3O2QB

Crystal structure of the human symplekin-ssu72-ctd phosphopeptide complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o2qB01
3RVQA 1YMVA 2ID7A 1JH9A 5PNTA 1KGSA 1DCKA 3SY8A 3SM9A 5JNVA 3TMYA 5JS2A 1DBPA 3OM1A 1BA2A 3H5IA 5JNSA 3ROTA 2FMFA 4RDCA 5IULC 2M98A 4E7PA 2GKGA 4HNSA 3HSYA 4OTZA 4PICA 2PMCA 3HDVA 5TE9A 2MYPA 1R8JA 3I09A 3VNBA 2OENG 3CTPA 2QVCA 4ETMA 4KMRA 1EFAA 4ZPJA 3QELB 4DADA 5FWYA 2MYUA 2YHAA 2ID9A 4Z4GA 3EQZA 1NXSA 5IEJA 2AYXA 3CG4A 4IMIB 4EYQA 3LUGA 3LKVA 4L85A 3QLUA 4KVFA 2FVYA 4PYRA 1JLKA 3GV0A 3Q15C 1ZHHA 3TO5A 4EVSA 1QQAA 2PUCA 1HEYA 1USGA 2PKXA 3M9WA 4RV5A 5IEBA 4RKQA 3HZHA 3OMWA 1SD5A 1MAVA 1KRWA 1EAYA 3QLVC 3P9YA 2Q5CA 3HK2A 5TPWA 1FQWA 2JK1A 3K9CA 1A0OA 4O1IA 1NXOA 1UDRA 3G1WA 5EWMA 1ISRA 4PE5B 3OQNA 3F7NA 3O1HB 4ZMRA 4IF4A 2CHEA 1SXHA 1D5WA 3C3MA 5C5EA 2PUDA 1E2BA 1PHRA 3T6KA 3GT7A 1FSPA 1XHFA 2O20A 4JP1A 5TQ0B 5KQGA 3H75A 4QYWA 4N0PA 4UHKA 4RKRA 2JB9A 4O5AA 1L5YA 1NTRA 4N0QA 4XAQA 3T8YA 1QQBA 4G0YA 1D2AA 3GWGA 4MQFA 2WRZA 1PNTA 2HQOA 3BRSA 3OO0A 2FKAA 3JPYA 1K68A 2E4XA 3EGCA 3Q7RA 4MQEA 1E6MA 1SXIA 4Z4IA 1M5TA 2FEKA 3LUHA 1MIHA 3E3MA 3NHMA 4RWEA 2CWDA 2H0AA 2JCGA 1F4VA 3EAFA 3O74A 5B3JC 2QVGA 4L4UA 4DN6A 5EWLB 4EYGA 4RK7A 5JNTA 3IP6A 4IRXA 1FFSA 3BILA 5DGCA 4RU1A 4TLMB 1JX6A 3A10A 5EWJA 3TX6A 2QSJA 5HKOA 4N41A 3DBIA 4YWHA 4OBBA 4F11A 3NBMA 1QP4A 2IYNA 4MRMA 1M5UA 1RZRA 3EODA 3HVRA 2LBPA 4LE2A 1AB6A 1U8TA 1ZH2A 5BRJA 3Q9SA 3SNKA 2MSLA 5KQMA 2JBAB 3NHZA 2FLKA 3HJFA 5ED4A 1Z12A 3CS3A 2PJUA 1QMPA 3IPAA 3MIZA 3RVMA 5GQSA 2HSGA 2NUBA 3EQ2A 2QW1A 4XASA 2QV0A 1IIBA 4MLDA 1MVOA 1DRKA 3C97A 3QEMB 2IPNA 3F73A 2GWRA 5DLEA 4FE4A 4Z4FA 4Z4HA 5TQ2A 4KK4A 1TM2A 4W5NA 1ZAYA 1JYEA 4KPYA 2JVIA 3LMKA 4WT7A 3Q7TA 4Z4EA 3CU5A 5F64A 1M2EA 5BR1A 2B4AA 4M88A 5FBKA 2PE5A 5FBHA 3OQMA 4Q7EA 4H3HB 1DBQA 1GCGA 3ILHA 3LUCA 4MLCA 3HO1A 2MYNA 3BREA 3GRCA 2PLNA 1Z17A 3URMA 5IUKC 1EHCA 3RVPA 2HPHA 2R25B 2IPLA 3JVDA 4OATA 3OO1A 2PL9A 4EY3A 2FEWB 1DJMA 4ZMSA 4LDZA 2JVJA 4ETNA 4KK3A 3DZDA 1YTUA 4MS4B 1LK0A 2FMIA 2KYRA 4O1HA 3H1FA 4XARA 1QP0A 1NATA 2LUOA 3LKBA 3HUTA 3BRQA 2FQWA 3O2SB 4HYEA 3RVSA 3GYBA 3SAJA 4ZYLA 1MB3A 4KFCA 1QNLA 4F06A 3MYYA 4KREA 3EDCA 1VRVA 1JDPA 4JOQA 4RZSA 1ZY2A 4N47A 3EJWA 2FW0A 1NXVA 3L6UA 3JS5A 3UK0A 2FMHA 2FEPA 2NT3A 2OQRA 4G0XA 4YRZA 1GCAA 4G97A 1PEYA 1YK1A 1NXPA 1LJLA 3O1JC 5FWYB 3CRNA 3QX8A 5C5CA 2JVKA 3W9SA 2HJ9A 4ZJPA 1J56A 2E4UA 2IKSA 1GLGA 4YCSA 7ABPA 1MB0A 4RK5A 4EYOA 1APBA 4KZKA 2VK2A 3IPCA 1EWKA 4MYRA 4RK0A 4YO7A 3RH0A 1RZRD 1C4WA 3T95A 4OLBA 2QU7A 4QICA 4TN5A 3HCWA 4MS1B 3Q7SA 2R48A 5CNKA 3QELA 1NXWA 1U04A 4IGAA 5T3YA 3LTEA 5TPWB 3RVJA 5KWSA 3VNAA 3F6CA 1E6LA 1P6UA 2H3HA 5CNJA 1EWTA 3DGFC 3G85A 5ABPA 1D1PA 1W25A 2E4ZA 1U2PA 4LZLA 4RY0A 4OLAA 3CG0A 1YS6A 4FE7A 3ROFA 6CHYA 4W5TA 4Y9TA 4IILA 4YLEA 3LUAA 3RVRA 5KQPA 3C3KA 2PUAA 1T34A 4G0PA 4Z99A 1D4ZA 3N53A 2BGGA 5JNUA 4YP9A 3FFWA 2NZVG 2FMKA 2RJNA 4KQ9A 1PUXA 2AYZA 4D6XA 4MQEB 1CEYA 3CZ5A 1TVMA 5TPZA 2WMYA 5BRAA 5D2CA 4G0QA 3OM0A 1Z25A 4Z9AA 1GUDA 5E3JA 3T38A 3N0RA 4XLTA 1VLZA 1NY5A 4TLLB 3LFTA 2NZUG 2LPMA 3KJXA 2B1JA 4MR7B 1DZ3A 2ZAYA 3OLVA 1XWWA 5I4CA 3HDGA 4E7OA 1USIA 1ZH4A 3QLVA 2FXIA 2N9UA 2V0NA 4MR9B 4RK1A 3SG0A 3KHTA 1QO0A 2X7XA 1ABEA 2HQRA 3KKEA 2IPAB 3JPWA 3KG2A 5EWJB 3H1EA 4EGSA 1DBWA 4YGXB 4F12A 1Z13A 5FWXB 1JHZA 5GOTA 3MQ4A 2WY2D 2A9PA 4MRMB 1JF8A 2CD7A 3FGZA 4S04A 4Q6WA 4EYKA 1JWLA 4JAVC 2M1ZA 2PUGA 2FN9A 4D74A 3IP9A 3ILYA 1P8AA 4G0ZA 4IMJB 3OLYA 1DRJA 4RXMA 1M2FA 1ZDMA 1AB5A 1RXEA 3OLZA 3CNBA 4JB0A 1P2FA 3I45A 1ISSA 2GX6A 3OLWA 4G86A 4RK4A 2PL1A 4QYMA 1URPA 4MR8A 4WWHA 6ABPA 4NICA 1JFTA 3KLOA 3IDOA 3TD9A 1BAPA 4RK6A 1JL3A 3JVIA 1F51E 3GBVA 4EVQA 1YIOA 3JTEA 4RS3A 5B3JA 5TQ2B 2J48A 2JBAA 1ZVVA 1OXBB 1ZGZA 3A3KA 3BBLA 1Z15A 3CKMA 4XXHA 5KI6A 5KC9A 5CHYA 3UUGA 5JNRA 2R4QA 1ZGGA 4S05A 3K4HA 1I3CA 2IDMA 3RQIA 2QXYA 2LIVA 1U0SY 4QPJC 1ZITA 4MAAA 4NCAA 3MA0A 3GBPA 4HNRA 1Z2DA 3OLXA 4FB4A 4YV7A 4W5RA 2VYCA 3N0WA 3C3WA 2E4YA 2RJOA 3R0JA 3H1GA 3FFTA 3D8UA 2WJAA 3TB6A 4Z0NA 3N6VA 4EUKA 4JASB 4H60A 2XDYA 1K66A 2PUEA 1KRXA 3LUFA 1XHEA 4NQRA 3KTOA 5HQJA 3QLUC 1DG9A 5JS1A 1A2OA 2DRIA 1KMIY 4MS3A 2FQXA 2WWVD 1Z18A 4Q6BA 2HQBA 3GA5A 3HXMA 5KQLA 5TPZD 4W5QA 4XFKA 1YK0A 4WXEA 4Z9BA 4KQCA 4JB2A 3DGEC 3OMXA 3N8IA 1Z2EA 4GNRA 3CFYA 2PUFA 5IUNC 4JA2A 1JFSA 2L18A 5CNIA 5HM6A 3QK7A 1DC7A 3RVLA 4RY9A 3FDFA 1QO0D 3O2QB 4NV3A 1SRRA 2FSPA 1TLFA 3RVNA 1SXGA 4P1ZA 1NXTA 4Z4CA 8ABPA 3FMVA 1D1QA 3HUUA 1RXIA 5IX8A 4B09A 3CLKA 4RSMA 3UKJA 1GUBA 2FQYA 5HSGA 2NT4A 3DLHA 3I42A 3NNDA 1YS7A 4YR7A 4RXTA 1VKRA 3M6MD 1JFVA 3KSMA 1B00A 5EWMB 4GPAA 2FTKE 1Y1LA 3RVOA 1ABFA 1DP4A 1CHNA 4WZZA 3H5OA 3RVKA 1JBEA 1C0EA 4H3KB 1WETA 2MSKA 2VUIB 1S8NA 3HV2A 3LOPA 3H5TA 3MM4A 2YHBA 4MS1A 2E4WA 4MQFB 4RY8A 4NCBA 4KRFA 3F6PA 3N0XA 1FFGA 5IUJC 1VPWA 2QR3A 5DTEA 3EULA 2ZWMA 5T7BA 4KNYA 3S99A 5TQ0A 3NNSA 3N75A 1USKA 1P6QA 4CBVA 3C6QA 2PUBA 1L5ZA 2MYTA 4LDAA 4W5OA 3B2NA 1H9CA 2QZJA 2WB4A 2RDMA 3Q41A 3O21A 5IC5A 1DCFA 1RNLA 5BQ3A 2L17A 1JDNA 3FFXA 3O2JA 4KV7A 4N03A 3SQNA 9ABPA 3O1IC 3LUKA 2L19A 2F8SA 1QPZA 3MF4A 1ZESA 3KLNA 3QEKA 4D6YA 3H5LA 4P98A 2FLWA 4RXUA 1LJUA 1DC8A 5IBQA 1JYFA 5EWLA 2GBPA 3KCNA 3KYIB 3H5VA 4OG2A 2W42A 3H6HA 4MR7A 2PAFA 1PNRA 3QX9A 2MSWA 1TMYA 2LP4Y 1EWVA 4MR9A 1OXKB 1LBHA 3CHYA 3JY6A 1DCMA 1BDIA 2I6FA 3HS3A 3CZCA 5DCLA 2F8TA 4N76A 1RPJA 1A04A 1FFWA 3KYJB 2GI4A 3A0UA 1E6KA 3DLBA 4LRQA 5FWXA 4MR8B 2P4UA 2TMYA 4MPTA 2A9OA 5JNWA 4WXMA 4ETIA 3LUJA 3OQOA 4YS6A 2P9HA 3E61A 4PZ0A 4MGEA 2E4VA 3GL9A 4LX8A 1QP7A 3D02A 1NXXA 1CYEA 3MMNA 5TQJA 2IPMA 4EVRA 3QLTA 3HEBA 1W9HA 2A9QA 4WUTA 2FN8A 1QKKA 1BDJA 1BDHA 1YMUA 4DQDA 4ML3A 3QEMA 4HNQA 1U2QA 1TJYA 1LBIA 1PEAA 4TMYA 3IP5A 5DKFA 2L2QA 4G0OA 1Z26A 2VUHB 3LUDA 3NNNA 4LE0A 2JRLA 5CNMA 3HM9A 4F8JA 2CHFA 2A9RA 3I5AA 5KC8A 3A0RB 2RGYA 3L49A 3O75A 3KS9A 2WJWA 1ZN2A 2IOYA 1YVUA 4MS3B 1BVHA 4UHJA 4F3TA 4G0MA 2R47A 3H5WA 3IP7A 4MS4A 4PEVA 4LE1A 1Z16A 3M9XA 3H6GA
chains in the Genus database with same CATH superfamily
3VR6D 2GHRA 3E3NA 1MX5A 2EFGA 3ORYA 4MA5A 2HT6A 3F9RA 1FFAA 1NVKA 2QENA 2VZEA 4YN3A 3LF2A 1KGSA 2O0MA 2J3MA 3TMYA 3MTDA 3WGYA 5C7IO 1Z5WA 2BMEA 4ZYVA 2ZSBA 5F7OA 4AMUA 2CDRA 3ASUA 3E9NA 4I9GA 4TS1A 1K88A 5EJMA 1X1RA 1VIDA 2FPIA 1PZXA 2G72A 3MAGA 4OLJA 4DNOA 5LQMA 2HV9A 2E48A 3CH7A 1MOZA 2JHPA 1EP2B 4UFNA 1R8JA 4LYDA 1YCFA 2COEA 2IGTA 2P7HA 1CERA 2WUVA 4QYSA 4GZMA 3QELB 2P9QA 3COJA 2MYUA 4PLTA 3RUFA 4DDHA 4I8IA 3C3BA 3VDMA 4B6JA 2QVLA 4N3NA 3LUGA 3NH6A 4TRNA 1T2CA 1SOVA 2IC5A 4PGAA 2FVYA 2FF5A 2VBGA 2XOEA 2Y2VA 1PBNA 3UAGA 2BSXA 1HEYA 3TLKA 3ZY3A 5LOVF 3EG9B 3NC1C 2UXDB 1HNZB 3DBLA 5G0UA 2WP0A 4OXXA 4BFVA 1YXMA 1QZUA 2OXTA 4K6OA 4GKBA 3ZU3A 4ZEMA 1DWOA 3WSWA 4Y2SA 1ESZA 3NHWA 3I72A 3Q10A 3IRVA 5DOZA 3G1WA 1U6IA 2F67A 3OQNA 4NYIQ 1G66A 1R0SA 3G7UA 2Q5LA 4QE3A 5I9NA 3NWOA 5A1TA 1Q91A 5C31A 2WG2A 4TTJA 3L1JA 3PNYA 4DDKA 3DE2X 3NHBA 2B8NA 1T0PA 4QYWA 2E5WA 1O2DA 2JB9A 2CLIB 3IHWA 1NTRA 4O5AA 1ECCA 4L8YA 4ZI3A 5JYCA 4EJSA 1SKAA 5E4JA 3OT5A 4J7UA 4BFXA 4E5VA 3N28A 5H70A 3AUJB 2HQOA 5LMUB 7ADHA 3WL8A 5LPNA 1OZAA 4KSCA 4QJ5A 4YP7A 3P27A 2WT4A 2PWYA 4LTMA 3ESCA 1TYEB 1J0DA 3M83A 1D8AA 2B3DA 2ZIVB 3CJTA 4RVHA 3P8ZA 5BW5A 2VPZA 2QLLA 2AFIE 1OH6A 1U9IA 3N39C 2Z4SA 3O3NB 3QTLA 4KE8A 1BS1A 3LW8A 4FK8A 1F4VA 2A14A 2W2MA 3STHA 4CKZA 1XNRB 3OFND 521PA 2ZUEA 1U80A 5K0BA 4I81A 3KXKA 2M6SA 2R65A 1FDUA 3VPDA 4BIIA 1QR2A 3Q9LA 1NAIA 4KXYA 3ZY6A 1U7WA 3DOUA 4BX3A 5JZSA 3KQLA 4FZRA 4NOLA 3AL2A 3RI3A 2QN7A 1UPTA 3IQGX 4EEZA 1T2EA 3OAAA 3WIBA 1KYQA 5IT9A 3NBQA 2YNMD 4KWIA 1P44A 2WJ6A 2IQIA 1XU4A 4MVYA 1QG0A 4WKBA 4D5GA 3PENA 5EYPB 3BTVA 1MDBA 2ZIAA 4QOIA 2D6FA 2PT6A 4TXHA 4RSRA 3CUEF 5FPHA 1TEXA 1H8EA 1RYEA 1T2UA 1EGQA 4I36A 4YRTA 2VQ6A 4UTVA 5HP4A 1M7HA 4H9GA 2Z43A 1JXOA 3LWBA 4ZEXA 1HQKA 1PZFA 2YY7A 2VWPA 4G07A 3H2BA 3PUJA 1H6AA 1WF6A 1NPYA 4IO0A 1RI3A 2XT0A 4P2BA 1QHIA 2XCOA 3FUUA 5KNBD 4Z4HA 4WY5A 4G36A 4A8JB 1QGZA 3TZBA 2IXTA 2OAGA 2W6NA 3TK1A 4S35A 3RAFC 1EWYA 3BS4A 3SX2A 4RHYA 3TH5A 3UNXA 5ALGA 1UAYA 4B33A 2ZUVA 1T1RA 2VXCA 4ALIA 1QGYA 4D4JA 4N9QA 4L50A 3U17A 2IELA 3L7YA 3I9KA 1N2IA 1TYCA 1B16A 1DKOA 3O92A 5EIOA 2I1VB 4UE2A 1BSVA 2BR3A 5CM8B 3C85A 1RHKA 2C83A 2VHUA 1P4AA 3FETA 1B8VA 1DG3A 1PR3A 2DPLA 3BMCB 3DV0B 3HJTA 3S5UA 4BNYA 1QGUA 3HN6A 2CF5A 1ODFA 2QMHA 2VHWA 1GG8A 1QGED 1PO7A 1MDFA 1HX7A 2CVPA 4I4LA 3PYXA 1TYAE 1Z6AA 4YPFA 4FN5A 2SCUA 4TXMA 1W36C 4B5KA 4KOAA 4OFZA 5IJZA 3ECAA 3WRXA 2BCGY 3LQQA 4FD2A 1I33A 5FL3A 1G1AA 2YWCA 2GJKA 3UGQA 3QOYA 2C3YA 4PG8A 1ZXXA 2ZRIA 3COWA 1E9RA 2EHDA 2FPIB 5H5JA 3ESAA 1FMLA 1GCAA 2VKTA 5CB0A 1JHXA 4FTWA 3IV7A 3B12A 2ZITA 4WRRA 1K9SA 2VHVA 4NFHA 3UG6A 2BH9A 4BB5A 3KPVA 4RVGA 1NBWB 1VE5A 4QTUB 1T5DX 2HIAA 5I7WA 4C4AA 4D8XA 4EEXA 4P0QB 5ERGB 4ILKA 1HEUA 1NUSA 3F5FA 1Z2AA 3L5OA 3Q0TA 4M1TA 1IUNA 4AO8A 5C35A 4DA4A 2GRUA 1TJNA 1U7HA 3DBLB 2GJ4A 3AEQB 3LT0A 3RAGA 1OFVA 3AUUA 3KQYA 1Q7GA 5EJ6A 3U1TA 3PC7A 1G16A 4RSGA 5ICEA 1YRBA 4BQSA 1RJEA 2HJVA 2I66A 2ZJFA 3HDYA 3PJDA 4B75A 4IVQA 3RT7A 3CR7A 4QXAA 4W5TA 1TE2A 1RWOA 1WY7A 4WW0A 2D2EA 3W5UA 4FBLA 4G0VA 2QUJA 3MLAA 4N5DA 4U63A 5CUQA 3HCCA 3QNMA 1OFUA 3SBEA 3E3OA 3VYUB 2VHTA 4KR0A 4GYWA 1NR7A 1F2VA 1T24A 1BZYA 1I10A 1N3BA 3LWDA 5AUOB 621PA 1GGKA 3VOSA 5BWCA 3QU7A 3CPSA 2OO7A 5AOCA 3R44A 3DD5A 1BWRA 1Z25A 2Y6UA 2VJNA 4IS2A 5CK5A 2TRSB 5KYGA 4Y1GA 1NFFA 1ZOOA 4RVNA 4PSCA 4BRZA 4DG8A 4E03A 3J7TA 5HIIA 1FJXA 1Q2UA 1RSZA 1YQXA 3SEQA 3A3NA 2FUEA 4JXKA 4S1OA 3V1TC 2HWWA 5KREA 1N4AA 3G2IA 2YN4A 2WM8A 3A2NA 4BWFB 3V1UA 1G60A 2QRLA 3A06A 3L7MA 4EBBA 2PNFA 3CUWA 3L84A 1PTJA 1E99A 5LP6A 4UZFA 5MHTA 4CG1A 2GCGA 3N2GA 4D5EA 1X8KA 2A9PA 4AIRA 2PFSA 1JFLA 1O6BA 4WXPA 5JAQA 2XIQA 2QWXA 3D8NA 3TUZC 3CXRA 4G4SO 3IP9A 1G3RA 3EPHA 1Z8FA 2C88A 4W1SA 1IXZA 1DRJA 2AZTA 2HMYB 2WSYB 3JD3A 3NUZA 4OSOA 5F52A 4D6PA 4F5EA 4RNDB 4D41A 2DY1A 2EJVA 3H97A 4RK4A 4YQZA 5DZSA 5CITA 4LRXA 1EVJA 1TRHA 1B74A 1W581 1MVNA 2RSLA 3H2HA 3IMCA 3SQLA 3VUEA 3AF1A 1ZI6A 3QVVA 3IDOA 4MQ4A 4MROA 3UJ8A 4RF3A 4RK6A 4HDCA 2PYDA 3LLCA 5FO1A 3OPYB 1QRUA 4E70A 5DV9A 3LRPA 2V5AA 3K8QA 2J7KA 3CCFA 2P4QA 3L0PA 1VHJA 3TNFA 3W6ZA 4LA4A 3UUGA 3QU2A 3F7OA 2PO5A 3BWXA 3QF4A 1IBCA 3E7FA 1X9HA 2Z1NA 3VKWA 3VNRA 4R9RA 2CFCA 1J2JA 2PGNA 3FGNA 2O0JA 3NTOA 5CYFA 4BWVA 4MHSA 1C9EA 1KJWA 4FB4A 5CCEA 1E2LA 2PH7A 1BQEA 4JB8A 2PKRA 2CDAA 4GNKA 4JSTA 3N0WA 1MAWA 4W5JA 4HEJA 3F67A 4DHWA 1XK7A 2XF2A 4ARAA 4IGFA 3EIXA 1CT9A 4OQDA 2OHOA 3OHSX 4JASB 3SHVA 2PLWA 2PUEA 1IE3A 3LT5A 1F8XA 4GC9A 4D82A 4EFLA 1RS0A 2O1WA 2HFJA 2OLEA 2IYRA 4ZO7A 3TQSA 3FPCA 1ZJYA 4TRRA 4I66A 3AF3A 5HF8A 2H9AA 1L5NA 1QB7A 1SKYB 4MS3A 1SM4A 1M0SA 3C7DB 1B0ZA 3F6BX 2FQXA 2PPVA 3GFFA 4KRYA 4UXHA 1IK6A 4WJZA 4LF8B 2Q1XA 1LB1B 3QYPA 3TRDA 4RHCA 1LPBB 4I4TA 4BZXA 4PAGA 4D0RA 2YR0A 4IH1A 4HWSA 1W6UA 1B8OA 1ZZEA 2YDYA 4WXEA 3RU3A 3DMTA 2WT8A 2AE1A 5ILOA 4JYAB 2R8OA 3UH0A 3QHAA 3ZWKA 1DARA 2X4GA 4MIOA 2ZKIA 4IEEA 4LQCA 3H0KA 1WZEA 3ZHOA 4U9UA 3JD4A 3FMOB 1WSDA 2EZ4A 2ISCA 1FTQA 4FYIA 4ZVLA 3SXPA 3VPSA 3KB8A 1KI2A 4B9EA 1NKTA 4ZTBA 4PZEA 5KOYA 3HVUA 3K9NA 1OT3A 2OHIA 4HNGA 4DY6A 1XK6A 3GCXA 3QKUA 2PM8A 3T7SA 3L8MA 5BN1A 2Y67A 1D2RA 4YJ3F 4KFUA 5DGDA 3T9BA 3AEKA 3CMMA 1IY1A 3DJYA 4I1RA 3K35A 3DPUA 4UD2A 4F7DA 4JL8A 4ZAFA 2GZDA 1QOPB 3FA2A 1RIFA 4TMXA 2FE4A 4TMFA 1OW3B 3G0CA 4TUYA 1MENA 3NH9A 5NULA 3R74A 5C5EA 1YS7A 4IG4A 3A6FA 3G2JA 1JFVA 1YNSA 2X0EA 3SE7A 2ET6A 3CX8A 3ESRA 3AM4A 4QTTB 4MV0A 3QVMA 4P4GA 3BPSA 3GRKA 2GAOA 1N6IA 2FTKE 2HXGA 1XJ5A 4QEZA 5A7HA 3RVOA 5JZMA 2GPTA 3AY6A 4Q01A 1YR9A 1AUPA 3HV2A 2ASEA 1DB3A 2ZIZA 1X94A 3WLFA 1XCBA 1KDRA 1RTKA 3CT4A 3QLJA 4ARBA 2XMPA 4HDSB 2CT8A 2VJMB 4UM9D 2PR2A 1U0GA 1M83A 1ODLA 1U3TA 2QJWA 2ZJ5A 4UVHA 1XTBA 1RQXA 2F3TA 4PZ9A 4X9XA 2QRJA 3UQYS 3NWEA 1FQKA 2G9UA 4X44A 5IXSA 1QF7A 1N2SA 2ZWMA 3EULA 2QUBA 1OXSC 1VE9A 3DKKA 3RWMB 4A23A 2YQ5A 4KNYA 3R3JA 1C3VA 5KYWA 4ONEA 3N75A 4PF1A 1HC7A 4HRVA 4QBTA 4AKEA 4C0KA 3HABA 4U0JA 2YS7A 2II6A 4BGVA 2JH3A 4J6EA 3JW8A 4J75A 5J5VA 3PPIA 2CVOA 3AJDA 1L7DA 2VF7A 2RDMA 4JVLA 1GKIA 1UMDB 3NWPA 4IIEA 4RFSA 5CEJA 1JEJA 4PYJA 2FSSA 4ZVQA 1YUBA 4BNVA 1P7CA 2GZSA 4N0EA 4NIMA 5L6LB 3ND8A 1PK7A 2OL4A 1ZUNA 4TT8A 1QU2A 3L0SA 4RXUA 3KLBA 5LZ9A 2OD9A 1LW7A 2F2TA 3RTEA 5LP6B 1ZISA 1U3CA 3N2GB 2OO5A 3LZDA 3OTGA 2X0DA 3ZK7A 1R7RA 3KFXA 4XB1A 2PAFA 2FZ4A 2O05A 2WJHA 3BKWA 3C3DA 3N8GA 2I8AA 3ANXA 4TT3A 3PQ5A 4MB6A 1DCMA 5TRTA 5DYGA 5AVTA 3A58B 3NT2A 1Y98A 5AUNB 5E8JA 4DIKA 2D3WA 4HH4A 1XPRA 4HAUA 3MOSA 4IDCA 1Y3FE 3C8ZA 5EIBC 2BMJA 5A71A 4LVNA 4NBWA 5M7EA 1IBMB 1HDXA 3KB1A 4MCHA 2LR0A 5G1OA 4ZCIA 1SB8A 1JNXX 1GPWB 3QXCA 5THKA 4L74A 2O2ZA 3ANTA 3W5IA 3WGZA 2X5JO 2YASA 2W58A 3BE6A 5CX4A 3MWKA 4CFZA 1L7QA 4IS3A 2PXAA 5AVRA 1UZUA 3OFJA 2ADOA 4LX8A 1P81A 3HJUA 3REQA 3EARA 4DRZA 4QKQA 1CIVA 4XTRA 2I33A 3OSUA 4PFQA 3EBOA 4C4YA 1SUWA 4JUCA 3ZQKA 5ES4B 2A5DA 3R6LA 3UENA 3FCOA 1LTKA 3GOHA 5KCZA 1U5CA 2P0EA 4CEIB 3FPFA 4QQNA 2QMEA 4HNQA 3S29A 1ULZA 2REQA 3Q11A 3ZGNA 3JXEA 1BHQ1 2G76A 8LDHA 2N47A 1SU7A 2JJ1A 1R8YA 2J5KA 5KJFA 1XZNA 3NVDA 1MKYA 4TMZA 4C0XA 3OZ7A 2PJRA 1P5HA 1Y48E 4RVUA 3NKFA 4OGLA 3TINA 1RP7A 1YQUA 2A9RA 3B6MA 2R66A 3WGQA 6YASA 2XLBA 3P4XA 4XDYA 2JFNA 3CO0S 2ZUWA 3LWNA 3V6MA 1YUMA 3KS9A 5DLPA 2OFPA 5TVGA 4MS3B 3LGXA 3V4OA 4D79A 3MJEA 2EX0A 4MO9A 5DGIA 4DLKA 5HK9A 2ZXUA 1JG4A 5AXAA 1OC2A 2DFTA 5I8ZA 2ZJYA 2GS9A 4K6MA 1GV1A 3M9XA 3TRIA 2DHRA 4Y9UA 2JIZD 2QRGA 3S0JA 2XD9A 1WXQA 3ZWPA 4BFCA 4DV0B 4NE2A 3RSQA 2F43A 3FPLA 1UPUA 3V1KA 3WNDA 1WP4A 3HCBA 1ZU4A 4G1EB 1QFMA 4XVQA 1DUVG 4TX1A 2VUTA 3U40A 2P5TB 1QHFA 3ZV5A 1P7WA 5AJYA 4OJKA 2IHUA 2ILVA 4PHFA 2QYTA 3B9PA 2J5QA 1LWOA 2CLCX 4H16A 4ZFNA 3LQFA 2A0KA 5IULC 3ASZA 2QPTA 3ZD8A 5I3ZA 3AEKB 4OTZA 4LGMA 4BB6A 2D1SA 5BW4A 1JAXA 1I7QB 1NHWA 1ZS9A 3Q7QA 2VUSA 3DFMA 3KTFA 1RRVA 4ZPJA 2XNDA 3TQIA 3WK4A 2D00A 1O6GA 1C1HA 3EQZA 2Z04A 4TUYB 2BHNA 3OPMA 4AFNA 2FOLA 4IDFA 4DWOA 2ZYHA 4L85A 2BI7A 4YYEA 3AW8A 3ZE9A 1NV9A 3UK1A 4G65A 3GV0A 3TQOA 3R8XA 2PH1A 2PKXA 4EI9A 3DCNA 1RHUA 2GBLA 3MN1A 4RYLA 2C5HA 3IKLA 3NONA 5L6MB 4BMCA 4WCFA 1RLUA 1VI6A 3N2NA 3QG1A 4C1NA 4DL9A 1Y89A 4MI6A 4E5KA 2BWJA 5JXHA 3HK2A 2JCBA 2QLNA 1SJ9A 1A0OA 1NZDA 3K0CA 1NR5A 1NXOA 4GBJA 4M9ZA 4DLSA 4EW6A 3D8TA 1OREA 3RDPA 2O19A 1O08A 2CHEA 3DLCA 5ALUA 1YRHA 1ZK4A 3AH8A 1E2BA 3DYVA 2XVXA 3WKDA 4B35A 4D3DA 3Q3CA 1L5FA 2O2XA 3H75A 3WHKA 3TRKA 5H9WA 1E6CA 5AKIA 5FHRA 1EEHA 4UE3S 5AJXA 4B34A 5ARBA 2FW8A 4E31A 3NS7A 3VHXB 4QJIA 1ZNYA 3CLSC 1QYWA 4XD7A 2IA5A 4RFSB 4X91A 3U3OA 5F77A 1Z0JA 1U94A 1YU9A 2GEKA 3SN6A 2JGIA 2Q6TA 3Q5EA 4IW3B 5LYJA 2EW2A 2FDXA 4CW7A 4MRPA 2O8FA 1SXIA 2VHCA 3PUZA 2GVZC 4YUVA 5A62A 3EWSA 1E1LA 1ZUNB 4QQRA 5C18A 1X77A 1Z5NA 3D5TA 4OQFA 3VOBA 1TM4E 3NHRA 2R11A 1HT1E 3VR2A 1RYDA 2WTBA 3L4BC 2QVGA 2E4AA 3C3JA 3LQ2A 5CT9A 4DZTA 1BWPA 4CUZA 4ER5A 4EY7A 1G6Q1 3PT5A 3JAWA 4DILA 1CRLA 3O3CA 4G25A 4BPBA 2WTXA 5DE3A 5ARDA 2WMNB 3CO5A 4RJ2A 3FPKA 3EEBA 4CVNA 1NZFA 1E60A 1QF9A 1JX6A 1X9IA 1N2HA 5FADA 3CEMA 3O8BA 3U0BA 4WFKA 1LZLA 2Q0HA 4C4ZA 1YOBA 2P3LA 3UYKA 4F11A 1J5EB 1UFVA 1V9SA 2BKVA 1A71A 3HP4A 3W90A 5AUPB 5J1TB 1EXDA 3QNWA 3HVRA 2RHRA 2G0AA 4HTFB 4Z1MD 1ZWKA 4IQ8A 5B1DA 1ZPDA 2W6ZA 3ZJUA 3CA8A 4Q1BA 5BV1A 4RUKA 5AJZA 5LMCA 1FIUA 4A2QA 1UC9A 4D3ZA 1JG1A 5KQMA 5KWJA 2NNLD 4GF5A 3HJFA 3DTTA 5ED4A 3NPAA 3MK31 3PGJA 3W9YA 4DA9A 3PWSA 1YC5A 1H2EA 4LJYA 3FIUA 3ANYB 3UMRA 2AJDA 1OLOA 3GGOA 4TZ0A 2HLNA 1IIBA 3UMBA 1KDPA 4IGEA 4CM7A 1BGVA 3RIXA 2IPNA 4MUXA 1T9ZA 4D9FA 2WPDD 4X6YA 1C9DB 4C7BA 4HNTA 3P2EA 1MVLA 4HKTA 1R9JA 4KKXB 4J91A 4K6CA 4HGRA 4M1SA 1B4DA 1EFHA 3U2QA 5HZKA 5K3FA 1EG2A 3CZ4A 2JIOA 3O6VA 3I9LA 2AB0A 3K1AA 3H2SA 3L6RA 4QATA 5ANRB 3ENNA 4UUOA 2H1VA 1WXXA 1ZCAA 1DE0A 2LD4A 2C95A 3K53A 3MUEA 3ZHXA 5JZVA 2BRUA 1OI3A 4AS1A 3WKAA 4V0KA 2PRKA 2XWPA 3WV4A 1TKAA 5CBPB 1CJKC 1UMKA 1IB0A 4B3MB 1WLSA 4A8HA 1P9OA 1DKMA 3A9TA 2YJ3A 3BD9A 5AQEA 4O1HA 1JQKA 3WA7A 1LBQA 1X1QA 3D3WA 4D9MA 4ZJZA 1FMFA 3UTDA 5CFQA 2BY4A 1DINA 2AYYA 3A70A 2F43B 2O4CA 1AGXA 1D2HA 1NN0A 1Z4LA 4KODA 1FSZA 2GTIA 1M73E 4GMGA 3H1TA 3W6PA 5M5BA 3EG5A 2GHTA 5AD1A 2ECOA 3WYGA 1Z9BA 1PL0A 2XSZD 1W73A 3OURA 4QLAA 4UMFA 3TZHA 1XZMA 2RGWA 2NZXA 3NHSA 5AXCA 2FEPA 2NZYA 1F1JA 2OQRA 4I5GA 4WLEA 1ZGHA 3G79A 3ED1A 3USCS 3QQ5A 3BIXA 3ICEA 3ZK9A 1VFPA 4XQCA 4IDAA 5B2FA 1U2GC 3R4VA 4DLPA 5FWAA 5AM2A 2YHUA 1GCIA 2JATA 4OI2A 2OM2A 2B92A 4KEAA 2PEYA 2DKFA 1OV4A 3SGLA 4KYUA 1X6VA 3CVVA 3D1LA 2W4MA 3MG9A 5AK4A 4EJMA 1JPNA 4WCFB 5HUQA 3H9JA 3TRFA 2LKCA 5T4HA 3EF1A 2V9ZA 2EWWA 1E0SA 2Q5QA 4HXFB 4C7XA 1N5DA 2V3CC 1YJQA 3I9OA 2FZEA 3EA4A 3KT8A 4RGVA 1N77A 4LYAA 2WUGA 2Z5GA 3BB3A 1M8GA 4H6PA 3K1YA 4BBAA 3FWYA 1Q1ZA 1QSGA 1EFCA 2B4TO 1DTWB 3LUAA 3P9ZA 3Q9NA 1UMBA 3L43A 4Y9TA 5JATA 2P62A 5F7JA 1TECE 1YDFA 4RCYA 2QQEA 2JFQA 3LW7A 5K45A 1NUUA 4HZUB 1L3CA 2IOHA 4Z99A 1IM2A 1E2QA 3UBMA 4NCIA 1JALA 5JNUA 3HDTA 3E53A 2JAOA 3INTA 3OQ6A 3GLIE 4CT5A 1WMDA 2C78A 4M9UA 5ALVA 3EQ7A 4GOMD 4D6XA 1IHUA 4IQFA 3UW3A 4BLWA 1FFHA 1EA7A 2E37A 4FOTA 2HI0A 4JI1B 5FI0B 3A4MA 2C97A 1QYXA 4ZAWA 4NXMB 3H5RA 1JEAA 1G8GA 3F3SA 2YMMA 5CYGA 3JAWB 1JDJA 4PQEA 2FSVA 4YRLA 1I4OA 2FW7A 2F6RA 4E7OA 1CUWA 1USIA 3TW0A 1ZIYA 2C8KA 1QO0A 4XOIA 3SG0A 3SZRA 3FAZA 4AZ0B 2XT9A 3DTNA 4EHHA 1VMEA 3LUBA 1J99A 4CLHA 3PQ4A 2OKCA 3WJ1A 4G1VA 1KXZA 2FW9A 4LZWA 3VR5H 1UPAA 4YHHB 4J4HA 2A57A 4D99A 4W8HA 5FAKA 1XEAA 2PY6A 3LUPA 1QV9A 1O0CA 4Q6WA 3TR6A 4ZOQI 1EVZA 3ADBA 1AXRA 4IIJA 2ENWA 4G23A 2NQ8A 4IMJB 3TIXB 2GA8A 3OZBA 5ALFA 3TLYA 1C9JA 1Z4IA 3PJFA 2JARA 1NVWQ 4TQGA 1R64A 1WXGA 1WV0A 1ORWA 1MTZA 1VL8A 3FOCA 4DDMA 1PLLA 4CQMB 5IC4A 2GX6A 3L1UA 4G86A 3IEMA 2FWBA 2OXRA 3HR7A 2WHXA 3G0BA 2WFAA 3BHIA 4RMNA 5BQFA 1C14A 1WUJS 2B1RA 2J3IA 3FSGA 3VGPA 4BC0A 2JEOA 1UADA 3DKPA 3KLOA 1DFHA 4LUCA 3NHYA 4YAGA 3PNMA 3TI7A 1V45E 3TOSA 3OJWA 4CWAA 4DJFC 3UMGA 4MV8A 2AE2A 4PXAA 2W6CX 3EDQA 1P2UA 1X1TA 3IERA 5CVEA 1UQUA 1KZ6A 1OILA 4XTCS 3EX7C 1E89A 3W6NA 2BELA 1U0RA 2QIOA 4C0QC 1OCEA 3PQ3A 3TSZA 1VZ2A 1W87A 5CM9C 3SYMA 2NOAA 3TW6A 4URXR 5J3JA 3RQIA 1UKEA 1VMKA 5DX1A 3GGCA 2CSUA 4Q02A 3D4PA 4C89A 5K3FB 2OPHA 1GT6A 3BH6A 3PQCA 3H9CA 2PZKA 3K1AB 3CPJB 2O3SA 4YRSA 3DKRA 2K4MA 2C4WA 5CMLA 1T26A 3AZPA 2BOVA 1RXWA 2WICA 3WWZA 3VBEA 4ZODA 2F3UA 2I1QA 2ODAA 4OSPA 5EUCA 3WRYA 4CL0A 4YCDA 1QANA 2CL7X 3LX5A 3I9V6 3KKMA 3OT4A 3U61B 4H60A 3IVMA 4GUDA 3DAGA 4ND7A 2FN4A 4S0XA 4TZKA 5L8VA 1A9XA 3T9FA 5DLQC 3QLUC 5HR5A 3VDQA 1GKYA 2G5CA 1AKWA 4FKZA 1QCCA 1QH0A 1U11A 3W06A 4ZCTA 3HXMA 2Q28A 5C7OO 2JC3A 4BU1A 1TO6A 5AW3A 4LBVA 4RKWA 4KZPA 4ICIA 4K1LA 3EPKA 1A7AA 4KQCA 4GIBA 2K2WA 3CH4B 2XODA 3WL4A 4HEA6 2V45A 3E8SA 4UDXX 2JFXA 5JXIA 4FXOA 3JD1A 2MJLA 1L3IA 4P08A 3W79A 1CDDA 1MRNA 4W1QA 4KBYA 4D4HA 1M2VA 4YIKA 1L7MA 1RVDA 3CWQA 4GQIA 2HCJB 3QBDA 1EINA 4KPEC 1QRTA 2MU1A 2YWFA 2QD1A 4P7BA 4NBSA 5TJHA 4Y98A 3HYRA 5AW6A 3PD0A 1EVEA 4FYPA 4P1ZA 4J2OA 3SZOA 2QBYB 4BJ6A 4Z4CA 1W0JD 1V95A 2BI8A 3HEMA 5C52B 4CR8A 1BNCA 4LMPA 5B57C 4N7JA 2O8DA 2JZOA 3CLKA 3KBOA 4S3MA 3ZV6A 2B3TA 1EXVA 1BFUA 3R3HA 4G1UC 4YXWA 3B6JA 1V47A 4KAXA 4MW4A 4NBKA 5B6IA 2Q1TA 3NNDA 4RD2A 4N8DA 5B2ZA 1ENYA 3OJLA 1OFIA 2CW5A 5D8DA 2QAGB 3SHQA 4BKRA 2FY8A 3E7PA 1L5SA 4WZZA 4FGZA 5TF0A 4CM4A 2RIRA 1O54A 3LOPA 1UMBB 2IBTA 1J09A 2X6RA 4ENUA 4GYKA 1E4YA 1RMYA 4JLMA 3HXPA 4NEHB 2IK8A 2VTDA 3PG5A 4F3YA 4RY2A 4E2WA 1K4YA 1SHJA 1QU3A 4XRGA 2DHEA 2H59A 1IEVA 2H7YA 3ZDAA 4DUGD 4FZ5A 2ZYAA 5EE0A 1KEEA 1ISGA 3HYNA 4JYCA 3EDMA 5IJXA 5U1PA 2CDNA 2J9FA 5CX1A 3QEBZ 4AW9A 4P3NA 4HN2A 3Q8WA 1I2ZA 2QTGA 3WDLA 1E1RD 3Q72A 3K0SA 3DOIA 4R41A 3QHPA 1A4IA 3B2NA 5JV5A 1NBMA 1CLUA 2J3JA 2CE2X 4ZK2A 5KKNB 3J80A 2WU0A 3U37A 1Z7YA 1I9CA 3E0QA 3MCZA 1SU6A 2IEAA 1UBFA 1Z88A 3GNQA 3R9XA 2MOKA 4GM0A 5A5DA 4YV1A 3EEFA 5LUAA 4P32A 1DC8A 3DFKA 4HEA1 2ZAGA 4GLOA 4W82A 3NM6B 5CXXA 2AX3A 3ZXXA 4R9NA 2WJZB 3KC2A 2O07A 1E9CA 5E1MA 4QT4A 4OB8A 1NBIA 2EGUA 3TAHA 4G5GA 2QAIA 1NG1A 3ZU5A 4IIJB 2PVSA 2VDLB 3PFCA 3QFRA 5TT1A 4MR9A 3SF0A 4P2GA 1Y33E 3WX0A 3MWDA 4O0MA 4O2AA 3CR3C 5AJHA 5B58T 2OT3B 1JLLA 2GI4A 4WN9B 1NQWA 1NVVQ 2FGJA 3A36A 4OAPA 5L3RA 3KXDA 4A82A 3M81A 1GYQA 2QTBA 4ZDKA 2XA2A 5K03A 3NV7A 3RSCA 1YCGA 2DFLA 2Q1UA 1VCMA 2ZR7A 1J0BA 2O8CA 1U1DA 2RHDA 1P39A 5CFRA 4KN9S 1ATZA 2Y1EA 3SKXA 4W9NA 2FHPA 4L28A 3SHOA 4AS3A 3BZWA 3T5BA 1JS1X 4AZWA 5HE8A 1OBHA 3UJ3X 4I5IA 2FPLA 4WKOA 3NLLA 4ZGGA 3MTQA 3PDIA 1JSLA 4DJEC 3SX0A 1YMUA 2FLVA 2YW2A 5CGQB 4ZKEA 4C6HA 3ZD7A 3FNEA 3GK3A 1KJ9A 1PYDA 2HCFA 2PKCA 3THSA 4BKUA 4A6XA 1WZUA 1YI8A 1J21A 3HB9A 3MXOA 1O96A 2Z08A 3GJ6A 4BX0A 1NIJA 2DHQA 2Q7XA 3JQ6A 3HR4A 4AMYA 3HRIA 3DOCA 5E7JA 1U81A 1C3EA 1JIJA 1C9MA 4B82A 4FVTA 1J1UA 1Q20A 1TMOA 1MR3F 1Y8QA 1A9XB 4JCOA 1K5HA 3QEAZ 1G8FA 2Y4NA 1HDIA 1Z2NX 3EHEA 2R8RA 4EHFA 1B1CA 3T7AA 1U0BB 3PCRB 4ADSG 1IC6A 2IKQA 2X9QA 3E1GA 3HLKA 2Y0DA 5CFZA 4Y9RA 3PBKA 1R12A 1NMEA 1TCAA 1ZU5A 3NI2A 4G5XA 4UZSA 4LY3A 1D03A 3RTGA 2E21A 2AW5A 4OGGA 1WTCA 3V9PA 1PWEA 2H1IA 4LMBA 4WSOA 3N0TA 5FPPA 4NBRA 3NQ41 1VCHA 4A6DA 4AJKA 4F6RB 2HSEA 2EIHA 4G6ZA 4Z54A 5HTOA 3GLFE 3VZCA 3DQZA 4ZVPA 4X20B 4M0MA 4H1HA 3H9GA 4F5YA 1GTSA 1M2VB 3ZV3A 3AKEA 2AA3A 4LJ5A 3WLIA 3HU5A 2F00A 4LFAB 3OM1A 1F3LA 4HRXA 5JS7A 1TAUA 2RKWA 1DBRA 2WKWA 3KM0A 1KDZA 3HA2A 4A1FA 1P5FA 4LXIA 3WK5A 1KQPA 3P0HA 2O8DB 2MYPA 3EA5A 1GUZA 4IFEA 3ORFA 5DRYA 1ETUA 5EVJA 1AKQA 4FYVA 1D7AA 2Y92A 2QX4A 3AP3A 1IOWA 2HNBA 2VDVE 2P3QA 5CYOA 3AB3A 3IBYA 1XA3A 3P2YA 3GGSA 3ZCVA 3WSTA 5DM60 5BRNA 5I01A 1EXMA 1JEQA 3CH6A 2B78A 4X93A 4AY6A 2A4MA 3GUVA 1ADBA 4KNWA 4EVSA 1HF3A 1T36B 1DTSA 3CWCA 1XWFA 1USGA 2AH5A 1F48A 2BKUA 3DLIA 4J0CA 2NQTA 4LOLA 4OP1A 1W0KA 4RV5A 4GKAA 5JH7F 3HB0A 1YOVA 1SD5A 1VTKA 4CM4B 3UANA 4PHTA 2HZBA 3GCDA 1GNVA 4KQWA 4F91B 4RV9A 4CM5A 4OIFA 1QRRA 3LFHA 4I5DA 3ER9A 4ACAA 1Y9JA 3TDKA 2AKAB 3GVIA 1FP1D 4TTIA 1G20E 1ZGJA 5ECGC 1JIUA 5JQGF 3KT3A 1RC1A 1T2FA 4IF4A 3VO8A 5F9HA 3RF6A 4G2NA 3A9VA 5JAHA 2J4CA 3IMFA 1Z5ZA 2Y1XA 1NQTA 4OJYA 1K63A 1NY6A 2A0FA 4PTLA 5CX1B 4BFLA 4RKRA 4LC9A 3MBOA 2NU8A 4LZNA 4CF4A 3W2EA 3HU1A 2IYTA 4YRGA 4N3BA 1B1AA 4FGLA 4ND8A 5CA1A 1MT3A 4D42A 1T3HA 1VCIA 2UVDA 3GLTA 2VXOA 3O7WA 1V3VA 1QTRA 4S1WA 4XIIA 2OHHA 2PV7A 5CCBA 3AM1A 3U13A 3GP8A 1EX9A 1I94B 3I28A 3R9XB 2NMVA 4RWEA 4AJJA 3VZSA 2AK2A 2HSWA 1GWNA 3TPZA 1IN1A 2DH6A 2CLHB 3UV7A 3OJEA 3WRVA 1CJCA 1RLMA 1UWKA 1Z68A 2HLPA 2XOXA 3AKCA 3EXIA 2VP2A 1HQYE 4KQKA 4Q4AB 3ZDFA 3IP6A 3BC1A 3OI7A 5AKZA 1S3SA 3T54A 1A8SA 2IEZA 4A03A 2ZU0C 6ADHA 3LOUA 1KO4A 1YJBA 1TX4B 3R0QA 4QXQA 5F1OA 5GGYA 3OQHA 4YMUA 2QSJA 3FDZB 3MWDB 1PX0A 3DBIA 4O2AB 1WSAA 1JLLB 4G37A 1QP4A 4UUQA 2C00A 1J1IA 4AN1A 3K3PA 3FVVA 1J90A 2AOUB 5LFAA 2VJAA 2REOA 1XTPA 3OX4A 3F3YA 5A7GA 1CQWA 1O9HA 1VLQA 4FE3A 3QPWA 1L7NA 1YFLA 2EDCA 3O82A 5DHAA 4F2WA 3D6JA 5JIBA 1OLUB 1FDTA 4DPMA 3FOZA 1DMRA 2CBGA 4FEAA 3UMSA 3FYTA 2Y1CA 2BR4A 1RFGE 1Y1TA 3C16C 1CRZA 1NMSA 2I67A 4MLDA 3GJ8A 4B7CA 1DRKA 1GFIA 5JMOA 1QUEA 2ZFUA 5FNZA 3F73A 3EC7A 2Q3DA 1YVRA 1O96B 2FFBA 3H1AA 1NOKA 3PIIA 4GMXA 4KK4A 5GWXA 3T9EA 3TM5A 1ETHA 1QVZA 5B37A 4Q3EA 1XC7A 2R8XA 3AR2A 3T1HB 3PJRA 3I8SA 1G17A 3TZ6A 4CXMA 3NAGA 1ZEJA 5HQTA 5DNDA 1NW8A 2QI9F 1Y8QB 3K30A 4TUYF 3UXEA 2HWYA 3DM9B 3B89A 4Q19A 1F9AA 3TLXA 1QQTA 3ELWA 2GB4A 2D5IA 2DPGA 1H93A 3QPAA 5CYPA 3FOWA 1QH1B 4NECA 1Q12A 2WM3A 4UBMA 2Q5HA 6LDHA 1EHCA 3GOQA 4X3CA 2WSMA 2XQJA 2VJLA 2GZ1A 2WHRA 3EXAA 3OO1A 4ZV9A 1KVTA 2PSFA 4DM4A 2P65A 4CF7A 2B61A 5F98A 4IRMA 3O8LA 1THMA 1N2EA 3E7WA 3N9IA 1M7GA 1XKLA 3C7TA 3QOFA 4IOMA 2Z98A 4CL2A 2N42A 5KZMB 1KKUA 2WWFA 4G9BA 3WMGA 1CRPA 5JD5A 3M3HA 3AFIA 3FGOA 1S02A 3GROA 3HUTA 3NDBB 2PKQO 3RQSA 2J30A 4PWYA 3RVSA 4DFDA 2INGX 1MW9X 1KK3A 3IIEA 3RUAA 3I53A 5A4IS 2ZSKA 3HCFA 2IYWA 3B1JA 5ELXA 4TKLA 2NT3A 4AIIA 4FI3F 2WD8A 4E5PA 3PA6A 4NULA 4H7JA 3B3GA 4M0DA 1Y63A 3HYSA 2C7QA 5IVHA 5IBPA 4HUTA 5FL7A 2VJBA 4BNXA 2FG6C 3MINB 3S1SA 1LPMA 1GV0A 3ZOKA 2C5AA 3KFLA 1WL8A 2O48X 1JDSA 3PQ2A 4IDEA 3E27A 5EXDA 4QEDA 5T3UA 3BVPA 4OGKA 1DUSA 1JEQB 1P0FA 1XQ9A 2VK2A 3HBAA 3IB3A 3PYLA 1ZN8A 5A3RA 3A6PC 1PT6A 2VSNA 5LIPA 1JBKA 4P7JA 3PFBA 4TS4A 3CTMA 2QMUA 1XTIA 2GM9A 3DL7A 4E33A 3GU3A 3KQHA 2WMOB 4QICA 1NXQA 1YOVB 4F2GA 4PQFA 2CFRA 1RAHA 2DUMA 3CF6R 3GZNA 3ONNA 2QZZA 3VVMA 2XWQA 2VT6A 3L7OA 1N8TA 1ZEMA 4DM7A 3HI4A 4H35A 2WZBA 4PNPA 5EMNA 4CDGA 3G85A 3A3YA 4JBXA 4B6SA 4YT2A 8MHTA 4X1YA 1W4LA 4FZVA 1U1CA 3SS8A 4EP1A 4XYEA 4J3JA 4IILA 3TTVA 3UUEA 3IYLW 2ZPUA 4YAIA 1XJCA 2YWJA 3NEYA 1Q50A 3GEIA 2NU8B 3R7WB 1HYBA 2Y3IA 1DL5A 3PGXA 2WJJA 1Y5MA 2NNWB 2I2FA 1CIJA 3KBBA 1VE1A 4F7WA 3T34A 3ZTWA 2B99A 5D3MA 2IYPA 2VPPA 4HFRA 2H11A 4IOJA 4IKEA 2F90A 2PJDA 1ODCA 3LXMA 3JTMA 2X86A 3GJSA 4DLYA 3TFOA 3D5QA 3CZ5A 1BXKA 1RQLA 3AHEA 5H81A 3OTQA 1GGJA 1I24A 2PGLA 4XSGA 3C4JA 4A4DA 4GLJA 1QVRA 3T38A 3MQFA 1BE1A 2BGKA 4LCJA 4BNLA 5HVNA 5I4BA 1J7JA 4YAJA 1VRWA 1M6EX 1O94A 2QX6A 4LI0A 1ZJZA 3E15A 1Y3HA 5FUQA 3LVQE 1E7YA 3EXIB 1NHGA 1Y0BA 1P91A 5ALMA 3DL0A 4CLDA 2C42A 1YT5A 3QLVA 2N9UA 3DVAB 3RM3A 2GJSA 3IXMA 3VR4H 1XTJA 3KWFA 4BMPB 1PT7A 4OMDA 3H1EA 1QYIA 4JT9A 1DBWA 3GI1A 4PPYA 1V8FA 2H4FA 2X4LA 3NHLA 4WOPA 2WY2D 3S44A 1JJVA 4AF7A 3R3UA 4FIDA 4MW2A 3FGZA 2D8MA 2JFFA 4J03A 1P3JA 1BCRB 1L7OA 4JBIA 4NZNA 3PRJA 4J0IA 4FIZA 4QQKA 2O5VA 4K8OA 2YJZA 4NMLA 2H7VA 4RZUA 4LISA 3OLYA 3EGWA 4XM2A 2Y05A 1JDUA 4CMIA 4EY5A 2KWIA 2LV8A 1Z4PX 3QWFA 3QFFA 1A5BB 3WNBA 1MBZA 4MVWA 2GZ3A 1PVOA 2BSAA 3KKKA 1OROA 2EBUA 1U28C 3UB3A 1JFTA 1HUQA 1M2JA 4IX1A 3LA6A 1I4DD 1RWXA 3E7DA 2BE9A 1NQOA 4K3UA 3GBVA 3INNA 4K2HA 1YIOA 4LJSA 1XSEA 4IXMA 1HDGO 1I7NA 3FRIA 5K5EA 1ZCBA 3NOQA 5FCDA 1TZMA 4AX8A 2PT5A 4EM6A 4DIDA 4ARSA 4CT4B 4MMYB 1G18A 1V1MA 4MWSA 2CFTA 4FBMA 1SUSA 4BQNA 3NO4A 5DF1A 4F85A 1KTIA 3CVUA 1J22A 1O3YA 4CCWA 3E4CA 3AR6A 1W85A 3BCRA 2VNHA 4PX9A 4RIGA 5ILGA 1GRVA 2ZCJA 2HKIA 1L6IA 3ANNA 3FWNA 4PSKA 2ZYRA 3JSXA 4IGKA 4Q37A 5ECYA 4ARUA 4YUWA 5K8CA 2RJOA 3LY7A 4Q9KA 4E5SA 1O95A 4OXNA 2JPDA 4IWNA 1QYCA 2PH3A 2BGUA 3HACA 4BX2A 3IOEA 2HDWA 4ZP1A 5FPTA 5B5SA 3PPYA 1CJTC 4BNWA 1EJ0A 3QW2A 2HA0A 2DEUA 3ZUPA 3LX4A 2Z9CA 2NSDA 4Q00A 2J32A 1NL3A 4JY7A 2TMGA 4XWOA 2ZIEA 3W8EA 3FHLA 5DTMA 1S96A 2WWVD 1ZLXA 3UY4A 1ZL0A 2EV9A 1VLMA 1EUDA 1G3IA 2O3QA 3KQVA 1KSGA 1ML4A 4OUDA 2HB6A 4N6GA 5NLLA 3RPEA 3WO0A 2OBYA 4ANFA 4MARA 3O94A 1JQDA 1HFJA 1RC0A 2ZJZA 1O9GA 2G9QA 2V6IA 3N2ZB 1NJSA 2GAFA 3DE3X 4Q3AA 2AW3A 3AO0B 3KOOA 2IDZA 2V03A 2YY5A 4F71A 2IXFA 2G17A 4Q15A 2TSYB 1MFZA 4YMVA 2P90A 3HP1A 2DGDA 1HDEA 3CRQA 4V3CA 1K7YA 3EWAA 3PXBA 4J1TA 3LBIA 4KYVA 5FYQA 3W1EA 1HRDA 1JUDA 3AKDA 5JARA 3GUYA 5EZSA 3RJZA 3THOA 2VBIA 4KAAA 5J4HA 2F17A 1OJLA 2O7VA 3FCCA 1NXTA 2VF5X 4OK6A 3LP6A 5BR4A 4QVGA 5JVDA 1CJMA 1MEJA 3JQ7A 4NCHA 4DJAA 5KJ6A 1OHHA 2WWYA 5FQOA 1ACMA 1D4AA 1XU7A 2FF7A 2P1RA 3QU4A 2FRDA 1KZGB 4P9NA 3V9AA 3PVSA 1KEWA 2HD4A 3GZNB 1TL7C 4YAFA 5G4KB 3E9RA 4P4LA 4LIPD 5DH9A 3EXHB 3QMVA 2VJOA 2Z4TA 3DC2A 1E6UA 3RFFA 1JLHA 2QVBA 4CDMA 5BSHA 5JADA 4Y6SA 3QKWA 1YZQA 3P9RA 5M3BA 1J9ZA 1QH9A 2FJ0A 3OQJA 3QWBA 5CP8A 3U4MA 1A7UA 3T5MA 4AY5A 2I3BA 821PA 2HDHA 1ZN9A 2EYUA 1GXSA 2NPOA 2FX3A 3OU6A 4NBLA 4P81A 1MQSA 1K8RA 2WSIA 4RY8A 5JSZA 3KQUA 4NH0A 3G2HA 4KDFA 1O0BA 5IKXA 1I3LA 1DMSA 4WLVA 4NMHA 1HE2A 1W30A 3QFSA 1BYUA 5D3MB 4EI8A 5I9LA 4DMRA 1Q16A 2XCIA 2C2ZA 3ESDA 3FRHA 1VPWA 1PZHA 5K01A 3CB2A 2JLWA 4FR5A 1RQ2A 1YE3A 2VDRB 1NMXA 1CRQA 4JR1A 3ZX5A 1J39A 4GR9A 2DCMA 2Q6KA 4B2IA 4BV8A 5BUZA 2IW1A 3U49A 3K6RA 1VYUA 4UVGA 2WJ4A 2P9EA 2ZRKA 1X7ZA 2H9YA 4D8TA 3ELYA 5I45A 5FLKA 5GZ3A 1BFDA 5K8TA 2E5FA 1YVEI 3TOCA 5H7XA 4JI6B 1N3YA 3DUWA 3A1VA 1ZM7A 2QKYA 3LPAA 4S1VA 4N8EA 3L7DA 2BLLA 3NVMB 2B82A 5ERXA 2BTQA 1H2WA 3CSDA 3ZGLA 3KUUA 2JFBA 2WSSA 3NV9A 1FDIA 3B7PA 1RI2A 2B7LA 4ZVSA 2AWNA 4OYRA 3QX3A 2FOIA 3NCTA 1W88A 2PXXA 1F6BA 1W4BA 3BICA 4HB3A 1Z28A 4OG2A 1KDOA 4F96A 1ZK0A 2AMFA 2ZJ0A 1PT8A 1WQ3A 1DOHA 2AG8A 2GJ8A 3DH0A 5FJJA 3G82C 3WA6A 1CF4A 2YW9A 1E9DA 3OJOA 2NXNA 4BO8A 4HWRA 4CNQA 4YV0A 3FHJA 5JRDS 1P3DA 3EFEA 2EZTA 4JSRA 4NHEA 4D92A 4UC0A 3BIJA 2RHCA 1GM5A 4JVSB 3V1YA 5JSFA 5HS6A 1WPGA 2QVXX 4A91A 1YFJA 1ZOIA 1JDTA 2QLMA 4MIEA 4A2CA 1ZAKA 5T64A 1DBVO 4BGUA 5KBYA 2QDXA 3OQOA 4TM8A 5HBRA 4ZICA 1PYGA 3FJOA 4MI1A 4MULA 4C4OA 1G291 2PQ6A 3VISA 1UDWA 1Y8RA 1VIMA 4EVRA 3P9PA 3FDJA 2QDKA 3A04A 3ONWA 4OJNA 2X42A 2P9FA 2XGJA 1TAGA 1KI3A 1TZ2A 3LBFA 1V1MB 3E9MA 4KIJA 3JWJA 3V80A 3GVXA 3TSOA 1PQ4A 4IJMA 5KHLB 5IAEA 3ZWNA 3NP9A 2BV3A 5JC1A 1W85B 3AESA 1XB2A 1RYBA 1AQJA 1YS1X 5KMGA 1PT5A 3A2LA 4JXXA 3JZFA 2C7VA 4ZWNA 1A4UA 3DXYA 4H0FA 1FFCA 3T7IA 2CNNA 2HBRA 4CMCA 5BP7A 4HZGA 5JCPA 4AROA 3AHGA 3K9LA 4LJ7A 3AIOA 2IXBA 4INOA 3V4FA 1HY3A 1GHTA 2PD4A 3O38A 2ZB8A 4O4HA 4BQEA 3U4IA 3PQDA 3BDAA 2XTNA 3KJFA 4I1SA 3I2YX 1GIAA 3GD5A 5AW0A 3ETGA 4IEIA 1JHQA 3UCXA 1XMQB 1Z62A 4BO0A 5BNIA 1L1EA 1VE3A 5I3CA 2OCIA 2P30A 2Q0QA 4NR0A 4YNBA 3WZLA 3ZZUA 4C14A 4CFYA 1NULA 1QFJA 4OK5A 4RTLA 1AC5A 2KSQA 3HV0A 3TUIC 1W19A 1Z83A 1C8KA 1EUDB 2PWPA 5HE9A 2ZYWX 2BGMA 2P3SA 2Y9MB 4BJHB 5DCWA 4FMCB 1TCCA 1GKKA 2QTMA 1XRQA 4I6GA 4KBFA 4MJLA 5FPYA 4B80A 5IK2D 5LNK6 4RTOA 3L0ZA 3T5CA 4CF6A 4QX6A 2UXCB 2AG1A 1SQ0A 2GPJA 4HI0E 1DCKA 1KHTA 3AIIA 4WA7A 4RD6A 3DTVD 3A1WA 4OU4A 2BZ0A 3PE6A 3WIEA 5JFOA 3GLKA 3FUWA 3GAMA 4HN9A 2UZ3A 2AI3A 1JG6A 2C9MA 4WX2B 5FR1A 2A1TS 2PYIA 1G5FA 1U8CB 2P2LA 3D6VA 3JQ7B 3GEDA 2GZ2A 3P19A 4HGQA 2YVKA 4MRAA 4UARA 4AWAA 3G9UA 1XZDA 2BKAA 2WIJA 3DR3A 4G8DA 2GZMA 4LEIA 1EFAA 2X1LA 3JRNA 3WKEA 1ZC4A 3CG4A 3WZ2A 1EB9A 1CV2A 4UHBA 5C8ZA 5JJIA 2G6BA 4DSZA 4RA6B 2ZR8A 1ZHHA 3HTXA 2OOSA 2XXJA 4MGHA 3M9WA 2Y6VA 3MTBA 2WWIA 3BJIC 4AN0A 2CF6A 3NAZA 4WOKA 1XE3A 3OMWA 3GLVA 3LLUA 3RTCA 2LVBA 2P5UA 5FHQA 1GXSB 3KD2A 4NZ9A 5FWNA 3T4EA 4MEBA 2FEXA 1JFFB 1TKBA 4LDQA 1GY8A 5IAGA 3L40A 2ECQA 3K0EA 4WNAA 5J5AA 2ZUSA 4INZA 1OA1A 4S1PA 1IBKB 4BP1A 3T06B 1OFGA 3L8DA 3P97A 3ZHUA 3T6KA 1HE8B 1T9DA 3GQBB 1W34A 3PL1A 2Z3ZA 4HO1X 2QX8A 4HX5A 3RIMA 1AUQA 1SWVA 1XAIA 2B0CA 3MELA 3N70A 4UVDA 3WP1B 3AWDA 4BFSA 4NKRA 2QR5A 1D2AA 1X7ZB 4XQ0A 5D7BA 1GZHB 1S5PA 2NV6A 3EC2A 4K86A 4ZHQA 1AKRA 1NT2A 4CTJA 2WEKA 3HFSA 5BSWA 2X8JA 1UPBA 3W4JA 1EIZA 1H6DA 1GQQA 2VH1A 4FXPA 2V8BA 3V2GA 1DIAA 4DQVA 2E6UX 3IXLA 2Z57A 1BHSA 1SC1A 3FVQA 1ADJA 2B83A 1UFKA 3DEKA 4U00A 3LUHA 1DFIA 3KZKA 5E1BA 2BTQB 1XOIA 3AI7A 1KOLA 4WFIA 5LZ5A 1OXXK 4M9RA 5LNK1 3C8UA 3MYRA 4LHZA 3WLNA 4HH3C 2I6QA 2A58A 1U7PA 4CRWB 2ZB4A 3AY3A 3PB3A 2RGNC 4GP7A 5EIHA 3WAGA 5D5PA 5CFOA 1J42A 1KQ3A 5JECA 1K98A 1EH5A 2I3GA 3P9IA 4B73A 1VSBA 1EK5A 2PZJA 4RPIA 5JPIA 3RK0A 4PCLA 4PG6A 1GCUA 4H4DA 2VF4X 1M5UA 3K2BA 4W9MC 4KBGA 1YB4A 3N7UA 4ZI7A 4LE2A 5JTUA 4UAVA 1P72A 1OT5A 3EH1A 5A1JA 2CV0A 4BNDA 1T4CA 1NM5C 3HBNA 2IYUA 2MSLA 3HHPA 1I9GA 2VR1A 2WILA 3KTAA 5JPCA 3KSAC 1T9HA 4P53A 1VJ1A 1Y8RB 2PGDA 1AURA 3U0VA 1E18A 5JAZA 1SFRA 4LHSA 3GP3A 1BTOA 4W7SA 1IG3A 1Q92A 4E0BA 1JMYA 3RC8A 3JV7A 3W8NA 2AZ4A 2W9XA 2WU3A 1C0KA 2VDMB 5FUMA 3H9EO 1AS3A 4PO8A 3C6KA 1HFEL 3RREA 1Q7EA 4HNUA 2GXQA 3AESB 1LLQA 1BOFA 4PVCA 1A27A 2WZQA 4GM4A 5KMGB 4FNAA 1IAQA 4ARZA 3W5CA 4DDWA 2GETA 2YJTD 4KV9A 3TNDA 1NYTA 1GPDG 1E1KA 2EG9A 2JGMA 3CEHA 2BMFA 1SCNE 2J6BA 5FBKA 1EJBA 2PLAA 3SIXA 2VJCA 3ZK8A 5B6JA 1W5AA 2HCBA 3FAKA 5G1NA 1O5OA 2MHCA 2MYNA 4M0UA 2J6IA 1TZCA 4OY3A 1BROA 4WTOA 3NIFB 1SN7A 4EGJA 4GC5A 2RHHA 1EHYA 2R25B 1EAMA 2CHQA 4BASA 3H8SA 2F4NA 2QB5A 1VHLA 4X7RA 5JI3E 5AKKA 1DJMA 1FLAA 4ZZ0A 3FMPB 5DNVA 1ULBA 1P7ZA 2MDTA 4RVSA 4A6EA 4F0JA 2X0IA 5BN3A 2DLCX 3ABOB 4I50F 4XSVA 3QM1A 1XR3A 4HRYA 3WQRA 4I7EA 4V2UA 3BN3A 1CFZA 4CDNA 2IIBA 4FMBB 1GRCA 1GP2A 3MXTA 1R6BX 4F3NA 1VYHA 1RHQA 3OZAA 1KOGA 4B7XA 1R0RE 5DYYA 3I9MA 4H1WA 1Q0TA 4KWEA 2HJRA 4N47A 3MUNA 3L01A 1VL0A 3OPQA 1TJ3A 2MIIA 3SHWA 4MV9A 3OX2A 4TYPA 5LU8A 4JK3A 2GYWA 4PBSA 1REQA 2APJA 4MKZA 4Z9FA 2JAUA 5LDGA 5EA2A 5ILQA 1LDYA 2H2GA 2HADA 1BD4A 2J3DA 4PSUA 4L7QA 1JJBA 5DISB 3ZJVA 3I12A 1GDTA 1ACJA 1FTWA 1L5KA 2H92A 4RZXA 3LLVA 4BNTA 1W36B 1WW2A 2HU5A 1P4RA 4M8SA 1E3LA 4V3BA 1EX6A 1QVWA 2JIDA 5KX5F 1AY0A 4RLQA 4DVGA 4X90A 1PZGA 2DY0A 2HM7A 4KR3A 1RM5A 1K1EA 5F12A 3DL4A 5LL6P 1G59A 4LFBB 1EBBA 2AFVA 3RS2A 4LF9B 4W7HA 3NKVA 4EUFA 2QD5A 3QVLA 4IHJB 5JCZA 3VNAA 2H7XA 2VT3A 4X97A 4KN5A 3DHNA 2HTEA 3FD8A 5ADUS 2P9CA 2ZRDA 4AB1A 3VTZA 3HVKA 3MOGA 3ZTYA 5CDTA 5SV2A 1TU4A 2W8ZA 3CW8X 3JQBC 1OU4A 3G68A 5SZHB 4C29A 5F78A 4OHRA 3ZCTA 4Q7MB 1V7QA 2F59A 4G0PA 3AEUA 3WGOA 4EA8A 4M8IA 4BN4A 4M8KA 4BTLA 4MV3A 4MEAA 1H0RA 3ID6C 3DDCA 4B76A 5KSYA 1E5LA 5LBTA 1EWQA 3HA5A 2R79A 2PT9A 4G0QA 3U9TA 5DN6D 3LBAA 4XLTA 1U5BA 1ZOSA 1VLZA 1V8PA 1BN7A 4KN8A 3JQEA 4K6GA 1PR5A 2K6GA 1SAYA 3A7EA 1EK6A 1JG3A 1I0IA 2R1TA 3BK1A 2B34A 4UM8B 1DCTA 3UPDA 1LC0A 2BGNA 3B13B 1OIWA 1XZLA 2XGMA 3L9XA 3AXTA 2IZOA 5IW8A 3V5NA 4IAOA 3HC7A 1GUYA 2G70A 1NSYA 5TV2A 5LQKA 2AUNA 1PJBA 3V8EA 4AECA 1Z13A 1DXYA 1PBTA 1A5SB 2B0JA 3V4SA 1YQWA 1NN1A 4R2KA 1WZNA 2XEXA 2ZUFA 4D25A 3DA8A 4RTMA 1P7VA 1T3SA 1MB4A 4ZVUA 4L16A 1A2QA 4NG4A 4EYKA 4ZI7B 3F47A 2VSQA 1HG1A 3NDJA 4C4XA 1IQPA 4JP5A 4BNDB 4B40A 2Q4BA 2Q4TA 3BD8A 2FSGA 3HA7A 5ELLA 4PN3A 3DBHA 3F3MA 5T7BA 1AB5A 4A0RA 4KXVA 5AVOA 3EXEB 1ST3A 2N1MA 4FFNA 4FOLA 4EUSA 2TYSB 4A27A 1FLNA 1CTQA 3CXUA 3TIVA 3UMJA 5FLYA 1MHPA 3M5WA 3R0ZA 4FFLA 3RUHA 5CD9A 2PLFA 5I5GA 2I91A 1PDWA 1WXWA 1W5TA 1QIGA 2O14A 1YL7A 1MP0A 2J5RA 2X1HA 3JTEA 4OVKA 3RABA 2EL9A 2CSXA 5DBFA 4ARZB 2AD1A 2Q3LA 1QC5A 2W90A 4MPDA 7AT1A 5CHYA 4YK7A 2DWCA 1W44A 5KC9A 4C2TA 3B53X 3OC0A 3X3HA 2JLCA 3C8MA 3D8HA 3FVWA 3O4GA 1JAYA 1AGPA 3OE1A 3R09A 4IDHA 4OJMX 5AM5A 2I34A 3TW4A 2I2XB 1OKKA 3ZVKA 2JIPA 1J0XO 3T3EA 3IAUA 2QA5A 3M33A 4L0DA 1MF7A 4CLRB 1IVSA 1K6IA 1WUTA 3RS8A 4B6GA 1AZLA 3ORHA 1N2XA 1QK4A 4YH1A 2W48A 1JVBA 3UEOA 3FPSA 4LZJA 5JPDA 2JIRA 2XRZA 5KHAA 1VKHA 4OPMA 4BMXA 4HX9A 1WDWB 5ALIA 1CVLA 5JXGA 4UEJA 4DQ0A 3L07A 3CCBA 1OE0A 4M7OA 4BLVA 3GLGE 1L7VC 4IGIA 5BN3B 2X1VA 1DG9A 1AQUA 1RP1A 3DMRA 4CQJA 4MQ6A 2CVQA 2C57A 2RB5A 4R8RA 3ZKWA 4BVBA 4P34A 4OHYA 2NXJA 2QQFA 3H87A 1R15A 1RRMA 1ZM4A 2XDQB 4BMOB 1Y42X 3O95A 4DZZA 3H99A 5KQLA 4F04A 4XFKA 1E62A 3OIWA 5EKTA 4CCAA 4Z9BA 4RM3A 4M21A 2AFIB 3TCNA 4DIMA 2JA2A 4MUJA 1T1GA 2HSZA 1FQOA 3KYDA 4MZXA 5L51A 3NHFA 1CE8B 5EPEA 1B43A 2IF2A 1OFTA 4RETA 4PAWA 3VTFA 3IOCA 3OPYI 4JWTA 2X7JA 4YDSA 3SNHA 2IIQA 5KYXA 5P21A 3GLUA 1RWBA 2Q2QA 1YAHA 3A6GA 4BFTA 1H8HD 2GKSA 2XBLA 3L7AA 1JPJA 4LWQA 5EGNA 4B3JA 4DQXA 4TZ6A 5IZ4A 4FQ5A 3WLJA 1IXYA 2HHCA 1C3JA 1JJ7A 4HEHA 4OO3A 3UFXA 3X2EA 4CM8A 2IX9A 3KSDO 2QD3A 4AL4A 3IUNA 4YAEA 1YDHA 1OI2A 1Z6TA 4NAHA 3DEYX 2IEDA 4DSOA 3NZEA 3VX3A 3ES9A 4C0LA 2OHJA 2NYRA 3IUMA 2D62A 2F7SA 1U6KA 3L7KA 3QU9A 3EVZA 4IIGA 4MINA 4E2YA 1SHTX 1IU9A 2NZJA 1NNEA 3OIFA 4MS1A 2YV5A 3HCOA 4EHDA 4YP0A 1QIMA 4AJ9A 1BEUB 5LC1A 4BO1A 3N2IA 2BGTA 3L0DA 1WSWA 4ZGWA 2ZWAA 3DWEX 3VU3A 3Q0IA 5EEHA 4XFJA 1J4AA 2PV0A 4QHSA 1KDYA 1GPAA 5DBEX 5DNWA 1VBKA 3B82A 3ADCA 5A6VA 1FLDA 3D4NA 4GBMA 4Y18A 5CVVA 1U5BB 2FSUA 4ZOLB 4CM9A 3VFDA 2R1TB 2FPPB 1MO2A 2QZJA 2AR0A 2M6LA 3CZPA 3LGSA 3VSDA 4CFSA 5IC5A 4BEBA 5IMSA 3F78A 4I2NA 3M6XA 1E1YA 1F0NA 1TTHA 3CX4A 4C2UA 4KHPB 1HOTA 3QVTA 2FHSA 5DBHX 2CGEA 2E5LB 4Z2YA 4CEJB 5ADHA 3W3AA 2XSZA 3KLNA 3NBZC 4UULA 4YJDA 2NVUA 3ACDA 3KSBC 3LT1A 2BTEA 1V1RB 3VNUA 1OD6A 1XGKA 1N9KA 2W37A 3LBYA 1SA0A 2EJTA 4H59A 4MR7A 1IN7A 1KZ1A 1N6NA 4WECA 3WG9A 2OFWA 1ISHA 3BHMA 4LAFA 2JHGA 4G5HA 2LP4Y 2FI1A 5IDQA 3R1IA 4Q93A 3DBHB 1CX9B 4XD2A 1Q0ZA 5FF9A 2ZB2A 4WLNA 4B3BA 1Y7PA 1W5SA 3M4NA 5K0JA 5L3QA 3P2IA 1E6KA 3FZGA 2GJ9A 1GU0A 2NUTB 2R7AA 3STWA 4MLPA 2BFPA 4ABYA 3UBTA 3X1YA 5JNWA 1HTBA 4B84A 2NXCA 1UC4B 2OQIA 2XRYA 1QO7A 3IJRA 3B3JA 5ETJA 1UIRA 3AJ9A 2Q27A 2HT1A 3MJSA 2ZAOA 1WCV1 2V4ZA 1QS0A 4M54A 1G2OA 1V3TA 1QC5B 1XFAA 3K09C 1DSSG 1JKMA 4Y0VA 2VP4A 3E9DA 2UZ1A 1DIHA 2C92A 5CPBA 1E4VA 2R6AA 1R3UA 4N5NA 1CY2A 3SC6A 1N3LA 1KEPA 1GZSA 1BXGA 1MAHA 4QVKA 2X58A 4FWTA 3AVUA 1U8FO 1KGDA 1QIIA 3K72B 1BVYF 1SCIA 3SSAA 1E98A 1SUBA 3IP5A 1G7TA 1TZBA 1T8SA 2DFNA 1E79D 3MPOA 4EKIA 3DP9A 4F9TA 4UTXA 2I71A 2RBGA 4P5EA 3I1FA 3ASVA 2VDNB 5CGZA 3QKTA 4ZANA 3KJEA 2PYZA 2IBMA 3PCXA 4ND2A 3VVBA 5HJ7A 4PLPA 1X39A 2Y1OA 3EF3A 2NTVA 2RGYA 2CLEB 2ZB3A 2DR0A 1UXKA 2AJLI 1UBLS 4CKXA 4JQCA 5F4ZA 4QBGB 1U3UA 2X3FA 4UPEA 3ZKWB 4EMSA 3LPLA 2MR6A 5CAEA 2IHNA 1EFRA 1PVVA 3N07A 4UHJA 2JFZA 2PL3A 2WYUA 2Q7DA 4DA6A 4DUZB 1H1LA 1TC2A 5DHSA 2R5WA 1OAOC 2R7NA 1TTTA 1ULTA 3EIHA 3DHVA 4MS4A 4PEVA 5JRZA 1ZC3A 3AFOA 4KGDA 3KAPA 1NE2A 3LI2A 4MKGA 3RVQA 4W99A 5LSAA 3GRZA 4J0GA 3OP1A 1ZIDA 1QO9A 3X1MA 2ZUBA 4WLOA 5DX0A 4EZEA 4EVQA 1GNSA 4RC9A 3LAWA 1G9TA 4PLVA 3DDWA 4ZT2A 3U4QA 5AUQA 4AZVA 1JKJB 2XXBA 4QDUA 3LDHA 3RYFB 3G02A 3PC8A 4CM3A 1A2KC 1NW9B 2Y68A 2AEEA 4QYIB 2W6PA 2EVWX 5C46F 2HWXA 2G40A 1UBGA 4B17A 2R84A 2R3SA 2ZI6A 1IJEA 3OIVA 4YO8A 1HXHA 1UEXC 2B9VA 2PMCA 4ZCQA 3TFQA 3G2KA 2YWXA 1A76A 1N0WA 3VNBA 4G67A 4G81A 4JUIA 4TLEA 2WVHA 4S2UA 4TSFA 5ER9A 5K2OA 2D1TA 5LIRA 3GF4A 3L02A 3UFXB 4L8VA 3F6YA 4CM8B 1L8LA 5IEJA 1XNJA 3F2VA 3PSHA 5TARA 3HKEA 5DYTA 4O0LA 4EF6A 4OI4A 1JAZA 1UR5A 2RFLA 4WNIA 3WQBA 4DCCA 1BS2A 2WYVA 2OP1A 1MEEA 2I7TA 4HGOA 4IZHA 2E1PA 1TA0A 3FSJX 4CCSA 1FJGB 1TPYA 1V6SA 2XZTA 3DEFA 4DYDA 1EAYA 1JKFA 3VR3A 4BE9A 1KRWA 2CNBA 1W1IA 3I05A 2C3MA 3IR5A 1R6VA 4JJ4A 5IJ9A 1IULA 1VYTA 1D9ZA 4C76A 2VDOB 4OYYA 1CW2B 1C3LA 4BQPA 5ICGA 4Q34A 5LQJA 4OK3A 4Z4QA 5EC8A 3CV3A 3MOIA 2QZ9A 4M1YA 3SSNA 3X2FA 1FSPA 2PA0A 2ZROA 1M8JA 1SKUA 3ZWBA 3AU8A 4R9SA 2XMSA 3CT6A 3WQQA 3MCTA 2X2PA 1R8XA 3GWGA 5KVVA 2H1WA 4KPUB 5E9JA 1GZ5A 2HNKA 4R8LA 4HLCA 2Y99A 3ZLUA 3JPYA 4NU8X 4QG7A 2PZEA 1K68A 1GAXA 1YONA 1JW9B 1U90A 2AXPA 2H63A 3PHHA 5DIFA 2CHUA 4CMBA 5MFZA 1WHSB 4Z4IA 1X86B 1D2NA 2QL6A 1UT6A 5F73A 4BEVA 4ENQA 1I32A 5L40A 2QSZA 3DLPX 2Q6VA 1PJZA 3UF0A 2RGEA 2BFCB 3FYUC 1JQAA 1CUFA 3CH5A 2NVUB 3UJDA 2EAUA 5B3JC 1VKZA 2GA9A 1JHUA 1ZBQA 3VR4D 2YOGA 4NTZA 3BFXA 2JI6A 1SA0B 3FYCA 3AONB 1ULAA 4OQ4A 3JALA 3T7EA 1NFRA 2VFAA 3DMPA 4M0KA 2Q49A 3BMNA 1F0PA 1I2BA 3DULA 4TLMB 3DDOA 4ZQIA 1B8NA 2HU2A 3A10A 2D0OB 4M8LA 2X9NA 3N6XA 3AJ8A 1B2RA 1AF7A 1T5TA 3TJZA 4ZJYA 4BQQA 4JJZA 1T5OA 1UBJS 2O7SA 3B5JA 2VHEA 4WK2B 5E7MA 4IQGA 1R0LA 1XN1A 5HGJA 4QM6A 4OL0A 1OYVA 1ZNWA 3EE6A 2A67A 1PJ3A 3VKGA 3B8HA 5DB4A 2C4MA 1XF1A 1Z4NA 4FMCF 5JLAA 1PR6A 4JGBA 4WBNB 2ZBGA 4I3FA 4BFWA 1KC1A 1X7YA 4N48A 2KI5A 2UZ1B 1JLRA 3LIIA 3NVKI 3R6WA 1EQUA 1LDNA 5I6DA 1L4UA 1TYBE 1BXGB 3QXGA 3CRVA 3R3YA 4V0OA 3E5NA 4FEGA 1JG2A 3GLSA 5L53A 1WJGA 3CRMA 1UC8A 3VC3A 2A30A 9ATCA 4RZ2A 1DKLA 1DVRA 1C8LA 2DHCA 1QPGA 2Q5JA 4M1WA 1EX1A 1WDLA 3F1LA 3K9QO 3K0KA 3CLUD 2FSFA 3SC4A 1GR0A 2IYZA 1DEHA 1UKBA 1EG7A 2XJ4A 3GAZA 4D9IA 3K70D 3DYIA 4ZVNA 4UEWA 1Z47A 3RYHA 2QN8A 2VEOA 2Q99A 2RI0A 3DHEA 3E2PA 5D01A 3RSSA 4OB7A 1E1RA 3KKNA 1U8YA 3S68A 3WB2A 1JAHA 5FYDA 2HA5A 4MAFA 3BDVA 3V8QA 1XIVA 1L7RA 4WFJA 4PHCA 3DMNA 4L9WA 3OCCA 3T99A 4B44A 5FTKA 3CONA 1G8YA 3TAUA 3X1JA 4ALJA 4N5LA 4P83A 4Q1VA 4ETNA 4MS4B 4AI6A 3A9CA 2BFOA 1JR3E 3P0EA 3E9YA 2OGTA 3RK1A 1KE2A 3BGVA 2P78A 5FFNA 1MA0A 2WIBA 3Q0EA 3H84A 1VBMA 2HFKA 3PUWA 3UMVA 4JLBA 3RFUA 4QPDA 2XW6A 4L8WB 3ICPA 1LK5A 1YZVA 3KU4A 3U09A 3U4QB 4RA9B 1R8QA 4RZSA 3CKYA 4DQUA 1S8FA 2PO7A 1APBA 1NDHA 4XJSA 3IBTA 4RFVA 1I3KA 2UYCA 1JIVA 1HLDA 3KHSA 2JDIA 4B87A 2C4KA 2MSCB 3MTEA 1ND6A 4GLFA 4ZAGA 4YRZA 5C4MA 2V58A 5GOZA 4PG4A 1C0PA 1DV2A 1CWUA 4BWGA 1HDRA 2ZBFA 5L3SA 1N6OA 2G88A 3OLCX 3IUBA 4JHLA 1XCLA 5A0VA 3KDPA 2PD3A 3G8CA 1KJZA 2BHTA 2JVKA 2ZULA 1QBKC 5EUQB 5CXUA 4BNNA 7ABPA 3P32A 2RHGB 2IYSA 3ROXA 8GPBA 4V1CB 1W0CA 3TJMA 3OAAD 5M34A 1GTJ1 4BV9A 3NBUA 3A2KA 1G64A 4BP9A 3ON5A 4GMFA 3PR2B 4HSEA 5C32A 4XSHA 3IMKA 4Y2PA 3PVCA 1XQ6A 3DDNA 4Y1RA 3PFIA 3Q7SA 3BAZA 4CIDA 5EFZA 3IALA 2X8AA 5IJ9B 2R6FA 3RB8A 3RASA 3WGGA 1IZZA 1KQGA 1NV8A 2D1RA 3OIDA 1KJQA 1KK0A 2YDXA 5LD2C 1H8ED 2WJIA 2G9ZA 3CR8A 4PANA 4BGEA 1GN9A 1P6UA 1R6DA 2GAIA 1L5VA 3BDIA 5MF6A 4MW0A 3ZCUA 1QV6A 5CPFA 1U2PA 3RIYA 3EGDA 4LBYA 2NO1A 1JEDA 3VPBA 1KS2A 2H18A 3H86A 1N0HA 4ND1A 3RVRA 5EXXA 3VTAA 4MW6A 2DTDA 1SXJE 2WLSA 4F86A 1N5JA 3A1EA 3ISVA 2GN4A 1M1ZA 1OASA 4A10A 2FJPA 4ZVTA 3N53A 1JTVA 1U9JA 4C2BA 1WB5A 4A5OA 1IJBA 2RJNA 5BYAA 3QX7A 2WTEA 3CISA 4LJ4A 5E2BA 5FRDA 1P3Y1 1VHQA 3BGWA 3OM0A 4OAOA 4BATA 4MH0R 3WGKA 5IU6A 2OAQ1 4MUHA 4OHMA 4U3JB 2HCTA 3N8KA 4L22A 2R97A 3NATA 2ZWIA 4PTZA 4FHZA 3SJ7A 4CMEC 4RKFA 2CD9A 5HBGA 3PITA 1BH2A 1MC1A 4FUQA 4PQRA 1CHDA 3G9XA 4FHGA 4L0CA 3TX2A 5I4CA 5AVQA 2RONA 3JALB 1DIBA 2EWV