3O2QB

Crystal structure of the human symplekin-ssu72-ctd phosphopeptide complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Symplekin
total genus 63
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o2qB01
1DRJA 4TN5A 1JFVA 1JF8A 4ETNA 1ZVVA 2R4QA 1LK0A 5JNVA 5CHYA 3OLVA 2LUOA 5IUNC 1GLGA 3KKEA 1DBPA 1P2FA 5TPZA 3C3KA 2GI4A 1E6KA 2KYRA 1DBWA 2L2QA 2QZJA 4IILA 3ROTA 2QVGA 3Q9SA 1FFGA 2HQOA 1EWVA 5IUJC 3RVLA 1BDHA 1ZY2A 5JNUA 3KG2A 3O2JA 3FFWA 3FGZA 5KC8A 2DRIA 4NV3A 1PUXA 1DCKA 3A0UA 4MYRA 3HUUA 3RVSA 1IIBA 1EFAA 4G0OA 1Z16A 2JBAA 2M1ZA 4PEVA 3LUJA 4RXUA 3LUFA 4G0YA 4LZLA 8ABPA 2QW1A 3LKVA 3HXMA 4RXMA 1OXKB 1LBHA 1VLZA 2LP4Y 1XWWA 3FFTA 2JB9A 3MQ4A 3LUAA 1D4ZA 5HQJA 3URMA 2LPMA 4UHJA 3O1IC 3EDCA 3H5TA 1JDNA 2HQBA 1P6UA 4JA2A 1PEYA 1JYEA 4RU1A 3JS5A 3JVIA 1Z13A 1J56A 1KRXA 1RPJA 2XDYA 3TD9A 3LUKA 3CU5A 3I45A 4MLDA 3LMKA 4YV7A 1KMIY 5FWXA 6ABPA 2V0NA 4OATA 3NBMA 4G86A 5HM6A 3VNBA 3NHZA 4FE7A 3N53A 3S99A 4OLBA 4HNSA 5KI6A 3CTPA 1GCAA 1D1PA 1ZESA 2GBPA 4PE5B 2WWVD 2E4UA 3CFYA 4HYEA 3G85A 4KREA 2ID7A 4RKRA 2PUCA 3N6VA 5FBHA 1DCMA 4JB2A 3ILHA 1PNTA 1JX6A 2YHAA 3KCNA 3OMXA 1ZAYA 1U8TA 4F11A 3RVPA 4RSMA 1ZHHA 4L85A 3OQMA 3FMVA 4NCAA 4EYKA 1U2PA 4B09A 4IF4A 3SG0A 4MQFB 5FWXB 1RZRD 4Z99A 2FVYA 3MM4A 5KQPA 3EJWA 3QLUC 4MQFA 1NY5A 3HM9A 1ZGZA 2QSJA 4MQEB 4Z4HA 4KQCA 1YVUA 4KQ9A 3H5IA 2FLKA 3O1HB 3DGEC 1BA2A 1DC7A 2F8SA 1JL3A 2IPNA 4OBBA 3IP7A 2CHEA 4MGEA 4ZMRA 2HJ9A 3UK0A 2FXIA 2CD7A 1FQWA 1TVMA 1Z17A 2WMYA 4MS4B 4IRXA 2A9OA 4ETMA 3H6GA 3I42A 1HEYA 5EWMA 1JYFA 2NT3A 4JP1A 4F06A 4KRFA 5JS2A 2R48A 3BRQA 4PYRA 3K4HA 4F3TA 2A9RA 4YWHA 4CBVA 4RY0A 5KQLA 2B4AA 4N03A 1URPA 5F64A 1K66A 1D5WA 3T8YA 2IPLA 2WJAA 3BREA 3CHYA 3QLVA 2W42A 3M9WA 3SQNA 2JVJA 3GRCA 4W5RA 4H3KB 1Y1LA 3RVRA 4F8JA 4IMJB 2QV0A 2PUEA 4MS3B 1YS6A 2QR3A 2GX6A 3Q7RA 4KK3A 3O2SB 5B3JC 2NT4A 4MLCA 2PLNA 2RDMA 4OLAA 1SXIA 3N8IA 3GL9A 3JPYA 3EODA 4MR7B 4YLEA 5BRJA 2L17A 3RVJA 3KLNA 4O1IA 4QYWA 4WXMA 3QEMA 2JVIA 2E4WA 3F73A 3CRNA 3F7NA 4IMIB 4RWEA 4MR9A 2WB4A 3SNKA 2HQRA 3GBPA 2FLWA 3H75A 3P9YA 2MSKA 4KPYA 1F4VA 3KYIB 4W5QA 3SAJA 4W5TA 1RXEA 2OQRA 1NXSA 2VK2A 3NNNA 4Z4CA 2MYTA 2HSGA 5GOTA 4ZMSA 1I3CA 1RXIA 3QX8A 2E4ZA 3RVMA 3KYJB 5EWJA 3MMNA 4EY3A 3HO1A 3QLTA 2FQXA 2I6FA 3QX9A 3TB6A 4XASA 1DCFA 4KMRA 4RDCA 2MYNA 2OENG 3JY6A 4O5AA 1USIA 3IP6A 3EQZA 1DJMA 1B00A 1F51E 2NZUG 3CZCA 3QLUA 2FMIA 3C6QA 5BR1A 2Q5CA 3H1EA 3JVDA 4RK5A 3M9XA 3QELB 5IUKC 1ISRA 2VUHB 2VUIB 3KLOA 3L6UA 5DKFA 3JTEA 5TQJA 1ISSA 4OTZA 3EULA 5ED4A 5T7BA 3MYYA 4N41A 1BVHA 3R0JA 3TMYA 3N0XA 1GUDA 1QP4A 1VPWA 2FKAA 1Z15A 4LDAA 5DLEA 1M2FA 2QXYA 1W25A 2LIVA 3HSYA 3QLVC 4NQRA 7ABPA 4XAQA 2FMFA 3A3KA 1Z26A 4KK4A 1YMVA 2BGGA 3OO0A 4RXTA 3EAFA 4YGXB 1MVOA 5TQ2B 4DN6A 1FSPA 4G0QA 5JS1A 5CNJA 5FWYB 3BRSA 4PZ0A 1NXVA 3MA0A 3KHTA 3OLXA 2PJUA 2A9QA 2NUBA 2FMKA 4MAAA 2PUAA 1KRWA 3EQ2A 1ABEA 3ROFA 5JNSA 2FEPA 2CHFA 3H5OA 4Y9TA 4P98A 1NXXA 5IEJA 1VRVA 2FMHA 1R8JA 3GBVA 4NICA 1QPZA 2PUDA 4MR8A 4P1ZA 1NXOA 3HS3A 4QYMA 1E6LA 1DC8A 1EAYA 5DCLA 2ZWMA 2JCGA 1H9CA 1AB6A 3C97A 1A2OA 3KJXA 3CG4A 3LUCA 5DTEA 1ABFA 4ZPJA 5C5EA 2RJNA 3O21A 4JOQA 3BBLA 5CNIA 4Z4FA 1QO0D 3GWGA 3CLKA 2MSWA 4TLMB 1QP0A 2P4UA 3UUGA 2L19A 3MF4A 4FB4A 4N47A 2JVKA 3OM0A 4H60A 3C3WA 1D2AA 4O1HA 3D02A 1A0OA 2FN9A 3EGCA 2N9UA 3HV2A 4KNYA 2IYNA 3HUTA 3IP9A 3H1FA 3I09A 1GUBA 1YS7A 2PAFA 2R47A 1AB5A 4RV5A 4PICA 1JWLA 1ZH2A 3D8UA 3HDVA 3H1GA 1P8AA 4MR8B 3N75A 4ETIA 3GT7A 4YRZA 1LJUA 2IDMA 4G0PA 4W5NA 5KWSA 5CNKA 2M98A 4L4UA 1XHEA 2R25B 2FN8A 3A10A 2JK1A 3HDGA 4YO7A 2CWDA 2GKGA 6CHYA 5I4CA 5KC9A 5IULC 4LDZA 2QVCA 1QP7A 1NTRA 3KSMA 1FFWA 1ZITA 1SD5A 5KQGA 2PE5A 5GQSA 1P6QA 1E6MA 4YCSA 3KS9A 4RS3A 1CEYA 1EHCA 3RVOA 2J48A 3JPWA 4KFCA 1USGA 1TLFA 1TMYA 4LE0A 4EYGA 3G1WA 4ZJPA 3FFXA 4MRMB 3GYBA 2IOYA 2AYXA 3CKMA 3W9SA 1ZN2A 4YS6A 3LFTA 3HVRA 4ML3A 1MAVA 3Q15C 5TQ0A 4DADA 5TPWB 3OLWA 4MR9B 2FEWB 1SXGA 3H5LA 4G97A 3O2QB 5EWLA 4G0ZA 1DP4A 5JNTA 4MS1B 3DLHA 3T95A 4EVRA 2RGYA 5D2CA 3QK7A 4GNRA 1QO0A 2NZVG 3NNSA 4MRMA 4Z4IA 2LBPA 4IGAA 1W9HA 2IPMA 2ZAYA 4RK1A 3RQIA 1TJYA 1D1QA 4RZSA 4ZYLA 4QICA 1C0EA 2E4XA 3HCWA 4N0PA 5TQ0B 4Z9AA 3RVKA 2PUGA 3IP5A 3O74A 4MS3A 3RVQA 3SY8A 3HZHA 1XHFA 4RY8A 3BILA 4WXEA 5TPWA 1LJLA 5KQMA 1APBA 4JASB 3E3MA 3O1JC 3KTOA 2WJWA 4WWHA 5E3JA 4KV7A 1CYEA 5TE9A 5IX8A 4LE1A 3OQOA 4EGSA 4E7OA 1ZDMA 4RK7A 1SXHA 4EUKA 3L49A 1K68A 1E2BA 2MYPA 1Z2EA 2FW0A 4LRQA 3Q41A 9ABPA 1JH9A 1PNRA 3H6HA 1QMPA 1JFSA 1CHNA 2H3HA 1YMUA 4S04A 2IPAB 1UDRA 4HNRA 4Q6BA 4D6YA 5DGCA 5JNWA 1EWTA 1YK0A 4H3HB 1RNLA 5IC5A 3GV0A 4Z0NA 5BRAA 1JLKA 2FEKA 3LOPA 2GWRA 1U2QA 1MIHA 3LKBA 1QQAA 4MS4A 5IEBA 2F8TA 1YK1A 2TMYA 3QELA 1USKA 3OM1A 4FE4A 3CZ5A 3CS3A 5EWLB 4G0MA 3UKJA 3OQNA 5BQ3A 2PUFA 1JBEA 1YIOA 3N0WA 1JHZA 4NCBA 1NATA 2IKSA 3QEKA 3DBIA 4XARA 4DQDA 4RY9A 3O75A 5T3YA 4YR7A 1GCGA 4EVQA 4MQEA 2ID9A 2PL9A 4WZZA 3TO5A 1DRKA 2JRLA 2E4VA 3I5AA 4G0XA 3H5VA 4LX8A 1DG9A 3IDOA 4W5OA 4S05A 1BDIA 3Q7TA 4WT7A 4EYOA 1QQBA 1ZGGA 2AYZA 2QU7A 3CNBA 4Q7EA 3NNDA 1BAPA 1M2EA 1SRRA 4LE2A 1VKRA 1Z25A 4XXHA 3C3MA 3OLYA 5EWMB 5C5CA 1L5YA 2FTKE 1NXTA 1PEAA 1RZRA 4OG2A 4Z4GA 3IPAA 2WY2D 4MR7A 2PKXA 1MB0A 3LUGA 4EVSA 2B1JA 1JDPA 2FQWA 2YHBA 4M88A 4MPTA 4KVFA 2PMCA 3IPCA 4XFKA 3VNAA 4F12A 5JNRA 4RK0A 5PNTA 2PUBA 5FBKA 5HSGA 1DZ3A 3DZDA 2MSLA 2VYCA 5IBQA 1NXPA 1M5TA 3N0RA 1M5UA 3GA5A 4RKQA 5TQ2A 1FFSA 1T34A 3T38A 4MS1A 4D74A 1QNLA 3DLBA 1U0SY 2L18A 1YTUA 2A9PA 1JFTA 1KGSA 4JAVC 5TPZD 3RVNA 2FQYA 1MB3A 1C4WA 3T6KA 2E4YA 3LTEA 1WETA 1EWKA 4JB0A 4GPAA 3TX6A 5FWYA 3ILYA 1L5ZA 1Z12A 4TMYA 2H0AA 5HKOA 5CNMA 3M6MD 3LUHA 3E61A 3OLZA 3OO1A 4WUTA 1DBQA 4RK6A 3F6CA 4Z9BA 2P9HA 3F6PA 2X7XA 2O20A 4E7PA 2FSPA 1LBIA 2HPHA 5EWJB 1TM2A 2MYUA 3CG0A 3K9CA 3OMWA 4YP9A 4Z4EA 3MIZA 1U04A 1PHRA 3HEBA 1Z18A 3H5WA 3NHMA 4KZKA 1S8NA 2RJOA 4QPJC 3Q7SA 4TLLB 3SM9A 1QKKA 3B2NA 4HNQA 4UHKA 4D6XA 5B3JA 1ZH4A 2JBAB 3RH0A 4EYQA 3A0RB 3QEMB 3HJFA 5ABPA 3DGFC 2PL1A 2WRZA 4N76A 4Q6WA 1NXWA 1Z2DA 1OXBB 4XLTA 1A04A 3LUDA 1BDJA 4RK4A 3HK2A 4N0QA 3FDFA
chains in the Genus database with same CATH superfamily
1F8XA 1NYLA 3W7VA 3JYOA 1K5HA 1BE0A 1IPHA 1OBHA 4CDRA 2BL4A 2F62A 2R4QA 1S7CA 3AHCA 3GPCA 4FJ1A 3UWDA 1U7UA 2I5PO 3F7OA 1WXDA 1U6JA 3K96A 4XB1A 4DB2A 1NY6A 1RQXA 2Z8YM 3PUKA 3SHTA 5BQ5A 4JDPA 3ZOKA 5B4VA 4OH1A 1K92A 1Z9BA 4CIAA 3EXHB 5C2JB 1AVTA 1UPCA 2WWWA 1VYHA 4RZHA 1XP8A 5KKAA 2LDXA 3AF3A 2D1YA 3K72B 1A2QA 1EP2B 5IUJC 3LRTA 1ZY2A 1UAYA 3T3HA 2PMBA 2ZR7A 2Y2VA 1SG6A 4IJMA 3R5XA 3DE2X 1X14A 1LW7A 2DBVO 4XWKA 3HYCA 3HCOA 3FSRA 3CINA 4FINA 3GMSA 1Y1SA 3T3GA 3BRCA 4UBNA 3EXFA 1QTNA 2HWUA 4XWAA 2XIJA 2R1UA 4TQ9A 4D26A 2BI7A 5BVGA 1W9MA 2ZRMA 2COEA 4RHXA 2ZUTA 3WWPA 3GCXA 4LZNA 3QBVA 3COZA 5U4XA 1SOUA 1QFYA 1ZCFA 4QPDA 1NMZA 4RMGA 1JQEA 3P8ZA 4JJ6A 1R50A 2PEYA 1JHRA 4ZD6A 2HIGA 3H5TA 2JL1A 4PSKA 2B5VA 3KR1A 4RD4A 1FMJA 4US0R 1SUBA 3AUXA 2GCNA 3SX0A 5LB2A 5A4FS 2PD3A 1M8PA 3R5HA 1QUEA 3YASA 1VGVA 1XAJA 3KQQA 4R9UC 2A5FA 1AHHA 3VVBA 4C1NA 3QEAZ 2BSXA 5KI6A 1NJ6A 1EU1A 3VZBA 1R6XA 3WKDA 4DV6B 1CUYA 2C2OA 4HYEA 4HX9A 3H9JA 4NKRA 2R2GA 1N6NA 3KB2A 4EJFA 1O97D 4UVIA 2BHSA 3TAHA 2OXIA 3CWQA 4PS1A 2FJPA 1Q0HA 1S2NA 4JB2A 3TTWA 1PNTA 1YDHA 2FDRA 2QDKA 2QMZA 1GQSA 2XRYA 2DHCA 2LD4A 3EOBI 2R60A 4HB2A 2FFBA 3DYIA 3RVPA 5CB4B 4RF3A 2BT4A 2WUWE 3WSWA 4QG3A 1H05A 4IIXA 3OQMA 1E9VA 3TI9A 1ULUA 2CLFB 3BHIA 1PJTA 4Z99A 3RTDA 4AX4A 4ZV4A 3LBHA 3WO0A 4QVIA 2ZANA 3HLKA 3NU1A 1UXKA 3U80A 2HT1A 1D2CA 1XROA 3FM9A 3LCJA 2R8RA 3AUSA 4Q3OA 5AXBA 3SWWA 1RC8A 2EFDB 4GDFA 1AK2A 2GHRA 4DVGA 4YJHB 1M6WA 1T2EA 4NWIA 3TRFA 2FWMX 3PQ5A 2DHDA 4FEYA 3T0GA 2BPOA 5F2NA 4OL0A 4WLFA 3AY6A 4CIBA 2QRUA 2ZB3A 3OQBA 1HDOA 1HFKA 4E5MA 1I80A 3D2LA 1IZYA 1TAHA 1C7RA 1DXHA 1TVMA 3BJMA 3IYLW 5EJ8A 2RKWA 2Q28A 3I4CA 4BCBA 3A7EA 3JQ7B 3QUAA 4XRGA 5KYWA 3LIIA 4Q4CA 1HEYA 1OF1A 5LZ7A 1AZLA 1JYFA 3S2EA 3LL4A 1CY6A 4GC9A 4I1VA 1T5OA 1GO2A 3FNBA 1DAOA 3VYSB 2II6A 3DMFA 4A8JC 3SVZA 3PNYA 4QEDA 1PEKE 4F93B 5THKA 4QYSA 3U4HA 5BO5A 3ZBQA 4IEIA 5HKKD 1L9KA 2ZI3A 1KPGA 3GDOA 4G9EA 5HMLA 4E94A 1M8FA 3BHJA 3U7QB 4EJ6A 3A4YA 3MOGA 3AKZA 3B36A 4W5RA 4U7FA 5IAAA 4P4UA 1I6WA 4X5OA 2OKGA 2PBZA 4DMRA 4MQ5A 5K51A 3STXA 3RASA 1XRLA 5AJYA 1JBQA 4PS0A 1L5WA 4L2IA 2R8BA 3Q7RA 4QJBA 4MB0A 3U4GA 4EP1A 4LY0A 3PIDA 1QGAA 1R6TA 1GOTA 1BXRA 1VL6A 3BFVA 2QR2A 4K9OA 4LHEA 4UEKA 4BL5A 5C5DA 5JS7A 4C2UA 2BFCA 1EVYA 1X8XA 5D5QA 5AW5A 1MV8A 5U9CA 1P8JA 4EFLA 2A0WA 3WDKA 2JVIA 4RHTA 5AOVA 3RT7A 1MENA 2OR3A 1QGUA 2RCYA 4TWBA 5FUVA 4QGSA 4N9QA 4MUJA 2AMYA 2XTMA 3CISA 4BWYA 5DI3A 1JQ5A 3PSHA 4PX9A 3R6LA 4CXMA 2H07A 1NF3A 1X8JA 1Z4JA 721PA 3DE3X 4A03A 3TGLA 1ZUIA 4XUGB 5CBPA 2FI1A 2AI3A 1PL0A 2BKEA 4I1UA 1RXIA 2Q3MA 5C4MA 1J0XO 1S6YA 2WA1A 4XWTA 1L4UA 5J4KA 2J30A 3U4DA 2GCEA 1SO8A 3SN6A 4CG3A 2CJFA 1P0PA 4Z3DA 3C70A 4G07A 1C29B 3MUNA 1LWOA 3G82C 4RDCA 4ZV7A 2BY4A 2H6EA 1NT2A 1USIA 2NSHA 4BX2A 5K0SA 2VCEA 1NJ2A 2BFOA 2NZUG 2RHCA 2TS1A 4H08A 3ZW8A 5J1SB 3GD5A 3MGGA 3G2MA 4W7SA 1QRDA 3C3YA 4R05A 2R65A 1CV2A 1U2GA 1G5PA 1GGKA 3CMMA 3R3JA 3U4QB 4FLFA 4EFDA 3EWAA 2G5PA 5T4EA 1A7JA 2PKCA 5TQJA 4PLZA 1S5PA 3DMYA 1U02A 4D5EA 1YKFA 4OQQA 1BW9B 1BCSB 5ER6A 3VSCA 1EZZA 5DYIA 2ZYTX 5DHRA 5T41A 2I99A 3V3KA 3RRNA 3U09A 1UFVA 5ALQA 2QSUA 3UA4A 4XYGA 3TUJC 1QS0A 4OQXA 2XUJA 3CT6A 3U3KA 1NUUA 1XMQB 4DLWA 1QOZA 1KVUA 2RB4A 4BC1A 1SZJG 1E8DA 3CURA 1IQ0A 3OO0A 4EDHA 5A2GA 3PXBA 4ZU3A 3QMPA 1UFQA 4G0QA 2JF0A 4ZZIA 3CNLA 1V0JA 4ENSA 4F9GA 4LTMA 1E92A 1OZHA 5K0FA 4R9VA 4HRYA 1QPGA 3HU2A 2VK4A 3TRKA 3WRVA 5KDOA 2GCGA 2WJ3A 1U1IA 4UDYX 4CHTA 1F20A 3PNMA 4NNJA 3FNRA 2R7NA 3NETA 5IEJA 3CJRA 3TIXB 2QYSA 5A9RA 4UARA 4Z0HO 3TL2A 4OVKA 2E89A 1B6SA 1JU9A 1Y6QA 2ZT7A 3DKKA 1H9CA 4IFEA 3NUGA 5D3MA 2V5AA 4WNCA 5IXYA 4QDKA 4JU9A 4WKPA 3ZHBA 4N6OA 2Q1YA 4JNKA 5E2BA 3OBIA 3N74A 4ZVSA 3UAGA 5DSZA 3KJGA 1AXRA 1W581 2QMYA 3HGMA 2ETXA 1D3AA 3AKDA 1OAOC 1G8GA 2G9QA 2HSEA 4JGBA 3OOWA 1YBHA 1XK6A 1GNLA 4TT3D 2ZZNA 4GYYA 1OMOA 2OZLB 3K2EA 2X9VA 1U0GA 3EZGA 2FN9A 1FMFA 1PUJA 1D4OA 3KXDA 2IYNA 5D01A 1ZWKA 4PX2A 2GXAA 3EGDA 2XZLA 3G59A 1YE5A 1NSTA 4TQAA 5BNZA 2M1XA 3FUWA 4NCNA 2FWNA 2ZBRA 2YICA 4DRXB 2JLUA 1N1MA 1P6XA 3BXOA 3CUTA 2Y1EA 4OQPA 5EYPB 5JBNA 1WQ1R 1ZM3A 2CNWD 2M98A 3SE7A 4RFSA 4JBWA 1PV2A 4QUAA 4U8GA 4KLZA 3I4LA 4GP9A 4HWOA 3TNFA 1YL7A 3PNSA 2ANCA 1XRRA 3ZHRA 1GPKA 1WD5A 4HFMA 2HLDD 3QLJA 1JLLB 5DB4A 1WSAA 1T91A 1VE3A 1EP9A 1MC1A 1JIIA 1T9DA 2HBYA 5TF4A 4X7BA 2QORA 2X0DA 5L8VA 3C7AA 2OUIA 1PR1A 2JHAA 4EPYA 3C8MA 4W6QA 3RVOA 4A27A 5CBPB 2WKRA 4DIDA 2IEYA 5LQUA 5BY2A 4ZJPA 4YFVA 3L4JA 4RSRA 4OPMA 3P19A 4B4DA 2CBGA 2PKWA 3ZDEA 1WZCA 3CF4G 4DADA 3UAOA 4MR9B 2VI5A 2VJOA 5ECGC 4KSYA 5U1PA 3STYA 1LEHA 3HHPA 3LT1A 1E1RD 3WY9A 2CF6A 5HK9A 4FDAA 1R1DA 2Q9AA 4LF8B 2VJNA 5KWJA 1EUCB 5TEWA 1L4GA 1K08A 1SKQA 1ECBA 2SICE 1X9GA 3DCYA 1KA9H 1F6DA 2AJTA 4D6PA 3WLQA 4ZDIA 3WK4A 4RK1A 3CWCA 5M2QA 1D1QA 3WDLA 5BV7A 2FG6C 3IT2A 2V4ZA 1AUVA 4Y6LA 1EUDB 1OJ7A 1BZYA 2Q6KA 3O74A 4J8PA 3B12A 5AIAA 3FJOA 4P08A 5DF1A 5EERA 4CL2A 2KBEA 5KQMA 1RQ7A 1VJDA 3R2JA 4LQ4A 3S5UA 2XA9A 3ADCA 4UNPA 3EEBA 2EHDA 2ZRCA 4OHFA 1IUOA 4U9UA 3QVGA 2CV0A 4HTAA 3SEQA 1Q3KA 3EIEA 5AT1A 2FEOA 4Y2PA 3U7FB 2PYZA 2KB0A 1E2BA 4TLAA 3VR4D 3DEIA 4IOMA 1JNYA 3FZYA 2Q3BA 4NK4A 3T9DA 1I94B 2Z2XA 1TFRA 2QENA 1QGZA 4BNNA 1NVXQ 2IPAB 2RAUA 3PHBE 1K4MA 1ZRMA 2PT7A 1PS8A 1I7NA 2AYYA 3MMZA 3IUPA 5D84A 4TM8A 1K8XB 3V9PA 1HE2A 1TA4A 2FEKA 3CUKA 5I9NA 3F4KA 2HA4A 4FKMA 4IOLA 3UPTA 3IPYA 2IXTA 1N36B 4Y2HA 4TT8A 5JI2E 2UXDB 2NQTA 2BGKA 2ZU6A 1YC5A 1MAHA 3IOMA 4YDSA 1FUYB 3ZU4A 2UZIR 2DPGA 1X1EA 4R71A 5JFGA 1WOYA 1OH7A 1B4DA 2WSMA 1EZ4A 4QFCA 1P62B 3CX8A 3VTAA 4DCPA 3D6AA 1GM5A 1DX4A 4QPPA 1BVYF 4DR4B 2VF7A 5H70A 4BFLA 1YS4A 3ISTA 1NMQA 2BSQA 3L02A 2PLRA 1DFHA 1MC5A 5BXQC 3L8DA 4AL4A 3OX1A 5GV7A 1JJFA 1YE8A 3T7SA 3KU4A 4R8MA 1N2CA 3ENNA 1AHIA 3EVTA 3MVEA 4M60A 4AY3A 5ILOA 2NVWA 3IQHX 1XCBA 3RM3A 2QG9A 2QN7A 3OCXA 4JY7A 4LE2A 1Q50A 4OX9B 3DBHA 2XNJA 5IM5A 2WY2D 5J47A 2GASA 4RE6A 4E4YA 3UCXA 1UKCA 2HJGA 2REQB 3OESA 5BWBA 2PHZA 1TZBA 2FRDA 4M1QA 2NUTA 1P2BA 3B1FA 4CMHA 1SD1A 2ZT6A 5AR1A 3Q0TA 3DMDA 4ZALA 1AQNA 1G7RA 1QE0A 3FROA 4H7JA 3A1CA 1PQPA 3KXKA 4ME6A 3BK2A 3ZD7A 1T1SA 1NOIA 5CA0F 2J09A 1K8RA 2ESRA 2PRJA 2W0MA 3GRAA 4AJIA 5BUZA 3I92A 2IUFA 4HBZA 2ZATA 1KAHA 2D2FA 1MFPA 4CJXA 2WJPA 3VZSA 2XDAA 4LZOA 5CXSA 2OZVA 4DBLC 5KAPA 3OSUA 3JALB 1G8KA 1DDIA 1R4ZA 3D6NB 2R6JA 5G0UA 3PL1A 4OA5A 2GLTA 3ETGA 4D74A 3NPAA 2WP8J 1ZNYA 2UYOA 1NI5A 2XNCA 1C8LA 4I2NA 1NC3A 2RGAA 4BAUA 3AVYA 2EBFX 2JATA 2FN3A 3UH1A 3OCUA 4FGWA 4J7XA 2OY0A 5LPNA 1IE3A 1PGJA 3JWGA 3LTEA 3OG9A 4N49A 4F6RB 1EWKA 1B93A 1TJ4A 3TL6A 1WETA 4GBJA 2ODWA 3AR2A 2EGUA 2YUIA 2Y6VA 4AJJA 3K5PA 5LKAA 3ISJA 3K2BA 5H81A 1L5KA 1E3SA 3KLPX 2PWPA 4LDRA 4DA0A 3SD7A 4B7UA 2A5JA 3SIWA 3FAKA 3E61A 1BE1A 1O96A 4WKBA 3EOAI 2CJPA 4YK7A 4KDCA 5GV8A 1GA1A 3WGIA 3QX3A 3F6PA 8OHMA 3I9V1 2XA1A 4LV5B 2X1HA 2Q6TA 2JS7A 4TTJA 3ZS9A 1BMFD 3GGGA 4TTTS 3UHAA 4KXFB 1GFIA 1ZN9A 2GEFA 3KZMA 4LMRA 5CURA 2ZUEA 4IWYA 4OK5A 4I50A 2Z1DA 2F1HA 1XKLA 2RJOA 1MMFB 2DF8A 2J45A 3B2NA 2AOWA 2XW6A 3Q7PA 3HXTA 4ZAGA 4DJTA 4DXHA 4RTLA 1ZH4A 3HJFA 2P79A 1UH5A 3DF9A 2RGNC 4EG5A 1F1JA 2VO1A 1CQWA 2XT6A 1X1RA 3IMEA 3KFVA 2WRZA 3OPMA 5AP9A 4P84A 1C2YA 1CX9B 2ZS7A 1ZH8A 1ZK4A 4NZNA 3TQQA 4Q6WA 1UM9A 2HHCA 1THTA 3B1KA 1J2JA 3LPMA 4DMUB 1GCUA 5AK0A 3HKBA 1COWD 2ECKA 5JS6A 5EA2A 1KIFA 3D8TA 3QXCA 3WYCA 4IINA 2ORYA 1S9HA 4HDSB 4BLVA 1L7MA 1ELOA 1VLJA 2YMMA 1ORTA 1UADA 2RI1A 4G26A 3EY9A 3COYA 1Y33E 1VCIA 1IQUA 1EA5A 4N12A 4ND6A 4CUKA 4KGXA 3T9FA 1SIUA 5BR4A 2AR9A 1ZM2A 1KJNA 2GK7A 1M0TA 3TD6A 5B58C 1PKXA 2QQ0A 2ODQA 3G6KA 4FC6A 5FUQA 3BB3A 3ZWQA 3WIUA 4K03A 2Q2QA 1IEVA 3GRFA 2Z1MA 2RC5A 4IILA 5BSRA 3DDHA 3OZTA 5JTUA 4Y6GB 2KE5A 4XJXA 1PFYA 1W94A 4OSOA 2WIDA 4NJEB 1K2WA 2FCRA 2VJKA 1C9YA 4D57A 4XQ9A 1F2UB 4MP6A 2N42A 1GPAA 5HGJA 4Q48A 3K9LA 1YGYA 3EA0A 3MWFA 5AM3A 1LPAB 4LQCA 4UMEA 4MICA 5EY5B 6REQB 3DXFA 1XTRA 3I34X 4J43A 4MGIR 3HXQA 3T3MB 1ZO8A 2JBAA 2OESA 1F9AA 4UTXA 1Q2XA 5LZ5A 4M9SA 1E4EA 4G0YA 4MVXA 1JUDA 5A3VA 4Q9NA 4C78A 1HR0B 5DM1A 3DE0X 4M0MA 1QLHA 5FPQA 4G4SP 4BVFA 2PUVA 2IE0A 4S1OA 5HIJA 2NU6B 1X42A 3TJZA 5GONF 3P4YA 4DLBA 4EELA 1UCFA 4ZN6A 5MN4A 1XLTA 2ZIFA 4OBEA 2XKJE 1AU9A 2G77B 1WNFA 2JIPA 2XHZA 3P2YA 4OHCA 7MHTA 3FCUB 3NTOA 3TB4A 4RMNA 4M8NE 1KZ9A 2G17A 3N86A 2LTAA 4L50A 3MELA 1ZWLA 5REQA 3DZBA 2ZRNA 3CLHA 4HWGA 4YV7A 2VHZA 1O5TA 3T7CA 2ACKA 2HXYA 2WG2A 3NBMA 5EJAA 1VHLA 1JHQA 2YOFA 4FE7A 1SXJD 4E13A 1ZA2A 4JVOA 3IAS1 2Q8NA 1W4ZA 4FS8A 4G1EB 1KO8A 1BN7A 2A1UB 1VGQA 1YT5A 5LZ9A 4GQAA 1V2GA 3KJIA 4AAYA 3TZCA 4EB0A 2VVTA 3FUXA 3PXEA 3HRKA 3CNQS 1MXHA 4JP3A 4LMAA 1R0KA 5DGDA 2ONKA 2WYWA 2YOHA 4BQFA 2C3MA 1DO8A 1R5OA 3VR5A 4R1SA 1X7DA 3OIDA 4R81A 3WVNA 5JCOC 4PANA 2J9RA 4XQ0A 2VHQA 3H2BA 1TUBB 3HJAA 2FVYA 2VNIA 9GPBA 3FTPA 4TVKA 3NKVA 3HYLA 5DBEX 3GLIB 1G41A 4KPUB 4I4CA 5BT8A 2GO1A 2OMKA 1UMBA 3CB2A 5HRUA 4GSYA 4L0QA 1JI0A 4YY3B 3JQ8A 3OOEA 2H65A 1MIOB 3QX7A 1I4WA 3DYVA 1V37A 4OBBA 1GJRA 1T4DA 3GZNB 2W6JD 3IP7A 4QOIA 5C4GB 4RTKA 4GKKB 2V8BA 1VCHA 3RHSA 1I7PA 2X0RA 3Q1LA 2B35A 1PNQA 1X1TA 3II6X 2H59A 2QE7D 1W0JD 2ZGVA 3ED1A 2AF4C 3TR6A 4DY6A 5KYTA 3GEEA 3MIIA 3VHXA 4EHNA 4I55A 2NT3A 2OP0A 1G5QA 3J80A 3DTVD 2XMZA 3DEYX 3MW8A 4PBSA 4YEDA 5M7EA 2FU5C 3AINA 3LHDA 3KKNA 4B7CA 4WFQA 3M6XA 4DCSA 2CUKA 4H59A 1SHJA 2ZRGA 3A37A 1NBME 2HU7A 3DG9A 1QUFA 3H8WA 5E38A 4WNAA 4PHFA 1KIMA 1T1EA 1OWOA 1U7ZA 3GBSA 3I1IA 3QY0A 1J90A 5HZKA 3HXKA 3IDSA 4CG1A 4GUDA 5G1NA 3RUEA 3UXHA 5EXDA 4EL5A 1KEVA 3T8YA 3KWJA 4DG9A 3GVIA 3CHYA 4YIKA 2W42A 4DHEA 3CVUA 3WQQA 1H2XA 2PMDA 1I4LD 2ZYAA 4KKVA 1NHGA 3Q9UA 3B53X 4DSNA 4EBBA 1BU5A 4YT8A 1NQUA 1N4DA 3O9MA 3P9NA 2PPVA 2PUHA 2GCPA 1SUWA 1IHOA 3FMPB 1E7YA 2P5TB 2W71A 4FNAA 4FOTA 4J75A 4RDIA 4HNUA 3BCUA 3RQSA 2IZ1A 3O2SB 1DJOA 3HUDA 1H4SA 4OHZA 5CP8A 3HPQA 2FOIA 3DLPX 3Q8WA 4UCXA 1WE2A 4MI3A 4QOJA 2X5XA 1E3DA 2L17A 3SFTA 4L75A 2XGGA 2ZYWX 3KR0A 1ZK3A 3A2MA 2JGAA 1HTTA 3IDZA 3P45A 3ZQJA 1Z4PX 2OB2A 3A1SA 4IMIB 4Y0AA 5LWQA 5ANRB 2X5KO 3FNIA 4P34A 5J59A 1NLMA 3RRFA 2PPLA 1UWVA 4DGQA 1PK8A 1IN7A 4I3HA 2B61A 3VRHA 4X1OA 4BQEA 3WICA 1OH8A 1X7WA 4L3OA 2P4EA 2V65A 3ONNA 3L46A 3BOSA 3F7TA 3FPFA 1YJ8A 2H9YA 2YXEA 2J8ZA 3SYLA 2AWNA 2F3QA 2IVZA 3BCHA 3EXEA 1EXWA 4UUAA 2I6FA 3PI6A 4GXNA 5COAA 4XYLA 2CV1A 5K1ZA 2CHVA 5ILGA 1VPLA 3HA5A 1E62A 4QOGA 4X7MA 4QOSA 1RI5A 4C89A 2ZRPA 4YLYA 1M2GA 4DAEA 5DTRA 4A3SA 3WGYA 3B9BA 2W6ZA 5FUXA 1C0PA 1ZVKA 4IBOA 3U3XA 4YI3A 3IVGA 2ZIAA 2BCEA 3UGTA 4O2BB 5IUKC 5DKFA 2FJUA 3OA2A 4G5FA 5GJVC 3VR1A 3WS7A 2HK6A 1NF2A 1QFZA 1GL6A 3LT5A 3F98A 3OCCA 2GM9A 4R7GA 4CR7A 4JLDA 5AM0A 4ILEA 5EMJA 3P96A 1CZHA 1N6KA 2ZT5A 3DQQA 4EM6A 4ZYXA 1M2FA 5B7GA 4UCWA 3FBTA 4NZOA 3OETA 3QLVC 3G5UA 5SYNA 2REBA 2O8FA 1M6NA 1OKKD 1SVMA 1YMVA 1R8XA 4DYHA 4DSZA 1GFZA 4L8GA 5DSTA 4DC0A 1YBMA 5KNDA 5I45A 2PKEA 3PBKA 4K6FA 1JG6A 1XMIA 4OQMA 3A31A 3O4JA 3ANNA 3DFFA 4J6EA 5E0KB 4JELA 3KHTA 3OLXA 4BDSA 4UTPA 4DCTA 2V6MA 3CXUA 2H8GA 3EQ2A 2O8EB 1WMFA 3OZVA 4P8RA 4NYIQ 3GELA 3JQFA 2FE4A 3G7NA 4JP8A 4XIJA 4EQ6B 3PDWA 1EVJA 3RWOA 1RSZA 2BFBA 2VF5X 3KP1A 4PIVA 1MAWA 1NXOA 1SCIA 2B5OA 1II0A 2HTEA 3LCCA 3P32A 3Q88A 4H27A 4WEQA 2C7GA 4ND2A 1OLSB 2Z6VA 1E9FA 4TSFD 2VEDA 1N8SA 3A6EA 5FA6A 1E0DA 3LL7A 4DZZA 4YIHA 3RCBA 2HDOA 4MW9A 1MJHA 2DFVA 2RJNA 3THYA 3FWHA 3RKRA 2WTAA 3HU5A 3A14A 3O73A 3ZCVA 4UVDA 1N3IA 4D4JA 4AMYA 4BVLA 3N05A 2P4UA 3KEOA 3B3AA 4X00A 4F5EA 1G6KA 3KUXA 1ZZGA 4YONB 3KZVA 4YRTA 2I0FA 2N3ZA 4XEUA 4AKSA 3HZZA 3JAKA 4YCCA 1HO3A 3UK1A 3UW3A 1ARZA 4UZEA 5JR3A 2VHVA 5COQA 4CQMD 2IQ5A 3H1FA 3N2LA 1Z28A 2X8LA 1BD4A 1DEHA 4R8LA 1JSLA 2YV4A 3S2ZA 5LXTB 1ZD8A 5ENZA 3M6VA 4ASUD 3CEJA 2J0SA 2GPYA 4K9RA 4XW2A 2P6OA 5ALEA 2Y0CA 4LJYA 2OHVA 3UYKA 2Q3HA 3TFWA 1SQ5A 2RK4A 3VPCA 3LO8A 4DCGA 4ZTUB 3PQ8A 1YB5A 3OEEA 2DCUA 2IHYA 2WTUA 1DMSA 2FUEA 3ETLA 4ER3A 1EFTA 4URUR 1C7QA 2CXUA 4X3CA 2GN6A 5JTTA 2QX9A 3RO7A 2CUZA 3G2KA 2X8WA 1VFNA 3BTOA 3QUQA 4DJAA 2HDNB 4ERXA 3A1UA 3Q9NA 4DE5A 1U1FA 2W00A 1T3GA 4YAUA 1UK7A 2FX2A 1Y5LA 2FX5A 1K88A 4N3CA 2DY1A 1BEEA 1NL3A 2PSSA 2XYPA 3JD3A 2PJDA 3FFXA 3OD5A 2IOYA 4HB4A 3VYRB 3DC2A 4KXXA 2FFRA 3X2SA 2O2HA 2Y1XA 3BX1A 4YXWA 3W9SA 2ZAOA 2JAHA 1XU4A 3I6MA 4G5HA 1OA1A 4FT2A 3SNKA 4EHAA 4C7OA 3CUUA 1OXTA 1LDBA 3O2QB 2Y76A 2LE0A 3UEOA 3VR2A 2I8AA 3WI7A 1UPBA 3LIPA 4Q9JA 4ZVQA 3WGVA 2WB2A 3QVXA 4EEXA 3C2QA 3EZYA 5DSXA 5IAKA 4BLSA 4QDOA 4KQ6A 4GKBA 4HAOA 4JL8A 1TJYA 2VH2A 2VJQA 3I8OA 3LBYA 4OCZA 4WN3A 1FFHA 1E5DA 1ZD9A 3OM8A 521PA 1SXPA 5K0NA 4WJLA 1JAHA 2WM2A 3Q6NA 3BZBA 4NU6A 4F1JA 1EMDA 2WJ6A 3HCDA 2AK3A 1BMTA 2X9NA 3K2IA 5HF8A 5CFNA 4G24A 4QQFA 4DIMA 1IXYA 4FR2A 2GD2A 2O2ZA 4OOFA 4BFZA 2ZYIA 2VOEA 5BUQA 1XN4A 1UBOS 2COUA 3TL3A 3C6KA 2JIMA 3FTFA 3I04M 4E7OA 1Y9AA 1SXHA 1RC0A 4JJ7A 3R23A 1Z2EA 1ZOLA 1CZUA 3DEAA 2O8VA 4NV1A 5ERXA 2PNFA 3N6XA 5BSVA 3Q72A 1Q12A 1HT3A 3LCMA 2VATA 4DSOA 1FTQA 2ZI7A 4FSHA 3G0IA 5HE8A 2XI4A 3P1JA 1EWTA 4RHEA 1VYVA 5KVVA 1HLPA 3HNRA 1L1FA 1QFXA 4C6RA 3RT1A 2P30A 1Z7EA 4EF4A 5GTDA 3UMSA 2EFCB 2VAMA 1TJ5A 1JTVA 3G2IA 4HMPA 1USKA 4CM4B 4DQXA 3U16A 1E3IA 3O8LA 2PA0A 3TYXA 1HE4A 1UM9B 3IURA 3OQNA 4BX0A 2F6RA 4JMLA 1N92A 3BVPA 3JRWA 1KDYA 5DX8A 3H4MA 5JALA 3MJCA 3VYWA 4F71A 1KETA 4XGNA 4RANA 1LTKA 4QODA 3TO5A 3PQDA 4A23A 4B6PA 2ZRLA 3W05A 1PGOA 3ZWYA 5JLJA 3LCVB 2OLJA 3CZ9A 3QE0A 4JQOA 4O8CA 1DTWA 1CDDA 4W5OA 2B98A 5BURA 3RYCA 4DQVA 1KC3A 2LZ0A 1PD1A 1IU9A 1TT5B 3OQIB 1M75A 3NALA 4Z3OA 2TRSB 4Q7EA 4B6FA 5EJIA 2ECPA 4B3BA 1HYEA 1Z0JA 3NJRA 3KYBA 2C96A 5EEHA 2ZVDA 1N5IA 3UMJA 1FQOA 4IH4A 2AX4A 4GYKA 5DJ5A 3TOSA 2CB9A 1I1NA 4CL0A 1Z0AA 1WY5A 1FVHA 1ZVMA 4B8WA 3C14C 4CLXA 5JPDA 1QZUA 2GSWA 3HCAA 3NIDB 3AYZB 3D2BA 1LK7A 2ECQA 3K8QA 3QG1A 5T67A 4EK9A 2JLBA 4FGJA 4B3HA 3IIIA 4F8YA 4JEMA 2JFUA 4F5DA 1BC5A 2IIPA 2R2AA 2W6JA 5TT1A 2JEZA 2LKDA 2B37A 5A1TA 1KI1A 3BUSA 3PB3A 4JH0A 4UXJA 3KQNA 3H19A 2PYIA 4GKAA 2NX2A 1MO5A 2FMXA 4KFSA 5AW2A 2ZSJA 4M0EA 1RCTE 1N5JA 1LFDB 2YWJA 1IBMB 1EFCA 4TV8A 3CR8A 4ENTA 3HR8A 5TF0A 4XTRA 5J2TB 3AQ4A 3RAGA 3FTQA 2O8BA 1KJ9A 4IJUA 5EP1A 2Y05A 4QXMA 5LJLA 3PPXA 2C7QA 3BCRA 1IUNA 1V9CA 2X1VA 2VQSA 5GM2A 1L4MA 1U0EA 1MN6A 1D8AA 3EVCA 2WHXA 3G68A 3Q6IA 4MA0A 1RW4A 2W98A 1WF3A 4YJFA 5A71A 1UKAA 1Z06A 2BUAA 5LA6F 3RUPA 5I4IA 4ARZA 4A2CA 4B7AA 1YUMA 3ROGA 1V41E 2UZ0A 3U3OA 5KTYA 2V74B 4O4HB 5KYXB 1UOOA 1W30A 5DHQA 4PWZA 3OLZA 3EK2A 5B7QA 4BVAA 1RVV1 1K98A 1W0KA 3FI9A 4HH4A 5E3HA 1RKXA 3F6CA 5IDXA 3WLIA 3U44B 3D0KA 2YWCA 2HRDA 4U3JB 2C2HA 5AQEA 2P5YA 2VCHA 1BEUB 3M6LA 2IBSA 2HPHA 2FX3A 3AEYA 1P5RA 1R0XA 5DHPA 2I8LA 5C32A 3VU9A 4FN4A 2BGNA 1H85A 2HBRA 1Z18A 3H5WA 4EKEA 4L8YA 3KETA 1UIRA 3NOVA 3OCZA 3ZU5A 3JWEA 3ET4A 2W9XA 5C3UA 4A6DA 2HI0A 4IG4A 4JQCA 5B1EA 4ZVLA 1TK9A 4L4RA 4V0LA 4YRCA 5HOEA 4MB6A 1IBLB 2GNOA 1ULTA 1L7OA 2QL7A 2AUMA 2XEDA 3W3ZB 2Z83A 1GQYA 2NO6A 3NRBA 3OJXA 4PLVA 5IVIA 3FFAA 2ZXEA 1FYFA 1G3RA 3EHEA 3ZLJA 2EZUA 4MINA 3G7UA 3WXBA 4LG1A 4N0QA 5K4AA 1DG3A 3FDFA 4IDNA 4FZRA 3K0FB 3O83A 4NCKA 3T7AA 2EP5A 3R41A 1Y8AA 3I2FA 4FK8A 3T1VA 5BSMA 4B71A 4X71A 2G9NA 5FEMA 4RMHA 3NVDA 2QY9A 4LRUA 4P0PB 1N7GA 4FYMA 3P0RA 2HWKA 2IQIA 2YVUA 3IAM1 3HTXA 2WM8A 4MUMA 4KUHA 5HNKA 2QZJA 2F1KA 4FDTA 5FLEX 1K97A 1XR3A 3L7AA 4KWHA 4BU0A 1V3TA 2HWYA 1UPUA 4LVOA 4WCFA 5CVVA 2IUSA 3ID6C 5I9IA 2GTIA 3NW9A 1R18A 3X1WA 1V8BA 3G5TA 1OWNA 3VI3B 4OHOA 4EMUA 5HQ3A 1XZBA 2HKIA 4QXOA 4AZTA 1QZ3A 2AKAB 4FLEA 3FFBA 4EPWA 3A0UA 2PLFA 1C4OA 1LPMA 1R9NA 2WU1A 5FH9A 2Z56A 1OX6A 5JWHA 2VYNA 2ODNA 4ZMBA 2ZE6A 1FTWA 1JEAA 2VSQA 4PEVA 4TRJA 5CM8B 5D8DA 5TEVA 4ZVTA 1QVZA 1JVBA 3VZQA 1GRNA 4YAJA 5AKLA 3KLBA 2QW1A 3OPQA 2JGMA 1ZHFA 3N2IA 4HNAB 4X3PA 1BO6A 2OFPA 3SHWA 3WB1A 4RX1A 3D3NA 1OXXK 5HBGA 1OLXB 1Y98A 3W5CA 2QWXA 3ZW7A 3BZUA 5DFAA 5KNBA 3HJNA 2C9MA 2P2GA 4TTIA 4Z9XA 3TE6A 3JVIA 3NBAA 1M2OA 1AK1A 3H83A 5KSPA 2B4TO 3S8MA 3SYRA 3AESB 4EJMA 4ER0A 2O8EA 4F92B 1NXQA 5TR9A 2W48A 3L82B 1L7NA 4TSFA 4GR9A 3RBVA 2CLEB 3M1YA 3NHZA 4G2TA 2JJ1D 1QRAA 3OKAA 5CVTA 5FTNA 1GY8A 2DM6A 3RARA 1U0HC 1GPYA 2Q8QA 2D6FA 4GMFA 4RKRA 2PUCA 5ESDA 3KQMA 2IVFA 2MMCA 3TBFA 5BVHA 4JC4A 2EJUA 1OA0A 4QAQA 4R1UA 3HE3A 3JCZA 4B6SA 5K45A 2YHAA 2H11A 1MVLA 1C4XA 1N0VC 3LXUX 1KOFA 1E2KA 3EEQA 4R6WA 4MKRA 3FMVA 3HWRA 3FWKA 4ZQGA 2WAMA 2JBWA 2YJTD 4YJGB 1CZRA 3BXZA 1YF3A 2O0HA 3K2QA 3PUVA 3WYNA 5BPFA 3NPMA 3K05A 4LOHA 2AA3A 1ESCA 1ADBA 4QUBA 2WWXA 5C7LO 3AK4A 2Q3CA 2EF1A 4GMKA 3RK0A 2WC1A 3IC5A 2Q1SA 1N5KA 4J0DA 4DA7A 5LQRA 4FYVA 1FTNA 3W8FA 2IPNA 2PR7A 4CCYB 5FTLA 5JJ5A 4F96A 1WMDA 1XF9A 2LCIA 4X0EA 1JFLA 1G20E 2KLHA 1B7GO 1FQWA 3QKRA 4JCOA 3RF7A 4CQLB 1XLVA 4ZCPA 1QK5A 5JEEA 1QAOA 3D3WB 2BFEB 3R8CA 4N1AA 3TCKA 1KEUA 3HKDB 3ECAA 4GAEA 4BFCA 1EVZA 5EWMA 4D42A 4IRMA 1XNJA 4JC5A 4EW2A 3RC8A 4KRFA 4C2AA 3CLUD 1PT7A 3O92A 5FUYA 4A15A 2BFFA 3IMCA 4KNWA 1H2HA 2Y0PA 3UBMA 3CEHA 4PYRA 4XJVA 5J2UF 2WE7A 1FC0A 1R8QA 1QVRA 4M9CA 3TGWA 3BWDD 3EC2A 4K9NA 5KQLA 2RHLA 5K8VA 2JKVA 4I50B 5EJEA 2H16A 2A2ZA 1QZZA 3AVPA 3EZLA 4KUEA 1IEXA 2IKQA 3MFQA 5DE3A 4REMA 2JIZD 1D9XA 1U3VA 4FKZA 1BFUA 1RZVA 2GSDA 2QLMA 4N7RA 1Q0PA 3LV8A 1O96B 5CG1A 2B4RO 3LBNA 4CM8B 1RLTA 1V5FA 2I1WA 4IMJB 3RSGA 1QZXA 4ZK6A 4KDEA 2JJ8A 6ABPA 1A71A 2NADA 2O6HA 3BDAA 4XGQA 4OK3A 5IKPA 4MULA 1Y6FA 4KSCA 3R5TA 1WXFA 5JCXA 3AZOA 2WABA 2VLIA 3PFIA 2LXNA 4G1FA 4RM3A 3T7IA 2JGKA 5L4LA 3OX3A 2D0OB 4ZYYA 1A8HA 1XA3A 4O1IA 1Y3FE 1E3TA 1TQ2A 2PRZA 4QU5A 3RNOA 3TR5A 1P80A 1FP4A 3KUDA 3UAWA 4B8ZA 4Y7CA 1ORHA 2XCLA 3CX4A 2CD9A 3PC8A 4AUNA 2CHUA 4M0CA 3RSZA 2L69A 3ZV3A 4TMVA 2IOQA 4BV3A 4RAQA 2JG3A 3N59A 4I8IA 1C4KA 4W5QA 2XXAB 4UUOA 1OV6A 4RGYA 5P21A 2D7CA 1Z83A 2Q5IA 3BE5A 2YC4C 3C45A 1YFZA 4WJZA 3TD2A 3WNVA 1O1YA 4B34A 5CDUA 3SJUA 2B20A 1YS9A 4YA6A 5EWJA 5JJCA 2D06A 4ZEMA 4LYEA 3PUXA 3RHZA 4KITB 1S2IA 5EMKA 3TRDA 5CT4A 4R2MA 4KACA 1GKLA 2MYNA 5E4TA 3AJAA 3VOTA 1SGWA 2PXAA 1DEAA 3BGVA 3DBOB 3IP6A 5L53A 1B00A 1MJFA 4JI2B 1L8AA 4EJSA 1TZCA 2HRBA 1VQ1A 2OILA 3QWBA 1Z6ZA 5B3LA 4H1VA 2H9IA 3N07A 3T12A 2OLEA 3HDHA 4WLOA 3JVEA 1XNHA 1EWYA 2IE8A 3BXFA 3OU2A 4U2FA 4N5IX 1A1SA 2ZJAA 3RKSA 3SJAA 1ORWA 3D2CA 4CKCB 3CRW1 3HI6A 5DLEA 1XSEA 4OIMA 5EHZA 2OCGA 1U1GA 3DPSA 5TMEA 4ALNA 3HACA 1IG0A 1R12A 3QFFA 5LZ2A 1ZCAA 2GXSA 4XD7D 4NE7A 5JEDA 5FX2A 4QYIB 4Q19A 1BFDA 2IODA 4RKFA 5FOSA 1F8YA 2QGFA 4HDKA 1Z5VA 5KYUB 3G17A 3F90A 1QXSA 2IYQA 4XVHA 2WUFA 1LVGA 4JOCA 2QTZA 2ZI6A 1WHSA 1X7XB 2DWCA 3SDZA 4CF5A 2BD0A 3VNQA 4ECEA 1TAGA 2NO4A 3OT5A 3GFSA 3R5SA 5D1NA 4B6QA 1ABEA 2WKQA 4LQDA 3UOWA 3V4ZA 5JMOA 4V0NA 3OMLA 1GN9A 1H2FA 4QFMA 1DKMA 4C4TA 4GZMA 2A4KA 1X8LA 1R8JA 2AHOA 2XRFA 5H59A 5LP6C 3VV2A 4PPYA 2H7VA 5CVUA 5GIPE 5DLPA 1LBEA 1K3TA 3AF4A 1O54A 2WYHA 4BUZA 3AVTA 1K1EA 5FR2A 4M53A 2JJMA 1OLSA 3R0VA 2BE7A 1SNYA 1XZDA 4KTTE 2Y8EA 5I47A 8ADHA 4FZVA 4MVCA 2GF2A 4U00A 4TWZA 2RHGB 1G7TA 4NU8X 3GGPA 4O4IF 1MX5A 2QXUA 5BWOA 4BFWA 4F72A 1RAAA 1ICIA 1UDXA 3G2PA 3IH5A 1FP1D 1Z4KA 2QAGA 3EUWA 5HS6A 2C9YA 1XAIA 4ZHSA 3E0QA 4MGHA 1VE9A 2GHTA 3M1IA 3G2LA 2C58A 4HAIA 4F2PA 1RLIA 4ZC1A 3RU7A 1M0EA 2WTMA 4K28A 1JEYB 4MGYR 3IMFA 2N9UA 1UP4A 3LDUA 5IC6A 1QVWA 1U28A 1QQTA 3ELUA 2O4CA 1ZL0A 3O7WA 4X8OA 3QBJA 5C1BA 3OOJA 4JOBA 4F2DA 2XLBA 5EVJA 5CDSA 1ZH2A 1R6AA 2A35A 1SOMA 2Q5OA 2Y9PB 4URYR 3P9XA 4M0KA 1Z6GA 4NZMA 2Q5FA 2AVNA 3DZIA 3REQB 3ROQA 4P22A 2O5CA 1L5HA 1WZ2A 1OU4A 1PSDA 2ZPTX 3TLZA 1RZUA 4B8YA 2HFKA 2ISQA 1PZMA 5B58T 3KWFA 2OAP1 1G60A 4QAJA 2QZZA 3EDQA 1RI4A 4PG7A 1OFTA 4MUHA 3TOZA 5F51A 3LBIA 2WIBA 1OH6A 2VQDA 1WB9A 1ULBA 2FW6A 4QQNA 6ADHA 1CC1S 1ITZA 1KYTA 2CDCA 4GI7A 3VPGA 3PD7A 2C5HA 2Z04A 4C7BA 3UHOA 3WYBA 4JSTA 1QO7A 2BTEA 1UOEA 4YRPA 3BULA 3G1WA 2RH9B 3N2GB 4JC0A 4PC3A 5CH8A 4BP1A 4JC8A 1XNQB 3E1SA 4HS4A 3TZHA 4FZ5A 2XR1A 2ZJ4A 3LFTA 5CA1F 1R0SA 5M34A 4WRRA 3RD5A 1NBWB 5A4JA 2AEJA 2GDJA 3ONVA 4G97A 1NUHA 1D2RA 1QJCA 5CM9C 5IANA 2BGWA 3QW2A 4FIDA 4V0KA 1S1MA 4K81B 5E9AA 5J5VA 4NOMA 4A6XA 4RDXA 4JR1A 2J59A 1E79A 3PL5A 2O8CB 2CVPA 5H3HA 4UZFA 4JEUA 5TMDA 3D0QA 1GG9A 1MBZA 2VDJA 3RQIA 4YYZA 5EI5A 4IS2A 3K09C 4Q4JB 4QICA 1PJ4A 4XDYA 4I4NA 1N2SA 1XFAA 2QAJA 3EZ7A 3NANA 2FPUA 3FPAA 3O95A 4GEGA 1WXIA 4QUEA 4D9EA 3ZZ0A 2BJWA 4HN2A 4GMXA 1FFYA 2MJLA 3ZR4B 1GR0A 4CDMA 1Q74A 4YI5A 2AJDA 4CVNA 4P83A 3PNPA 5L3QB 3AEKB 3C1OA 4OQZA 5K3FA 2CL0X 3DHYA 3IHWA 1XLUA 1JQ3A 2P2YA 4R2JA 5K6TA 5E1OA 2A9FA 2V9ZA 2IBMA 4B6JA 4OI0A 1TMGE 5DH9A 3MCZA 2FFHA 3GG9A 4EHJA 2NZJA 3OFJA 3W2EA 3DKIA 3EXHA 4EGSA 1ETUA 3IOCA 4UUPA 2VK8A 3BA1A 4DLRA 1MC4A 5LVAA 1VIYA 2BBTA 3KVRA 5LYJB 4LOKA 3JZIA 2TECE 1JFSA 1SN7A 2I76A 3J81A 4Z53A 2B8EA 1VL0A 1FP4B 3F6YA 4P53A 5EIAA 1U6IA 5B6JA 4IFTA 4PRLA 1QRUA 1R88A 4LRSB 3MMSA 4RMIA 3H7AA 1QYRA 5KREA 3SDSA 4CQJA 2W2KB 4CMGA 2PJZA 1AIPA 2PMFA 4WN9A 1MX9A 4ZODA 2QLFA 4B2LA 3JRXA 4BO8A 4B3XA 2CDAA 1G0OA 4EARA 4RHCA 2CL7X 1KR2A 4BASA 1Z7YA 2AE2A 3M3PA 4GLJA 4W1QA 5G3ZA 4C3OB 1R7RA 2C1XA 2W2TA 3Q4GA 5EWLB 3P27A 2GETA 1PR3A 5L7YA 3N0WA 1JHZA 1RFGE 2BTQA 2JCVA 5ARCA 3RC9A 5FF9A 5BT9A 3NM6B 4KHPB 4DZTA 1DRUA 2GEBA 2ZJ5A 1LW6E 2QIPA 3GJ6A 2CMKA 4GH5A 3WL3A 4ESOA 4UOQA 1XRMA 3QVLA 1LDYA 1E61A 2UUPA 3DTYA 4F4FA 1KNXA 3NC4A 4ZEXA 5KOIA 3N5KA 3LKDA 1ZQ9A 2PS9A 4CM8A 1WDLA 4UUNA 3GK3A 3SICE 5EEGA 5CCEA 4YCDA 4EHHA 1U3GA 1UPTA 4G8JA 3TLJA 2BMFA 4GI5A 3BD8A 4HDNB 2FWPA 5KNBH 2GH1A 2QRJA 3ZNOA 3BIFA 4HFNA 1FP7A 4K3VA 4OMDA 4CG0A 1JWBB 2HJRA 3EGDB 2ANBA 3U4QA 3VDQA 2UVPA 1ML3A 3QHPA 1JSZA 4QUGA 1NTOA 1MABA 1V1JA 1WRBA 2GZAA 3DZCA 4C4YA 5M29A 4I0WB 4CFZA 2QG4A 3HFRA 1GTMA 1QAMA 3MWJA 3T4PA 1RYZA 5K3FB 1N9KA 3I9OA 4YRKA 2AG5A 5DVZA 3EPHA 3F3SA 3M6WA 2GESA 5DHTA 2JZOA 2YY6A 3P4UA 1L5LA 3SSMA 2FZGA 4JWTA 4HWTA 4DDVA 1N4AA 5I6DA 4KXMA 2Y6UA 3PC7A 2M9MA 1FYEA 3CVJA 4KDRA 3O93A 4RKQA 1X2BA 2GYYA 3C8ZA 1AHPA 2WG0A 1KSFX 2RMKA 3ESDA 3QU2A 5TXGA 5IHPA 2JH8A 3BMXA 3DTNA 1IHYA 1X38A 3ENVA 3IKMB 1CRPA 2F64A 3KJZA 3T5BA 1C3EA 1RACA 4MEAA 2G0TA 1MEOA 2FFJA 5DI9A 4RAOA 4EL0A 2VC2B 3FYTA 4KLRA 4PXSA 3TCNA 1JQBA 1SBTA 3P9QA 2GNPA 3U40A 3WLJA 3PP8A 2QE6A 3HKEB 1LWNA 1OXVA 3GLHA 1ADCA 4L0CA 2R8XA 2F67A 3AUJB 1IWPB 4DGSA 1NBEA 3N39C 4JT9A 2A9KA 3PYMA 2V5UA 4PXYA 1A2BA 4PFSA 1VG9B 4M6WB 5C31A 3S70A 1F5NA 1YJCA 5HKOA 1NZDA 1R6BX 3Q3VA 5BVHB 2D0PB 2H48A 2O2EA 2YZGA 3QIVA 3MTJA 2D3TA 4FYKA 3ZE7A 2NP7A 1UC5B 3FZGA 3O1LA 4WUTA 3IMGA 3HYRA 3O0TA 1J8QA 2VQEB 3HN6A 3CIFA 3OFKA 4HTFA 3W78A 4TL7A 3BT7A 5I7AA 1ZJ6A 3WGQA 3PXGA 3CG0A 1GRRA 4RH3A 4YP9A 4AJHA 2IFTA 3AOEA 5L3SA 2YS6A 3NHAA 2X2FA 2OYCA 2CLIB 3DOOA 4LRXA 1M1NB 1RHMA 4EATA 3IQEA 2OGTA 3L3BA 1CY7A 3H2ZA 3QEMB 4JB3A 2HSZA 1SBQA 4PAOA 3WYGA 4M1MA 4D9KA 3D3KA 4HAVA 4YRIA 2TYSB 4AO7A 2P6UA 4YP1A 3FLBA 3VAAA 4YPFA 5BQOA 2SKCA 3EARA 3TKAA 3UT6A 2AKEA 5HBRA 1ETHA 1NASA 4IKPA 3ZDCA 1CDEA 1V4VA 2ZI9A 3R3UA 3U9LA 4YMUA 1JG1A 1SU8A 2UDPA 1K4YA 3R3ZA 3SU8A 2Z9BA 1N1GA 1GUAA 1XEXB 1P2TA 2C3PA 4JKYA 1A5SB 4DIUA 5CPFA 4EB3A 2GQ0A 2JFFA 1OTYA 4UFPA 3AM1A 3QF4B 4FWIB 5HQ3B 5KYNA 1VLLA 4M8LA 1U5BB 4PYJA 1TYBE 4I5IA 5AKZA 1PI3A 3NQ41 4EAAA 3L6RA 1EX7A 2EP7A 4C7MA 3X2FA 3VISA 1M0SA 3EG5A 2BCJQ 1K7XB 3Q9LA 3ENZA 4LNUA 3NB0A 1X70A 2EJWA 4UMFA 2DYKA 3GD7A 2HCFA 5KSWB 3MILA 2B1RA 4J4TA 4XCXA 4PZLA 3NBFA 4KPFC 3GRRA 4NHEA 1AMUA 1QJ4A 3L41A 8ATCA 1TAQA 4Q16A 3ROZA 1Z4LA 2ZWAA 4QHSA 4ZCIA 3ZN2A 1FX1A 2QE7A 3LKVA 4U5QA 5BWMA 1UJCA 5C80A 1OXKB 4PINA 1A8QA 4S12A 3QE9Y 4ZVVA 5E2IA 4RVSA 1CETA 5E6UA 5C8YF 4W9NA 4CEIB 5HQJA 2BTOA 1G8AA 1XPOA 2FFQA 1XMJA 3AFMA 2GK3A 4IIDA 1JDTA 2HQBA 1P6UA 1WBDA 1JYEA 1B41A 4Q12A 1GQFA 2G9ZA 4P31A 4WD3A 1TL7C 3LMKA 4GP7A 1IN6A 2C84A 2G06A 2YW2A 3VOSA 1ZAKA 2YYAA 3FWZA 1Z6TA 4AKGA 4RVHA 4IX1A 1YQEA 2G5TA 1MAUA 4NDNE 1OB5A 2VJMA 3MJ4A 4TUYA 3S99A 3DLIA 4NATA 1OZGA 4FEGA 4UBLA 2GBPA 3QTBA 4BJHB 3IODA 4TLCA 4UUQA 4BN4A 3WGUA 4QREA 2J9ZB 2XITA 2RHJA 3OOHA 4GMGA 2EQAA 3M9LA 3Q3IA 2FPIA 2I1QA 4QATA 3RSHA 3RSCA 4BGEA 3OY7A 2GPTA 3WSVA 2AH5A 1E2FA 3W6NA 2BN4A 2H2HA 2PUJA 1EXMA 1H3EA 1ODSA 3DBHB 1E6WA 1G63A 1PD0A 1M1YB 2EEPA 3T1NA 5AESA 3ORFA 3MM4A 3LUPA 4BNTA 1YB4A 4JI8B 5EOVA 3U19A 5LFAA 1EFVB 2NTNA 2VZ9A 4K6OA 5D5PA 1T3LA 3EIFA 3OTQA 4K8OA 1HDYA 4N7MA 3DWEX 4NYJQ 3LXRA 1MX1A 3D4NA 4UAVA 2FP4A 4EKYA 3U9SA 3A6JA 4I5GA 4O0MA 2FZCA 4G3XA 1LU9A 4TV8B 3ZE6A 5BSKA 4GSLA 4HPJB 1G38A 2BGJA 3AEZA 1A4XA 4UATA 3V7NA 2W2LA 1GCIA 1M34E 1R4NA 3Q3CA 3KIPA 1NLZA 3K9WA 3R6WA 2O7SA 4EB6A 1S2DA 5AMXA 4NK5A 2CY0A 1VE7A 3IR6A 2VHJA 5CJJA 4GD3Q 1DIAA 1WCIB 1Q1NA 4LYYA 1JB1A 4HWKA 1EM8B 4D1YA 4RUKA 1O7JA 3E9ZA 3K4HA 2BH9A 4LRYA 4NBSA 2PMWB 2N0SA 1ZX1A 4ETWA 2I6XA 2H1RA 2PRSA 4IIVA 4KN9S 4NBKA 3WMWA 2O0KA 4BU1A 5HHTA 3H1PA 1VJTA 1NURA 5LQJA 2FSHA 3BIWA 4N03A 3N2EA 1S1CA 2I3DA 2XNHA 3KSRA 4L57A 2Z5LA 4Y6QA 2CZCA 4BFTA 2PZAA 1IVSA 1SXJA 4TYWA 4KN8A 5JSUA 1SK8A 3WL5A 4BFSA 1C3VA 3S6JA 1M7GA 2Y92A 2PGAA 2H2GA 2ZUVA 3G8AA 5E9JA 1OZFA 2F4VB 4ZDKA 4UJ5A 5CD9A 1Y80A 1L1QA 2QV0A 2ZW9A 1L7EA 1RLJA 4RJIA 2C0QA 2PUEA 1AV6A 1EP3B 1XZAA 1TLLA 1UXJA 1II9A 2CFTA 1ZPDA 3HGTA 4Q18A 4KK3A 1F48A 3MCVA 3OPNA 4W9NC 2RDMA 3UJAA 5NLLA 4NZ9A 3COSA 2KBFA 3K32A 1E2MA 4JLKA 1A9QA 3MMPA 1B1AA 2VDRB 4MR7B 3E15A 3K1AB 3A1EA 4PZPA 3GLGB 3QQPA 2BKVA 3KLNA 3NBZC 4A0GA 1LY1A 5BV2P 1QK3A 3LDGA 1Q95A 1QHNA 3DUFA 5JMTA 1AD2A 3IQFA 4CTJA 4EPRA 5ICGA 2HQRA 3RBXA 3GEMA 3JTMA 1ORIA 4XSHA 2QD2A 1MQSA 3I6YA 5EGSA 5I5GA 3TTYA 4YJ2F 1O95A 1H8HD 1B6RA 4V0QA 4L74A 1QG6A 3T41A 1RPAA 3IVCA 4O2AA 3IVMA 1H94A 2IS2A 1CUBA 4LGVA 1ESMA 4AO6A 4CPDA 1RM3A 1UC8A 2YXPX 3TI7A 3OJLA 1XVAA 2H51A 5HKLA 4R0MA 4XM1A 1USVA 3A2KA 3BH6A 5DIFA 1G5RA 4UREA 2OENG 1U1DA 5I7WA 2XRZA 2NSJA 3ZZ1A 1DWUA 4E5SA 4MROA 1E8NA 1UP6A 3H1EA 1P3DA 3SMVA 1ZBDA 4DRYA 3M9XA 4ECAA 4Z2AA 5DWVA 3MK31 5TV2A 4D9MA 1NC1A 4B82A 5KNLA 4QGAA 5LQAA 5JISA 2OO7A 2IHUA 4AZ0B 1PJ2A 4MV3A 3O26A 1WXWA 3EULA 2D4HA 3M49A 2OE2A 3FOAA 1DT3A 1GUDA 1OLXA 1QP4A 4OUDB 3KZKA 1J99A 3MRVA 4LDAA 3L04A 5AUQA 2R85A 3H2GA 4BTEA 1QX4A 4WOPA 1J07A 4TS9A 5EIFA 3V1YA 3PNLA 1I51A 3DOHA 4KK4A 4WNYA 5ADUS 1DLIA 1QVAA 2XTJA 5D7BA 1BGWA 2VT2A 2YMQA 1EDOA 4HVCA 1T8YA 1VKZA 3MLAA 3L0BA 1FE8A 2BE9A 4DMHA 2X0FA 4BO9A 2Q3EA 1PX2A 2XE4A 5AJVB 3VUFA 4BNVA 3T1HB 3HR7A 5EP3A 2MHCA 4JI3B 3AUUA 3JAWA 5JADA 5KMGB 3NGMA 5AI5A 2HU8A 4E2WA 1MZVA 1DZIA 3FUCA 4IJ6A 1PFKA 2XDWA 1PK9A 1WS6A 3WWZA 1P1IA 1PL8A 1IJBA 5DNEA 4RESA 5KJFA 5JNSA 1N0HA 2FEPA 5F7OA 5GAJA 5AD1A 2I2XB 1XYYA 1Z6PA 1GGVA 2KX7A 2G80A 2V3WA 4M8IA 4NR0A 4P54A 1O97C 3CN9A 3DDSA 3GBVA 4QX6A 3V3TA 3I04A 3A7DA 4W99A 2BDUA 2FZEA 1ILWA 1GV0A 1QV6A 3O8QA 4KTVE 4MWZA 1NVEA 5DGHA 2AEMA 2Q45A 3P2EA 5H02A 2FEMA 2GVZC 3C97A 1RLOA 1YQXA 3LUCA 1YZNA 3DP7A 4LQLA 4OHVA 1ZN8A 3NFYA 3GP5A 4S2EA 3GJSA 4X94A 4ZPJA 1ND6A 1JR3E 1MPXA 1X7XA 2BFNA 1EFDN 1H1DA 2FPGA 2VA8A 3AR4A 4WADA 4XVRA 2BI8A 3NOQA 3WRWA 1YCHA 1Z63A 2OCPA 2A1TS 3GHYA 3CX7A 1QHHA 3AETB 4UPEA 4Q3DA 3EXAA 4LJ7A 3ANSA 1YR2A 3GVXA 3KRTA 2ZBGA 5KOYA 3ZDYB 4QBFA 4QFBA 5KWIA 1YQTA 4X7RA 1MJ5A 5A5FA 2A0UA 3OF5A 4NESA 3CNNA 2QX6A 1G291 3JYQA 1IBSA 1CR4A 1BN6A 2I4NA 2WVGA 3EGCA 5AVJA 2RD2A 4YALA 4Z5XA 1A69A 1DBRA 1WU8A 2QF7A 2YHUA 4GE3A 1LI4A 1RWQA 3TNLA 3G1TA 1M2KA 2PX6A 3L06A 4TL8A 3CF4A 3WNQA 1UT6A 3QSGA 2V9CA 5TJHA 2D62A 1LJUA 2V7QA 4PQFA 4G0PA 1OKKA 4L4UA 4DFDA 1U0RA 1XHEA 2GVNA 4Q3NA 1UF9A 1PJ8A 3G49A 5I4CA 3OCYA 2ZUBA 3C39A 4IW3B 2GKGA 4MUAA 1M10A 4MXDA 4PCVA 5IZ4A 5F9FA 2HPVA 4B0OA 5KNDD 3UMMA 3L7CA 2QVCA 3PR1A 5JXGA 3JASA 4OJYA 1TEXA 3GLTA 4ESVA 3EG9A 1ZITA 3EZ2A 1RIIA 5T6MA 1YHNA 2NN3C 2Q8PA 4QDXA 4F1WA 4IHJB 4MK4A 1P2UA 2WYVA 3HXLA 4OLJA 3F3MA 3TN7A 2IL1A 1LSUA 3DE4X 1QONA 1G55A 1V6SA 1OBFO 3FVQA 1MO6A 3E9RA 3RYFB 4ABYA 4ARIA 2Q4DA 1HTWA 4OO3A 1CFJA 5IVHA 4FC7A 1ECGA 1T5LA 4TROA 1G66A 1SBHA 2O2IA 4OB7A 1FRZA 2HT6A 2ZE7A 3ENWA 2A8YA 4GT1A 3ZZNA 3SVTA 5FAXA 1DOZA 1OOEA 1T2FA 4UE3S 5CLLA 2YJ3A 1M7BA 3LQ1A 4G1BA 2JIQA 1J0CA 4I1RA 5CT8A 1CR0A 4NNPA 2X5NA 4AZWA 4DM3A 1U3UA 2LBPA 1I6KA 1ZRHA 2NGRA 2QTHA 4PAWA 2ZAYA 5CJ2A 3X1ZA 4ATNA 1Y8QB 4OXIA 2OBXA 3LX8A 3NIWA 5DTQA 4NENA 1C0EA 4BQPA 1OX4A 5TQ0B 2R96A 4D8TA 2GTHA 2P9BA 3I9FA 1GKIA 3IT0A 4DUYB 3P9SA 3AVXA 4LFAB 2CVHA 2F1IA 4V0MA 3UK7A 1L5GB 3AC0A 1DKPA 1LJLA 2Q7XA 1GAWA 2WW8A 3CCFA 3KXIA 1OLUA 4O25A 3KTOA 5D87A 1QKIA 1ULZA 2P91A 2QRGA 1X7WB 2GARA 4NRDA 2NO9A 5J3JA 3UJDA 4E2FA 1RM5A 3TLEA 3VU0A 3W1VA 3N1UA 1N5OX 2CMDA 5F78A 2C82A 1F38A 3NDJA 2HGZA 2Q3DA 1KYIA 3EXEB 4UTVA 2G5CA 2GEDA 3DKRA 4P86A 3QQ5A 1RRKA 3WV5A 3TRIA 1XXHB 2JW5A 5DGCA 2WUVA 1QIFA 3VNUA 2YY5A 2BKLA 2INGX 5DTMA 4TKVA 1KI4A 2VCYA 4ODIA 4RL6A 4ZGBA 3LKBA 1MIHA 1YB7A 4BGIA 1DPFA 5J9FA 1KH3A 2ZUFA 2E48A 2B69A 2GRAA 1SUPA 4V02A 5HF9A 1SBIA 3ZKWB 5ITWA 5IPFA 2ORED 1EFUA 1ONSA 3K9QO 4GBMA 3USCS 1RYBA 1YIOA 3K8ZA 4ZCRA 1NATA 5KOJB 3E1KA 3IT1A 2FG7C 4Z7QB 1SUAA 2JCYA 3H05A 3DH0A 2QQEA 4BZPA 1SULA 3BMNA 3GRYA 3DBRB 2GJSA 1IB0A 1NAIA 3I37X 4RKWA 5F21A 1UJ4A 2IU4A 3OM9A 2OV6A 4MUEA 4DUZB 1AGXA 4HF7A 3OZ7A 5BORA 4LZZA 2OHHA 5KYYB 3H5VA 2WHYA 3BE6A 3VV3A 4Y9RA 5IWCA 1Z5WA 3QU9A 4NL4H 4ZQIA 1FBNA 5K8CA 4O5OA 2PVSA 1KMCA 1RHRA 3COWA 5DW3A 1DPGA 1BX3A 3JYLA 3ZCRA 3L8MA 1T9AA 1NFRA 4YRSA 1D6NA 2R7KA 2CDNA 3C3MA 1NBMA 3M82A 5NULA 4TUYF 2AS0A 3IEIA 1RZRA 1JAIA 2Q0QA 2R5WA 1GGMA 2AQKA 3SSOA 3E58A 2OBLA 1PL7A 2X2OA 1NUTA 1OROA 4JYPA 3A11A 3S29A 4H4CA 2DWUA 5L3ZA 2B1JA 1QIHA 1Q21A 1JDPA 1E32A 2YQ5A 3ORYA 5DV9A 1Z68A 2OV8A 3H11B 5FPHA 4QRIA 5BV0A 4YDQA 3JQEA 1MA0A 1CUGA 3NUZA 1OHHD 1R27A 1OYOA 3IUMA 1QM5A 1HYHA 3D8HA 4P35A 4QM7A 1SKUA 2FP4B 4WHMA 1NXPA 1UWKA 1YZTA 1M5UA 4JWKA 4QNNA 3A28A 4V03A 4LBWA 3TR0A 2QMHA 3RTAA 2AFHB 2ORWA 5K0LA 2DHQA 1R9MA 3GFBA 1KFJB 3QPWA 3RIEA 2UYHA 2GJAA 4QTTB 3QU4A 1CY2A 4ZT6A 5TMPA 2VTEA 1C30B 1YCFA 1JLRA 2B94A 2EJTA 2DKFA 4JK3A 5CFRA 3K5HA 2QHXA 3LXMA 4KIFA 4M1OA 4KSBA 3ZOZA 3DNFA 3B60A 3F71A 1TZ2A 3P7MA 4URXR 2JLXA 4KR3A 2YV1A 3NGLA 4HCJA 3U13A 1QRRA 1ZNZA 3OJ0A 1JZQA 3D8RA 3IQDB 1SKYB 1QH1B 2DZDA 5L7WA 2BC9A 4W5HA 2W22A 2A67A 1NVVQ 3L1HA 4IIGA 2WNSA 5SY6A 421PA 3N28A 4XIFA 1P2SA 2IW1A 4N01A 4RK6A 1C1DA 4YAIA 3WO1A 4BBJA 1SOAA 1JPUA 1HWYA 2H8KA 5C8YB 1RKQA 2NU6A 1R5NA 2X86A 5GVRA 4R9NA 1DTSA 3HDTA 3L0IB 1XDDA 1NT4A 1ZD2P 1I4OA 1T0PA 4D25A 3DAGA 4RADA 1J8FA 1E4YA 2AE1A 2WAYA 5GMOA 1IZ9A 3Q7SA 3SM9A 4OQ4A 1Q15A 2P78A 3LO5A 3O84A 2VP3A 4GX5A 4YFYA 4FFSA 2SNIE 1CEXA 4XPIB 5B3JA 2JBAB 3RT9A 4CMCA 1F2VA 3CGGA 4AWBA 2VSFA 1GFWA 3G79A 2WSSA 3OT4A 3DW3X 3TNJA 2GPJA 1SCUA 1VSTA 4JLJA 2VPZA 1FDWA 2VTDA 4UQLA 4FMCB 3FPSA 1GU7A 3H11A 4MP3A 3UG6A 2JIOA 5ALNA 3HK2A 2JCXA 1XNRB 3RTGA 4PRYA 2YBEA 5JAZA 4MQUA 2GF9A 4YJ2A 1OU0A 5F5XA 3AY3A 3W2HA 3GLFB 4WXPA 2A84A 2QZ4A 1VBFA 1BDMA 1ZLXA 3C85A 2VJCA 1B23P 1VI5A 3D4LA 4BXOB 3H5RA 3T5CA 1MO4A 3FCXA 3AUTA 4BQOA 4ZCMA 3AIIA 3LHFA 3T1TA 3U56A 1OYVA 4BPBA 3ANMA 4RKEA 2G25A 2XQGA 1Y9ZA 1NLUA 2WD7A 2PSJA 1N9GA 2R79A 2ZETA 2B4QA 1C7ZA 3UA3A 5CDHA 5JNUA 1JKXA 3PTAA 4PIMA 3JD4A 1XTVA 3TMKA 4DTIA 2XF2A 2DAPA 5DK6A 3V4FA 4ZYUA 3D0RA 3M1AA 4DLZA 4U7PB 1Z4MA 1KYXA 3TZKA 1QBKC 2HLPA 3ZV4A 4A0RA 3WHKA 2F7SA 1ZUNB 3CYFA 2M2IA 2G70A 1L9XA 2XB4A 1P1RA 2ACVA 2NLOA 4INPA 5LBUA 2H1VA 3WDSA 3ZUGA 1XEFA 3UK6A 4AJOA 1YBVA 1NNEA 1LI5A 4IVRA 5KTPA 3U37A 1K89A 3BPSA 3I8SA 1VG8A 3BHMA 3HXMA 5A3JA 1TAUA 1Q6ZA 4LSMA 3TOXA 5H3LA 2JB9A 4N7BA 2OMEA 2GPWA 2Q4OA 3W4IA 1XTIA 3ICCA 3NASA 4O33A 3HEMA 4DC1A 5BUCA 5I3ZA 4HLQB 5L4NA 1AE1A 3O1IC 8GPBA 3EDCA 4LRTB 2P1DA 2QN2A 5DX1A 1U8XX 4ZT4A 3IEMA 3JS5A 3JQQA 4BRSA 2Q1WA 2XMPA 4V2UA 2V3CC 3K94A 3CU5A 1OYWA 4EOGA 1ISIA 1WOMA 3FWYA 3CVVA 5DN6D 3UM9A 1LNQA 1L4BA 2IWHA 2G9UA 1H6DA 1OGYA 4BJ5A 4BLRA 4E2ZA 1ZJYA 5CPBA 3GLRA 3I5XA 5FBZA 1AURA 4C06A 1PU2A 2K6GA 3N53A 4ITRC 4L8FA 3DB2A 5F5NA 5L6MB 3OQ1A 2UUAB 1ZESA 4BIMA 4JVSB 5CA0B 5FIUA 2WWVD 1YZ3A 2GKOA 5EXEA 2VT7A 5CG2A 2LV8A 3BJIC 4RLHA 3T34A 1NE2A 4C21A 2PYDA 4WOBA 4D0GA 4ISBA 3KCNA 3AERA 3R3WA 1NOKA 4F11A 2VF8A 3LKZA 1LV7A 2C7BA 1QGED 3AESA 1QRSA 2WLTA 1Q3HA 1C41A 2X7HA 1KIAA 3PCTA 2LRHA 3X1YA 1AOXA 4XLLA 3ZVRA 4BFVA 5IJXA 5KQPA 1Y7IA 1Q0QA 1SPBS 2V0GA 4DL9A 2FSGA 5DNVA 2J3IA 3VJKA 5IMSA 3KQLA 4W9MC 1BX0A 1UZLA 3RF6A 1ZMTA 3BMQA 3MPOA 1UDBA 1MTZA 2GBIA 2OBBA 4P7GA 2FE1A 1PV4A 4TKMA 3V1TC 1BA2A 3NHJA 3BWXA 4MEBA 4QOEA 3QOYA 2HJ9A 4RA9A 2JASA 2CD7A 5AKJA 3EWIA 5CBKA 1HL7A 1UXHA 1Z17A 4PC6A 3B5EA 1P60A 3SCZA 1ZCZA 5CEJA 4D9FA 3I52A 3H6GA 1Z4NA 2EFHB 2J6HA 4RLFA 2E85A 3VAZA 5K9ZA 7MDHA 4TMTA 1F0YA 3PLAE 5KNBD 3BICA 3BRQA 4G5GA 4G4GA 2OHFA 2O5EA 2FWIA 4TTVA 1XJWA 5ESXA 4MIEA 4JR0A 5CX4A 5IKXA 1YQUA 1V43A 2NZYA 1J1ZA 4N8SA 5JZMA 3O3NB 3FD8A 3W77A 1RE0A 1URPA 3FA2A 5LR6A 3A58B 3CVXA 4F6CA 2AJBA 3WLMA 3PUZA 2J0QA 4G37A 4COKA 3JZAA 2W43A 1U0NA 4YJ3F 1SOWA 5ULLA 5LBIA 1Q0SA 3DT6A 1N2CB 2HA6A 4D56A 4RO0A 1BMQA 4UNNA 3LLUA 2W8BA 1YR1A 2QTMA 3UC5A 5EIXA 1MJGM 3LAWA 3LQ4A 3WWYA 1DKRA 1LDMA 2VJPA 3FCSB 3PUYA 2OEPA 3NXSA 4P92A 5B3JC 2ECFA 4MLCA 3TZEA 2OHIA 1Y6JA 2W7TA 3OZDA 5IN4A 1QHHB 2NNWB 3JSAA 4WY5A 1YQGA 1EFRA 4HI0E 3VM6A 2FZWA 1MZPA 1LPNA 2ON6A 4P4LA 3F9CA 3G23A 1E7SA 1T8WA 1UEXC 3T5DA 1XVLA 2H06A 2HNAA 2AT1A 4IIJA 4L6AA 1F4VA 2I66A 4RELA 1J24A 3A2NA 3QVVA 2AEFA 4Y1EA 2OQ2A 5AKYA 3NNNA 1TM5E 5FYQA 1COWA 1E59A 3T3IA 2XWQA 3QP9A 4D98A 4KR7A 1JAXA 3QKSB 1NRWA 3QFHA 4GMDA 1VOTA 4LWPA 2FPPB 4LGCA 3UCFA 4F3CA 1X1QA 5KMGA 2JLZA 2O7RA 3NJ4A 3O8BA 3O0DA 4TS3A 1SZPA 2DLNA 2GOYA 2OTCA 3MN1A 1GZSA 3TSZA 5ICMA 1C30A 4AY4A 1OBVA 3CC8A 4H16A 2YN2A 2P90A 2JK0A 2Q5CA 3VHLB 4F45A 2OZPA 2X40A 2CXSA 3USES 1ESZA 4RQTA 2C5BA 3FKJA 2BZSA 1WKCA 3SYTA 3IAHA 1KI9A 2BFWA 3EZNA 4MPPA 4FD3A 4J9VA 5BV8A 2O50A 3I1JA 3IV6A 5G4LA 2X3FA 3WKEA 3DTVB 5IDVA 4M76B 5E1MA 1WSWA 3TIIA 3ZE9A 3RUIA 5A06A 5JSHA 1VPWA 1Z15A 2FPMA 4Y1FA 4NSNA 3Q5EA 3RROA 4BNIA 1OXUA 3LX4A 1YRLA 3H2IA 1JB9A 1UOQA 3H17A 2JLVA 2OG1A 3L7NA 4X44A 4CL3A 5JZSA 1OUMA 2QUAA 1LH0A 2X3YA 2EYUA 5LOVF 2R0QC 2C7VA 1NBMD 2FSVA 3IDQA 3FPJA 1KE2A 5BWCA 2A7XA 1DE0A 4CQMB 2FNAA 4KHZA 2XNDD 2QVXX 4RTPA 1XF1A 2PM8A 4GKJB 1JNXX 1UBCA 2WT9A 3G0DA 2VYVD 3MA0A 4FFBA 3SLGA 4BQQA 4ZANA 3Q5DA 1DXQA 1CR1A 1PJCA 2DU8A 2V58A 2C31A 2J3DA 4P98A 3X2EA 4RACA 1R4AA 1SVNA 1XQ1A 1NSFA 1YJ5A 2CK3A 2IA5A 3DMTA 3TG2A 4A0FA 5A5EA 1DC8A 2Z4RA 4FBGA 3E81A 2FR8C 4U02A 2JCGA 1A2OA 5HEKA 5KWVA 2EL7A 5EE9A 2J9XB 4IUBS 5J4YA 3NHRA 1Z74A 4K88A 5F3DA 1K6JA 1T25A 4P4SA 5J2UB 3TXXA 3FOFC 2CXNA 3CUVA 4GFDA 1TLTA 2FN7A 3EGIA 3GJZA 1NI4B 4K9SA 1XX6A 1KQPA 1JEYA 3FE2A 1WUIS 2QVBA 1SUCA 3CLKA 1YRAA 4LOJA 4P6VF 5KTMA 5KKCA 2NTEA 1Q0ZA 2JI9A 5KEIA 3CBGA 1XVUA 3JU3A 3QUSA 5LMUB 1UAGA