3O2QB

Crystal structure of the human symplekin-ssu72-ctd phosphopeptide complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Symplekin
publication title Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o2qB01
1ISSA 1W9HA 1F51E 4HNQA 1DBWA 3Q7SA 4RXMA 3BBLA 4L85A 1GLGA 5GOTA 4Q6BA 4OATA 3MIZA 4M88A 3FFXA 1Z17A 2RJNA 1NXPA 2TMYA 3H5VA 1NXOA 4MR9A 1TM2A 4MQEA 1KRWA 1C4WA 3L6UA 3OLXA 2PE5A 4MR7A 2FEPA 4RK5A 3QEKA 3SNKA 3LFTA 4MR8A 1NXSA 4JAVC 2MSLA 1JLKA 5TPWB 2ZAYA 3OM0A 1S8NA 2FKAA 2QVCA 1BDHA 2OENG 3T38A 4WT7A 3RVQA 1KMIY 1RNLA 2F8TA 1XWWA 2PUFA 3CU5A 3EQ2A 5DGCA 5JNSA 1EWTA 2FEWB 4EY3A 4RXTA 2CHEA 3RH0A 3O1HB 1Z2EA 4XASA 1U2QA 2PUAA 4FB4A 1BDJA 1QP7A 2J48A 3OLZA 5TQ0A 3NNSA 1DC7A 2PLNA 3D02A 3HZHA 1M2EA 4HNRA 2PAFA 4RY8A 5TQ2A 3KS9A 2ZWMA 3T6KA 3M9WA 2FMFA 3IP5A 4GPAA 2GKGA 4N0QA 1NXWA 1ZN2A 5IUJC 3OLWA 5TQJA 3QLVA 1FFSA 5D2CA 1USGA 1ZH2A 3LUCA 3FMVA 3NHMA 2L17A 3QLVC 4ML3A 3A0RB 5FWXA 4W5RA 2JBAA 5DCLA 4ZJPA 4L4UA 1NXTA 1MVOA 1QPZA 4JB0A 2PUDA 4FE7A 1JL3A 2RJOA 5IEJA 4EYGA 3H5LA 4YV7A 5TPZD 4IGAA 1EWVA 2WMYA 3C97A 4WXMA 5PNTA 3SAJA 1B00A 3LKBA 5KQMA 5CNMA 3TO5A 1QMPA 3H75A 1AB6A 4E7OA 3RVOA 1U04A 3FGZA 4KNYA 4LDAA 1FFWA 2R4QA 4RY9A 1ZAYA 1Z13A 4Y9TA 1F4VA 1SXIA 2NUBA 5GQSA 4MQEB 4KPYA 4QYMA 4KRFA 2LPMA 4MR7B 3W9SA 3MM4A 1TVMA 3CFYA 1QQAA 3I45A 3N0XA 4MR8B 3OO0A 2MYTA 5TPZA 5EWMA 2IYNA 1AB5A 1Z16A 1DCMA 1NATA 2FQXA 1MAVA 3CG0A 1L5YA 4IILA 2PL9A 1QKKA 3C3MA 5CNKA 3JVDA 2CWDA 2CHFA 4RWEA 1ZHHA 2HJ9A 3OQMA 1DP4A 2W42A 2IPNA 5KC9A 4Z9AA 1JF8A 3BRQA 3O75A 2PJUA 1MIHA 4W5NA 1P2FA 2IDMA 3QLTA 2JCGA 3C3KA 3F6CA 4LE1A 4TMYA 4EVSA 4YR7A 3M9XA 2E4UA 1YTUA 4IMJB 3IP7A 2H0AA 2GI4A 4YLEA 5TQ0B 2GBPA 2JVJA 4CBVA 2MSKA 3HCWA 4JA2A 1OXBB 2FLWA 2HQOA 1JBEA 1JH9A 4RU1A 1USIA 2M1ZA 4O1HA 4N47A 3Q15C 4YGXB 4N0PA 3KHTA 4NQRA 4Z0NA 4Z4CA 1PNRA 5EWLA 4DADA 1TLFA 3EAFA 2WJAA 3URMA 5FWXB 2MSWA 3GV0A 2BGGA 4RY0A 1GUBA 3JPYA 4XXHA 4RK7A 4Z9BA 1EAYA 5CNIA 3VNAA 3FFTA 2FXIA 2P4UA 1ZVVA 1GCGA 2QV0A 4OTZA 1JX6A 1Y1LA 3RVRA 1BVHA 4WXEA 5JNWA 5B3JA 3HSYA 3H5OA 3EJWA 1CHNA 2I6FA 1Z12A 2N9UA 1Z26A 5B3JC 2H3HA 2FQYA 1VPWA 2E4XA 2B1JA 3O21A 3O2QB 1M2FA 2LIVA 3H6GA 2FLKA 3GA5A 4MPTA 3H5TA 4IF4A 3HVRA 3HEBA 3RVMA 3MMNA 1GUDA 4RK0A 3R0JA 5E3JA 4QYWA 3HO1A 2R47A 5KQLA 1P6UA 4Z4IA 4RDCA 3Q41A 4KVFA 5IC5A 1H9CA 2VUIB 4RV5A 4YS6A 3O2JA 4H60A 3RVPA 4KV7A 1ZITA 4YRZA 4KK3A 4PYRA 5IEBA 2QXYA 4RK6A 3O74A 1ZDMA 1QO0D 2JRLA 4LDZA 1UDRA 4N76A 4E7PA 4MS3A 1QP0A 1QP4A 3OQNA 2RGYA 1E6LA 4NV3A 1ZGZA 1PEYA 3OLVA 1NTRA 4LE2A 3LUJA 2MYPA 4RKQA 3H1FA 3NHZA 5BR1A 1KGSA 5I4CA 4F3TA 3QX8A 2FW0A 2L19A 4EYKA 2HPHA 4MQFA 1JYEA 1P6QA 3K4HA 2PUEA 4FE4A 2QU7A 3UUGA 2NZVG 4DN6A 5JNRA 3DLBA 2F8SA 1QO0A 1M5TA 2FMKA 1T34A 3F73A 2XDYA 4RS3A 2HQBA 4XAQA 2LBPA 5ED4A 3RQIA 1ZGGA 2WJWA 4G0QA 4H3KB 1NXVA 3SY8A 5JNUA 1CYEA 5EWLB 1OXKB 4EUKA 5JS2A 5C5CA 3NBMA 1QNLA 5TQ2B 2E4VA 2IKSA 4O1IA 4EVRA 1RXIA 3H5WA 1EHCA 4G0PA 3LUHA 1JFVA 3M6MD 4IRXA 2RDMA 4W5OA 1R8JA 1M5UA 4UHKA 4F12A 5HM6A 4EYOA 3DLHA 3B2NA 3Q9SA 2FMIA 3RVSA 3SQNA 3RVJA 3LTEA 1YMVA 4ZMRA 3OQOA 3QLUA 1SXGA 1K66A 3F7NA 4EGSA 1YS7A 2Q5CA 9ABPA 1YK0A 1JDNA 3QLUC 2A9OA 4MR9B 1BA2A 4JASB 3VNBA 2FSPA 3KJXA 3TMYA 2GWRA 3QK7A 4RK1A 1DG9A 3TB6A 2MYNA 5BRAA 3TD9A 1D4ZA 1J56A 2FN8A 1JFSA 2GX6A 1D5WA 1USKA 3Q7TA 3HDGA 1RPJA 4H3HB 6CHYA 2QW1A 1DC8A 1FQWA 2PL1A 3N6VA 2QR3A 4F06A 4S05A 1XHFA 4IMIB 1E6KA 5KQPA 1LBHA 4OG2A 4GNRA 3BILA 3CRNA 3JPWA 5FWYA 4W5QA 4XLTA 2X7XA 1RZRD 1CEYA 4LZLA 1U0SY 2MYUA 5EWJA 4KZKA 4MS3B 1Z25A 1JHZA 3JTEA 4N03A 2WB4A 1C0EA 1DZ3A 2FEKA 3IPAA 3OMXA 3C6QA 1JDPA 4KK4A 3HK2A 1EFAA 3ROFA 2FTKE 3UKJA 4P1ZA 1MB0A 3LKVA 5HKOA 4N41A 1BDIA 1VRVA 1YS6A 4O5AA 3OLYA 3QX9A 4QPJC 4Z99A 3P9YA 4G0XA 4HYEA 2JVIA 4TN5A 4YWHA 3RVLA 3EQZA 3SG0A 1RZRA 4PICA 1ZY2A 2PUCA 4MS4A 4RK4A 3GRCA 3KTOA 1U2PA 1W25A 3BREA 4Q7EA 4ZPJA 2M98A 1DBQA 3I09A 4G0OA 3EODA 3MQ4A 4WZZA 4D6YA 5KI6A 3N53A 1U8TA 5JNVA 1WETA 3LUFA 2JBAB 3UK0A 1BAPA 3IDOA 1Z2DA 3EGCA 3KCNA 3CZ5A 3QELA 3S99A 1RXEA 1JWLA 4JB2A 5KQGA 3KYJB 2PKXA 3N8IA 3OM1A 3N0WA 3O1JC 5IULC 4XARA 4ETIA 3ILHA 2L2QA 4KMRA 1E2BA 5IX8A 3CKMA 2IPAB 5BRJA 2HSGA 1LBIA 3HV2A 2A9QA 7ABPA 1SD5A 2FQWA 5KWSA 3BRSA 4ZYLA 3GBVA 3CG4A 3HXMA 3ROTA 3HM9A 2R25B 3N0RA 3KLNA 5EWMB 1ZH4A 4WWHA 5IUNC 3LUGA 4MYRA 4TLMB 4Z4GA 1A2OA 3JVIA 4P98A 2O20A 4Z4EA 1A0OA 1GCAA 2JB9A 5FWYB 4EVQA 4NCBA 1FSPA 1LJUA 4YCSA 5DKFA 3LUKA 3KLOA 5EWJB 1URPA 2FVYA 3Q7RA 1PNTA 4B09A 3G1WA 3GBPA 2VUHB 4G97A 3I5AA 2FN9A 3H1EA 4Q6WA 3KYIB 3CHYA 2DRIA 2YHAA 1Z18A 4XFKA 4ETNA 4TLLB 4NCAA 2V0NA 3L49A 4PZ0A 4UHJA 3FFWA 1APBA 2R48A 3CS3A 3DGFC 4EYQA 5KC8A 3D8UA 2QZJA 2OQRA 4MS4B 8ABPA 3F6PA 6ABPA 2E4ZA 2NZUG 4MS1A 5HSGA 4PEVA 3NNNA 4S04A 1E6MA 1IIBA 1JFTA 5DTEA 2ID7A 5HQJA 2AYXA 3DGEC 3NNDA 3RVKA 2QVGA 1DBPA 1DCFA 1I3CA 3A3KA 4MLDA 3QELB 3MA0A 1JYFA 2PUGA 4OBBA 2A9PA 1A04A 5JNTA 2NT4A 1DJMA 4KQ9A 3O1IC 3RVNA 4QICA 2HQRA 2JK1A 3OO1A 5F64A 4Z4FA 3KG2A 3I42A 2L18A 3OMWA 1Z15A 2YHBA 3K9CA 1SRRA 2KYRA 1DCKA 1ZESA 5JS1A 3DZDA 3CTPA 3GT7A 3T8YA 1K68A 1ABFA 3KSMA 5IBQA 3H5IA 5FBKA 3T95A 2FMHA 4MRMA 4WUTA 3N75A 3QEMA 1YK1A 4RSMA 4MAAA 4ZMSA 4MLCA 1TJYA 4RKRA 3MF4A 5TE9A 3IP9A 4D6XA 3HUUA 2VK2A 4HNSA 3CNBA 1DRJA 3JY6A 1TMYA 3GYBA 3LUDA 1P8AA 2JVKA 3A10A 2IPMA 4KFCA 4JP1A 3LUAA 4ETMA 3CZCA 3HDVA 1PUXA 5DLEA 3EULA 4YO7A 3E61A 2E4WA 1HEYA 1D1QA 1EWKA 4G86A 1MB3A 1KRXA 4PE5B 4DQDA 2QSJA 2B4AA 2P9HA 2LP4Y 4G0YA 5CHYA 1XHEA 4MQFB 5TPWA 4LE0A 2PMCA 4G0ZA 4MGEA 5FBHA 3GWGA 3H6HA 3MYYA 1FFGA 4OLAA 3G85A 3C3WA 4MS1B 4D74A 2ID9A 4F8JA 1D1PA 3HJFA 1YVUA 2WWVD 1LK0A 2WRZA 1ABEA 3HUTA 4JOQA 3SM9A 1VLZA 3O2SB 4YP9A 2A9RA 4G0MA 4KQCA 1NXXA 1D2AA 1YMUA 3E3MA 3JS5A 5ABPA 4Z4HA 2PUBA 1ISRA 2IPLA 4LX8A 3LMKA 3KKEA 4W5TA 2NT3A 5BQ3A 1NY5A 3IPCA 4NICA 3DBIA 2AYZA 4KREA 2E4YA 1QQBA 2IOYA 5T7BA 5T3YA 3A0UA 2WY2D 5C5EA 2LUOA 1VKRA 3CLKA 3ILYA 3EDCA 1PEAA 3H1GA 4LRQA 3GL9A 3IP6A 2VYCA 2CD7A 1L5ZA 4MRMB 3HS3A 5CNJA 3QEMB 4F11A 3LOPA 1DRKA 1PHRA 1YIOA 4RXUA 3FDFA 1SXHA 4RZSA 5IUKC 4OLBA 3TX6A 1LJLA
chains in the Genus database with same CATH superfamily
5KOHA 2LV8A 1ZRNA 2ATIA 1PFGA 1RIIA 3BBLA 3IQWA 4FQ7A 3ISJA 4L15A 5EEHA 5GOTA 3WR5A 1Y89A 1RJ9A 2DP4E 2NZ8A 3DAYA 2CFOA 2H5IA 5ECGC 3FFXA 3H5VA 1LPBB 1TM2A 1XSEA 1JQEA 2YRFA 1EVEA 1MC5A 3OLXA 4AQDA 5I7WA 2WC1A 3W5CA 2IZ0A 2H1WA 1MB4A 4BX9A 9GPBA 3IQHX 4JI5B 3VA7A 5TT1A 1V8PA 3HJRA 4WZAE 3Q88A 4D8YA 1J0XO 4AZ3B 4GX0A 1OBHA 2R4TA 4LRWA 1MJHA 2FLVA 3UXHA 3ZC3A 3UMMA 3PGXA 4BQRA 2OYSA 4DQLA 1SVMA 4WT7A 4CZ2A 4E31A 1JDSA 4G1MB 4G84A 5K45A 4DCTA 1U6KA 1XI2A 2WA1A 4GF5A 1PDVA 2WHXA 3AHHA 3L0SA 3R3UA 2Z6UA 2X5NA 2Z4SA 5FADA 1N3BA 4EY3A 2VJAA 3MB8A 1UJ5A 2RHRA 1GFZA 5FV7A 4EJ0A 3HUFA 5CTAA 2XUDA 3F6RA 2WIDA 1WQ3A 3Q8KA 2WZDA 2J48A 3MMXA 3ECCA 3MWEB 3ZXUB 4C5CA 1RPAA 1SEPA 5K0SA 4AS1A 2FW7A 1VSUA 3JWGA 3C98A 4C6SA 4YP6A 3WFIA 1GL6A 5D8DA 4ZCIA 1U63A 4UZEA 1SKQA 3OZ7A 1C1XA 3RTEA 2LDBA 2O5RA 2YICA 1FQKA 1LX6A 3DFUA 4IG9A 2Q3FA 2J4DA 1NWCA 1XL1A 4URYR 1WY5A 3H1PA 1GNPA 3CCCA 4N49A 5CCDA 5IUJC 2QP4A 3GJYA 2XZDA 4CG1A 4GW3A 1HI9A 2Q8PA 1OTXA 2WWFA 1OXSC 1FX0B 2HA7A 4QYIA 1MGPA 3O8OA 1O97C 1N2HA 3P7MA 5JNLA 4V0RA 1GHTA 4NEHB 1YDWA 4Q05A 3JYPA 3CB2A 1CHDA 3VC1A 4UQOA 5EJ5A 2XRFA 3H5LA 1TFUA 2W4MA 3UOWA 3DLTA 4WBSA 4D9GA 1M54A 3JWIA 4BVLA 4LECA 4DRZA 5KQMA 1IHXA 3OLQA 1P2DA 4ZQIA 1YS2X 1O96B 1PTJC 4YJGB 4JKYA 4EHBA 4E7OA 3ZOZA 5KHLB 1L5VA 3HB7A 3VPFA 4KIUA 4LRTB 2IUTA 2PX3A 5AW7A 3DDUA 1TJ3A 2O7RA 4BO9A 4IYJA 4RD4A 3LHKA 1F4VA 2CGEA 4M0LA 4IOLA 1UK7A 1HUQA 4AY5A 3I5UA 2P6UA 1PZNA 2RE8A 4ZVUA 2CCGA 3I2HA 1D8AA 5K4AA 2XI4A 2OO7A 2HSJA 1CNFA 2EBUA 4O3FA 3GDHA 3MJFA 1BFDA 1RMYA 5BT9A 3M5WA 4G4SO 2PGOA 3S8MA 3R7WA 4BX2A 2H5JA 3C3MA 4KWCA 3LC0A 3JVDA 2M6RA 5CNKA 3HCFA 3R09A 5JW6A 2PV7A 3INGA 2HJ9A 4KQGA 4A0FA 5AVRA 2XD4A 1DP4A 4JT2A 2IY9A 3GLIB 4U00A 3F9IA 3Q9NA 5TIIA 4ON9A 1E61A 5AJTA 3FI0A 1MZPA 3DEJA 2X58A 4TXNA 4YJHB 4B31A 1RKQA 3KT8A 3QLTA 3H99A 3E4CA 3KEFA 2QY6A 1LPNA 3EZYA 1Q91A 1A9TA 2ZIXB 2Y71A 1P62B 1EFRA 1YZKA 2BEVB 1Z0SA 2CYBA 4M37A 1KK3A 1SCDA 2A4KA 3O4FA 4R0MA 2BVNA 2JGAA 2VBCA 3DOOA 4BO6A 1IULA 4BIIA 1R6TA 3OKCA 1NVDA 2NXEA 2QX9A 4TTSA 5EHXA 5LZ4A 3N2GB 4C9BA 2E89A 4RANA 1AV7A 4PYOA 3KTDA 4KO4S 2YIDA 3VAAA 2O59A 1UCFA 2VDJA 1U2DA 2I6GA 4HQKA 4GR9A 4BNLA 7MHTA 1Q7EA 1E0SA 4X45A 1E4EB 1TF7A 5AUOB 4AKGA 2HXYA 2MSWA 2BFDA 2NSYA 1XZGA 2HSZA 4NS1A 4BVJA 3K9QO 4LY0A 2I34A 3LQYA 1Q0HA 4MHOA 5BNWA 1LNSA 4OTZA 1DV2A 4DPLA 3LY5A 3D6MA 1K9SA 2I1VB 3L40A 3MT9A 5BVGA 1WTCA 5H80A 2YWRA 3TQFA 2I6FA 1NRIA 1P31A 2QVBA 2N9UA 2WHYA 3D7NA 4LFCB 1COWD 3QXJA 5ENVA 4AP5A 1SHZA 1YQ9A 3VR6A 3ZBPA 2VTVA 3GAMA 1RFLA 3L02A 2FW8A 4PHGA 4KRGA 1E2PA 1PQUA 1YACA 4JYAB 1OLSA 2ILTA 1QHYA 3FYDA 4DJFC 1IE3A 5D01A 2X4LA 5LQCA 1N2GA 3FPAA 1L3CA 3LQQA 5E3JA 1F12A 1SC9A 4FONA 4KJXA 1YR2A 4P5PA 5EXDA 1GTJ1 5CX4A 4I9NA 3COJA 3E9ZA 1L5WA 1CE8B 4FZVA 2RHJA 2XNSA 2VUIB 2N1BA 3QU9A 4JZKA 3TLYA 2AC4A 2JI6A 2X9NA 3K1YA 4AO6A 4JD5A 5IEBA 2I55A 2K7ZA 3W6PA 1KP2A 2ISSD 3I1FA 3WGTA 1NZFA 2PUTA 1H3FA 5KYXB 4TL7A 2VBFA 4HRYA 1UDRA 3BXXA 3ZKWB 3OZDA 1L5MA 3IKMB 3KSZO 1YU9A 1TVCA 2FA9A 2FP4B 4WMLA 5KVQA 3T9FA 4YRTA 2O5EA 3ZVMA 3IO3A 3NEAA 1T1GA 1NJ5A 3TSYA 1EU1A 1WB9A 4GMGA 2W6MA 4GSKA 3OEHD 4IDOA 1F2DA 2FUG6 2OQIA 5AXAA 1M1NB 1N6PA 4ALIA 1ZXLA 4EYKA 1M2VB 3QYJA 2C4HA 4MKXA 4B5LA 3Q2IA 2BLLA 3SDBA 5JYCA 1T8SA 1N92A 2FMKA 3G2QA 3KKPA 3DL0A 3TXYA 3Q6IA 5BSGA 2HXSA 3ROMA 3JXEA 4KG7A 1L5SA 5JNUA 3KVNA 1Z8HA 1XV5A 2BHSA 2O1SA 3VR2A 1SA0B 3WISA 4QJBA 4BGIA 3VNVA 3RF7A 5LMNB 1GQRA 4PFQA 1RXIA 5DM1A 5KTYA 1BC5A 1J90A 4NRDA 3I9NA 4QPCA 1X80B 2BFEA 1XTTA 4MV4A 5DCUA 1N1EA 2RDMA 4LBVA 3TUJC 1BQ3A 1XFAA 1MJNA 2ALJA 1PTJA 1P77A 3MXTA 3VV2A 2DPYA 3LHSA 4FNAA 4NXMB 3U7FB 3U4HA 5AM1A 4JYBA 4X97A 5AYVA 1B15A 1BHJA 4DDWA 4EL0A 1A1VA 1OYYA 2PX8A 3HYRA 1XAGA 3MMPA 4MWZA 1ST3A 2QGZA 2FEOA 2I2FA 5DBGA 1R5BA 4EGSA 5IFKA 1AJEA 2WJYA 1VGVA 5WRFA 4CLXA 2PH5A 1BA2A 4P3KA 5CMLA 5JCOA 1ODIA 3DYBA 2QIOA 5H3LA 5SY6A 1Y6QA 5IASA 1UBSB 2GNPA 3HYTA 5DMHA 5E2BA 4EW6A 4YUYA 2O1WA 2LZ0A 5KEIA 5DU2A 3CNLA 1JFSA 1UEIA 3RAJA 1PYGA 1TRKA 1USKA 3WIUA 3EA0A 1RPJA 1U9CA 2CXOA 3KQPA 4DM4A 4E5DA 3J81A 2GB4A 5H5JA 3WZMA 2R8BA 3BQNB 5BO5A 2J6CA 3AW9A 4RETA 1I3KA 1QK5A 1TK2A 3CLTD 4NE2A 3WICA 4GNRA 2MSCB 2PTHA 3T5PA 2O2YA 4W5QA 1M2OA 1UQTA 2P9TA 5EVJA 4CCWA 1QUFA 5HRAA 1TAGA 2Q21A 3Q8WA 5K3FB 1LRKA 1NMZA 3Q72A 1L2TA 1JT9A 1AXRA 3OTWA 2O2GA 4R1LA 4HZIA 5D86A 5HIIA 3CB4A 4E3ZA 4G4JA 1GAEO 1TM4E 2QQGA 1ZG3A 4G85A 1BOOA 2L69A 3AK4A 1N0UA 4OF4A 4IDFA 1DG1G 3MRTA 2HMWA 1ZOLA 3UMVA 4TV8A 3BCSA 4IQ4A 1VI2A 4D8WA 4Y2HA 2OZLA 3NFRA 2A30A 4FMDB 4YUVA 3VVMA 1AUOA 4D8VA 3C39A 1XRLA 1XZFA 1X8JA 3V4OA 3X3HA 5CEFA 3JR7A 4YHHB 1KO1A 1EI9A 2VC2B 1W25A 4JENA 4HAWA 2UYGA 2XEXA 4HGNA 4C03A 1E5LA 1GYRA 4ZKEA 4D79A 3RFTA 2OMEA 4RACA 3NU1A 2QN8A 3T54A 3AFGA 2Z3VA 3T3MB 4BN0A 4D9JA 4OFXA 9LDTA 1D6JA 1NI5A 5KS2A 3H2HA 4ALKA 1OXXK 1FRZA 3CZ5A 4QO8A 2C5SA 4YRLA 3NDIA 2GHIA 3I6YA 4H27A 1GZ4A 4K9PA 2Q7OE 1D7AA 3VTKA 4AG6A 1QGYA 5JROA 5GOZA 5BOVA 2GM9A 4HAXA 1JG4A 5KAPA 3BB1A 2UAGA 4MVXA 3NT2A 4JKIA 4LQLA 2FETA 2WU3A 3ZJ5A 4AF7A 4G6ZA 5CVDA 3RIMA 3ZHYA 5EIFA 1YULA 1ZMBA 2IYUA 2C2HA 3KE9A 1CUDA 1L3IA 3K71B 3KL4A 5EIOA 1RCUA 3R3YA 1QF6A 1YAHA 3OQPA 1EE9A 5CYPA 4NTZA 3CA8A 5CT8A 3WDLA 4D46A 1YZFA 2QQEA 3E7WA 4LYJA 4CTNA 1BEZA 2FFAA 4PGHA 4ALJA 3ROTA 3HM9A 2R6DA 1T0IA 1TJNA 3EFEA 4B0PA 3AG5A 4EG1A 3OD1A 4HB0A 1KAEA 4F5ZA 3C3CA 2A7QA 3DC2A 4XPIA 5KVAA 3E15A 2OESA 4EO7A 3H11A 3PHHA 4H9GA 1ZA2A 1LJUA 3DLPX 1WZEA 3LUKA 5IF3A 1RYZA 4H7KA 2H2DA 3KTFA 4RHFA 5D7BA 1XGKA 3B6IA 2IOQA 3OE7D 2VHZA 4RF4A 5FUWA 1OTHA 1NKTA 4RABA 5AO9A 3RU7A 3TZLA 4ABTA 4M0MA 3TVTA 3UUWA 4KBGA 2IW3A 1Z83A 2V9ZA 2WTAA 4Q4HA 5JDIA 4BFLA 1OB5A 2XE8A 4X54A 1J09A 1DMRA 3GVIA 4WN3A 4ZYZA 4V2IA 3VO1A 1TGVA 1KJZA 5MGNA 2ISCA 1SFRA 4ZAGA 4KAXA 2V0NA 4Q12A 4PZ0A 3EXHA 1OVGA 2FSSA 1HEUA 2AZ4A 4KR2A 2H1OA 1YE8A 3IESA 4KGZA 4XJSA 1CQZA 1JQDA 4PC2A 3HP4A 4FDUA 2NVOA 3RHZA 3VYTB 2GA8A 1O94A 1ARZA 3DLIA 1HZZC 5HIAA 3ZCUA 5AK5A 4AURA 3D81A 3UY4A 3KJIA 1E6MA 1IIBA 3RU9A 1GNVA 1V8FA 2QPOA 4G5QA 2D00A 4NL4H 5LYJF 1SCBA 3SIXA 2HY7A 2ATXA 2AYXA 4A8JB 1PQ4A 1QU2A 3DZBA 2YFKA 5A0FA 2EX0A 2Z08A 4Z4QA 1DCFA 3QA9A 4QX6A 5JARA 2PVSA 2HN9A 3RFVA 2XXAA 4OBBA 1JN0A 2NO7A 2Q5EA 5JG7A 4ESEA 3U7HB 3Q9LA 1TT7A 2HHAA 4R51A 4W6ZA 5JXGA 1T8RA 2ONYA 4M0EA 2IHJA 4KWIA 2WSIA 2FPUA 3RC9A 3AF2A 4KEAA 2WYUA 4C0AC 4UE6A 2QUIA 2REQA 3CR7A 4EGJA 1H5NA 3GR6A 3ZWBA 5IM4A 2BDEA 2LCFA 4RE6A 1QLJA 5KNCH 1Z4QA 4JP2A 2PMKA 1U3UA 2FJPA 1U28A 2CJFA 2VAVA 3JX9A 3IQFA 3R9XA 1TCBA 2O2XA 5JSFA 4M38A 3H5IA 1M6NA 4K6MA 4HEA6 3N75A 2X5KO 5DX0A 2BTOA 1ZBQA 4AD8A 1IZ0A 1L5KA 1KSHA 1PZMA 3S2IA 3H5RA 4U7DA 4PQYA 1YH3A 1W1IA 3GEPA 3OZGA 3RK4A 5F51A 6PFKA 3IUMA 3L06A 4TXHA 1N1MA 3IAXA 5T67A 1TMYA 4WOJA 4MIOA 5EKTA 4E11A 4M9XA 4OXXA 4LYHA 2WNHA 1WCWA 4LX0A 4MEJA 1KKMA 2ZTMA 5DLEA 1RHUA 3E61A 3K9NA 4A1FA 1D1QA 4BNGA 4IM7A 5TJHA 2D7CA 1W59A 3PXUA 1CZLA 2Q6OA 1CR4A 3QQPA 5CHYA 1I3LA 4YQZA 3OZCA 3EDYA 1DQRA 3BJEA 1WUTA 4MGEA 1V8BA 4AZ3A 3GWGA 4RDXA 5B4UA 2JCSA 3AXTA 1UKZA 2HRRA 4JU8A 1MC8A 1D6SA 5HG0A 2Q6IA 2YMMA 4H1HA 5DRTA 1FFXB 1JPVA 5TARA 5BUZA 3R7DA 3QSGA 1V3QE 1G21B 4UVEA 1F8YA 5K0ZA 3HUTA 2HIHA 2W0MA 2Q46A 1KE2A 4O8CA 1IN1A 2G5PA 5ALYA 1YR9A 4YP9A 1BMTA 2Z0MA 4OHXA 3SX2A 3VMFA 2DYKA 5CCXA 2DR2A 1JWBB 2ZEJA 4PTZA 3V2IA 2H7XA 4O2AF 2C3YA 3QLJA 1EK0A 1ML3A 2G9NA 1NVTA 3EW9A 4YRAA 1WMAA 4XIIA 4ZTBA 3CNQS 2JS7A 3CE9A 5AHRA 1GOTA 1Y7TA 3HADA 3MAGA 4QSHA 3TTVA 4DCJA 3DEYX 3R75A 1E2UA 2H7CA 5JZBA 1WDMA 3LLSA 2WAAA 5IG2A 4N0MA 1YA6A 3L0IB 5EUMA 3R76A 4KXQA 2E7ZA 3WLHA 2YFQA 1JKJB 2WIJA 2ZI7A 3OF3A 3KSRA 1KYIA 3TOZA 1LQ2A 3HACA 1X1EA 2OCIA 1A8SA 1ZI9A 3D1LA 3SJZA 4D97A 2FG6C 3MJDA 4B34A 4RPIA 3G6KA 1E7WA 3QEAZ 3LOPA 4FS8A 3AJ9A 4FHFA 1S2MA 4RXUA 1Y4DE 4ZVMA 1HETA 4KXNA 3SQWA 1EKXA 1O2DA 2IDJA 1EP3B 2OBLA 3AERB 1GPWB 1ONOA 4WGFA 1WKVA 1YR8A 3WYCA 4MVJP 5FTLA 1PP4A 1W9HA 3O93A 1KMMA 1A82A 1O96A 4YJGA 3CUUA 2XVZA 2DE0X 1O9GA 1WEHA 3L0DA 5LBIA 1N77A 1IDN1 2PL3A 3MIZA 4UCXA 2Y0EA 3ZYCA 3ZU3A 1E9VA 3ND8A 4PFJA 1NN1A 2NV2B 3B3FA 5DM2A 4BVGA 1H2XA 1REQA 2O1EA 3L6UA 4W4TA 3ODPA 3TSZA 3BWYA 1TTQB 1T5SA 2YXLA 4TWAA 5ADWA 3MINA 4OKSA 2Y0CA 1TD9A 1BJTA 4KH0A 1L8AA 1T24A 2L0XA 1YAJA 3TVDA 1JLKA 4J49A 1PFWA 2TYSB 4ZQEA 1SO8A 2WMOB 3ZNOA 5ECYA 1P18A 5ETJA 2OENG 5IXJA 2FN7A 3U39A 2WABA 1RPZA 1MW8X 4GKKB 5JFTA 1TF2A 5BQOA 4F72A 3N5KA 1Y6GA 2F8TA 1ILWA 1ZAKA 4AWAA 4J2TA 4NF2A 4ER3A 5JNSA 3G2IA 3SC6A 4D26A 3KQSA 1W2WB 1FW6A 4KMOA 3O92A 4L5IA 3T94A 3IAS6 4NMMA 1H4SA 4M7RA 3EN0A 2EV9A 1DXOA 2X5JO 3OA0A 3RPEA 1JQBA 2AHOA 1RRVA 5E7IA 1SCUB 2BEVA 2KS6A 3F46A 1JE1A 1J2UA 1YC2A 3I0NA 5C1BA 2D5IA 3OZBA 3MGGA 3TNDA 2ZWMA 3G89A 4H1UA 2IZ7A 4AKIA 1EUCB 3WWDA 3UQZA 2EKPA 3NHAA 1DBIA 2FMFA 4DLWA 3T34A 1FEZA 1XRPA 3N2GA 5BW6B 1XOIA 4IIJA 2DLDA 4C6TB 3U4GA 3N7TA 2RGNC 1ZH2A 2PT5A 2C97A 2C00A 1EAMA 3KJEA 3LUCA 1EUDB 1NF9A 4Q3AA 1E4EA 4UU7A 1PJ3A 1RABA 2BSXA 3RB8A 2I8AA 1DUIA 4J0DA 3I9V1 3EEQA 1YB7A 4F97A 1A9QA 1UDAA 3A6JA 2NYAA 3I64A 4JB0A 3V8QA 1X1AA 3A1VA 1HGXA 3NTLA 4I99A 4NAUA 4RTKA 4BVAA 4IKOA 4IGAA 5DIFA 2HGSA 2ZT5A 4IUDS 1M3SA 3H75A 1DT3A 4AMVA 4ZPXA 2VPXA 3DDWA 4I6EA 1TTHA 1SQSA 1M66A 5EY5B 1NRXA 2JD2A 3GA0A 1WOYA 1PS0A 5TGZA 4KMSA 1FL9A 1ND6A 4LDNA 1N6NA 2HA6A 4MI6A 5BQPA 2PCJA 4MQEB 5DF1A 4NZZA 4UE2A 3QWAA 3GLHB 4JLSA 3R0IA 2C77A 3MWGA 4YI3A 3CIFA 1YZQA 4WJKB 3VPSA 1CE8A 1I3MA 2JH8A 2WAYA 2VNIA 1ESNA 5F9MA 3GOQA 4ZVQA 2AWOA 4JJAA 4NP6A 1HT1E 4RWEA 3DM9B 4WXYB 2OGWA 3OQMA 5E6SA 4LF5B 4Z8XA 3REQA 4ZAFA 3ZKWA 3G9TA 1UDBA 2F43B 1PJLA 2FP4A 3PKJA 1ZGJA 2H6EA 3E0XA 1FDRA 1NR1A 3FLBA 4XW2A 1YIDA 4GBGA 2SCUB 3G2JA 4NAVA 1YVEI 4U63A 4JX9A 1NBAA 2JCGA 4YFVA 5CM2Z 5B58C 3EPLA 1C5KA 2RBGA 1PR0A 3OHPA 4Q39A 4R9VA 3QYAA 3ISVA 1ULUA 4CBVA 5LBTA 1M1NA 2FFQA 3L0YA 2Z8YM 1M2VA 1L7RA 3G5AA 3M82A 1E6WA 3JWPA 4AN0A 3H5AA 3DYVA 4YGXB 1RS0A 2ZPTX 5FHQA 5A7GA 3L6EA 1P5FA 1F60A 4DMUB 2J5RA 4FR2A 4N3AA 1JFRA 3SSNA 4BFCA 4Z5XA 1JEEA 5C1PA 5EJ4A 2I1WA 3UMBA 4C0KA 1ULAA 2VPZA 1SA0A 3AEUA 3E9CA 3EIEA 3G7NA 4G8DA 4IHJF 1E7RA 2PKQO 4HVTA 4C88A 4F4DA 2WUEA 2FPPB 2WVHA 3R0VA 3T1NA 1X7ZB 1GUBA 3CEHA 4MW2A 2JKYA 3P5BA 3GT0A 4CT4B 3PHJA 1P1FA 5DP1A 3A36A 2HA0A 2R96A 3DL7A 1MOSA 3EVDA 3N7UA 4J0EA 4RJ2A 3SC4A 5A4IS 2ENUA 3FMFA 4Q9IA 1P2BA 4EZEA 1IATA 1F17A 1Q1ZA 2QAJA 1VFPA 4GRDA 1VHJA 2XIQA 5JAQA 1CHNA 1GWNA 4H1VA 4MV9A 3I39X 5DI3B 4CM8B 5IKEA 1CJCA 3G0OA 4FI3F 1N5KA 3AYZB 4DFDA 4AO8A 1JKXA 1KC1A 4QVKA 2GD2A 1M2FA 3MTAA 2AKAB 4ZCPA 4X6UA 3W5IA 5JCZA 3O4IA 1Q7TA 2OBBA 3MOIA 1NBWB 1AO3A 4WDQA 1ID8A 1DTWB 3SBXA 4NYJQ 2GPSA 2ZE8A 1FU7A 5FFFA 1B43A 3U3MA 3OT4A 1VIYA 2JGRA 1TUEA 1ZA1A 2XZPA 3HR4A 2VDQB 4G5SA 4YS6A 5K3BA 5ITSA 5KWEA 2PYDA 1VG8A 4KK3A 3TL2A 1YRLA 2OXCA 1U98A 2V45A 4I2VA 5DJ5A 4BPRA 5I9MA 4DIKA 4HT3B 1MAUA 1K2WA 1ZDMA 3EIFA 3BHIA 2BT4A 3O38A 5K3FA 4BJHB 3Q3HA 1H2WA 2IZZA 1E0KA 2ATVA 3P9CA 1OKKA 3TEJA 1NNEA 2XUAA 4YH1A 1ZGZA 3QTLA 2DUWA 1X92A 3M49A 3SR3A 3SU8A 3TPZA 1C7ZA 2XGMA 3VSAA 1XJWA 1XHLA 2Z58A 3B1XA 2MTBA 4JXKA 3SEAA 3PITA 2FR8C 1IWOA 4II3A 3HZOA 4MP8A 5EJMA 3VMMA 3D7KA 1NN0A 3ND5A 2FXVA 2CFSA 5EXSA 2EBWA 3M1LA 4K9RA 1P6XA 1NC3A 3C8UA 3FWZA 4ZU1X 2X1HA 2C5FA 2WYHA 3UPTA 2Q62A 4BNVA 3K32A 4JUBA 1CZNA 2BMFA 3O7MA 4KPUB 5TS3A 3BHNA 5FD8A 1R18A 5B2EA 5JQGB 4RGVA 1H2EA 5JXWA 1QNLA 1YRHA 3CVJA 2EC5A 3EAGA 4WCDA 4QYTA 4EVRA 3FYUC 4UBKA 3LUHA 2GEBA 1SIBE 1YDEA 3DE5X 3JRNA 4P53A 3RIGA 4Y8VA 3ANYB 2XAUA 4L6CA 3EXG1 3A8TA 2OSBA 2VK8A 4JSYA 5F4BA 3CRQA 3D4BA 4H1WA 2B7CA 1ZD5A 2C7BA 1GL7A 2YCBA 5J2TF 1QAOA 5CHEA 3QKIA 4C78A 3KJQA 1MGOA 2J3QA 4MWGA 2CLCX 4FFPA 5EJEA 1PNVA 2XHEA 3HL4A 2CXQA 2RIRA 1UJCA 3AEQB 3L46A 2DU8A 2DKOA 2Q4RA 5FUXA 4E5MA 4MW0A 1NLFA 4GR4A 2DQYA 4HZUB 1QUEA 4RK1A 3KLPX 5BRAA 2X40A 4F8EA 1KJIA 1X74A 4M0CA 4UVDA 3PDUA 2GX6A 3PVZA 1WOMA 3R44A 4KN5A 3HDGA 1UAYA 4JSRA 1IQRA 2Y77A 4KWTA 3BICA 1FQWA 1C1YA 3NANA 3CZAA 3GJ4A 3QYPA 2A84A 4MUXA 5AHWA 1GTL1 4N6NA 1LBHA 2JGMA 2WQ6A 1L5HB 2VI5A 4MUKA 4OFWA 3W2IA 3EDRA 1EXVA 3BWVA 1DRVA 1Z5UA 3IE2A 3LNCA 3QFTA 3KDPA 2R1TB 4MS3B 5E38A 2MIIA 3RARA 2FPMA 4N03A 2WB4A 1AUQA 2IJGX 4P34A 2E1RA 4U8GA 2MWMA 2BHLA 1SMKA 4G25A 1UBCA 4H3VA 4MPPA 4ZKDA 5EXEA 3ZXYA 5C8VA 4AQ7A 3DBHB 1YI1A 1WXXA 3WRYC 4BE7B 3LKVA 4N6GA 5HBGA 2VCEA 1VRVA 3B1JA 4NYMQ 2H1IA 3WNCA 1BVRA 2ZWIA 1NUAA 3P9YA 3UFXA 4HYEA 4TS3A 4EEXA 1KI9A 2B7BA 2WJ4A 3EQZA 4ICIA 3WQBA 4I5IA 3TNJA 1ZY2A 3QITA 4AFNA 4DIUA 5JAHA 1H5QA 1K8XB 3A2LA 2PUCA 1Q0QA 3LYUA 4PGFA 1JGTA 4N5MA 1A4UA 4GVXA 2K6GA 4OYHA 3FUTA 1QK3A 3OIVA 1NA5A 1RWXA 1T9HA 3EODA 3T9CA 1SWVA 2COUA 2XLBA 5MN4A 4JQSA 2A1TR 3SXJA 5KIAA 4A8JA 3ZI7A 3IOMA 3SQDA 5LZ8A 1D1TA 3JZAA 2FPKA 3U4DA 4PNEA 1EDZA 4R98A 2PGAA 3TSWA 1WUYA 2GHQA 5AH0A 1NVEA 4GS5A 4ZYVA 1XYYA 1CT9A 2ZYTX 3NM4A 1H8EA 2WP8J 1YDHA 2J0SA 3N8IA 2KQUA 2DG2A 2P68A 5PGMA 3ETLA 5CXXA 1QTNA 1CD5A 3M2TA 3M4ZA 3Q1LA 2CLLB 5BN4B 2H31A 3RRXA 5J1SB 2P5TB 3UANA 1DAMA 3FNGA 5TGTA 5BRJA 2YXPX 3QW4B 4F1JA 2VQEB 2V98A 4AIRA 2ZCUA 4W8GA 3HB1A 3W7VA 4DDHA 2FDCA 1U4OA 1W48A 1QB8A 4IRUB 1WM1A 3IT0A 2FSVA 1Y9AA 1PF7E 1KYYA 1XMIA 4N5LA 5FNZA 1FTYA 3U09A 2PRYA 2R5FA 3DV9A 1L5GB 3V32A 3RYFB 5KNCA 5DRYA 1QDEA 3WOVA 3DO8A 3A05A 4ZHSA 4GKAA 4NMHA 2C9DA 5IJ0B 1SKUA 4G09A 3EYAA 4QDTA 4XM2A 2P7IA 5ILGA 3W9YA 1UOQA 1UXJA 1YV9A 2FVYA 1RI1A 1W19A 4KDCA 5KU1A 2GF0A 3D3KA 3AUYA 3K0KA 2CNDA 3GRKA 4KRXA 2EKLA 2PLRA 5A4MS 1NYLA 3RD5A 4DRYA 2XHZA 1QWOA 3TNFA 1LK5A 2ECOA 3I12A 3KYIB 5H9WA 1K9VF 2MSNA 4HDKB 2D4HA 2YHAA 2XNDA 1EK1A 5FBLB 2ZVPX 3TAXA 1N5MA 4WK4B 1Q0UA 2C4NA 2PUBA 3FFWA 4ZI7B 3MPOA 2ZYRA 5C8ZA 4MQBA 2BFCB 3E3NA 3PT5A 5KC8A 3FA2A 5T4HA 3D8BA 4OMDA 1P60A 3HB0A 4XFJA 4MUBA 5ADHA 3VPCA 1D2HA 2O1XA 1BIFA 2AJBA 2OY0A 2HA5A 4GU5A 1G98A 2CJXA 1Q12A 4JR1A 3JU3A 4D9CA 5L45A 1DEHA 2JAHA 1D4AA 5DTEA 5IANA 1QHFA 2G1UA 2IYEA 2PA3A 2ZZKA 1G21A 1ZJYA 3DGEC 3KUDA 4NABA 4N39A 3ST7A 1G8MA 5SYNA 1NMSA 1QHSA 3V8NA 3KAKA 1QORA 2NZWA 2BONA 2JHAA 1ADFA 4U7PB 2XGGA 4YRSA 5TMEA 2CVFA 1JYFA 3E58A 3PC4A 4CMBA 5HFJA 5JD4A 1MTZA 5CCEA 2GCOA 1R15A 3U3XA 3TI9A 4B85A 1DAIA 2DXIA 1YNOA 2HQRA 1DADA 3R5KA 4OLHA 5D00A 4Y7DA 5IC6A 4HDCA 1TU0A 2YJ6A 3ZS8A 4YRKA 2OHXA 2X0RA 4RKWA 4K9LA 5JUWA 1LK7A 2CB9A 2XWSA 5ILQA 5TSDA 2GCGA 3HUDA 1S2GA 3SC3A 3WTCA 2J67A 4DC9A 1E1RD 1ONSA 1QRRA 4IUYA 4NCNA 2J3KA 4PNHA 3COYA 2XMCA 1JFLA 1JZSA 3O5AA 1JKJA 3GMIA 2ZYIA 4YDRA 4EJSB 3HSKA 3CW2A 1H1TA 4F5EA 3EPKA 1RQGA 2CLSA 3JWHA 1TQ6A 2ENWA 3T95A 1YK1A 7REQB 3FOEC 2DSNA 2P0YA 1BEEA 3GUYA 4ZTUB 4LI0A 4K86A 3AERA 3EZNA 4HXGA 3QMVA 4WD3A 3IP9A 2C8VA 2C2MA 1MEJA 2VK2A 3SKXA 2ATEA 1FXSA 1O95C 1YZTA 3CIOA 4M99A 5BSTA 4YYZA 3R7SA 3KWFA 1S7CA 5BQFA 1EESA 1RXYA 1OSNA 1A72A 1MPTA 2ZROA 3O3MB 3HY3A 3T3EA 3IUSA 4NFYA 3WB2A 1ESDA 2PH3A 1V1RB 2VHQA 3N8NA 4IS3A 1MX3A 2IYWA 2QTBA 1GLNA 3KQYA 4GYWA 4LUCA 5LKRA 2GN2A 1Z6YA 2WNSA 1PFVA 2PZ8A 3D54D 3GJ3A 4JDPA 1EJ6A 2IU6A 4N5NA 3OX4A 4WA8A 3RRMA 4H7EA 1G0NA 3AR5A 3I2KA 4QBIA 3RODA 2VNSA 4JJ6A 4HPJB 4LE0A 3B13B 3BE4A 2G9VA 4TS1A 1Z4LA 4BP9A 1KIAA 3BFXA 2JAUA 5JMPA 4DGSA 5BWCA 1XIVA 1P0CA 3PG5A 4Z54A 2UVPB 1Q16A 5A9SB 2GCPA 2ID9A 2O9JA 4UOQA 3TUZC 4IR7A 3F9RA 2WWVD 3V1YA 1Z4KA 3ILSA 3WAJA 1HE8B 1ISPA 1LK0A 2BRUC 3DPUA 1IY0A 1VJ0A 5TF4A 3RUAA 1VLZA 5KPDA 1T9CA 3EMDA 1JA1A 3OU2A 4OYYA 4Y7CA 1CQXA 3EEOA 2XYPA 4K6FA 3E3MA 1U90A 4ARUA 4DM3A 1SC1A 3P96A 4P4LA 2JFQA 1XA0A 5AUQA 1UWCA 4MAFA 3STVA 1G2PA 1SCUA 3D0QA 1XD8A 1UQUA 2POQX 4GXRA 1II8B 5BQ3A 4Y0NA 5DX1A 4Q9LA 4JLJA 3BIJA 1EUCA 4ZOQI 2O6HA 4WBNF 4F5YA 2OLEA 3ANXA 1IUOA 1VKRA 3CLKA 4C6TA 2PVCA 4E5KA 1BKDR 2E48A 2FG5A 4AJJA 2J7PD 3LVBA 1VYTA 3AU9A 4P3OA 3R7FA 1KU6A 1Q0TA 4KFUA 3GL9A 2VYCA 2AE1A 5IVDA 5K8UA 1EUDA 5CNJA 1HQKA 4WKPA 1DUSA 5J2UB 3H9CA 2EW8A 1KNQA 1MU0A 4F60A 1SXJD 1SXHA 4IINA 3HSSA 4N01A 1Q92A 1YQUA 3S55A 3ZZ1A 1TUGA 2WZQA 3AI2A 2Q8NA 1Y7HA 3L79A 4PAQA 4IX1A 1GILA 1FFAA 3HLKA 1FUYB 3L4SO 3PD1A 5KINB 4KO2S 2ZBUA 4TYWA 1TI7A 1PV2A 1XTPA 2HT6A 3M5PA 4L85A 4CTJA 2DUNA 2IL1A 2D1SA 2GVNA 2HI0A 4CL8A 4QQNA 3CKLA 3KOXA 4M88A 2RJNA 3H0KA 5C37A 3ES9A 4GPD1 4MQEA 5F73A 4B76A 5FQNA 3JSXA 4NMWA 2I54A 2R86A 3GLHA 5IF9A 1ZMXA 3LJKA 4R7TA 1T6ZA 5DTJA 4BC0A 5CA1F 2P1ZA 1E2IA 4AX8A 2QTTA 2CYAA 3WHLA 1ISIA 2B78A 4OHFA 4LZJA 3LCJA 3NI2A 5D5QA 1IUPA 1TADA 3WL6A 3PBKA 1NDUA 1DWOA 4Y0VA 4F21A 3TLJA 1WUHS 2JI8A 3CUVA 1QJ4A 5BSRA 2AOVA 4KQIA 2QS9A 4IGIA 4N8EA 2HC9A 3LBIA 3HZRA 4NKRA 4B2YA 2IYVA 1E63A 2F43A 1ULZA 2EERA 2VYFA 2W9XA 5ALSA 5HCNA 4DCUA 3I01M 3VU1A 1B6SA 2R62A 2SCUA 3K9FC 5EINA 1HDXA 5DW0A 3RJZA 4CM7A 3OIFA 5CFPA 3BIFA 4I19A 1M2EA 5L6LB 1V8OA 3KS9A 2IUUA 1EK5A 1K8QA 4PSCA 2H4XA 3PNLA 1XD2A 3N0TA 3WKEA 4MHTA 1WA5A 1PNQA 2E6UX 1TPZA 4NQZA 3PHBE 4E2FA 4DVGA 4I3GA 2XA9A 2AQKA 4DUGA 3ZK7A 1E5TA 1L4GA 3G49A 3VHRA 2UYCA 4N5DA 4COOA 4WCFA 2CV1A 1OROA 2QUJA 3FKSD 4CM9D 3LO8A 1EFPB 2FPPA 5G1NA 3B3GA 1X7ZA 4ZJPA 1GCUA 1MVOA 1IRXA 1VE6A 4ID3A 3QHAA 2DH6A 5M34A 4XB6B 1QPZA 3FWKA 1OGJA 3HVUA 3LFHA 3PDIB 4EX6A 1Z36A 1KTIA 1KJYA 521PA 1B14A 5I4KA 1B0PA 1MDFA 4AI6A 3EAQA 5CDTA 5ECWA 3IT3A 2G06A 1I4DD 1CZHA 5EG5A 4AF6A 3RVOA 1VI6A 3TCNA 1RYBA 1JECA 5DI3A 4CM8A 4KNYA 4UNRA 2J3MA 2BGTA 5FV4A 1U0JA 5BXYA 1OJ7A 3KLBA 3SZRA 3R3WA 3OF2A 1CUSA 3ENZA 4NU0A 1SAYA 3N0XA 2V9CA 3P4YA 2FSUA 3KIPA 4HI0E 2G5TA 1YQXA 3WGGA 2O2EA 3NEJA 3UTDA 3UOGA 2O8BB 2Y9PB 4PN7A 4EJ2A 3T1YB 1KFCB 4FX5A 4GR5A 3ZIAA 2YV2A 1QKKA 1GKKA 4M1EA 1BDMA 3R9WA 2BR4A 5P8WA 4Q1DA 2HFJA 2Q6KA 2QLBA 2WU1A 5JFGA 4QASA 3UJ7A 2AN3A 5K03A 2UXDB 3T12A 4P4UA 5KC9A 4Z9AA 2JA2A 3A3OA 3ZE7A 1YS1X 1E2FA 1KVSA 2GPAA 4EI2A 4FGZA 1O8BA 5LLDA 4GM4A 4IMJB 3IP7A 4EDFA 3PK0A 1VBNA 2B83A 4AKTA 2JAWA 4QEZA 3KVRA 5A5DA 4G26A 2YVUA 3WB1A 2W43A 4PCUA 4XX1A 2VHYA 4RJJA 3CV3A 2F3RA 3WMGA 2JLRA 5MHTA 2XNHA 5LQMA 1USIA 2M1ZA 4NH0A 3DTVD 5JO0A 1MENA 1QKIA 2C84A 1N0WA 1ZWLA 4KPUA 5C46F 1JLSA 1KGDA 1GA6A 4I4TB 4NQRA 2BHNA 2BZGA 1U1GA 1QE5A 1C9EA 3TE6A 2P7HA 4IFTA 1IMOA 1FVOA 5KTOA 3KYDB 3ANNA 2K87A 2WV9A 4Y30A 1EVIA 3PF8A 3FWPA 1YD7A 2PRZA 1KETA 3NYQA 4P0TA 2VRCA 1KAMA 1C2TA 3TL3A 4FSXA 4D4GA 4I4LA 3ZDZB 2WJ6A 5CK4A 3UT6A 1H3EA 2FXIA 5AVTA 1CUIA 3OZTA 4CM5A 2Y1CA 1Y1LA 2O2IA 3RUEA 3RBAA 4WXEA 3H17A 1ZC4A 3HSYA 3RS0A 2MR6A 1V11A 4CN8A 4MQ5A 1ECFA 2PKRA 1N1GA 1WV1A 2VYQA 1PVOA 3C3JA 1Z45A 1TKRA 4R2HA 5HZMA 2VHCA 3C2QA 3NM5A 4KFRA 2LIVA 1NF3A 3ANSA 4GZ6A 4YAFA 2ST1A 3AEQA 5IK2D 3O47A 5A1TA 4R2KA 3B1YA 4HZUA 3AESB 1L7EA 4B6EA 4QYWA 2WYOA 3KR9A 1P6UA 3E1SA 4YCAA 4Q7QA 1I10A 5K4GA 4GPBA 2I3BA 5A4AA 3ELWA 3K6RA 4RVOA 5CDFA 2IHNA 3O2JA 3TLAA 4B7XA 2P5UA 3N6RA 1CSEE 4QSMA 1L5HA 1FFEA 3UV3A 3L8FA 3VAZA 3QHPA 2VXCA 4M1OA 1KEVA 3W2EA 3WGUA 5TY0A 1OREA 4F4HA 5FO1A 3ZE8A 2FGJA 2R1TA 3A06A 3P71T 4MS3A 3PXAA 3VTZA 1QP4A 2VDWA 3MW8A 4EHLA 4CF6A 4R41A 2B5WA 2KLHA 4YASA 2GPTA 2OVBA 3NIBA 1DXYA 5KCMA 4RNDB 5GVRA 4EAQA 2QU8A 1VJRA 1ZQ1A 2F9FA 3IDQA 1UK8A 4MROA 3DBHA 4Q18A 3PU6A 2YNMA 3SJCA 2FW0A 3G17A 3LGXA 3V6MA 2AEEA 3DHVA 3CWQA 4RS4A 2F8SA 2B36A 2X7HA 4URXR 2GFHA 1UZNA 1T34A 2XDQB 1E59A 2OCAA 5GGXA 5C9ZA 4OAPA 3FAKA 3H4VA 4LXXA 2C8JA 4ZT7A 2G77B 3E2PA 1Z0KA 3H5WA 1VBKA 1AY0A 3AB7A 3ASVA 4M8LA 1FUEA 1RXCA 3CCFA 4G81A 1GPDG 2VHEA 4Q4AB 5AOCA 5A3RA 2XMDA 3T4PA 1UH5A 4UHKA 4K2AA 1S8FA 2XCIA 3DLHA 1MC4A 1ZL0A 3Q98A 3VC2A 4M1MA 3HBNA 1W9MA 4NSNA 1NAHA 5BN4A 4A0QA 2XXJA 1SXGA 1XG5A 3A11A 4WCFB 4BU0A 3GUZA 3ZY2A 1P9LA 2GK6A 2ACWA 4G9EA 1ZBDA 3IVXA 4WUVA 3VV3A 2XRZA 1UODA 4QJ4A 2AB0A 2C7QA 3KJXA 1LPAB 1RYFA 2EX1A 3NTUA 4I81A 2OXIA 5BSWA 1G5TA 1DG9A 5CGZA 2VJQA 3RV4A 5ELXA 1ZR2A 4TRNA 1KO5A 2PWPA 4PX9A 5HX7A 3DLCA 1R5JA 2P9EA 1JW9B 3C24A 4NV1A 4QOSA 3QVVA 4ER7A 5JSHA 1YFJA 1BHQ1 2O4UX 3QMPA 4P7JA 1E6KA 2W6ID 2I2DA 1X7HA 2ONZA 5BQ5A 1I2ZA 3BGDA 1OXVA 1QVRA 1CEYA 1KFJB 1IZYA 4Q9KA 3RVDA 3GW8A 4IXNA 5ARBA 3WOHA 3ZE9A 1Z25A 1EX1A 4C2BA 5F1PA 2EZ4A 3P19A 1ODCA 1Y5LA 3LLVA 4J0HA 1TAHA 4RPHA 1WHTB 5DI9A 2NU9B 3RFFA 3KPWA 4BBZA 4AO7A 3K0CC 3UJ8A 2LCQA 4HDKA 4TS9A 2PX5A 3TZ6A 4BFVA 3W8RA 5AVSA 2G1JA 2P62A 3CVVA 2VXBA 2PKCA 5TQ2B 2GN6A 3MCVA 2R84A 4M89A 5FTJA 2ZUVA 4ZI7A 2JLVA 2ZRKA 2ZXEA 3V9AA 3ZNNA 2R60A 3WSTA 4LSMA 1VJTA 4RK4A 3WLAA 3ROEA 2I67A 2C2GA 3VR4H 1U2PA 5KWJA 3OPYB 2NN3C 5LU8A 3H9BA 3IQIX 4N1AA 3MQ4A 4EI7A 1RXUA 3IAHA 4BB0A 1J22A 1GU7A 4EY8A 4WADA 2OV1A 1DELA 1USUA 2V03A 5JNVA 5KTNA 4ZYWA 3V8BA 2GJSA 1HL3A 3FLMA 3LUFA 3RREA 4QQFA 2ZZMA 4FW8A 3TRKA 1CQPA 4R3WA 2F3SA 1MXFA 5B5SA 1P75A 4IV8A 5IVKA 3PQFA 1Q7GA 4D9EA 4Z7NB 2MSEB 4QXPA 1P7PA 1GPJA 3BFKA 1VLQA 3WHPA 3OM1A 5DYWA 2Q3EA 1H65A 1WLYA 2W8ZA 3H8WA 4INAA 4IIJF 4EG7A 3ILHA 1ZUNB 2YZNA 4KQXA 1MUUA 4A26A 4C0QC 5CB8A 3HFRA 1T6YA 4PX2A 1E2BA 5IX8A 4UHBA 3QV2A 1XLTC 1FLAA 3KHSA 3S2FA 4DSOA 4EJSA 3GEIA 1AZTA 2CFIA 4QYXA 4UEKA 3THOA 2GXAA 3QU4A 4QFDA 1N32B 5HJ2A 5KNBH 4AZ0B 2J3IA 2RH8A 3HPQA 3WNDA 5LD2B 1RKXA 4P80A 5TT0A 5REQB 1YGYA 3DXYA 5BMVA 4HX9A 3U3ZA 4E12A 1X39A 4IXMA 1MO6A 1I1HA 1CUJA 821PA 4JKOA 5FWYB 3PGKA 5CURA 3DONA 4L02A 4A2PA 1VIMA 1KJWA 1WSBA 1C41A 5ALDA 3STXA 2R6HA 1P74A 3H2BA 1UFVA 4IJ5A 5HKKD 2I62A 2JD0A 3HXPA 2R7MA 1JMKC 4J90A 3AEKB 2XYVA 3HCEA 3IJ5A 1T5LA 3P97A 4QEKA 1DMSA 1DO8A 1EGVB 2FN9A 3IMKA 3JAKA 1V1RA 2VUSA 5DNDA 4DA0A 3QPWA 3E84A 1CJMA 4O0MA 4JJ7A 1PFQA 4IDNA 2E87A 3DKVA 3NGLA 3ZZUA 4QKQA 1OWPA 4BL5A 1Y3DE 4CKZA 3D6JA 2IYOA 4NZ9A 3Q6NA 3CS3A 1NBIA 2C54A 2DUUA 3C4JA 1A4RA 2CDAA 3HGMA 4HGYA 1K0UA 4L3OA 1GV1A 1I13A 5IZCC 2XQKA 3G0HA 4B9AA 1P4JA 2GO1A 6ABPA 1G7RA 5EJ6A 4XRGA 1EUQA 5HSGA 1R6BX 5A9SA 5JH7B 4BLVA 4Z0HO 5HQJA 3LPCA 5D7NA 4GQIA 3HXQA 5JJBA 1T9DA 1C4XA 2EDCA 4Z51A 3TEMA 1I8TA 2N42A 4HXFB 4LHYA 3LHIA 1B6GA 5F5NA 5FR1A 1DXQA 3OQBA 3WMFA 5HOEA 4M86A 2Y76A 4PQEA 3ZUGA 2NT4A 2WJGA 1GAJA 4UQLA 1ZIXA 1TC1A 4X0EA 2EEZA 1FTSA 1XTZA 1WV0A 1IQPA 4BAUA 4JXJA 4NVRA 2ZUFA 4F93B 2VP4A 2E5LB 1K5PA 2E4AA 1CRZA 3AETB 3H4MA 4KIJA 1WF6A 2G88A 3ROKA 2QD5A 1UFKA 3DP7A 3L18A 2EOAA 4OXKA 1AN0A 4TKUA 1U5BA 4D98A 2H06A 1ABFA 1C0IA 2E55A 3LXRA 3QZUA 4A15A 3WE7A 1CZOA 5EYPB 2BKVA 3UCXA 2C0PA 3QRWA 4BLTA 4BOYA 5J2UA 3BUSA 3S44A 4CM1A 3FZYA 2X5OA 3TPCA 1CQIB 3A9SA 4DJTA 4JB3A 4BEBA 5KYTA 4PSAA 3QVMA 3QXXA 1NVXQ 1BMQA 5EXTA 4PAMA 1DQPA 2OD2A 2X7JA 2OBMA 3F96A 1R4NB 4B6FA 4E13A 4ETMA 1FP4B 2Z5GA 3O3CA 4F7DA 2XSZD 4IQFA 1XTKA 4QNNA 1GV0A 4ZHQB 4JC4A 3AFNA 3QVKA 2EG5A 2EIHA 5AW2A 1RC8A 2W00A 1NI4B 4MQ6A 4UW9A 4UTXA 1UDXA 3GARA 2WPDD 3UCEA 1F0YA 4ND3A 1ISMA 5GGYA 2JHCA 2D5LA 5DSTA 3JQRA 4HAUA 4LNAA 1EK6A 4D0GA 1OH8A 2IZOA 3ED1A 3IAM1 2AVDA 3KZMA 3P20A 5EHIA 5FBHA 3ER9A 4ZWNA 3W5BA 5A5VA 3FH0A 4YTEA 2AG8A 2DFKB 3EZ2A 1YKSA 2PGIA 2O57A 3GMSA 2XT9A 4D74A 3LPAA 4JHLA 3PQCA 4BTEA 1QVZA 2CCJA 1I36A 3GGCA 1N75A 2IHVA 4KU4A 5EPOA 2A5YB 1DB3A 4IDPA 3SM9A 3E35A 4ZOLF 3TNLA 3WADA 4HJXA 4D5GA 4EL5A 5KSWB 4YMIA 4OSPA 3CRW1 3TD6A 1QTIA 4NX2A 4B4OA 4OU4A 2RGUA 5K3CA 5L3QB 1ORWA 5K3AA 2DHQA 4JU9A 4RQBA 3ZUPA 4N8SA 3KEOA 1C30B 4ZZIA 4Q7MB 2JJQA 1IBKB 1WRBA 1ZNYA 4HJRA 3HDYA 5F1OA 2A3NA 5GONB 5ITZB 1XELA 2CZCA 4G63A 5C5EA 2BBWA 3DKRA 1BWQA 1Q1EA 4MGIR 5LCXA 2ZSEA 5DLYA 4HQNA 1FNCA 4L3VA 2DQSA 2BEJA 2G0TA 1V43A 2ZPAA 3CLSD 3H1GA 4I0WB 4H0FA 1X7XB 2GPYA 2IFTA 3CJRA 4RYDA 2P2NA 4Y3UA 1P3JA 3WL4A 4UOZA 2BMJA 2XZLA 1SOMA 4C6RA 3SYNA 1EFPA 2VH5R 5LLTA 1CR0A 4KO8A 4DXHA 1JIXA 4TLBA 1CJSA 5DB4A 1T1JA 3GQBB 4PONA 4CETA 1NQ5A 1UEXC 5ICMA 1Z37A 3OTHA 4OIFA 3PDIA 3TX6A 5JYEA 5K3EA 1I4TD 4XX0B 4EJFA 4PIVA 1ISSA 4N3BA 3MFQA 4FJ0A 1KJNA 3M6FA 3AF0A 3HRIA 4G0NA 4BLQA 1DBWA 3E03A 2Z5LA 2R68A 3MELA 4L22A 4PC3A 5I9BA 2IHBA 3ZE0B 1X9HA 1XEFA 4OATA 1RZ3A 3Q3GE 4LOLA 1KEEB 5JSZB 3QVJA 3C4VA 5CFMA 4Q19A 3TN7A 2JFNA 2AN5A 3H9QA 1NU6A 3ZK8A 4F3CA 1U1IA 4FW9A 4HDQB 5I9IA 1Z6PA 1VDZA 5TR9A 4XDHA 3ZX4A 2XMPA 4DA9A 4FMPA 2CXRA 2PIAA 1TJ5A 1U2RA 4PSVA 4PO9A 1DRWA 2HUNA 1H4VB 1L7MA 1ODLA 3PENA 3GH3A 4ZQBA 2ANCA 5JVDB 5I3ZA 2WF5A 2Y1LA 3G1TA 4IIUA 3MTEA 3C6BA 4OQFA 2X0KA 3JQGB 4UHEA 1JSLA 2ZATA 5AI4A 4BWVA 4RULA 3NWOA 3DZIA 3TQRA 2GAIA 4ZN6A 5TLSA 3OP4A 3WLJA 1CJTC 1E3EA 2HNKA 3HCBA 3UWKA 2AJDA 3ECAA 5E4YA 2OK7A 5K0LA 3WGJA 4LJAA 4HAZA 4J2OA 1SD2A 1IN5A 3IP5A 1E2NA 4FFDA 1Z6ZA 4G1VA 1ZN2A 2REBA 1Y37A 3GDFA 8AT1A 2UUCB 3PPXA 1P5RA 4IZOA 1S4MA 1Q7RA 4I4TA 2NX2A 5DFAA 4J7CA 3STHA 5AW0A 4D9BA 2VP3A 1OHHD 3MAJA 3QLVC 5BR8B 4A10A 3QUBA 1XKXA 3K8OE 3KYDA 3NAMA 1RKUA 4YAOA 3EWIA 2MINB 2ZKIA 5FUMA 4CGYA 1RHJA 2BEWB 4N7MA 5AJWA 4Y6RA 1WD5A 2ZW9A 3LLCA 4EYGA 5I4IA 1JHPA 2NUTB 1Z56C 4ITRC 3TKLA 2F55A 3PGMA 1JT2A 4KE7A 2NO1A 1S3IA 1QMPA 3TO5A 5C3MA 2WJZB 3HVHA 3O9VA 1W96A 3VPDA 1FDOA 5HF6A 1HDGO 3HGQA 3K15A 3L8EA 1Z13A 1RPNA 1RYYA 3FBWA 4GMKA 2ZETA 3TOVA 4LTDA 5FA5A 4P0QB 1AX9A 5HF9A 3HDJA 1ZP6A 3GZTB 3P32A 4MUMA 1H0RA 4OHUA 3OO0A 4GP9A 1JB9A 3W3AA 3GFBA 3OP1A 5FTKA 5J3JA 2FJUA 5LD2C 3ZG6A 3ZU2A 4IAOA 2BI7A 2NZ2A 1YKGA 3KXLA 3ESBA 3STWA 1QIJA 2CXXA 4PWZA 2ZYDA 1KY2A 4AJEA 4DC1A 1ZISA 5MN6A 1UFRA 2W8BA 1WBBA 3B52X 2OMKA 3DZFA 1DIBA 2RHWA 3LIPA 3X1MA 3X1XA 5H68A 4EGCB 3UH1A 2XRYA 1J1IA 1T91A 1TA0A 3Q5EA 5T6BA 1MIHA 2Q5LA 4WCVA 1HE1C 2HHLA 4DWVA 2IDMA 1PFUA 1W5AA 3G88A 3C3KA 4TMYA 3AHGA 2RI6A 2C4KA 2WA2A 5CU7A 4OSEA 3UJPA 1XPUA 2ADMA 2GJAA 4LYEA 2O19A 1TJ4A 3PPIA 4IJKA 1JHRA 1PWHA 2OGTA 5FF9A 1JBEA 2XMGA 2R5NA 4PPGA 2XDQA 3IOBA 3PTZA 3CBQA 2BH2A 3B53X 2XVYA 3S4YA 4XSVA 4NZMA 4YALA 2WWXA 5DEOA 2Q2OA 3PNBA 5AKIA 1PWYE 3TAUA 4R83A 4EG8A 5C7LO 9MHTA 5ADUS 2BGGA 2DX7A 4TQ9A 3JD1A 1KVQA 2C82A 2YQ4A 4XXHA 2IYQA 1GPNA 1GUAA 2G7ZA 1F4LA 4JLMA 4Q4AA 4LCJA 3RTAA 1BVHA 1M8JA 1NTOA 4M7WA 4REMA 2P40A 4BKPA 4UPEA 4O4LF 4WHMA 5AVUA 1L1QA 3UJCA 1CUHA 1W76A 4R1QA 4FGWA 1HT2E 2FQYA 4IQGA 5KYGA 2E4XA 1ELOA 3O21A 4KODA 1GARA 3OQ6A 3BGIA 1YVPA 3PEEA 3JQPA 3QXGA 4RD3A 1W0KA 3GG2A 1G5IA 3AVWA 1EP1B 1RHKA 1JI0A 1WMSA 5AJHA 1WWKA 1WPQA 3DLAA 3R0JA 3QEOA 4Q3CA 4ZT6A 1DO2A 4ALNA 1E9FA 1FB5A 3DL4A 2D2FA 3NHFA 4RVUA 4BO2A 4DTIA 5B3LA 1XD9A 1ZX1A 2JFWA 5FJJA 3IXLA 1M8FA 3BE5A 4UNIA 1NT2A 4H60A 1E9SA 1P2VA 1M6HA 1GZSA 1Q84A 1U3DA 2BP7B 3OOYA 4FUTA 4YI5A 1DX4A 3O74A 1COZA 5ERYA 2Q1XA 4TTRA 4NAHA 1RAGA 2B0JA 2ZIWB 5IPFA 3OQNA 4OHBA 4O3MA 1ZSVA 3A6ZA 3HN6A 4G89A 3IEXA 4NV3A 1V2HE 1WHTA 2NU9A 2WLSA 3Q9UA 3MTJA 4YAJA 4HLCA 4PV7A 3FCEA 2QVXX 3VPBA 5L51A 3OI7A 3V4RA 5BR1A 4M1QA 5ALHA 2QYSA 5FUQA 1GKLA 2V1UA 1DJPA 1JEDA 4NHOA 3T7IA 1R8YA 1PSZA 3RK1A 1NLYA 1FXWA 1QO0A 2J6BA 3PQ5A 4U2EA 2J59A 1Y3HA 2XDYA 3Q0IA 4NZYA 1I7SB 1NXVA 1SBYA 2XYRA 1ONPA 5EWLB 1GRNA 3DZHA 2JIZA 2C58A 1C0LA 1DS6A 1G6Q1 1XNJA 1MV5A 3LD9A 5K2MA 2NP7A 1LW6E 1RADA 2OBNA 3JQAD 1KA9H 1NVAA 2QMYA 1Z28A 1E32A 2XB4A 3R4VA 4R7ZA 3JQQA 2QP9X 1JJ7A 4JJ4A 2HRBA 5F2KA 3WQQA 4D4KA 3QUQA 5BN3B 5ALNA 2BCJQ 2WMNB 3LYLA 4F7WA 2D6FA 2EGUA 3I6ZA 4ENQA 4HP8A 5FXMA 3SMQA 2P9GA 4LVCA 1AF4A 3SM3A 3MWDB 1X0XA 2OWDA 3K2QA 1ZUNA 4QDXA 4CTOA 3FHCB 4KYVA 2HLDD 3QLUA 3JRWA 2VSYA 4LRSB 4HQ0A 4JZYA 4EKEA 1YDFA 4YT5A 1IMJA 4J0QA 2YV4A 1E5QA 3V46A 5EIAA 1V6AA 4RY2A 4F3YA 1X1DA 2FSPA 2YUIA 4IZHA 1NM5C 1I5RA 4L78A 4INPA 3C5WP 3GWZA 5DHRA 2FN8A 4A0RA 2GTPA 1MRZA 4YT8A 3B78A 2ZIEA 3D0RA 2YXDA 3LHDA 1IEXA 2P0AA 3LQ2A 2G9RA 4IEFB 2R7NA 1OU4A 1ZM7A 2QR3A 3N6VA 1F38A 2HCJB 4IMIB 2ZDHA 4Q1BA 1WABA 4G0UA 4E2WA 1LBSA 4QQ8A 4OG2A 2OGZA 5FWYA 1GA1A 4OHVA 2DBZA 3PVSA 4R81A 4EEZA 1OFTA 4JQOA 1QE0A 4LMPA 1Z39A 3D3EA 1L7VC 4WNCA 5ERGB 3F5FA 4RVNA 1XC7A 2O0JA 3R6WA 1O08A 3ZIDA 2R4UA 4RTRA 3OPYI 3UN1A 3LU1A 1ZMRA 4AG5A 1W47A 1ND5A 1UL1X 2WUVA 1MW9X 3IR6A 4Y2UA 3U19A 2ZJBA 2ZYGA 1X19A 4OXQA 3ROFA 3TR5A 4P1ZA 4DR5B 2G6BA 2Z4TA 4J1NA 1JQLB 3FSEA 4C7OA 1GRQA 2QYOA 4I5GA 3W0LB 3NAZA 4S1NA 2ZJ1A 4TN5A 3PLAE 1ZIPA 1QF9A 4K28A 3ZY4A 4IWXA 4EBBA 1NONA 2VAPA 1ES9A 2NVUA 2YWCA 3E81A 1CDEA 2JFBA 3CSSA 3GVCA 1AQUA 3LDGA 1EP9A 5AM4A 2XWPA 1T2UA 3AUUA 3PJGA 5JH7A 2O7QA 1Q0RA 2VSFA 2B34A 4LJYA 1NBMD 5KI6A 2VJOA 3T3NA 3R6TA 1S3FA 4QOJA 2CF5A 3NVAA 4WK0B 3RAPR 1WETA 5AKXA 3A6EA 3AR6A 3BD6A 4I5EA 2EARA 3T5CA 2CUTA 3U2QA 1O3YA 4JLAA 5JOQA 2ECFA 4TSFA 5DT2A 5IS2A 4M49A 2X6QA 2Y4NA 3O73A 5BQXA 1QC5B 2EQBA 1UAGA 1OILA 3VNQA 4C1BA 2HTEA 2G09A 2QNIA 1PGPA 4RZXA 4BWFB 1P0PA 5FBWB 3GNLA 4XUCA 3IE1A 1VCHA 5DWQA 3KAQA 2G28A 3AETA 2EQAA 2VHUA 4URWR 5L95A 7ABPA 1YZHA 1CP3A 2IYRA 3CF4A 3T9DA 4UTNA 1F1BA 2FQWA 4H1TA 3EVFA 6ADHA 2C2WA 4TYPA 3MCTA 4MW9A 3DMNA 5EYPA 3U48A 1IRIA 1Y4ZA 1RCTE 2VF7A 5H8WA 4TLMB 1NJFA 1F2VA 2IWRA 3OE5A 4AXBA 2DWPA 3OAAA 3TIIA 4Q7JB 2CNLA 3T5BA 2J1LA 2A0YA 3C6MA 1WKBA 4X85A 3WQHA 4BLSA 1GFWA 4RTOA 4O4IB 4Y6GB 3Q7RA 3TJMA 3H2KA 3FVRA 5FI3A 2OA0A 1R4NA 1EX6A 1FP4A 3G1WA 2VUHB 5DHTA 3GX1A 5JHHB 4OIMA 5EJ8A 4ZHQA 2YY7A 3T3IA 3HA7A 4CMEA 3NATA 1ST2A 1NI4A 2OCDA 4BFYA 3COZA 1ZW1A 5GZ3A 4DV6B 5AXCA 4A91A 3GPBA 1SH7A 3HUEA 2YJZA 3QVLA 4OUKX 2AOUA 2GH1A 2IY7A 2OLKA 5CW1A 2OQRA 3F6YA 1PJ4A 2IXFA 2VYNA 1FLDA 2H4ZA 1NUPA 2HV8A 1LGYA 3PCRB 3UO8B 1N5OX 1DX6A 5I8PA 2NTNA 4B83A 3IPLA 2R9VA 2OQVA 1EWRA 4J2HA 4KKVA 2W58A 2YOHA 1Z5GA 3RU3A 2Z8YA 3TRDA 4HK4A 3B89A 1FK8A 3CLUC 2O2JA 1D09A 3NOQA 10MHA 4AMBA 1VPTA 1NW7A 3L6OO 4HB2A 4KITB 1SHTX 2W2MA 4CIVA 3P52A 4HSEA 4W1SA 1NC1A 2RI1A 1A4IA 5L3QA 5JD5A 2CNNA 1KI2A 1P2TA 2HLNA 1A04A 2NO4A 2V7GA 3NIFB 4M9ZA 3UENA 1GEEA 4C7VA 1C30A 4PZYA 3BWEA 1RYHA 3RVNA 2BBSA 4UM5A 1RT9A 3F3SA 3AR4A 1BRMA 3OO1A 3WV5A 1RRMA 4LBWA 5GONA 1T0JB 2DBRA 5ITZA 1A8QA 2CL0X 2R6R1 2OORC 4C4OA 5F7XA 1N25A 2SECE 4LDPA 3HVIA 4KAJA 4L28A 1Z63A 4MKIA 1PS8A 3OQ1A 3O8BA 4RA9A 4YHBA 3F3MA 4DA6A 4QGSA 3WGOA 3GLIE 3SC2B 1X7XA 5BV2P 3WK5A 4N5IX 3EH2A 4L8VA 4RVDA 3O3OB 3D59A 1NUTA 3RW9A 2ZWOA 3JV7A 3O8LA 2FHSA 5AKKA 5E8RA 4QWMA 3GQBA 4RKFA 4P9NA 3ZQ4A 4D6XA 2VJCA 1WXHA 4UUPA 2QRUA 5B58T 3VI3B 1D07A 4XX0A 4B8YA 1P8AA 3BMOB 3IULA 2G7MC 2F7SA 5K8TA 2I4NA 1CZRA 2AG1A 4LA4A 2OWEA 5FPYA 5DBIA 1FYWA 3V2GA 4RLFA 3RC3A 4E32A 1UKYA 3EULA 2C96A 1FSGA 2VSNA 3B1FA 1KDVA 4J1SA 1YOVA 4MKRA 5F5LA 4I4NA 3ITKA 3RSGA 5JSZA 1KEEA 3ITNA 1XKTA 4XTRA 4D2IA 1K5HA 3HYCA 3ABOB 1Q7BA 4YJ3F 1K75A 5JAZA 5SY9A 3ICPA 3ZD8A 5KZMB 3KALA 1HSZA 4U6NA 2IX9A 2QN3A 3AINA 3DP9A 3LM8A 5LQJA 1Z2PX 3HKDB 1SHKA 4LJSA 2FRDC 4GI7A 3GXBA 1V96A 1NVWQ 3C8MA 5BPFA 4PINA 4JI8B 2C2XA 4ZVSA 3CZ9A 2CJYA 2JKVA 4RIEA 3HKBB 1G291 3G85A 4BFWA 1X7DA 1L4EA 4DDTA 1EZZA 3FG9A 4X93A 5JVDA 4HL6A 3ZJTA 1U5CA 1WS6A 2BM8A 2CHUA 2X0IA 3M6IA 4Y1FA 3ZE6A 3FJ1A 4JC0A 1F48A 4NOJA 4E5SA 4DSAA 5I51A 1B0AA 4WNAB 1GUZA 2QJWA 5CT9A 1NVMB 2A78A 3JQGA 4KQCA 3UJDA 4K6CA 4YMLA 2GN1A 2C57A 3D43A 3RQSA 4YMTA 2HSDA 1CUWA 1GQSA 3AX6A 3DAGA 3G6WA 1SNYA 1V26A 2ZTSA 3QE2A 2ZUSA 4N7JA 4QPDA 2PWZA 3WWOA 1EYZA 3F6BX 4GC5A 4K3VA 3RWMB 4AUKA 2NQTA 1QH0A 5GM2A 2XV1A 1GP2A 3ETDA 3WGLA 4EW2A 3PDJA 4M9CA 2W2PA 4TTVA 2DQZA 2ADFA 2WYWA 3W1EA 1P73A 2ZSIA 5I6DA 4MIYA 4PC7A 1I2CA 1EDBA 2XLCA 4P6VF 1PEAA 3FMPB 2PRKA 4GO1A 3U5ZB 2GYUA 2K4MA 3WLRA 1XF1A 3U4AA 4R5MA 2A58A 5T4EA 3UK1A 3LVFO 3K94A 4HKTA 4WY2A 2MINA 2BMDA 4MDFA 2BEWA 1XK7A 1XMJA 2XTMA 6REQA 1JIIA 1XQYA 1Q1NA 2NUTA 4QQKA 2ADOA 4YV1A 4RVSA 4EEKA 1Z5OA 1OWOA 4TSRA 4NE7A 3V4SA 3OZRA 2FOIA 3WMWA 2PCLA 2WILA 3OG9A 4MYDA 3AVYA 1FNDA 3DZJA 4PZDA 5CLIA 5FWDA 1NXOA 2YIJA 1UBFA 3C8ZA 3VYWA 1PR5A 4L08A 2G4VA 1VDMA 2GK4A 3G3EA 2B1GA 1ORIA 3VKVA 4FWBA 4UXIA 2BMVA 2B3DA 2GSDA 4K8OA 1RHQA 2QEQA 5HWSA 3IBGA 4TTJA 4B81A 2ZUCA 3II6X 1TRHA 4PHHA 1QYWA 1JALA 5C8DA 1JSXA 1SUCA 1NV9A 2P6NA 4YRIA 3GJQA 4P3NA 4XM1A 1KH3A 3LY9A 3V7NA 2D06A 2SKEA 4B43A 2PUFA 2JH9A 3PJRA 5DM0A 3QEJA 5CITA 1NDHA 1X86B 4P0PB 2V9PA 1KOLA 1CPYA 3V33A 2QTNA 3ED5A 1JEJA 2ICAA 1CWUA 1XPRA 4PS1A 1JG1A 3I05A 4HNUA 5C34B 3GEMA 3TJRA 3EGDB 1Q0LA 1L5NA 3L7LA 5H83A 5JS8A 2HCTA 1T8WA 2PLNA 3SHQA 4AKSA 3HZHA 4DPMA 2RKOA 1PZHA 4YUZA 5CG1A 3B12A 4YRNA 3I53A 4ZC8A 1R4AA 1ZVJA 5ARDA 1D9ZA 3GLKA 1CERA 1UJNA 4I6GA 1V7QA 3SN6A 3MTDA 2Z95A 4ABYA 1CZKA 4FKZA 4BKMA 2QL9A 5JFOA 1MC1A 3L7BA 2UKDA 5TMBA 3ZHCA 3SZGA 4BO1A 4CMKA 1R9GA 3O8QB 2PRSA 2HIGA 1QCYA 3Q3EA 5FA6A 2QB5A 4LKRA 4TT8A 1QU3A 4R5HA 5EIBD 3FMVA 3HBLA 1KRHA 1P8JA 2P2ZA 1PEDA 3DDZX 2JBAA 1I51A 3HU1A 4LPKA 2A3RA 5EJ2A 2DT8A 1OT5A 1QV6A 5EIWA 1VIAA 2ECKA 3C97A 4GLOA 1VZ3A 1KZ1A 4TT3D 3QPVA 5B1DA 1QIGA 3WGVA 3IEVA 2PQMA 4ZU3A 2IS6A 1HZJA 2YOFA 3BA1A 1QRTA 2N46A 4WJLA 1Z7WA 5AKHA 3ZV5A 3TCKA 1WF3A 1CVRA 4XE5A 2Z56A 3RTDA 2F1OA 2GESA 3ELDA 5G0TA 2LPMA 4B2PA 4UCQA 5BMVF 2X4DA 3A4NA 1F6WA 2WD8A 4U6SA 2HB6A 4OQZA 5L3RA 3EXEA 1E9CA 3TZQA 3SQXA 1VCNA 3ENVA 5KVCA 5EWMA 3U3JA 1AB5A 3N58A 4O4HF 2QTHA 2KSQA 3TE7A 2AF4C 3QF7A 4K7JA 1R64A 2DJ5A 2VF4X 2ZQ5A 3GCDA 3Q7QA 1W0CA 2CEAA 4MQMA 2CDBA 4IPTA 4Y2GA 2Z3WA 5EP1A 2BMWA 2BP7A 2SHKA 3ZGYA 1Y1TA 4P84A 3WA6A 2H2AA 5K3SA 4UTOA 3IEPA 4XOIA 3BWCA 3LVQE 1QFMA 4QGBA 1AXGA 3QI2A 3P9SA 3OOHA 5H3HA 2C9YA 4ILEA 3QBVA 2QRGA 1ADJA 1ONBA 2BY4A 1NOKA 2DMRA 2B4RO 2GHTA 2XUPA 1IWBB 3AF3A 1KFKB 2WYIA 4J9VA 1UZAA 4AS2A 2OG2A 5C5DA 4QBTA 3DXXA 4YAKA 3KQWA 3NHPA 5J4KA 2QP3A 1EXDA 1YTUA 2PZFA 1RQLA 3BB4A 4TLAA 2JVJA 1YR6A 2CMHA 1N2CB 3O90A 3PR3A 1NMYA 4IJMA 4DG5A 2RBKA 1BGVA 2ZU6A 1RWKA 1OXBB 2QMQA 4QBGB 3T41A 4OQQA 5I5EA 1P44A 3IXMA 4HN9A 4I4IA 1ZLXA 5BURA 4R9NA 3I62A 3H9EO 1KKUA 3SEQA 4JBNA 4D6PA 5EWLA 4DADA 1JFFB 1JP7A 3WHKA 3KETA 3M2PA 4OY3A 1I6WA 1YJQA 2WJAA 4WKOA 3KR1A 2DSTA 4IBOA 3DR3A 2KBEA 4QFBA 1FPMA 2XWJI 5BN3A 3GUUA 4XVUA 3GEGA 5JDCA 3VNAA 1EDOA 2UYOA 1ISGA 3FZGA 2P4UA 4MJ7A 3T5MA 1DBRA 1KI4A 1U81A 1TCVA 1V9CA 2YN0A 4RA6B 5D6OA 4DABA 1KR2A 1V3UA 3EJWA 3MWDA 4I1RA 1NY6A 1OH5A 2ZR7A 1YZGA 2GDZA 3WNVA 4LF4B 4FGKA 1UBNA 1XTIA 3SJ7A 1DO0A 1Z8DA 4G36A 4YO8A 4GKJB 2FY8A 4EB6B 2PD3A 4KR0A 3RRZA 3M6WA 2Q5OA 2ZJ3A 3MMNA 3TTYA 1E96A 5L4NA 3HVRA 3TAHA 1NG1A 1SY7A 5TVKA 5AW4A 2R47A 4X60A 2PZKA 5HZKA 4Z4IA 1IIRA 5H81A 1JDBC 2H7VA 2NQ2C 3HXLA 4KVFA 3STUA 4CCAA 1KMHB 2BGNA 4JUIA 4L0CA 4WN9B 1JHYA 4WH0A 1ACJA 2G76A 2FX3A 4JP8A 3VZQA 2UVDA 1E9AA 5EKSA 2INGX 2QA5A 3RFXA 1YIAA 4GPTA 1H0SA 4E7PA 3PKZA 1JBQA 1OUMA 3ETHA 3V2HA 1RE1A 5ALTA 3CISA 2OPHA 2ZB3A 3ZLUA 3K70B 4RESA 3WKCA 3PYMA 1IN4A 4MVWA 3LWZA 3LUJA 2P2CA 1CDDA 3D2BA 4M8IA 1J39A 4JUDX 5CYOA 3B2QA 2ZUTA 4YECA 3VH3A 1PUJA 2VUTA 1V4NA 3LOUA 3QX8A 2Z2JA 3U3KA 1J4AA 1DDOA 1ZUWA 2V7WA 4AT1A 5E0OA 3S0JA 1GNQA 1ZOOA 3ZY6A 5L4SA 1YI8A 2HD4A 1A5AB 1H2HA 1K7FB 3R6LA 1WR8A 2P3SA 4GSLA 3RQIA 2JASA 3U9TA 5DSXA 2B35A 2GWHA 2Y92A 1C1DB 1NRJB 3QKWA 3FCSB 4NBUA 4EUKA 5BMOA 1U94A 3EK2A 2BUBA 1N57A 5AVKA 1U0NA 1UWVA 1XU7A 2WM2A 5BUSA 1E69A 1RTTA 3I8XA 3ON5A 3OX3A 1U3GA 4XD7D 3TDNA 4QU5A 1JRLA 2Y67A 4GI2A 3DMGA 3AIMA 4K9SA 1AK9A 4W9NC 3OE4A 4JB8A 1KYWA 1R8JA 4ZRDA 4J3FA 4F12A