3O2QB

Crystal structure of the human symplekin-ssu72-ctd phosphopeptide complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
LRVAVVSSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSREQETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQEFEEKSGRTFLHTVCFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Symplekin
publication title Crystal structure of the human symplekin-Ssu72-CTD phosphopeptide complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 189
sequence length 189
chains with identical sequence E
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o2qB01
2GBPA 4LE1A 1Z16A 4Z4EA 4MR9B 2R47A 4E7OA 4RXTA 4RY9A 3C3MA 3NNSA 1D5WA 1GLGA 4JB0A 5HSGA 4CBVA 2E4UA 4O1IA 3C3WA 1M2EA 3QK7A 3A0UA 1GCAA 1E2BA 4WWHA 1C0EA 1HEYA 4NCAA 3CKMA 2FN8A 2HQOA 1QMPA 3JPYA 3DBIA 4G0MA 3LKBA 4XLTA 2E4YA 1RZRA 1MAVA 4HNRA 5TQ0B 3HUTA 4F8JA 4Z99A 4RK1A 2J48A 3UKJA 4DQDA 1JH9A 1ZAYA 5JNVA 3RVJA 4RS3A 5EWLA 4IRXA 2M98A 4QPJC 2WWVD 1K68A 3P9YA 5FWYB 4WT7A 2PKXA 1W25A 2CD7A 1NXXA 5JNUA 3IP6A 1Z17A 3CG4A 1KRXA 3H75A 4NICA 4UHKA 2IKSA 3DZDA 1NXSA 1DBQA 1QP0A 2FVYA 3CS3A 3RVPA 2WB4A 4RZSA 2PE5A 5CHYA 5TQ2B 5CNIA 1MIHA 3OLXA 1U2QA 3HXMA 3FGZA 5JS2A 4KREA 3CZCA 1JWLA 3T6KA 1Z25A 2O20A 3GA5A 1BDIA 5CNKA 1QO0D 2IYNA 4RK0A 3N8IA 5TPZA 1ISRA 3G1WA 4RV5A 3LKVA 5ABPA 2AYZA 4MQEA 3H5LA 1H9CA 5BR1A 7ABPA 3H6GA 1JF8A 4PE5B 4RK5A 3OLYA 4P1ZA 4YLEA 1T34A 6ABPA 4MS1A 1MB0A 5FBHA 4YR7A 1P2FA 3H1EA 1DRKA 4N03A 4XXHA 1D2AA 4YRZA 1PEAA 5KQPA 1PHRA 3QEMB 2FN9A 2JVKA 3W9SA 4F06A 3O1HB 1JX6A 2FMFA 5TQJA 4EVQA 1QP7A 1GUBA 3HCWA 1AB5A 3TX6A 5JNTA 1VRVA 4W5NA 2GI4A 3L6UA 1LJLA 1LK0A 4GPAA 1ZESA 1Z26A 2FXIA 1DZ3A 1D1PA 4YWHA 3RQIA 1BA2A 3QELA 2R48A 3ILYA 1NXWA 4OLBA 3LUKA 5D2CA 2GX6A 3H5IA 3LOPA 2FMIA 2L18A 4N76A 1TJYA 2WRZA 2RDMA 5GQSA 1BDJA 3O75A 1FSPA 5EWLB 2FKAA 4XASA 4YV7A 2HQRA 3F6CA 2A9RA 2A9PA 1ZVVA 3DLHA 4KFCA 1WETA 1NTRA 1JBEA 2L17A 4EUKA 2DRIA 3M9WA 1Z2DA 4PYRA 3D8UA 3JS5A 2L2QA 4FE7A 1YTUA 2IOYA 4KQCA 3HDVA 4TLLB 1QP4A 3FFTA 3DLBA 2PLNA 3LTEA 2RGYA 4QYWA 1PUXA 3KJXA 4KMRA 5CNJA 1J56A 4XFKA 5C5CA 3NBMA 3OLZA 5BRJA 4MPTA 1TM2A 4ZYLA 5IUKC 1Z2EA 3QLVC 1JDNA 2LPMA 5FWXA 3HSYA 3BRSA 3KKEA 5IBQA 4H3KB 5E3JA 3LUAA 3HZHA 3JTEA 4JB2A 4D6YA 3N53A 5TPWA 3H1GA 3IP9A 4JASB 4MQEB 1FFSA 4TMYA 3T8YA 3CNBA 3RVLA 3Q7RA 1TMYA 2FLKA 4HNSA 3QLVA 1K66A 3MIZA 1RZRD 2GWRA 1NXPA 1D1QA 3QLTA 4MS1B 3SG0A 3ROTA 4MGEA 4LE0A 2WJWA 2LP4Y 3Q9SA 1PNTA 2R25B 3E3MA 2JCGA 2CHFA 1RPJA 3OO0A 2NZUG 3MYYA 4OG2A 1APBA 5ED4A 3CRNA 3FFWA 4QICA 4N0QA 3DGEC 1ZN2A 3RVSA 3IP5A 4MQFA 3A10A 3BBLA 4G0ZA 1JLKA 2HPHA 2BGGA 3CTPA 4EGSA 3QELB 1U2PA 2NZVG 4RK7A 3CLKA 5IX8A 4W5RA 4Z4GA 4Z4IA 2MSWA 2LUOA 2ZAYA 5KC9A 5DGCA 3M6MD 3JY6A 3SY8A 1BVHA 3OQNA 3GT7A 5T7BA 3N0RA 3RVQA 1NATA 2HSGA 3IPAA 3MQ4A 4LE2A 4LRQA 1L5YA 2V0NA 3HV2A 2JB9A 4FB4A 5JNSA 2VYCA 1ZGGA 3CZ5A 1RXEA 2PUCA 3O2QB 2JRLA 4H3HB 2NT4A 1DP4A 2WMYA 3KYJB 3RVNA 3TMYA 2B1JA 3L49A 3KLNA 1RXIA 1LJUA 2QSJA 4N0PA 1PEYA 2P4UA 2PMCA 4IGAA 4RY8A 4Q6WA 4MYRA 5FWXB 4MAAA 3T95A 2FLWA 5DKFA 4S04A 5I4CA 3F7NA 1YMVA 3H6HA 5TPWB 4G0QA 1EAYA 1JHZA 1XHEA 4RWEA 1ZH4A 1DRJA 1MVOA 2H0AA 2B4AA 4LX8A 4EVRA 1YMUA 2FQYA 3OO1A 3N6VA 3E61A 4Z0NA 3KCNA 4D6XA 4G0YA 4G0OA 2CHEA 4DN6A 3VNBA 4MR8A 1P6QA 2JBAB 3F73A 4ML3A 3HDGA 4MR7A 4WZZA 1CYEA 4Y9TA 1KRWA 1ABEA 2MYPA 3C3KA 4RXUA 4Q7EA 5KC8A 3HVRA 5KI6A 4ZPJA 1YIOA 4MQFB 4RK4A 3C6QA 3CU5A 2ZWMA 2MSKA 1Z18A 2FMKA 2M1ZA 3NNDA 3Q15C 3FFXA 3F6PA 4O5AA 4ZMSA 1YS7A 1DC8A 3HUUA 3C97A 1JYEA 4RKQA 1M5UA 3LUCA 2FTKE 4NQRA 3SAJA 4D74A 3KS9A 3MF4A 5KQLA 2MSLA 3FMVA 2PUBA 4F3TA 4YO7A 3I45A 1NXOA 1LBIA 4ETNA 1VLZA 3I5AA 4UHJA 4KVFA 1QKKA 5EWJA 4ZMRA 3GBVA 3H5WA 3KSMA 3O21A 3I42A 2MYTA 3BRQA 4PICA 4RU1A 1YK1A 2FQXA 3IPCA 3LUHA 3O2JA 4RXMA 1CHNA 3KHTA 3OMWA 2W42A 5JS1A 3H5TA 1QO0A 2E4ZA 4LZLA 4KNYA 2RJOA 2JK1A 4P98A 5DTEA 3OM0A 3LUFA 4IMJB 2IPNA 1NXVA 2AYXA 1FQWA 2IPMA 1NXTA 5JNRA 3GL9A 1E6MA 1S8NA 2MYNA 3Q7SA 4DADA 3EAFA 3ROFA 1DCFA 3Q7TA 4KRFA 1E6LA 3SQNA 2FSPA 3QLUC 1USKA 8ABPA 3N0XA 1M5TA 2VUHB 4MR8B 2PUFA 1W9HA 4MR7B 1JFSA 3OQMA 4HNQA 1D4ZA 5PNTA 3N75A 2HJ9A 4EY3A 2OENG 5IULC 1EWKA 1R8JA 1MB3A 3LUGA 3QLUA 4MS3A 2PUEA 2WY2D 1UDRA 2YHBA 3NHZA 3QEKA 2R4QA 1KGSA 1ZH2A 1F4VA 3D02A 4FE4A 1ZDMA 4QYMA 1USIA 3RVMA 4MRMA 4MLCA 2OQRA 5IC5A 4O1HA 2QV0A 4F12A 4WXEA 3H5OA 5IUJC 1ZHHA 2H3HA 4RDCA 1ISSA 2PL1A 2PL9A 4GNRA 3R0JA 1EFAA 2KYRA 5KQGA 1VPWA 3EODA 1DG9A 1QPZA 3CG0A 4OLAA 1M2FA 1QQAA 1AB6A 4Z4CA 4MLDA 5EWJB 3HEBA 4RKRA 4HYEA 5TPZD 1L5ZA 3LMKA 4RK6A 2L19A 2QU7A 1SXIA 1RNLA 2X7XA 2XDYA 4Z4HA 2QR3A 3OM1A 4KK4A 2JVIA 2MYUA 2LIVA 5IEJA 1ZGZA 3HO1A 3GV0A 2E4WA 1QNLA 1XWWA 1I3CA 4EYQA 3S99A 4Z9AA 5IEBA 9ABPA 2IDMA 3GBPA 1DBPA 2QVGA 4ETIA 4TN5A 4L85A 1DCKA 1JL3A 1Z13A 3QX8A 3TB6A 2FEKA 3LUJA 3SNKA 5HM6A 1SXHA 2A9QA 2ID7A 3OLWA 2F8SA 2QZJA 4NV3A 4EYGA 4MS4A 1SXGA 1EHCA 1GUDA 1FFWA 3GRCA 3GYBA 3OQOA 3JVIA 2FQWA 4B09A 3IDOA 1YK0A 4N47A 5DCLA 1YS6A 3T38A 3IP7A 4E7PA 4G86A 4YP9A 2LBPA 3KLOA 3UUGA 5HQJA 3RVOA 1BDHA 4RSMA 1OXBB 2IPLA 5EWMA 3TD9A 3UK0A 1QQBA 1GCGA 4KK3A 3RVRA 4W5OA 2P9HA 1C4WA 3MM4A 1SD5A 3ILHA 3Q41A 4MS3B 1ZY2A 3LFTA 1EWTA 5BQ3A 1XHFA 4H60A 2FW0A 4G0XA 2QW1A 1DC7A 2VUIB 5KWSA 4IF4A 3EQZA 3KTOA 3EULA 3HJFA 1JDPA 1OXKB 2HQBA 3FDFA 4MRMB 4XARA 4S05A 5KQMA 3VNAA 3N0WA 1IIBA 3JVDA 4M88A 4JAVC 3O2SB 1ABFA 3GWGA 5JNWA 4NCBA 3H5VA 3OMXA 4OBBA 3LUDA 1JFTA 3EJWA 3KG2A 1PNRA 1P8AA 5BRAA 4LDZA 4KZKA 5TE9A 5F64A 4ETMA 2PJUA 2PUGA 1EWVA 4XAQA 4OTZA 1TLFA 3RH0A 4Q6BA 3TO5A 1Z15A 4EYKA 4JOQA 4PZ0A 3HM9A 2E4VA 4Z9BA 3BILA 1B00A 2RJNA 3DGFC 4MR9A 3RVKA 3EQ2A 4RY0A 1A2OA 3H1FA 1KMIY 2WJAA 5GOTA 3HS3A 2A9OA 1YVUA 4TLMB 2GKGA 2PUDA 2Q5CA 1LBHA 4W5TA 3M9XA 2N9UA 4KV7A 3O1JC 1A04A 3JPWA 4LDAA 3A0RB 3QX9A 3B2NA 3O74A 1BAPA 1DBWA 4EYOA 4WXMA 1Z12A 2PAFA 4Z4FA 1P6UA 4KPYA 4G97A 4YGXB 2FEPA 3CFYA 2TMYA 5TQ0A 4MS4B 1URPA 4EVSA 1DCMA 2I6FA 1E6KA 3NNNA 2F8TA 1Y1LA 1USGA 1ZITA 2ID9A 5FWYA 5FBKA 1CEYA 6CHYA 4IILA 5B3JC 5EWMB 3EDCA 3EGCA 2VK2A 5CNMA 4JP1A 4KQ9A 3K9CA 3BREA 2NUBA 1U8TA 2QVCA 4IMIB 3URMA 4YCSA 2YHAA 3G85A 4L4UA 5TQ2A 5C5EA 3NHMA 4F11A 1VKRA 5B3JA 1U0SY 3CHYA 3O1IC 4OATA 4JA2A 3SM9A 1A0OA 2NT3A 4WUTA 1TVMA 1F51E 3I09A 4YS6A 2QXYA 4N41A 2PUAA 2JVJA 3MMNA 4G0PA 3K4HA 2E4XA 3MA0A 3HK2A 2FMHA 4ZJPA 5DLEA 4W5QA 1JFVA 1SRRA 4PEVA 1U04A 2IPAB 3KYIB 1NY5A 2JBAA 5HKOA 1FFGA 3A3KA 1JYFA 5IUNC 3OLVA 5T3YA 2FEWB 2CWDA 1DJMA 3QEMA
chains in the Genus database with same CATH superfamily
2W6JA 1LI7A 2GBPA 4PTLA 5CYOA 3T1YB 1GNSA 3DOEA 4JC0A 1XDUA 1LLDA 3IAHA 5CIQA 4KPUA 4M0LA 1DELA 4RTSA 4BGEA 1LSUA 3R9XB 3KE8A 2AXQA 3QK7A 4BO2A 4KG7A 4BBAA 1W85B 3ZWAA 3PZBA 4DG8A 1GCAA 4YBZA 1J22A 4TYWA 2OUKA 4V0KA 4GI2A 2HXYA 1U0NA 3GB9A 3M6FA 3ZHVA 3MS4A 2QTMA 1WKCA 2QRUA 4A6XA 5BN5B 2XEDA 2W2VA 2FPSA 2QNIA 1ZR2A 4YRTA 5TQ0B 3PPIA 1PJRA 2O0JA 4O2BF 3TTYA 4KR3A 4Z99A 5M7EA 3N2IA 2JAPA 4I50F 1THGA 2WWVD 4ISCA 5FWYB 4MUFA 2OHOA 1QR2A 1ZXBA 3OEYA 1JU4A 1OREA 4GS5A 2ECQA 3ZBUA 2CD7A 4OFWA 1TKBA 2XMQA 2YWDA 2JFOA 2GASA 3M5WA 4XUEA 2JHGA 2QAGB 3CW2A 4FGSA 1D5CA 4L0DA 2ADMA 3KP1A 3HDYA 2XUJA 3M2TA 4MUGA 3WJ2A 1MABA 2B1QA 2OG1A 2XHZA 4RZSA 2PE5A 1JG6A 1L5OA 4OOEA 2YNMA 3AFMA 4PQYA 5GV7A 1T1SA 3G8BA 4KREA 3EA4A 1XTPA 3HJUA 3HRKA 2YN0A 1DWUA 4ND3A 2NXWA 5FR2A 3TDNA 2W22A 1NHWA 5CPFA 4B2PA 4HYTA 4PSVA 1EDBA 2EU8A 1WWKA 2PUHA 3K7EA 1FP4A 3LA6A 4HS4A 3EIWA 1HZZA 1MJ5A 4NFLA 4QQFA 4S1TA 1NI5A 2PSFA 2X0NA 3A6ZA 4IYJA 3F98A 4KNWA 2MR5A 4JFAA 5C5IA 1ZU5A 4PSCA 7ABPA 1H0RA 4PHCA 4HWKA 1TLLA 4PE5B 4EABA 1ICIA 4P1ZA 2EARA 3SJUA 1EMDA 1I2MA 3OEWA 1NPYA 4RH0A 1EAMA 2AX3A 2I55A 3OTGA 3OPYA 2DZDA 3QBEA 1VKHA 3F4LA 4L76A 4FILA 5TNXA 3PUZA 3QVVA 3WIEA 4Q4CA 5HGXA 1PEKE 2BONA 1ULHA 2HJGA 3DMPA 3EIOA 1F14A 2QTCA 4M76B 5H83A 4PR0A 3ECAA 2JH8A 4ZDIA 3LW8A 2POQX 3PXEA 4N1AA 4PS0A 5G1NA 2PVSA 4QQNA 3KD3A 4RGQA 1WXDA 3BXFA 3CA8A 5D87A 4EATA 1MAUA 1ZESA 3B1VA 4F4HA 1WXWA 2V7TA 3ZCUA 2BV3A 3KPJA 2HHCA 1C1XB 5IF9A 1RWNA 1XZKA 4QHTA 3N6XA 4D9NA 1VHJA 3DM5A 4BASA 3WK5A 2B4QA 2VF7A 1VMAA 1W96A 3B3JA 3H5IA 3QW4B 4KPGA 4LHZA 2QM3A 1KNXA 3SDBA 1A82A 5J1TB 4ME6A 3ORFA 1R8QA 4FOPA 5CIYA 3P8ZA 1IM2A 4E1AA 3KSAC 1EP9A 4PYRA 1CY7A 1JTEA 2PBRA 3FYTA 3TVDA 1YTUA 3PKJA 3N07A 3WDKA 2NXCA 3D1LA 4NV1A 4UOZA 3MMPA 5EG5A 3PX7A 3TLEA 4PO8A 4HF7A 4KMRA 2YMPA 4M46A 4M89A 3VHXA 3MTGA 3VTAA 1N78A 3QVJA 2JAQA 2GJ8A 3QKSA 2J7PD 1ZNQO 3R74A 3AOGA 2FPUA 1GGEA 3TN7A 4KQEA 2XNKA 5BRJA 4KE9A 4BZPA 3NTVA 4GE3A 4WA7A 2BEUA 3P27A 2WVHA 4EBBA 2BRUC 3L77A 5K8TA 1F20A 4JP8A 4H3KB 4LN1A 3RREA 2ZUSA 4R68A 1E4OA 1PN3A 2HIAA 2EHJA 3BJRA 4EOGA 3K71B 5C7LO 4Y2QA 3MS2A 3OE1A 4DYHA 5JAPA 1FU4A 3CRW1 3FW1A 3K96A 3KYDB 2XCUA 4V03A 4CDMA 2I91A 4QZVA 3H13A 4MV6A 4XSHA 1U99A 4P34A 5EUCA 3LBIA 2BBSA 2H7XA 3ROTA 4JHXA 2WJWA 3HDJA 3RVDA 1XZCA 2YJ3A 5DN6D 5ALFA 4JC8A 2PKQO 5FUXA 1SUIA 1YRBA 2WVAA 3RFUA 4YJGB 4NYMR 2C7GA 1OWLA 1V3TA 3MT0A 1NRXA 5DHTA 4KWEA 1DO0A 2WJVA 1ULUA 2V7BA 3PUYA 2HMWA 2G82A 1ZK1A 4BB0A 2GEJA 2OHGA 3FFWA 3RPEA 3BXXA 4L4XA 2VRNA 2JLUA 1HXHA 1AF4A 4Q1CA 1BTOA 1OU4A 2JI7A 2XQVA 3OTWA 4QGSA 5B7GA 2VJNA 1ZSYA 5JCJD 2XQKA 1MGPA 3PHJA 2QQEA 5FPPA 4H1WA 1JG3A 4EGSA 3H8VA 3S4YA 2QN8A 3BCRA 4XWKA 7REQA 5KJCA 1YDFA 2XUFA 3SGLA 4BP9A 5BWMA 1G66A 2AFRA 1CF2O 2MSWA 1T3LA 2A57A 2W93A 1X7GA 3AKCA 4IQ8A 1Z08A 2I1VB 3I30X 2ZJ4A 1HFKA 1KEEA 2CBZA 3Q40A 1NU8A 3G7NA 8GPBA 5ALJA 3A6KA 5KYXA 3U3RA 1CNMA 1K0UA 1L6RA 3NYIA 4NZYA 3BSWA 1RKQA 1O77A 3OKPA 3H7IA 5JNSA 1L4LA 1BCRA 1JQKA 1KC3A 1ZGGA 3BJZA 4O4LA 4ZVNA 3A25A 3QVTA 3JYLA 4HDKB 2AG0A 4EHLA 2PUCA 1IG3A 3IQXA 2WMYA 4KRXA 3I72A 4ZOCA 2FSVC 3G9XA 3NV7A 4NAUA 4MYCA 5DMXA 5EHQA 1L7QA 4G2TA 2WTXA 4KUEA 1NQAO 1KZ1A 3NHKA 1U2DA 3VUFA 3I92A 2J46A 4HRVA 5IASA 4RJTA 3VJKA 3EIQA 2PMDA 3THOA 3UH0A 3NH6A 5DKFA 4RYLA 4FDLA 1AGRA 2G6BA 3H84A 1VKNA 1J09A 3LLCA 4MVJF 4MI3A 3TZEA 3WQHA 1SQGA 1PBTA 1PVOA 1S4MA 4Q12A 3SMQA 3ZZMA 1NVDA 1P74A 3IP8A 3K1ZA 1EZZA 2Z8YA 1YTLA 3PUVA 4EVRA 1BQ4A 4CQMA 2X58A 3KELA 3EW9A 3IJEB 1M34B 4AG5A 1ISGA 4G0YA 1YRWA 1SG0A 2CHEA 3R9WA 4XSGA 3EY4A 3GT3A 4PAOA 4UMVA 5TEWA 1OX4B 2A58A 3RC3A 5LOVA 5IWAB 3ANNA 1JZTA 4HTFB 2V1UA 4Y9TA 3T0FA 3EG9A 4ZO8A 1U11A 3FMOB 4ARIA 2D00A 3C3KA 3IUYA 4QA9A 4QU9A 4KQFA 4HY3A 2JZNA 3VYUB 3J81A 3U13A 3IFSA 2PY6A 4JVMA 1E4YA 4QU5A 5TB5A 3LFUA 5GINE 1OF1A 1TK3A 2HHAA 2R8RA 1VPEA 2ASEA 2IUEA 4DLPA 1FDWA 4QTUB 4XUGB 1OH7A 1TKAA 1Y3BE 3WTBA 2ZB2A 5TEVA 3UBMA 1MA3A 4ZMSA 1I6MA 5KREA 1KHTA 1XTIA 2REBA 3FIUA 1C41A 3KO8A 4C5BA 1PNOA 3HUUA 1DTEA 1DC5A 1UKZA 2AR7A 2GHIA 4K6MA 5E2IA 2O4CA 4MA4A 3RTCA 1M5UA 2I9KA 2NU7A 3GZTB 3NQ41 2C84A 4H4DA 3FD8A 1ZWLA 3TLMA 4X62B 4OI2A 4QOHA 4V3CA 2NU6B 4G6ZA 2XGGA 4ZAFA 4AO7A 1TM7E 1XRLA 2CL7X 2P0YA 4OUKX 4H0NA 4BFXA 4PICA 3WGMA 1PR4A 1DZIA 5K8CA 1JA0A 3ND8A 4CR6A 1V1RB 4F86A 2WHPA 3EC1A 4HWSA 3I2GA 5BT9A 3IDSA 3QM1A 2J9FA 2GMWA 4I1IA 4KVZA 1GRRA 1JEQA 1H65A 1GTG1 3H0KA 1ZWKA 3QP9A 5AQEA 3R3JA 4BRZA 5FLEX 4MJ7A 1L5LA 4AMGA 4CKBB 3PUIA 2IEYA 2H2AA 1FQWA 2F7SA 1DUVG 1VCNA 3LWDA 4M55A 3S2GA 2ISCA 4BE7B 3CR7A 4JI1B 1W4ZA 1QHFA 1TJPB 4O3FA 3GLGA 2OAGA 1TYDE 2BM9A 2AV6A 1AK2A 1VDZA 4DIMA 2EWWA 1FPMA 2ZYSA 3MRVA 1T2VA 3MQ2A 5LJLA 1E2JA 1YVPA 4DV2B 1MQSA 4EFKA 1KJQA 4N40A 3TQQA 2GN4A 1TRKA 2BUAA 2WK1A 3BAFA 2PNJA 3WDMA 1QDLB 3ZDXB 2RIPA 1CUBA 1T0UA 1M0SA 3IUNA 3K05A 5J63A 3EVFA 2EZTA 3IQEA 2WD7B 1BFUA 1A5TA 2HJ9A 4PU0A 5IN4A 2QJWA 1M5RA 1EWKA 4AU1A 1OH6A 1I2BA 5HKKD 3FCXA 1MB3A 4R8MA 4WASA 4BLOA 2H9YA 2CXTA 2H65A 2I87A 3MSCA 4U7FA 2LDXA 2UZ1B 3FHCB 2XE7A 3SZGA 2BMWA 3ZBPA 1FFEA 1RZVA 5KOJA 4RV9A 1LXCA 1T9CA 4X3PA 4Z7JA 1H5NA 1UKVY 1JB1A 2YWBA 3IB3A 3OQPA 3Q5GA 4LQ4A 3V8BA 1OJ7A 5LNK6 3MXOA 1V6CA 4DA7A 1E5XA 4IJMA 5E6SB 1F0YA 3NUZA 2JLXA 4R9VA 5E2AA 2P6RA 1GITA 1WKBA 1N5KA 3LY9A 4K40A 2LWIA 1Y48E 4P4GA 4REMA 1MH1A 1AUVA 1GD1O 2RCYA 1E89A 3V97A 2JD1A 1OLOA 3PS9A 3KXPA 1NJ5A 5TPZD 2J0UB 2ZVPX 4B8WA 5A7FA 2XDYA 2OBLA 5F7ZA 1DRVA 1YAJA 4LZWA 2G5GX 3TRDA 2GPAA 4E2YA 3AIKA 3IV6A 3I2HA 2AD5A 1VCOA 4ZQFA 3NEJA 1PX0A 2NPFA 4A15A 1N0WA 1F3LA 1H0SA 1S2NA 2E21A 2CUKA 2B8WA 2VAMA 3GCXA 4QUEA 4RL4A 4JJ4A 1CETA 4AO6A 4OQLA 2DT8A 2FF5A 3FYDA 1MX9A 5EGNA 4RADA 4ETIA 2XYVA 1JL3A 1VL6A 2G6TA 3T7TA 1ZMOA 2OP1A 2VDQB 4C0XA 2QTGA 4DWOA 1CB7A 2XNDA 1R3UA 4WBNA 2JHPA 4I2VA 1SXPA 3MUNA 4M1MA 4YROA 3LGSA 5AJUA 4AJHA 1IB6A 2YYSA 3EWIA 3A4IA 1HL7A 3G0CA 3OQOA 2Y0DA 2ZYUX 3B12A 3GRCA 3LKZA 1VSQA 3PE3A 5CFOA 1QVWA 4ARCA 1SPXA 2BPOA 5CX1B 3EPRA 2OZPA 2Q8PA 2QRQA 3DKKA 3T7SA 1E9SA 1MVNA 3F5DA 5BNWA 2FHSA 4G5OA 4PZLA 2CYCA 4KXNA 1TU4A 4MWTA 4OL0A 5HQJA 3RSSA 3S1AA 3VNRA 1GRCA 5EP2A 1UKBA 2J4CA 1LDBA 3PF8A 5CG1A 2PZLA 2V96A 2OHHA 2XMCA 4WZAE 1E1KA 2ZTVA 4PQFA 3IPYA 4ZP1A 2ATXA 4S1OA 5BQ3A 3L1VA 1US8B 1OW3B 5KTNA 1YZGA 2B0CA 1UODA 3DR5A 1BVRA 5CB4F 1NW8A 1OYOA 2R62A 5IVPA 2JCVA 2XI4A 1U31A 4IVNA 4JJ7A 3GEMA 5KU1A 2ZANA 2PV7A 1PG5A 1C7JA 4RANA 5CFLA 2WIKA 5KQMA 5FTLA 2XYQA 4NKRA 1ABFA 3VYWA 4B3CA 1A88A 5IS2A 2P3SA 5HTKA 3VKHA 4QUBA 3QVKA 2NO7A 3KG2A 1QV6A 2JIPA 3AEQB 5JSQA 1I6WA 2ZRIA 1Y6GA 4KZKA 4YP7A 2XECA 2NP6A 4Q6BA 1EFLA 1L5RA 1NOJA 2Z8XA 4B75A 3BILA 4M7OA 2GVNA 3C4JA 5H3LA 4YJ3F 1MO2A 4ERNA 3N5CA 1A1SA 1U3FA 3VTFA 4RACA 4NDAA 2AXEA 1YKSA 1KMHB 3FKJA 1IVYA 4X1YA 4FMDB 3TNDA 2W2PA 4KXYA 2C9MA 4FU0A 4OMUA 3PRYA 5DLQC 1HTBA 1ZP6A 2VDRB 2YN2A 4TV9B 4TWAA 3Q8MA 2PUDA 3OQ1A 3SJ7A 1ZOPA 4R1PA 1JQ5A 1GSHA 4H1HA 5JJLA 1EI9A 3A0RB 2W2KB 1R10A 3AB7A 1O03A 4OAQA 3DUFB 1ML4A 2D74A 5E9JA 4EYOA 1D6JA 1S8OA 3RS5A 1OIWA 3WWZA 1U8ZA 5LYJA 5IJ9B 4F7WA 2HCJB 3CFYA 2NYRA 4I3HA 4YRMA 3PVZA 1GVNB 5CDSA 2FVXA 3DMNA 4GHWA 1OZHA 4HNAA 1E0KA 1T13A 1IATA 2O7RA 1NM5C 5DRTA 5F1YA 3JTMA 1USGA 3MIIA 4HAOA 4EAQA 1PO7A 3H17A 1HQCA 2BM8A 2J1LA 5D3MA 4JI7B 4DSAA 4HXFB 1V9SA 2D62A 2DPYA 3CX8A 1UKCA 1QLWA 1U2SA 2ZE8A 1WSAA 4KI0A 4EG4A 5J43A 5TX7A 2IEAA 2OGTA 3FWNA 2QVCA 3OFJA 2GAOA 5GZ1A 4J16C 3O1LA 1V35A 3G8CA 4EPXA 1L7DA 3TDMA 4EQ6B 1VBFA 5FF9A 1J9ZA 2FZ5A 1IQ0A 3AK4A 3OZUA 3AL0C 4H2DA 1F51E 2P91A 3HWX1 3TSCA 1JSRA 3JAWB 3QUTA 4PR3A 1FW8A 2BR3A 2GTIA 4BNDB 3NTRA 4CIDA 4R81A 3MWFA 4E15A 2IY7A 3WZLA 1R8YA 1Q1NA 1P4GA 3IH5A 1RWWA 4P7GA 2C2GA 4WJZA 4IAOA 1JIXA 4IKOA 4OI4A 3HP1A 4QBFA 3IHKA 4I9FA 2JFHA 2LR0A 2EP7A 2YCBA 4LXGA 2B61A 1AC5A 1CUYA 1W9MA 3CCBA 1YD7A 1S8FA 3IDZA 3OEEA 2ZI7A 3OURA 4K8OA 4F1KA 2OBYA 3FVTA 2C98A 1WNTA 4PNPA 5K09A 1U65A 1TRHA 5I7FA 3DVLA 1IOZA 2FQ1A 3MINB 5KYYA 2H2FA 1FXWA 5SZJA 1YB6A 4TTSA 3SBXA 1NSTA 4JENA 4PF1A 4EHDA 2CLFB 2FE1A 1JAXA 1E66A 2V45A 4Q93A 1BRTA 3JWJA 4ZOQI 1D09A 1E2BA 2XEXA 3GP5A 4RJLA 1HEYA 2VUUA 4NCAA 4YT8A 5E8JA 1EFUA 5EJMA 2IUYA 3WK6A 2DLDA 3AJAA 4C0QC 4FSXA 4IGFA 1GYPA 2X0IA 1HGXA 3PV0A 4MDYA 4PW0A 5AJVB 1NVKA 2H16A 2Z2ZA 3S0JA 4JXKA 5JZOA 4ZJZA 4R40A 3Q85A 3VR5A 1JT9A 2FZCA 2VH1A 1Q7GA 2JARA 5EJ9A 1FBTA 2AJ8A 3DWFA 4KODA 1KDZA 1BFDA 1X70A 1L9KA 2NO4A 3WLTA 2O8CA 1M74A 2BN4A 2D5IA 2Y2UA 1E2MA 5DOZA 2QN2A 1HR0B 1EK0A 1N6KA 1Q6ZA 3R41A 4J0EA 2EX1A 3ER8A 4HQLA 4Y6PA 3WIVA 1BJTA 1WDMA 5L3SB 1X38A 1LK5A 1V5EA 3QWFA 4KLNA 4DBLE 5AVQA 5MGNA 4JEIA 3WAKA 1RE0A 2OAQ1 2BFAA 5C8DA 3L6DA 1O94D 3GLQA 5D5HA 2F8LA 2QDXA 4OLJA 3HXMA 3BXHA 1F8GA 3UMYA 3DONA 4B3XA 4O4JF 4X41A 4IJ5A 3EFOB 1QYCA 4KITB 4TLBA 3BHIA 1DEKA 1V11B 2YMQA 2RFLA 1JI0A 1ZCJA 4ARZB 3SXJA 3GRAA 2AYZA 1RM4A 3C6XA 4H16A 4MQEA 1LC3A 1SCUA 3CCFA 3DWGA 3DTNA 3JSAA 4OJNA 4XWTA 5AW5A 5IXSA 2IH5A 1TUGA 2CZQA 4QAQA 1IB0A 3IYLW 5GIOE 1XTZA 2L69A 2X8AA 4RVCA 4Y2XA 1LQ2A 3QF4B 1ADGA 4JLKA 2V55B 3R3UA 2VT2A 2FMFA 1TJ5A 4XEHA 3JD4A 4PLPA 1B15A 4BLVA 4YUAA 2I8CA 2V74B 4C4OA 3ICEA 1MDBA 3R3VA 5HVNA 5CFZA 3GJ0A 4A0FA 4FYPA 1KY2A 5BYJA 4HEHA 1CNFA 2HRCA 1L7OA 2JJYA 4LYHA 1R0RE 2IODA 4BNZA 2X1HA 1E1RA 1DZ3A 1D1PA 3MT9A 5AVSA 1QS0A 2MMCA 3F4BA 2Z3ZA 3LDFA 5CM2Z 1UBTS 5DPMA 3LX8A 4I55A 1B7GO 4N76A 3C6KA 2OYSA 2OSBA 3O75A 3F46A 4UUAA 2RH5A 1FRNA 1RRFA 3PR3A 2HQRA 3HFRA 3NALA 2VWPA 2GO1A 1T2DA 4L9RA 4ER7A 1UJ6A 2L17A 3ZJUA 5B12A 1DU4A 4MIYA 4D0NA 1W6RA 3UWKA 3HCBA 5KVVA 2NVWA 3AOEC 3LRXA 3PR2B 2CK3A 5EXXA 1TAUA 5IT0A 3W8DA 3U16A 3NONA 3H18A 1WJGA 1MB4A 2PLNA 2XZPA 3LTEA 2Q2QA 5J5CA 4PZEA 5JH7F 1Q15A 3HNRA 3VZSA 4WZAA 1QZ3A 4XFDA 5WRFA 1HDXA 3RYCA 2R1UA 3FDIA 2NXJA 1PWYE 3D0OA 3KPUA 4O29A 2HMTA 2XCRB 4QTTB 4CCWA 2CE2X 2IUTA 5K3AA 2O2HA 1BIFA 3WGIA 5ITZB 5BN4B 1G0NA 1GTZA 4I08A 1SU8A 2GPYA 4RM3A 4AULA 2F67A 3BSSA 1QIJA 4WUVA 2B9EA 3KKQA 3QVSA 5IT5A 1DEOA 3KSBC 1ATIA 3TVYA 2A9VA 3ZWXA 4IINA 3TBKA 1M8KA 2DLNA 3MN1A 3QLTA 1K2WA 3BD8A 1DQYA 3PGA1 4UZFA 4P3PA 2DFTA 4XE5A 3I8OA 4B1FA 621PA 1PNTA 3QXXA 4DF3A 3JASB 2NMVA 5GWXA 4II3A 3WA6A 1KSGA 5AM1A 3DO8A 1ZH6A 1MPTA 2OQIA 5E4JA 3ND5A 4HFRA 1P0FA 2F4NA 4X7BA 4A8JC 2FUEA 4D98A 2ADOA 3MJRA 1Z34A 1P2DA 1J2EA 1ZN2A 4W1QA 4OYLA 4PC1A 3VXKA 6YASA 1Q14A 3BBLA 1E5VA 4D41A 1NN3A 1TAHA 5BNZA 4AIRA 5L7TA 5DV9A 2HPHA 1J39A 3UAXA 3OCUA 3P2OA 5JQGF 2O8FA 5EHZA 3RIMA 1TVCA 2IYVA 1V5FA 3PCTA 1KZYC 1D03A 1MO5A 2QTTA 1X7DA 3G5AA 1D2GA 2AOWA 4LMRA 2O3JA 3DDWA 1VG1A 3GCDA 3QBVA 4PCLA 4US0R 2E5FA 3RVQA 3I6MA 5A4JA 2A1UB 3FNEA 4UCWA 4HEA1 1FXUA 2V0NA 3HV2A 3TZCA 4BE4A 5ITVA 2R2GA 2BCJQ 1CZRA 2RHBA 4NZMA 3L0DA 1YQ9A 2GLXA 5JAQA 3WNDA 5B55A 1EX9A 4XIJA 3MBOA 5L6LB 4AICA 4MHTA 4X7PA 2GQ0A 4KQHA 1LKZA 1X1CA 1YGPA 2NVUA 3PITA 3Q0IA 1NBME 1XLTA 1PR6A 4KV9A 4NY1A 1EFRD 1TEXA 4FGUA 2BSQA 1QG2A 5LXTA 1UJ4A 1WQ1R 2Q3DA 4S3MA 2FP4A 1GZ3A 1RYHA 4LF8B 2NXEA 2VJCA 1BKYA 2OGSA 2TSYB 3TR5A 3SKXA 5JZMA 2W6QA 2BDEA 1A5BB 1LA2A 4CLHA 1ITZA 2ZB3A 3L1UA 1Z8DA 3M4NA 3ONWA 1G3RA 4B82A 4BNFA 4EB0A 1YMVA 3RRBA 1OC2A 3T3PB 2QT1A 3A2LA 1AUOA 1MMFB 2R84A 3VDRA 1TZCA 3BCHA 4E31A 2JLYA 4HZUA 4CIVA 4DPMA 1HE1C 1T5DX 2FQYA 4LGMA 3E61A 4OFBA 4ZYTA 2PSJA 3DLTA 4EI2A 2FWMX 4DN6A 2O23A 4DJFC 4EKEA 1G5FA 4JT2A 2PH7A 2BVNA 4J49A 1WF6A 2XYRA 1E2LA 1QGZA 3F7TA 2KX7A 3ESDA 4J0QA 2C20A 3M33A 1SGWA 4IO0A 2ICAA 2FFJA 2I76A 3FTNA 3S8EA 5CP8A 4RCZA 3IULA 3N87A 4PC2A 2A0KA 4TTJA 5IZCA 1A8UA 5AQ1A 1YIOA 2Z1DA 4RK4A 3V4ZA 1H3FA 1Q7RA 3ICVA 3F67A 1M1YB 3A11A 4O0MA 1RMYA 1MAAA 5KKCA 4EO7A 4A8JB 1MTZA 2TS1A 1Y33E 4J8PA 3C8DA 3A31A 4DV3B 2EKZA 3G2IA 4OB7A 2A2ZA 2ZSUA 4M3NA 1ZC4A 4UW9A 2VO1A 3RT1A 1EEXB 2ZR0A 4RAQA 4HLCA 4DB4A 3EHEA 4KX5A 4ZOLB 2PUBA 4ZO6A 5EJ8A 3BEDA 1Z4OA 3BIOA 3AUAA 4C2AA 1NXOA 3I9FA 2HA2A 2PT6A 3C14C 3HCDA 5FOSA 3RFCA 3DXFA 3LCRA 4TUYA 3WJAA 4RS4A 2CLIB 3O21A 1PJ2A 1U3UA 4H4CA 3IEVA 3VDNB 3K9BA 4G1VA 1IZ9A 2Q8QA 4R1QA 3DAPA 2PANA 2ZI6A 5FLYA 2Z3VA 4AKGA 4HWOA 4OK3A 2WJ4A 1IN5A 2NZ2A 2C57A 4WNYA 1SCIA 2HI0A 1KEKA 1P91A 1YFLA 2IUSA 3VDQA 2RCNA 3NJ4A 1E4EA 2GNOA 5DTEA 4GYWA 2Q2WA 4LYDA 1V16A 2QI9F 4UAJA 4WLFA 1C1YA 4DLYA 2QJOA 2V3VA 3TFOA 1MIOA 1JJIA 2VQDA 3TFQA 3LK6A 5JBNA 2KB0A 2Y3IA 1IMJA 4M0CA 3SSMA 3ZQJA 3W7VA 2GD6A 5GADl 4NV0A 1E1QA 4PSAA 1NKTA 4XD7A 4GXTA 1IXRC 2G7ZA 4CJXA 1XCLA 1B8OA 2V6GA 3B1YA 4DV1B 1NUTA 3RNLA 2XQFA 3EDRA 4ACBA 2Z1NA 4F4IA 3OAAA 3U3XA 3GR6A 3TI9A 3DNMA 1IQUA 4B6PA 3RVBA 4AZTA 5KMGB 1T5TA 3GAAA 3FYUC 4PLGA 2IOFA 1MV5A 3OY7A 4YCCA 2OENG 2W8BB 3FPLA 2R6GA 1AMUA 1VSTA 2HLPA 4K8RB 3OIUA 2PUEA 2AOTA 4H3VA 4OM7A 2OLEA 3RJMA 4MXDA 4FYKA 4CT5A 4R41A 4IIUA 1S2MA 1UP4A 3GMDA 3NDBB 1PL7A 2VJYA 4I0WB 3RVMA 2PD3A 3M0EA 4JQZA 1WBBA 4I1PA 4RTNA 1MBZA 1XDZA 4OO3A 2QJRA 2GPSA 5A6SB 4I9GA 3TM4A 2Y1WA 1H8HA 4QD3A 4ZI7B 2PLRA 1P7CA 3BHNA 4M1TA 4YJ2F 3NO4A 3ICWA 4FC6A 2GS9A 4MV3A 1EHIA 1MU0A 1ATZA 4KQKA 4NNOA 2YFQA 4HYEA 4BVBA 3I62A 2C78A 4GP7A 1R15A 5EI5A 2D1YA 4DMKA 4NOKA 4Z4HA 3T5TA 1X13A 2HYDA 2SKCA 4FNGA 2ZUDA 4GZ5A 1HEIA 4KK4A 4PXAA 4TZTA 1RAIA 2LZ0A 2B92A 4QUDA 5KTOA 3FPCA 1E8MA 2A4KA 4GWGA 1CJUC 3DZGA 5CAEA 1SCAA 2Z2IA 1XYVA 2HRBA 2GAIA 1H85A 1OKKD 2PH3A 1QWOA 3ILXA 7ADHA 5ADHA 4ZCSA 1TTTA 2PUVA 5J40A 3LCJA 4M2LA 2I7TA 4MPDA 1CUGA 1OXSC 2REXB 2X22A 4KYTA 3AFOA 4RVFA 3U80A 1E9AA 2QMOA 3IPRA 1EVEA 5HS6A 4QASA 4ASUA 4BECA 3UYLA 1L3IA 1XRSB 4EYGA 4Z1OA 4F4UA 1EHCA 1KOJA 1I3OA 1XDBA 3QTTA 4K6HA 4OA8A 4EWLA 5CH8A 2X2PA 3O47A 3MOGA 5F9FA 4QELA 4QDZA 3RAJA 2NVBA 2H9IA 1QBGA 3BWMA 4G86A 4KQ1A 1SZJG 1T9BA 3TVTA 2DSNA 4OXNA 1WMDA 4TV8A 2R00A 1VP3A 2VPQA 2A67A 3CLSC 4FI3F 3TW8B 1SVUA 4TTAA 3LC7O 2MWMA 4KK3A 2YW9A 1EX6A 2GH1A 3KZOA 1MH9A 1H5QA 1JH9A 5G40A 3A37A 3JD1A 4OXYA 4ZPXA 3BRWA 1XHFA 1C3JA 1SUWA 5REQA 1M2NA 4WK6A 1QRSA 1RQXA 3I0ZA 3V6LA 4ZXFA 3FYUB 1OXKB 2QNRA 1SELA 2QW0X 3FDFA 1TD1A 1PKEA 4D0GA 2W6PA 1WVGA 2C8LA 1E58A 1JQJC 1MKYA 4ZHSA 4YP5A 1Z4QA 2CFCA 2IEGA 3QPBA 4CR7A 2DB3A 3AFHA 1A50B 2FUG1 3EZ9A 2Q5QA 1PL8A 1MZPA 3WWYA 1C3OB 3C2QA 3KR0A 1IHDA 1DNPA 3ZHUA 1F2TB 4LDZA 1DBIA 3QJ5A 4XRGA 5AKYA 2PJUA 1EWVA 2O05A 1H1LB 2VSYA 4B83A 3B8HA 1O6BA 2HLNA 2ZYAA 1EA5A 2PPLA 3SVTA 1ZGCA 1UL1X 4HATA 1E4VA 1SD2A 1TMOA 3A3OA 4BC0A 4GUDA 2NTYC 4NJOA 2AUNA 3AI3A 4PN3A 1NBMA 4RZUA 3ZD9A 4AWAA 3PA8A 2CMGA 2E89A 4YAEA 4B0PA 4LYFA 2QM7A 5ALXA 1KDVA 1FQOA 3EGVA 4UARA 2I34A 3RYHA 2J45A 5F9MA 5ALDA 2DM6A 3CF4G 1DBWA 2ONCA 4WXMA 1KYVA 1Z12A 4K87A 3OT4A 4I4TB 2J0EA 1QHSA 1WXHA 1EUDA 1RYDA 1XQVA 2HF8A 3R23A 4UBLA 1NJGA 1TTQB 3IUQA 1YZHA 4FWBA 5HE8A 2FHPA 3EBLA 3GFVA 3DE7X 4FLEA 3V32A 3WRWA 4YMUA 4DCJA 5L95A 1I4OA 4P7BA 4KX3A 1L5KA 2ZRDA 3J81k 3ZZUA 3QKWA 1FFDA 3IKVA 3N70A 3MSXA 3P2YA 4W8OA 5K45A 3E81A 4Z51A 2PHZA 1ZCZA 3LO8A 3OZAA 4P4UA 1T25A 5B37A 1K6MA 1C9YA 2VT6A 1N0IA 3W9UA 1NNUA 4F9EA 1IQPA 5CD1A 3WLNA 2VLIA 3K8ZA 4KJXA 2GAAA 4GMXA 5H4HA 3RIXA 3R40A 4D0SA 2PO5A 5DP2A 1KJYA 3H65A 2BP7A 4NYIR 1E2HA 4OBWA 4CDGA 3D4IA 3RJ9A 1M83A 5LQDA 3GVXA 2HHHB 3ESQA 4QM6A 1VMDA 3FCUB 3MMNA 2QL7A 5JOQA 2X7JA 3W2HA 4QL3A 4I4NA 1NF8A 2E18A 3AF3A 3WAJA 1Z39A 1CLEA 3CUEF 1T4CB 3PD1A 2NOAA 5DEOA 4L0MA 2OXTA 2CDAA 1UMDA 2WJPA 3HYTA 3T1NA 1E0AA 3V4VB 2P67A 3D6HA 3QENA 3MD0A 2GETA 4C7KA 2ATIA 3WZ2A 1HM5A 4B8YA 2ZXUA 1AY0A 1G9XA 1IYZA 3DUWA 2JHAA 4NENA 4TVBA 5EC8A 3RUEA 2OCPA 1IPHA 1FP1D 3ZGVA 2R47A 1V3QE 4BAGA 2IUUA 1SC4A 1HI9A 2OPHA 1K89A 4GDFA 4M38A 3I28A 3NIDB 4LF5B 1L5FA 1KKLA 2OFFA 3STUA 3WRYC 1JEYA 3WIBA 2PGDA 5T4BA 2MHCA 4OMDA 2WIDA 3THXA 3R7DA 1YZFA 3N0VA 4KO4S 3MJEA 4MEAA 2VDMB 4OPMA 1F06A 1FBNA 2HH9A 4G0MA 3DBIA 4TKUB 2RGWA 1RZRA 1P9LA 3FLEA 1RWMA 4HNRA 3GRUA 3HUTA 4S0XA 1U0LA 2XNHA 4WRRA 4EH1A 1PDVA 3TG2A 4RS3A 2QX8A 5JJKA 2FW6A 2HN9A 4RQBA 1V48A 2I3AA 4GP9A 1Z5PA 4MW9A 3ZR4B 4WTOA 2ZJ7A 4RKFA 1ZAKA 1NXXA 1G8PA 5D84A 1VCIA 4JWKA 3TKYA 1G0OA 2FJ0A 3BL8A 1W2WB 3ODGA 5FBLB 3D8SA 2H7CA 2IU0A 1EEHA 4GU5A 4J1QA 3I1YA 3M1AA 4L5CA 1DAIA 4ZANA 1AN0A 2YC2C 3IBGA 2FGJA 3RS3A 2NUAA 3UICA 5EZSA 5HZKA 3PDWA 1GTMA 1VGRA 3IV7A 4JLPA 4WERA 4BB6A 3T3NA 2XBUA 2O20A 3MYRA 5KX5A 4J76A 4P35A 4C2TA 4IHJA 1V6SA 3JQ8A 1A98A 4HQNA 2GD2A 5JLJA 3H83A 3QXCA 3CTMA 3OZIA 2FWAA 2IXDA 4PYQA 2VSXA 3D5EA 3B13B 3LDUA 4RHCA 5DWQA 3RKUA 4LYYA 3WLHA 2VLBA 5KIAA 1RCUA 5BYBA 4LBYA 1UDCA 3IUEA 3CJRA 4YR7A 5BQXA 1I4LD 4HBGA 2QTWB 1PEAA 4LG1A 1AA9A 3J80A 1FMJA 1SQ5A 4OSEA 1U7TA 1E3EA 4U39A 1FQJA 3RSHA 2ZS9A 3O1HB 4AJJA 2BMVA 2PXXA 3G2KA 3AWDA 4H7PA 5BW4A 1L4HA 1CRZA 2BKVA 3JQAD 5ALSA 5C5DA 3U09A 1J97A 4JSTA 1GPBA 4R16A 1AKQA 2X15A 2PAAA 2C4KA 1TAGA 2H8GA 3FPJA 3JWIA 5E2BA 3WMXA 3ZX4A 5IU6A 5TSDA 2GILA 3N39C 5B58T 4NU6A 3BC1A 5D51S 2PIDA 4ISBA 2CLCX 1N75A 3B1KA 4ZVTA 4ED9A 3A27A 3I2IA 4GR4A 5LLDA 2O8DA 3D0RA 1WHSA 5KTYA 2C54A 1Y5IA 1COWD 1WQ3A 5KYWB 1OTXA 3UJ7A 3QUAA 1ZMRA 5JZBA 2ECKA 3KYBA 1P4RA 1V7CA 3TB4A 3CO5A 3QKTA 5BSUA 1E8DA 1TK2A 1TEHA 4LXQA 4FBLA 3ZZ0A 5CVJA 5T6MA 2QSYA 1DTWB 4RUKA 4F8YA 3KUUA 1Z0SA 3KFLA 4UC0A 2OFWA 3T5CA 4QDKA 5EKDA 1V45E 2JJMA 2EVWX 1Y5MA 4QUIA 3ROMA 1ZVQA 4ZXPA 4UM9B 1YS2X 2IQ5A 3K4PA 3ESYA 3L7BA 1X6VA 4CT4B 2Y0EA 3U4CA 2QMEA 4F5ZA 1UJCA 3VA7A 2G1PA 4O63O 1ZXXA 1S89A 2EV9A 2FPGB 2PZKA 2XWPA 4FFNA 1C3XA 2QLMA 1NVWQ 1U2GA 2BFDB 2N46A 1GZ7A 1EUCA 4JMLA 3ESZA 3SHOA 3W9BA 3FMPB 3NI2A 2K2WA 1BXRA 5IUKC 3V4SA 1UP7A 3L2OB 5AKIA 1G8YA 4GI7A 3ZIDA 4NBKA 3WGLA 5EUMA 2R1VB 4IEEA 5E3JA 2V9CA 4D96A 3SHQA 3UMJA 1TADA 3ZNQA 4ZZIA 4TMKA 4YJHA 1WB6A 2IHBA 3IP9A 1SCKA 4UDXX 1IHPA 1QRAA 4CM1A 5E6RA 1NYTA 3KB1A 3I76A 1YJ5A 1HLFA 2PBFA 1AZWA 2WHXA 3K31A 4AQDA 1LW6E 4YAOA 4RD4A 4PYIA 5A4FS 1DIBA 1HT2E 2RBEA 3AM3A 3MNFA 4QU0A 4J3NA 3ASVA 1W76A 3CC8A 2VDNB 4FR5A 3AP1A 4XIFA 5IVDA 2EJCA 1ZKMA 4P0PB 2GN8A 1WUYA 2WTBA 2A9JA 1MEEA 2BFWA 3KB2A 3KOOA 4FOLA 5IM4F 4QQ8A 2XAAA 1OLSB 1RLIA 4KO2S 1F6WA 2O1XA 1DEHA 2YJNA 4JJEA 3S70A 3W3AH 3A4NA 3HU1A 1WEHA 2Y1EA 3E58A 4NP6A 1TIKA 2B6NA 4HADA 5AO9A 3OZSA 1CVRA 4LF9B 5CG2A 3DOOA 2B2CA 3L0SA 2P0EA 4N3GA 4NJEA 2PS1A 1N36B 4KXUA 3FTQA 5JISA 1YI1A 2WF9A 4XLZA 1MPXA 5IWCA 3D43A 2EFEB 1MOSA 4RLSA 1PJCA 5HOQA 5KJ1A 4WN9A 3PT9A 5DGXA 3OFSA 3DFFA 2XB9A 4MRRA 4D9CA 4U02A 3S8YA 4AF7A 1W4LA 2EXXA 3NDIA 3PQDA 2FPOA 4N5MA 5FNVB 2X4IA 2KLHA 2RHGB 2MU1A 2V7PA 3GFRA 3ZVLA 2Z6QA 5L4NA 4DCUA 5AJYA 2V7WA 4B6QA 2GAJA 2ZDGA 4J4TA 2F1HA 2D5BA 3AC0A 1II8B 1U9IC 4FLMA 1YZ3A 2AF3C 1C4XA 5LP6F 4FXPA 1O6CA 2JRLA 3DCNA 4H3HB 4RD1A 1SKYE 3THSA 1PGQA 4D5EA 5JEDA 2FPPB 5LOVF 5M5BA 4BGDA 4BDTA 1E9CA 3NIWA 1MVLA 1SULA 1ODTC 3NEYA 3BE4A 2REQA 2Q45A 3Q7QA 2DG2A 2I6UA 4BO0A 4YONB 2B1IA 3TW0A 4G4SO 3WSVA 1XQWA 2AOXA 2XD4A 2XSZA 1AVTA 1M1UA 4FONA 3WWEA 3PICA 4TX1A 3QVXA 4Y2JA 4C3OB 5I4CA 2VTBA 1OHHA 1ZRNA 3A2KA 2BOVA 1Z6XA 4JMPA 4QHYA 5JO0A 1RJ9B 1MX1A 3QI7A 2H4ZA 1KFKB 2GEDA 1SURA 2PFSA 4I5GA 2V98A 2HQSA 2AN4A 3RK4A 4L51A 2K7ZA 3B6EA 2IVZA 2F62A 3K5IA 1GZVA 2WAOA 4ZIRB 2CUNA 5ARDA 3DE2X 1H1DA 3QKUA 2XGJA 5EIHA 3AW8A 4ML3A 3GEPA 3A9SA 4E4TA 3OUZA 1QTRA 1Y98A 1Z35A 3CH4B 4E70A 4NF2A 4DJAA 1DIAA 3MGAA 5B58C 1X42A 3BTSA 1RD4A 2VZ0A 4MGHA 3STYA 3QXJA 4OHOA 3SXPA 1NR7A 4I1YA 3TZQA 5H4GA 2VN8A 5BUZA 5EJ6A 1SUFA 3C6QA 5I51A 4WNIA 2PUWA 4D4GA 5D7BA 1BXZA 1Z6GA 2XMBA 4LOHA 1R4MA 2IDZA 1H8ED 4F3RA 1SZCA 3QPDA 1YS7A 3L8MA 5JSKA 1V0JA 4ZRNA 4DDKA 5K8LA 3TD9A 3C97A 3KTDA 3MCAA 1W5SA 3IESA 4J0HA 4JVLA 2F3RA 3WX0A 5AM3A 1TCVA 3SAJA 2MSLA 1EIZA 4OP3A 1FFBA 1SBCA 4KOAA 5EXTA 3DEFA 1RU3A 5F9HA 4OQFA 1JIVA 1DKQA 1T36B 2M6KA 3SDZA 1V4NA 1KYYA 1Z83A 3EXFA 3KSMA 4ENUA 1VRCA 2IRWA 1RHJA 1SUSA 2Q4DA 4M9QA 1YK1A 4GOMD 1FF9A 2EC5A 1O5TA 1E1MA 5HJ7A 1LRKA 4L0CA 1R0SA 2O6HA 1T0IA 2ZK7A 1VKJA 4K26A 1PFKA 4C0LA 4CEJB 1CUUA 2Q9CA 2VEOA 4HOYA 4RMGA 4QKQA 4NOMA 3LBAA 4G25A 4PAQA 4BNNA 3ZWKA 4BWGA 6ADHA 3DEJA 1ZM3A 1O8CA 4DIOA 5DXJA 5FUYA 2OV1A 1OXMA 3FWKA 4UNIA 2A3NA 2C7RA 4NSNA 1K3FA 5CIWA 2Q4OA 3WIDA 1E9DA 4G1EB 3AVWA 4O2BB 4HDSA 4LISA 3JQ9C 2J0QA 4I50B 3EPPA 3Q7TA 3NTQA 1W1UA 1WY5A 5E0OA 4E5DA 1WOYA 1JP7A 4KL8S 5KNBH 2GA8A 3KLMX 3PNSA 1PLLA 1VJ5A 2GT1A 1NDHA 1DFIA 4PGFA 4A0QA 1CS4C 1FCJA 3IXQA 3U17A 1COZA 2VQFB 1OWMA 4WSOA 2D2XA 5SY4A 1XEAA 2PQ0A 2QTFA 3ZPXA 1OYWA 4V1CI 5IULC 4C9BA 1E2NA 2HA7A 3W3AA 4FFMA 2GSWA 3D0QA 1X77A 2B1GA 3FDZB 3ZNPA 1C9NA 2J9XB 3ASYA 1U7DA 4L27A 1EBUA 4C14A 3M1LA 3HB1A 2AFHB 4PRYA 5IJAA 4DJJA 3KEQA 3OEHA 4MRMA 3UB4A 3K9NA 3V2GA 3LC1O 4KDCA 3PJGA 2JCSA 3DJFA 4GWKA 1DJLA 2JI4A 2IZ6A 3Q2KA 4HEQA 3T61A 1KF0A 4RFSB 5HRAA 2V4UA 4ZQGA 4AI6A 4FFBA 4OLAA 2AXNA 4Z4CA 3HSSA 3SX0A 3ZDAA 1SOWA 3IVMA 4XZ3A 1TJ4A 4R9NA 2NTNA 4HAIA 3S3TA 4ZALA 3LMKA 3SVLA 4E6EA 1SC1A 3QFSA 3IR5A 3AVYA 4C08A 2WAMA 4IZIA 2HA5A 4XJTA 3VYSB 2QTVA 5G4KA 4TPKA 2CMKA 1NW9B 4XX0B 5MFZA 3D81A 1DV1A 1VHTA 4CL2A 3ND9A 4WKOA 3HNPA 1D2NA 2Q5JA 1NSYA 4GEGA 3FA2A 2BGNA 1MP0A 1XWWA 2VEDA 3RT7A 1J1IA 1K63A 2NZXA 1I4DD 3VPXA 2NLOA 3WBFA 4CF4A 3OE7A 2IDMA 2D3TA 4WAUA 1LRLA 4DILA 1F17A 9LDBA 2P7HA 2J4DA 2Q7DA 3UHPA 4QBHA 4KYIB 5CYPA 3D3QA 3FIJA 2VYVA 4W4TA 5K3FA 4BO4A 4EJ2A 2WQ7A 1I4WA 3OLWA 4IDBA 3N2GB 4TLEA 1I9GA 3KRTA 3TAHA 4DUGA 3CLHA 2BHSA 2JFPA 1B1CA 3H9QA 1V8OA 2PTHA 1U81A 3LPAA 4RKEA 1KYTA 3KUDA 4I7EA 3QF7A 3SP1A 1G3MA 1QNFA 4IVQA 1TF2A 3WDLA 3PHLA 5FPQA 3RQSA 3U3JA 4JT8A 5DN9A 3I4LA 3RVRA 2XQGA 5YASA 3WYAA 5JC8A 2I2BA 2V6JA 1HDIA 2FMTA 1FFXA 1OBHA 3TRHA 3NEAA 5CCXA 5CVDA 1PW7A 3SXUB 1JEJA 1S2GA 4J2HA 1M0WA 2QW1A 5KKNB 2ODQA 1JUDA 3AEKB 3BH7A 2EERA 2BIFA 2PS9A 1YULA 2YJ4A 3KTOA 3QVGB 4I6EA 3IP1A 3A9VA 3OKAA 4A8TA 4E5NA 1UIRA 1UJBA 2DAPA 3INNA 3I3OA 4YC7A 3HU5A 5ESXA 3HWWA 1B0UA 2IYQA 2RJ3A 3ZJYA 3JVDA 5FFNA 1AJEA 4HB4A 1XMVA 3ZK9A 1XZQA 2CZGA 1ZGAA 5D85A 1OAOA 1PP4A 3IOBA 2DKFA 4A5SA 3ZQUA 2CB9A 1DIRA 3FGNA 4MB6A 2VG8A 4FOTA 1E18A 1FDIA 4DQVA 3AW9A 1Z15A 3LWNA 4QTXA 4B3JA 3JWEA 1JH8A 1HWYA 2P3OA 4PHGA 4ITUA 1WCYA 4EW3A 4KGDA 5CEJA 1IVNA 1DAPA 1GNQA 2A0FA 4F21A 5I47A 1XC7A 3GNLA 3MWGA 4JLOA 4Q7LA 1P31A 1L4KA 1WUIS 4LIPD 4QXRA 4B3SB 2WJAA 3QU7A 3E05A 3H5NA 2HB6A 2A9OA 3LBHA 4EITA 1F60A 5A4AA 1KMQA 3UV7A 4W5TA 5C8YA 3KV1A 2Z5VA 4NYJQ 3LIIA 5K0BA 5EZ6B 3L05A 5EMNA 3PRKE 1MT3A 2AKEA 4FBMA 1N2SA 5LQCA 5ITSA 2DKOA 5DK6A 4BLRA 1BE8A 3E9YA 4NOJA 2IQIA 1G8KA 1VQ1A 3OJ0A 3KEOA 3D0KA 4G85A 1QDUA 1B1AA 2EKDA 1K6IA 2J7KA 2O1SA 4LJ5A 4CMKA 5KNCA 1Z0FA 1E6KA 1TGVA 2B5VA 3IUBA 3NHWA 5ALKA 5EZQA 4WE3A 3REFA 2FZ4A 4OHPA 3ZGYA 5A9RA 5B7QA 1U6IA 1NLMA 1Y8ZA 1GNRA 2RE8A 2OB1A 1RYNA 4UMEA 1UC5B 1VM6A 2OESA 5I5GA 1U8CB 4TMFA 5F3WB 5EWMB 4CLEA 3BM5A 5CM8B 3TH5A 2V7GA 4Q66C 1U3DA 1QIHA 2PDAA 4L15A 5LJIA 4QYTA 1V39A 2J3QA 4DAOA 1W29A 2FNAA 3ZJ5A 3TQSA 3E5HA 2ZAMA 4JWTA 1L5QA 2IW1A 1FXWF 4PCAA 4KOEC 1O0CA 4X20B 1I2DA 2B2NA 2A59A 5DYYA 1GPJA 5AI0A 5FADA 2GA9A 1GOTA 1QGUB 2R8ZA 2W0MA 3IE0A 2G9NA 3HGTA 3AVOA 1QPBA 3RC1A 2ORWA 2YFKA 4D44A 5HILA 4BB5A 3EG5A 4O2AA 1PQ4A 1ZU4A 3DE1X 2IPAB 2VTKA 2RI1A 2OC9A 3MWKA 3MTDA 5A3VA 3UCFA 2YV2A 2BFEA 3GEHA 2AUTA 4RSGA 1YBMA 5EXDA 1O2DA 1PD0A 5U4XA 4D9HA 4QNNA 3FAKA 4Z4EA 1U1IA 4MR9B 2EF1A 4J2TA 3TOVA 3H87A 3C3MA 2OM6A 4CKXA 1EG7A 3BF7A 3NNSA 3WNCA 2DTXA 4M98A 4N39A 3SX4A 1C7QA 1FE8A 2YHSA 4QT0A 1XVAA 3QJYA 1EVYA 3G2OA 5CLHA 3GG9A 1YDGA 3NHUA 2TMKA 1NE2A 1X2BA 1EIWA 4U0JA 3X1JA 3UK7A 3P2KA 2ILTA 2H5LA 7GPBA 3L4KA 4K81B 1QMPA 3OJCA 4ZT3A 2X4GA 3ND6A 4DQUA 4DZZA 3VZDA 1XLTC 3INRA 2QT9A 4KAFA 5ULLA 1T0HB 3RYFA 4KBGA 4FNMA 3NT2A 2HF7A 3QEOA 4NBVA 3I3SR 5IJZA 1OZ0A 3M8KA 2WT9A 2C95A 4XM0A 521PA 4LQLA 4ND8B 4IQFA 2PKXA 2XOKA 4PG7A 1ZIXA 5C3MA 3VKGA 4GVXA 4E13A 2IX9A 3MGBA 5JNUA 2PM8A 1QGED 3ABSB 1YRLA 4GWLA 3FUVA 5JVDA 4GUAA 3CH5A 2OA0A 3DE6X 4HQ0A 3RS9A 3RC7A 1ZI9A 3QBTA 1K7SN 3QFHA 4IIJA 1NP3A 1XXHB 4G5GA 1JXMA 4NBSA 3OLXA 1GKUB 3WOHA 2CLLB 1W4RA 5JS2A 3UG7A 1Z0KA 1JWLA 4L28A 1K8XB 4QHSA 3D6JA 1CIJA 5I9LA 1E2QA 4BKUA 4FMPA 4F5DA 4Z7OB 5COQA 3K09C 1E69A 4LK3A 3NXSA 2WINI 3KHSA 1P80A 3TRJA 2NO5A 2IHJA 1ZJWA 1XK6A 3ZLJA 4PFKA 2X9VA 1T5HX 2HGSA 3K92A 1QIKA 2VP9A 3H1EA 4TKLA 3WYCA 4XSVA 1SU4A 3GJ4A 2JVKA 1EE1A 1W73A 3DBLB 4IIHA 3CZ9A 4OHVA 4QWWA 1LWNA 4BO3A 2EIHA 5KPDA 1GUBA 3WAGA 2JFUA 4XGNA 3TXAA 5ECWA 2I8LA 3H8SA 1QP8A 5T3UA 5I7UA 1QKJA 4C7OA 1CEXA 1VRVA 3ND7A 1RLUA 3NPAA 4TZKA 4OXRA 4YQYA 3G0HA 1ONBA 1E2GA 1LJLA 4HH0A 1NFRA 1XRRA 4WA8A 4KIFA 4YREA 4ZZ0A 3H0CA 1Z0UA 4OHUA 2PCJA 2WSSA 3OJFA 4TMTA 4X9XA 5CT4A 3AEXA 1NWHA 3HZOA 3TFWA 3U3ZA 5CA1A 3GG2A 4XVUA 2GX6A 4TTQA 1Y7PA 3LOPA 3WK9A 2XE8A 4I81A 5GQSA 1K4MA 4LF4B 1RZ3A 4KXFB 1QF9A 4O4HA 3I83A 3O5AA 3KSZO 3IQFA 4PWYA 4ZVMA 3L1HA 2QRGA 3K0AB 3O31A 3TL3A 1QRUA 2LKDA 4K9LA 3QKRB 5AI4A 4YH1A 3EXHC 2YYAA 7AT1A 2GERA 1ZYUA 1NVMB 2Z2YA 4ZEXA 1X0VA 2WJZB 4HUQB 3WRXA 2EW2A 1HNWB 2DTEA 2H2HA 3U3MA 2C0PA 5CFMA 3GHHA 3VZCA 4LI3X 3K70D 3DLBA 4F3KA 2A5LA 1GEGA 4PTZA 4TS3A 4YALA 1I30A 5KHAA 4B17A 3VNBA 1KQNA 3NTUA 1JQLB 4COOA 1VJTA 3R1IA 1TGYA 4HD8A 4OQQA 3QMWA 5L40A 1ORRA 1TK9A 3ZX5A 5IBQA 2X5KO 4ND2A 3WWPA 4EHIA 4Y1FA 1QHHB 4RTKA 5BV0A 4BBJA 3CLVA 1B76A 3SZMA 4OKSA 2WSYB 1ZAYA 3VHRA 4JYMA 1W0JA 2RIRA 4RFLA 5F98A 4JU9A 1NKVA 4RDIA 1IFXA 5A3QA 1JKIA 2B7LA 5CCBA 3S5JA 3P0HA 4RTQA 1WHTA 3SG0A 4IUYA 4JVSB 1RP1A 4FFRA 1PJ4A 3B1JA 3B3GA 2ERYA 1HPLA 1EU1A 1LGYA 1SJ9A 3DYBA 3GJ5A 3GLHB 4PHFA 5K3DA 5ED4A 1CFZA 1U8EA 1B6GA 2AMLA 1Z5UA 2G76A 2CYBA 2GPTA 2IHVA 2QZ4A 2ZR8A 3FLMA 1TQ2A 5ECDA 3W4IA 1C3EA 2XB6A 2IEDA 4NCKA 3I6IA 5CB4B 3B8EA 3PXGA 3UHAA 4CL8A 3NHBA 5LXTF 4D82A 3V8QA 1OTHA 2GEUA 3DQZA 3HBNA 3PI6A 3L8DA 3TOZA 1OGJA 3ETCA 3QELB 4PC6A 4AZ3A 2XTNA 4J3FA 2D7CA 2YNMD 2ZIEA 3CKKA 5B4TA 5AK0A 3B5IA 5IX8A 5H3CA 2VNKA 3NBAA 2VPPA 4WPGA 5GGXA 4YRNA 1P9RA 1YHNA 3C6MA 2P9TA 3HWSA 3OQNA 1M72A 3MELA 3WGQA 4LE2A 1BDMA 3DEIA 4YRJA 5IBCA 1MEOA 1G5IA 3VH3A 3ORQA 1USUA 2QJTA 3IT3A 2IYLD 4QUAA 2XMZA 4AY3A 2NT4A 3OSUA 4D3YA 2DFLA 3TMYA 1G8GA 2NACA 2WM3A 3GJQA 1S8AA 4OL9A 3B52X 4ZT7A 1ZCBA 3EXHB 1R3DA 1RZUA 2P9JA 1W581 4MYRA 2ZUBA 1D4FA 3OJWA 3RUHA 2XIJA 5J2UF 1UZLA 2PFKA 4NCNA 4GOJA 2NN3C 2BSAA 1LPPA 4G07A 5JW6A 2QPOA 3WMFA 4IUCS 3GDWA 3C1UA 4OHCA 2JFYA 4HGYA 2BFFA 5MDHA 4HAXA 3L4JA 2C58A 2J8ZA 3CF0A 3HKBB 4DY4A 2OZLA 4RTPA 3I9MA 2Y6UA 3VM6A 1VFNA 5CT9A 3UKDA 5ALTA 4BMXA 3KCNA 4TL8A 2YWRA 3EDOA 4YUVA 2EKBA 3U37A 4QDUA 2AWNA 4LNHA 3VMFA 1YIDA 1EE9A 1MENA 1E77A 3GOQA 1C0PA 1KETA 4E2WA 1P45A 1HYBA 4P33A 1NT4A 1LLCA 1UBCA 4RDXA 4UTPA 1C7IA 2Q4EA 3ZWCA 2AFIE 3E1SA 5C1BA 1NJFA 2A5GA 5K0NA 1E2KA 4AZWA 1KTIA 1KRWA 2V7QA 3C45A 2AC2A 2C07A 2HUPA 1U6JA 3FWHA 5C7YA 2CJXA 1J2JA 2YVUA 3BG5A 1MO3A 4M9SA 2NX2A 3T7CA 1RYMA 4Y6QA 3SFTA 4TWRA 4KQWA 4J0GA 2WKSA 4OI1A 3IEPA 4BL5A 3KZNA 5DK4A 2DUMA 1D0VA 5IMBA 5F52A 4MVYA 2RD2A 2QY9A 2C03A 4KQGA 4E1VA 4O5AA 5JCXA 1N2GA 2X5OA 4DOMA 1VHWA 3TLZA 3MEQA 2F48A 1H6CA 2VL7A 3BWCA 4PYKA 1F4LA 1P2GA 1O58A 4YCDA 1G7TA 1QONA 2O4UX 3MGCA 1GGFA 2GN6A 4NQRA 4D74A 1RXWA 1XPOA 3F96A 2GBLA 5ERGB 4J90A 4UXIA 2WICA 1JT2A 3WHIA 3B2EA 2GZSA 2C5GA 4ILKA 5DSZA 3ROKA 3L07A 3ZHXA 3VSAA 5EA2A 3TBHA 3GQBA 2Y0BA 3I42A 1JZQA 5E3IA 3WGKA 3EVCA 2X6TA 5C32A 1CPYA 1GN9A 3BZUA 1CHNA 2GRJA 1LY1A 1CSEE 4UEQA 1MAHA 4NMLA 3KQUA 2E4ZA 2FR8C 4MWGA 4LV8B 3TEFA 4QC2A 4KNYA 4QFBA 3SNHA 3TQOA 2GZRA 3G2LA 1B14A 1TF5A 5DM1A 4Q4AA 3OM0A 1X8LA 2GVDC 2Z8YM 4HJXA 5BW6B 4MEJA 3LVQE 2HDWA 5A7GA 2DLCX 1RBQA 1WSWA 4F2DA 4QOSA 3PFCA 3KCQA 2XQJA 4Y6LA 1T4BA 2VJLA 4FFPA 5KNBA 2IS2A 1XN4A 2B4KA 3DTTA 4FYWA 4Q4JB 3M34A 5FBZA 1TFRA 5B1YA 5D01A 1E6LA 3TD6A 4H0CA 5C18A 1RSZA 5DM70 3OFNA 1JYSA 5LKRA 3T7JA 3W90A 3ZDDA 3CM0A 4E30A 4Q9NA 3GRPA 3NTLA 1HX7A 1Q5PA 1EBBA 1T24A 3SFVA 3RADC 2ET6A 3V7FA 1XTUA 1IEQA 1KDOA 1F1BA 4CWAA 1Q92A 3FCCA 3QLUA 1A7UA 2D0DA 3JALA 3ETLA 1FU7A 5HE9A 4P82A 2JPDA 2RGDA 2J3KA 3NHZA 4LGVA 5JG7A 3UT5A 1YOBA 1CUHA 4GBMA 4O4JB 1ZH2A 4LVOA 5CYFA 3UXYA 1CQIB 2VHYA 2YH2A 4FE4A 4B5KA 4QYMA 4ZMBA 3JW8A 1M0EA 2IH4A 3G9UA 2DHCA 4MLCA 2X1LA 2ATEA 2Q6TA 3AERA 1UOOA 1FYVA 3C24A 3FOCA 4WXEA 3E84A 1BMFA 4MQLA 5BMVA 4DCMA 1U8FO 3DL4A 1IXSB 2KYRA 3ESAA 1OOEA 4DV5B 3I8XA 4K9SA 1AHIA 5I48A 4EGCB 2C83A 1QQAA 1GGHA 1GZHB 4OKIA 4YAWA 1WL8A 2Y1XA 3VPSA 5IG2A 2X4DA 3L7AA 3D7LA 3TTWA 1AKNA 3AJ9A 3WLMA 2L19A 1IUNA 1Q2UA 3B78A 5EP3A 4QE3A 4ETWA 4CQMD 1AUPA 3SYRA 3DTVB 4E2XA 4UNNA 2FQQA 5ER6A 2Z6UA 2C4MA 1HOTA 3U40A 5BVGB 1PZEA 2JVIA 4OYHA 3EVBA 2YFHA 4QQRA 3LPCA 4UNPA 1Y9DA 1BS9A 4FFSA 1W2GA 4TMVA 2C77A 2NPIA 2F9MA 2K5UA 3FTPA 2ZJFA 3PD7A 4OQNA 3B48A 3A2NA 1ISJA 1L4NA 1M2HA 1P1RA 2VIIA 3AHFA 1LS1A 3W1VA 3CVOA 1DBPA 1L5HA 4KKVA 4M0FA 2R8EA 3LYLA 1F7VA 2VJMA 1SWVA 4D8UA 3VZQA 3K0CA 4ZEWA 3TB6A 1EM8B 3UF0A 1RYFA 2CFSA 3A06A 5ICEA 1NC3A 3GGPA 1J2UA 2PH5A 1LLFA 5JD6A 2QQ0A 2Q5FA 5EIAA 4TVSA 3IT0A 2QLBA 2C92A 2BFCA 2PKCA 4N3CA 4N7RA 1P77A 4LOKA 2UZ4A 4TWZA 4MJ3A 3WY9A 1UJNA 3UA3A 3AP3A 3ROPA 1G41A 2GNPA 3RVOA 5THKA 1Q0SA 2JLSA 4XYLA 5JH7B 5CB6A 5HFAA 5JCJA 3VR4A 1U3CA 1SD5A 3SEFA 3V2UA 4RA9B 1C50A 1W93A 3ZZ1A 4ENRA 3LV8A 1UT8A 3FBWA 1FRQA 4DA4A 3EOAI 2OXRA 3T3MB 1NMXA 3L0YA 2CMHA 5HZMA 1JLMA 4E14A 1AU9A 1OIVA 2IUFA 1JDPA 1YBAA 3HA3A 3HRHA 3N59A 4FCCA 4EG3A 1M2KA 1N1EA 2BSXA 4HZGA 3RU7A 3N2KA 4IIBA 2ZUVA 4EJSC 1ACJA 5H80A 2CLSA 3RWBA 1EQUA 2CBXA 3HKDA 3B60A 4X3OA 5JDCA 1IIBA 4LJYA 1QB8A 2ZT7A 4UVGA 3C5EA 1X1AA 3VR0A 1NR5A 1OA1A 1TUBA 4YRIA 4R0VA 5IH7A 1WW3A 1SWWA 2RG1A 3FOWA 4EX6A 3LHKA 5JXWA 4Z1MD 1KL7A 2P2NA 3ORSA 2DHQA 4UJ3A 5F64A 4P4LA 4DC1A 1K92A 4EI8A 5JECA 4N12A 3U3DA 1SBYA 4D42A 2V6FA 1ZLYA 1KOFA 2ZB4A 4Z9BA 1Y9JA 1Z5ZA 3JWGA 2AHOA 1TPYA 3AL3A 4PTYA 3V8VA 1XO1A 4R71A 4AJPA 2O07A 3KQHA 4YDQA 3U39A 5ALOA 2K7FA 1RIFA 1VPLA 4LOJA 4OH7A 2P4HX 3R20A 1SVWA 3ZDZB 3FYSA 1GAXA 2ATCA 2I8AA 5A3RA 2I0FA 2PPVA 2Q6VA 2YV1A 3Q7EA 4FZJA 4CLOA 2AH5A 4GLJA 5JQGB 5KYGA 2H11A 4ITRC 3QOWA 2PUTA 1J4AA 4R2JA 4BV3A 1W49A 4JUIA 4OQDA 3ZS9A 1IC6A 1Y7TA 2XX3A 3ESBA 3LT1A 4MKIA 5SZHB 1RXUA 5BV7A 1NMYA 4LC0A 5B4VA 3IUJA 1TC2A 2Q9UA 3KVNA 1DCMA 3MRTA 3R24A 3OJLA 3NC0C 4QYXA 4DJEC 1Y34E 4CIYA 4LNUB 2J6IA 1X7XA 5B36A 4QXAA 2P5TB 4GC5A 1KAMA 2AJTA 5I7EA 2QI9C 2FWIA 1WPXA 2BJWA 1D1TA 2IHZA 3R7LA 3EDCA 3PD0A 1G1AA 2HL6A 2C7PA 1JS1X 2H18A 1SXQA 4GF5A 3UH1A 4COKA 4A6DA 2AFIA 3GIDA 2RI6A 1NASA 1WO8A 3Q5EA 3QXHA 4FX2A 3VISA 1YVEI 4CQNA 2R68A 2VHJA 3CWQA 1R12A 1GSOA 1W19A 4EZIA 4LRTB 1QBKC 2DVMA 4ZREA 5LQUA 4DR3B 4YPFA 3OJOA 2NO0A 3H4MA 2PUAA 1CERA 3EXEA 4IGKA 3G02A 4BFVA 3K0HA 3LP5A 1TC1A 1WB9A 4LYEA 1LF0A 2HA0A 1QTIA 5EMHA 2F55A 4LZNA 2ZSHA 2PK3A 3ETHA 3F3MA 4EJSB 3G0IA 3A3KA 1L5SA 1X86B 3GH1A 2H1WA 1GJRA 1JYFA 4TWBA 4C7VA 1DV2A 4DAEA 4GKAA 4F97A 2DUUA 3QZUA 3HCFA 1D0SA 3A1NA 1QLHA 2HMVA 4GOOD 3KQSA 4XGKA 4RTJA 2CJFA 2QN6A 1P8JA 1I94B 1YHYA 2GJKA 1GV1A 2EFYA 2QVYX 4H77A 4RLFA 4REQA 5BURA 3F5QA 3GLUA 4PLWA 2HU5A 1G2PA 1PGJA 2ZIZA 4B6GA 1JGTA 1Y0BA 4L9AA 5TJHA 5KOHB 3H2JA 4OHBA 3KDPA 4RHFA 3NAMA 3IERA 4DRZA 4IV0A 3MK31 4H1UA 4XLTA 3QVLA 5LA6A 4DQDA 3RJ5A 1QGYA 3RVJA 3SR3A 5CITA 9LDTA 2OKCA 1OYYA 2XKKA 2I5PO 4F04A 1EM6A 2Q1WA 2ZBDA 3CW8X 3GLTA 1W25A 1KMNA 3G49A 3WMGA 5BNTA 2CUZA 5I7AA 2IHNA 1Z5GA 3GA7A 2PWAA 4GSYA 1B4DA 1PZMA 4IDCA 4BVGA 3REOA 1O95A 5IT4A 1ORHA 1ZMXA 1I10A 5HUHA 1KSHA 2X8JA 5B1DA 4B48A 2UAGA 3WXMA 4GOLD 2RH8A 5AJTA 3U44B 1N32B 1IAQA 4RABA 2WTAA 3CRRA 1BXKA 2RAVA 2P2LA 4RHXA 5HIAA 1XEWY 3UWPA 3UENA 3DF7A 3T6KA 1RI3A 3VZRA 1XNQB 4O2RA 1WS6A 2RHTA 5TPZA 2XXJA 4FI3C 5C80A 1X74A 5LDGA 2OORA 4MICA 4UBMA 3JQCA 1ECFA 4DT1A 4Q00A 5LB4A 4RLHA 4A7PA 4EAAA 2B94A 1PF7E 3HCRA 5DBIA 3FUXA 3OLYA 4HP8A 4WOKA 1INLA 4HQFA 1OLXB 1E3WA 1R5OA 1LI5A 3HCEA 4OYYA 1GPNA 4H15A 3DHNA 4FHEA 3VDMA 1NBEA 5KQPA 4KWCA 4L4SA 4U63A 3IQZA 4XPIB 3GO4A 3HTXA 2RGXA 2AN5A 2ZVDA 3PHIA 1MJFA 2BEWA 4FKMA 1OYVA 3MVEA 5DLYA 3HY6A 1CD5A 3BD7A 1JXAA 2DX7A 4BNJA 3VR2D 2ZRNA 1RTKA 3NP9A 3L6UA 4U2CA 2OXEA 3WR5A 5I7RA 1J8QA 2HWKA 5CCEA 4BVJA 4GPAA 5K9ZA 4WDQA 5A5GA 3H5AA 5JJBA 3BE5A 4YWHA 3L40A 3EHDA 1UFRA 3RSOA 1XVUA 4YCAA 5TY0A 3KQMA 4B40A 2KLBA 5A0TA 4TKVA 3KOXA 5LP1A 3ABIA 2HRDA 2FMIA 3IGFA 4ZOEA 3GLFB 2JLZA 3IIJA 3AM4A 3DZCA 4UBOA 1F2UA 1P0IA 4YJ2B 3KETA 3L7NA 2ZIGA 3N2ZB 3OPYI 3UK6A 3ZG6A 3AVPA 1DKPA 5FBWB 4ER5A 2FZVA 4II7A 1R4NB 3NW9A 5A5EA 3MWDA 5UKDA 3IXLA 3AJDA 4LZPA 5AK3A 4K9KA 3H97A 4YV2A 4HXGA 3SC2B 3CY6A 3DLIA 2AQ8A 3T4XA 1J9EA 3OEED 2LD4A 4RENA 2FX3A 1JMYA 4CG0A 5LIRA 1IE3A 3LY5A 1A8QA 1X1TA 2CL6X 4MVJM 1TNDA 1VBNA 3DC7A 4MPTA 1E60A 4PO1A 3WYBA 3HKCB 1GA6A 1QIGA 3NWEA 2PMEA 4B43A 3T7AA 1F2DA 5FWXA 4EF5A 3BRSA 2BH2A 4BUJA 4I8XA 2PJZA 3F49S 3BGWA 4TVOA 4WADA 1V3UA 4B4VA 1DG1G 5F3DA 5HDQA 3PDIB 1J8YF 2GYVA 3DMFA 5TPWA 5A4MS 3E03A 4JASB 4YMLA 3T8YA 1AM4D 1S3GA 1UBNA 5HHTA 3WWOA 2A0WA 4J9UE 5EP1A 2NUPB 1BX0A 2W2LD 5C4GB 2RBKA 5DZSA 3E27A 2I4OA 2YVLA 2C7OA 1FX1A 2Q8NA 1NVXQ 2MT9A 2Z2KA 1VJRA 3KDAA 3ZU6A 4JT9A 4NMHA 4Y1RB 4IVRA 5L3QB 2XXAB 3OWXA 4IIFA 1KE2A 2YR0A 1TT5A 3OO0A 3DVRX 1WUTA 3VR5D 4HH3C 3ZQ4A 1KFJB 2BGRA 2PYZA 4F3YA 2QQFA 3MTJA 1RKUA 2ZROA 3F9CA 1JPNA 1MRNA 3K16A 1ZD4A 4G1MB 3ZZNA 3ZE2B 3FB4A 3LECA 4LHEA 4QBGB 3CW9A 3DCIA 1FEZA 3W5VA 5MN6A 4EUSA 1KFCB 3GA0A 4D02A 2FB9A 5MGBA 2X9QA 3P9ZA 4KN9S 4WFIA 4DXDA 1M2VB 2CNDA 3B38A 5CCDA 4G0NA 4AJKA 4Z9XA 5EESA 3UK1A 1GPDG 4YNBA 1C4OA 3ELWA 3L6OO 2JRCA 3R0XA 3JY6A 5L3RA 4EGJA 3EGIA 1Z22A 3ZU2A 1BVHA 3GT7A 2R7KA 2HSGA 3D2CA 4MVJD 2SHKA 4C6HA 5KHOC 4WKBA 1WBDA 2UXDB 2B25A 5BT8A 5HYVA 1KJ8A 2NTEA 4LKOA 3MBKA 4UTVA 2O0HA 4D57A 2ZM5A 1DHTA 1UT5A 1BEZA 2B7CA 4KXMA 1KKUA 4AT1A 1DUSA 2WAAA 3DO6A 3W8FA 4Q4HA 1A1VA 2Y93A 1P60A 2X1MA 4X61A 4JY7A 4CFZA 3BJEA 3DQPA 4NMWA 3KLNA 3QBJA 1SQFA 1E0SA 3HCPA 4Z8YA 4P4SA 5H70A 1QFMA 4E33A 4EPYA 2J5QA 4IEIA 2P2SA 3C85A 1EFDN 4BNKA 2ZPUA 4TM7A 1UFOA 4AZ0A 5LZ4A 1Y8QB 4MUNA 3ELUA 2HO4A 4QIHA 4EBFA 3TPFA 4H7JA 4B35A 1WMAA 3GMTA 2GRAA 2QPTA 3H6HA 4FFWA 1MW8X 4BLSA 2GFIA 3EAGA 4RWEA 1VBMA 5FTJA 2WMDA 1G17A 2B3TA 2R87A 4PHHA 5G1OA 1UBJS 2CXUA 4KCGA 3LQ4A 3SR4A 3Q2IA 1FTNA 3ENWA 4NAHA 2NO1A 1CF4A 4N3NA 5LZ9A 2QRHA 3LM8A 2P2DA 3T5PA 1G8HA 3R09A 4GX0A 3T9BA 1CR6A 1P9OA 2QX6A 3AR3A 1P3JA 3IUMA 4JJFA 3ZXIA 4EDFA 4CM4B 4CM8B 3AILA 3OQIB 2WZQA 1DARA 1G6HA 4ECAA 2H59A 3AV0B 1A9SA 1G20B 2F1JA 1PVVA 1D7OA 3KT0A 1JEEA 2A30A 1DPFA 3IMGA 5KVCA 3EZFA 4QOJA 4K6OA 3A1DA 2DR2A 3AXTA 3FLAA 1Y89A 3L82B 4KBYA 5IKOA 5J9FA 3JX9A 5G0TA 5BRNA 3X1MA 3FFXA 1Z4JA 5EFZA 2WWWA 2J9RA 2ZSJA 1Z0JA 3SZUA 1KH3A 1Q7TA 3E53A 4O25A 2MSDB 3UMSA 1JYEA 2ROQA 1J9GA 3UN1A 4BMVA 1PFUA 5AW1A 2A4MA 1I0ZA 1RKXA 3LUCA 4CEHB 4M22A 1NI3A 4F3TA 3UC9A 4UULA 1GZ4A 2WWIA 2P9FA 3DPSA 4JBLA 1CY4A 3DP7A 2FFBA 4E5UA 3R0IA 2IL1A 5HG0A 5K6AC 4J7XA 2F1KA 5EWJA 2UVPB 1MT0A 3NC1