  5LBC A;  2WNU C;  3K48 A;  3MUY 1;  3SH4 A;  2B39 A;  4FXG B;  2RM2 3;  1TME 1;  5FUI A;  1VBB 3;  1QXP A;  4QQH A;  2W08 A;  3KF3 A;  2ZX2 A;  1DYO A;  3SLI A;  2HEY F;  3SCG A;  3EHK A;  1POV 1;  1O3R A;  1RMU 1;  2DUR A;  4MGI E;  2DTY A;  2W52 A;  5IT6 A;  4MH0 E;  1CZT A;  2YPD A;  2Y8K A;  5E16 A;  3GZT B;  3VBU A;  5LEJ A;  3ACI A;  4D94 A;  4AGG A;  5BNO A;  2H0V A;  2PHU A;  2JKX A;  2R30 A;  4J25 A;  1HRI 2;  3DPR C;  4OI4 A;  3VD7 A;  3I54 A;  4L99 A;  1W0N A;  3B69 A;  1PX4 A;  2N7G A;  3FX3 A;  2VOK A;  5AC9 1;  1C3H A;  1ZM1 A;  2QQO A;  4YFZ A;  1FPN 3;  2ZKN A;  4Z2W A;  1OUX A;  2XKO A;  4RR3 C;  1OD5 A;  1LGC A;  1DBN A;  4QPW A;  3DV8 A;  4BHP A;  1RUJ 2;  2RMU 3;  3NV4 A;  4LK6 A;  3H1W A;  3USS A;  5JXJ A;  2X8K A;  4NAM A;  3WT3 A;  2BGC A;  5E8A A;  3CZJ A;  2A6Z A;  1RUG 2;  2X5I C;  4EE2 A;  2GNT A;  1YJK A;  3WUD A;  2EXJ A;  2FDI A;  2J1R A;  5BNO B;  2WDB A;  1IG0 A;  1MEC 1;  3MHZ A;  3MW3 A;  5I8Y A;  5JLV A;  4MGQ A;  3V0B B;  3MI8 A;  1DGW X;  1OUR A;  4IDZ A;  4TSV A;  5T52 A;  2Q5T A;  1FT9 A;  5FPA A;  4NJ4 A;  4QQ2 A;  2VMI A;  2GMM A;  4HPK B;  4AFD A;  4KWK A;  1I1E A;  4QKB A;  2Y33 A;  3QBQ A;  4RHV 3;  4CE8 A;  4HVQ A;  2EXK A;  3TAY A;  3I3D A;  2WYS A;  2XOM A;  4G9S B;  4ES9 A;  1MS9 A;  2MPF A;  2I74 A;  5F5Q A;  3U14 A;  5ABJ A;  3TNP B;  3EB7 A;  3NV2 A;  2GAL A;  3RS6 A;  2R07 1;  3KV5 A;  4HL0 A;  4UWD A;  3NNG A;  2CYF A;  4XJA A;  1GR3 A;  3W59 A;  5E6H A;  4PLN A;  4XIO A;  1RUI 1;  3K4D A;  3WNX A;  2HKX A;  2MNG A;  3DKW A;  1QJU 3;  1FNZ A;  4P9I A;  3N36 A;  3SH3 A;  2IXC A;  2V4V A;  4IL7 A;  3A22 A;  3NJY A;  1ND2 A;  3ETP A;  4JGY A;  2YMZ A;  4PIZ A;  4UF0 B;  1VAV A;  4XYX A;  4HKL A;  2W3J A;  1PVC 2;  2CDO A;  3PVB B;  1W8O A;  1PX3 A;  2DBI A;  4GJY A;  1MS8 A;  4Q1P A;  2GN7 A;  1G9C A;  1CJP A;  2VM9 A;  3C3V A;  2A6X A;  1W3X A;  2BBA A;  3LIH A;  1AYM 2;  5GLT A;  5LZ6 A;  2AC1 A;  4FPJ A;  1TEI A;  2QNK A;  4L8Q A;  1VB4 A;  1WLC A;  2YHJ A;  1NX9 A;  2YC4 A;  3IM0 A;  5C3P A;  5C7G A;  3AFG A;  1VBE 1;  2P34 A;  5JPM B;  2QDR A;  3ZKU A;  2Y0O A;  2DCY A;  1LNS A;  4IE7 A;  1HJG A;  1L7Q A;  3PUR A;  4EN0 A;  2XJP A;  1QKQ A;  2WFF 2;  1R09 2;  2QVS B;  2OKX A;  5FY7 A;  4JKK A;  5C9A A;  2FCV A;  1MQT B;  2VMH A;  3CDZ B;  3CF6 E;  4M3C E;  4UW4 A;  2VO5 A;  4W6Y A;  1WMD A;  4MGZ E;  4R9D A;  1HN0 A;  2JDP A;  4DB5 A;  5I0S A;  1V6J A;  1W6M A;  3O1R A;  1DGW A;  4D8M A;  1E5S A;  1VBD 2;  1K12 A;  1SLT A;  2D3P A;  4IE0 A;  2VW1 A;  4E8C A;  3WZ1 A;  2HLE A;  4DUX A;  3DXT A;  1KGY A;  2BNM A;  2HBT A;  3E6D A;  3FHI B;  1JZ8 A;  4GQ7 A;  1ZRE A;  1IGO A;  3B9I A;  3GHM A;  2C6S A;  5L9R A;  5AC9 2;  3H8O A;  1JHJ A;  3LAG A;  1C1L A;  4Y20 A;  3NWK A;  1NE6 A;  4QX3 A;  1S0G A;  2DCJ A;  4QPG A;  3WF1 A;  3ME2 A;  1TG7 A;  2D3S A;  1O5U A;  3EQE A;  1AL2 2;  3AC0 A;  2A1X A;  1RC6 A;  4DO0 A;  2GNM A;  1H8T A;  5EXO A;  3C7E A;  3KV9 A;  1S1A A;  1QJU 1;  5EFU A;  1PNF A;  1S2E A;  4OHY A;  4HMZ A;  1UZV A;  3M70 A;  4K20 A;  4KU7 A;  4KMQ A;  5C4W A;  2XBO 3;  4OHW A;  4LT5 A;  4AVV A;  4CUA A;  2OPK A;  5A3L A;  5C3Q A;  1OPM A;  2Q1F A;  1DLL A;  3OPT A;  3WD5 A;  2AEY A;  2RS3 2;  4CA9 A;  3AFK A;  3NJZ A;  3T3Y A;  5ACA 1;  2ZX4 A;  3ZXL A;  3OGJ A;  3LPF A;  5L36 A;  3ZSK A;  1Y9G A;  1PK6 B;  1P8J A;  4RGG A;  2DCZ A;  4TN7 A;  1S0J A;  3WNN A;  1JBC A;  2VZU A;  2ZHL A; 
#chains in the Genus database with same CATH homology
 3O1T A;  3T4H B;  3O1U A;  2FDJ A;  4NID A;  4CXW A;  4QKF A;  3BTY A;  4MGT A;  4QHO A;  4ZS2 A;  3O1R A;  3O1P A;  4NRO A;  3RZL A;  5F8P A;  3RZK A;  4NRQ A;  3S57 A;  3RZJ A;  4O7X A;  4IE4 A;  3I3M A;  4ZHN A;  4CXX A;  3RZH A;  3S5A A;  4IE0 A;  5DAB A;  2FDH A;  3H8X A;  3I49 A;  4NII A;  4MG2 A;  3BTZ A;  4RFR B;  3BU0 A;  2IUW A;  4JHT A;  3I3Q A;  3BUC A;  4CXY A;  3KHC A;  2FDI A;  3BTX A;  4NIH A;  3O1V A;  4NRM A;  4NPM A;  3T4V A;  3KHB A;  4NRP A;  3T3Y A;  4OCT A;  3O1S A;  4IE7 A;  3H8O A;  2FDF A;  4NIG A;  4QKN A;  4IE5 A;  4IDZ A;  3H8R A;  4NPL A;  3O1M A;  2FDK A;  4IE6 A;  4QKD A;  4O61 A;  4NJ4 A;  4ZS3 A;  3O1O A;  3I2O A;  3BI3 A;  3RZG A;  2FDG A;  2FD8 A;  3RZM A;  3BKZ A;  3BIE A;  3LFM A;  4QKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...