3O31A

E81q mutant of mtnas in complex with a reaction intermediate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
264
structure length
264
Chain Sequence
SCYIYWDKIKRIASRLEGMNYHFDEMDTSGVMPLLDEIEEIAHDSTIDFESAKHILDDAEMNHALSLIRKFYVNLGMKLQMEKAQEVIESDSPWETLRSFYFYPRYLELLKNEAALGRFRRGERAVFIGGGPLPLTGILLSHVYGMRVNVVEIEPDIAELSRKVIEGLGVDGVNVITGDETVIDGLEFDVLMVAALAEPKRRVFRNIHRYVDTETRIIYRTYTGMRAILYAPVSDDDITGFRRAGVVLPSGKVNNTSVLVFKCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of thermoNicotianamine synthase with a synthetic reaction intermediate highlights the sequential processing mechanism.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Biosynthetic protein
molecule keywords ThermoNicotianamine Synthase
total genus 98
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03059 NAS Nicotianamine synthase protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3o31A00
2NXEA 5K0CA 4ER0A 4DCMA 2YX1A 4YUYA 3FTFA 3IYLW 4MQ4A 1JQDA 2GPYA 4X60A 3DLIA 5DX8A 5KS2A 4DA4A 2I9KA 4EK9A 3TOSA 4JXJA 1SUIA 3VC2A 4WXHA 4F86A 3EGEA 5BW4A 5KQSA 3OZTA 3G2PA 1TPYA 3BGDA 5ERGB 3HCDA 1AF7A 1IM8A 2DULA 3FUWA 4E33A 1FP1D 1UFKA 2ZCJA 3PFHA 2HV9A 2ZIEA 4PGGA 4M38A 3TPZA 5LQNA 2ERCA 1RJDA 3BGVA 3DULA 3P9CA 2IBTA 3TLJA 1KPGA 3ID6C 1F3LA 3I9FA 5E1BA 5HOQA 3LGAA 5HIMA 4RTOA 1NBIA 3FRHA 1KPIA 8MHTA 5EKUA 5IKMA 4EQZA 2IPXA 3DR5A 4KRGA 2AOTA 2DPMA 2EFJA 1VIDA 2PX5A 2PY6A 3MTIA 5IH3A 3ME5A 3SSOA 5K05A 2I62A 3PFGA 4G56A 4E2ZA 4YV2A 3BGIA 4XUEA 1JTFA 3HA3A 5T67A 4RVHA 4AZVA 5E2BA 4LECA 4F85A 5FTWA 4CWAA 3EGIA 4EKIA 1YF3A 4KIGA 3KR0A 2Y1XA 2OY0A 3DP7A 2PX4A 3UJ7A 1XJ5A 3EVGA 4KVZA 1SUSA 3QV2A 3SVZA 3ER9A 3EPPA 2OYRA 2YVLA 4GOLD 1BC5A 5EZSA 2ZW9A 3G2OA 5DT2A 2P3QA 5F2NA 1BKYA 2JHCA 1RI4A 1FP2A 3KU1A 5GWXA 2PV0A 1D2HA 1EJ0A 2A14A 3UJBA 2ZIGA 4MWZA 5KQRA 5LQKA 3FPJA 3I53A 4HH4A 3ERCA 1G38A 3EEYA 2IDKA 2XYQA 4ER3A 2GLUA 1WS6A 1M6YA 2AVDA 1P39A 5E2AA 3LDGA 3FPFA 1G8AA 3HCBA 1JSZA 2B9EA 4HRAA 5E8RA 5K0BA 4YV1A 2HWKA 3LSTA 3LBYA 1KHHA 2AOUB 2ORED 1VP9A 3MTEA 5ICFA 1YFJA 1VQ1A 4R6XA 1TW3A 4QQKA 5FHQA 2ZZNA 3EVCA 3OE5A 2ZULA 5BP7A 4YUXA 2ZBPA 1G6Q1 2Z6AA 3E23A 3G2QA 2UZ4A 1D2CA 4GQBA 4R8RA 5DXJA 1X1AA 3KQYA 2XVAA 3P8ZA 4BY9E 5E1MA 3PVCA 2ZZKA 1DL5A 1WG8A 2ZWAA 4HTFB 3EGVA 4R6WA 2PXXA 5DSXA 5EIFA 5C9ZA 3KKZA 5ICCA 5FULA 1L1EA 5U4XA 2CL5A 4V0RA 3S68A 3BWYA 4OQDA 2HR1A 3O7WA 4AZSA 4E70A 3GGDA 3KQOA 3SX0A 4RWZA 1QZZA 3FYCA 5LQAA 2VDVE 4KW7A 3PTAA 4IV0A 2ADMA 2EX4A 5EMJA 5K0NA 5GOZA 2NXNA 3TR6A 3P71T 2ZVJA 3HNRA 2AZTA 1SQFA 2FK7A 2F8LA 4BLVA 1G8SA 1R8YA 2HNKA 4RVGA 4EVIA 4RTJA 2NXJA 4OA5A 2V74B 1PJZA 1MHTA 5F2KA 1RJGA 3DLCA 2O0LA 5D1NA 3NJRA 4P58A 4E31A 5FWDA 2QM3A 3TRKA 5DTRA 2JJQA 4RVDA 2BR4A 2YXDA 4C05A 4UOEA 3G8BA 2IH5A 3KHKA 4AX8A 2B3TA 5HIIA 3HCFA 1BOOA 2PSSA 3BWBA 4GOND 3C6MA 4E2WA 3OPNA 3VSEA 4RTMA 1JQEA 4R8SA 1NW7A 2WA2A 4HGZA 2IGTA 5K0LA 3FUTA 4U7TB 3TKYA 3UJDA 4CKEA 3C3YA 2OZVA 3SSMA 5K0JA 4KIFA 2G70A 2H11A 4PCLA 3UA3A 5DLYA 1EQAA 3M6UA 1QAQA 2XVMA 4DKJA 3JWJA 2Q41A 3B5IA 2Z6UA 3MAGA 3ELDA 4RTRA 1QAMA 1Q0SA 3PX3A 5CVDA 3CJRA 2IDJA 3HCAA 4C08A 1N7IA 1O9GA 3DTNA 4FT2A 4XCXA 5BXYA 4X1OA 4QTTB 3GRVA 4Y30A 5DTMA 4WVLA 3QOWA 1X19A 1Z3CA 3FUVA 2GA9A 3KR1A 4PYMA 2IIPA 3MB5A 1UWVA 4FGZA 4PIPA 1L3CA 4R05A 1WY7A 1JTEA 5DM1A 4V0QA 2IFTA 2YTZA 3CGGA 5EIWA 3QOXA 3V97A 2P41A 5LSAA 4RTPA 2YXEA 3CC8A 2GS9A 1SKMA 1VE3A 2AOVA 2OBFA 3H2BA 3NMUF 3P9NA 2C7QA 3HVJA 2O06A 1SVUA 1JG2A 2JHPA 4C04A 3GCZA 4YMHA 5KYGA 3NVKI 3NWBA 3RIEA 4PCAA 2VZ9A 5K01A 4RTQA 3FUXA 4OBXA 4PONA 3Q87B 3KPYA 2PT6A 2G1PA 2K4MA 4QTUB 4RTSA 2LD4A 2P1DA 4GF5A 1G55A 1EJ6A 2ZSUA 3HVHA 5E1DA 5CVJA 1NBHA 3O31A 3PS9A 4OX9Y 1U2ZA 5GINE 1R74A 1FBNA 3KPJA 4QQNA 4KDRA 1AQJA 5FCDA 3UJ8A 3UJCA 3GXOA 3G5LA 2BH2A 1NT2A 3P97A 5D1HA 3FUUA 4GC9A 2B2CA 5DXAA 3GRYA 3KPWA 4LG1A 3UZUA 4EKGA 2QRVB 3LDFA 1NW6A 4RTNA 2XBMA 3HA7A 3HM2A 1IXKA 2PGXA 5ICGA 1QANA 1XXLA 2ZWVA 3IV6A 3T7RA 4FZVA 3D2LA 4RSRA 4QPNA 2PX2A 4B17A 3DUWA 1G60A 3OZRA 2YQZA 2AN5A 1WXWA 5K03A 2C7RA 3TKAA 2JG3A 3PT9A 5CIYA 1HMYA 3GNLA 3OU2A 5FUBA 3X0DA 1RJFA 3G88A 1RI5A 2AN3A 4HGYA 1XDSA 1SQGA 1P91A 1OR8A 1XTPA 1YB2A 3GRRA 4GEKA 4IV8A 4X41A 2C7OA 2UYQA 2H00A 4RV9A 5HEKA 3OE4A 2ONYA 5EVJA 3TM5A 4Y2HA 3NDJA 2UYHA 3DMFA 2P40A 3LCCA 4A6DA 3U81A 4ER5A 3P2IA 5EMLA 3LDUA 5HILA 3DXXA 4RTLA 3B89A 3B3GA 2PBFA 3Q7EA 3BWMA 5E8JA 3ELYA 5F2OA 3OFJA 3PLAE 3M4XA 4U7PB 2QRVA 5FQNA 2XYVA 2AOUA 4PIMA 5JUWA 3VC1A 3C6KA 2AOWA 4DF3A 5DSTA 5DM2A 3ORHA 1R6AA 1PRYA 5HIJA 1UIRA 1ORHA 4P7KA 3HA5A 5DWQA 3BWCA 4OA8A 2VP3A 1JSXA 4C03A 2JH8A 4PINA 2EG5A 3P2KA 1F38A 2AN4A 3SSNA 4QDKA 1INLA 1AQIA 2GB4A 2I7CA 5EOVA 4BLWA 4F84A 5CD1A 4E30A 3OU7A 2IH4A 3M6VA 1XDZA 5CVVA 5M5BA 3KR2A 3CKKA 5GIPE 1NW3A 3PB3A 2VDWA 4CXMA 1ZQ9A 2V7EA 1QAOA 4H0NA 1RI3A 4O29A 2ONZA 3EVAA 4PYLA 3CBGA 3FPEA 4FT4A 4PYOA 1XCLA 3IEIA 3MCZA 3MGGA 1YZHA 1D2GA 3OCJA 3LCVB 5HIKA 5JR3A 3T7SA 2GH1A 3I64A 1NKVA 3A4TA 3FPHA 1JG3A 5K09A 1X1BA 4DQ0A 3RW9A 5EPEA 3C0KA 3SGLA 4CKBA 1RI1A 2IH2A 1R18A 3AJDA 3K6RA 3LECA 2Z6QA 1NW5A 4X61A 3EVFA 3NDIA 2QE6A 2B78A 1TW2A 2GAFA 1JR4A 3JWHA 3TFWA 1EIZA 2AOTB 3P2EA 2O07A 3CJTA 4PYNA 3UFBA 3VYWA 3LCUA 2OPBA 3KQTA 5DTQA 2C7PA 4HTFA 1O54A 1R8XA 2P3OA 3GRUA 1WXXA 3KQPA 5CCBA 1NV9A 3SR4A 3KPVA 1I1NA 3F4KA 4P7GA 3UA4A 1P1CA 2FK8A 3T7TA 4ATNA 2EJUA 4HG2A 1VLMA 1H1DA 2PX8A 2ZTHA 1RI2A 4ER6A 5BW5A 5FA8A 3R24A 1ZG3A 4CKCA 5HZMA 2HTEA 2PKWA 3HEMA 3E7PA 2YUIA 3FPGA 3DMHA 2P7IA 2YXLA 1P1BA 5CVUA 5GM1A 1N7JA 3OZSA 2ZFUA 4DCGA 4K6MA 1B42A 4XUCA 3B3JA 1BHJA 3GO4A 1KYZA 1YZ3A 2VS1A 3GDHA 5CVEA 5FWAA 3GU3A 3LBFA 3OU6A 5C0OE 3R9XB 3CVOA 2ESRA 5EEGA 5FHRA 2NP7A 1I9GA 4E2YA 3R6TA 5MHTA 3MCTA 3O4FA 5KVAA 3KPUA 1KPHA 2WA1A 1KIAA 1VP3A 3G2MA 4FS8A 3EVDA 2CMHA 1L3IA 1L3BA 3M6WA 4PWYA 1YUBA 3G8AA 2OB1A 2PWYA 3ANXA 5B1SA 3A25A 4DZRA 1I4WA 2R3SA 2OB2A 5DX0A 3BXOA 3HVIA 4QVGA 3E8SA 1X1CA 4BP1A 5HFJA 5T64A 3FTCA 3GIWA 5LQCA 2P3LA 4P7FA 5K0GA 1VL5A 3EVBA 4RYLA 2BM9A 3AXSA 4CTJA 5EHIA 2BR3A 2HMYB 7MHTA 2OO3A 2PWPA 3DH0A 3REOA 1SG9A 1ZGAA 5EGSA 3MHTA 5P8WA 2AOXA 4OBWA 2NNWB 2FHPA 4M7RA 3SM3A 1ZKDA 3LX6A 4GC5A 2EJTA 2P35A 4PGHA 4QVKA 4DM3A 2E5WA 2FCAA 3G7UA 5K0EA 1XCJA 2JHAA 5DM4A 1XDUA 3SMQA 4LWPA 1M6EX 3DMGA 1KYWA 3KQMA 2OXTA 3RODA 2PJDA 3THRA 1XVAA 3A7EA 4YUWA 2XYRA 4MIKA 2IBSA 5GM2A 2N47A 3NW9A 3THSA 4A6EA 1YFLA 3M6XA 4GOOD 1M0EA 3B7PA 3KQSA 5EMKA 3AY0A 3LL7A 3HVKA 3NTVA 3BKWA 4ZTBA 4Z2YA 3KQQA 4X63A 3HTXA 4E32A 3NVMB 5DM0A 1JG4A 5FADA 3EMBA 3IHTA 3R3HA 1NE2A 4FSDA 4PYJA 3BZBA 2BM8A 1DUSA 2G8NA 3L8DA 3EEOA 5GP1A 2CWWA 4GOMD 2Y1WA 3V8VA 3E05A 2BZGA 2ZLBA 1R00A 2H1RA 3NWEA 5EKXA 5LQRA 4RTKA 2OKCA 1JG1A 3I5UA 3KR9A 3MERA 3G89A 3JWIA 1IY9A 1KR5A 2QYOA 3AXTA 3C3PA 3TMAA 5LQUA 1DCTA 3AWIA 3BUSA 3MQ2A 4QDJA 2FRXA 4BP3A 2ZBQA 2ZIFA 5DPMA 2PXCA 4MTLA 2UYOA 3OFKA 3UJ9A 3LKDA 1X1DA 2G71A 1V39A 1O9HA 4FR0A 3A7DA 4E2XA 2VDUE 3HP7A 1ZHFA 4IKPA 5FQOA 4YMGA 5EC8A 2O57A 2FPOA 2ZBRA 3KQWA 4AZWA 10MHA 1AV6A 3BKXA 4KDCA 3GRZA 3GWZA 5T6BA 3CJQA 5K0FA 5ICEA 1Y8CA 2G72A 2AVNA 1N2XA 2YR0A 4M37A 4EMSA 5GIOE 2IP2A 5EQJB 2O05A 5EG5A 4RVFA 3FZGA 4IWNA 3DXYA 5CM2Z 4LWOA 5DX1A 2NXCA 1ZGJA 3LKZA 2PXAA 4PYQA 5CUQA 4AUKA 3UWPA 2I6GA 3CCFA 3PX2A 4HC4A 4YV0A 3G5TA 3ELWA 1JQ3A 5LR6A 2KW5A 3SXJA 2ZZMA 2UYCA 4FSXA 4P7JA 3FTDA 3UJ6A 4ER7A 3A27A 1QYRA 5E1OA 5G02A 3T0IA 5E9QA 1NV8A 5C1IA 5EMMA 4MHTA 4DMGA 3FRIA 2NP6A 2JH9A 2AS0A 3DOUA 2QY6A 4L7VA 3B3FA 4ISCA 1RJEA 3KQVA 5E9JA 5EEHA 4M36A 4YUZA 3ER8A 4C4AA 4BLUA 3TQSA 2AR0A 3LPMA 4C07A 1VPTA 4GBED 2CMGA 1ORIA 1KP9A 1MJFA 2B25A 4HSGA 1FPQA 4RX1A 3UJAA 4CTKA 9MHTA 4XUDA 5E9WA 1WZNA 5DRTA 3K0BA 4PYKA 1T43A 3EVZA 5K8VA 3BT7A 5DRYA 3GJYA 3ELUA 1L9KA 5EHGA 4FP9A 1EAMA 5CCXA 2WK1A 3A26A 3JWGA 4KWCA 2PLWA 2BR5A 2NYUA 2R6ZA 3FYDA 4YUVA 4OQEA 5EZQA 2P7HA 2PT9A 3TM4A 3EVEA 3HCCA 3DXZA 4QPPA 1FJXA 2FYTA 5H02A 1EG2A 4PNEA 3EMDA 3HCEA 3I58A 3P9KA 3WSTA 1Q0TA 1HNNA 5FA5A 3UBTA 2PVCA 1VBFA 2CKDA 3P9IA 1KXZA 2P8JA 4AZTA 4NECA 3R0QA 5LQJA 3FTEA 3LHDA 3M70A 4POOA 4GUAA 4C06A 3M33A 4PYIA 1NW8A
chains in the Genus database with same CATH superfamily
5LJIA 4IOLA 2YX1A 5ALRA 1Y3FE 4YUYA 4YQYA 2OSBA 1Q50A 2RB4A 2VPTA 3B5EA 4NBUA 3S7ZA 1AD2A 3QUCA 4I19A 1U3VA 1YZYA 4NATA 3MIZA 4OI0A 4QODA 4ZDIA 1Y34E 4ZOAA 1H4QA 2I4IA 3WSVA 2D54A 2DX7A 3I5MA 3CRW1 3TW4A 3I09A 5LLTA 4FNAA 3QXSA 2VO1A 4JC0A 4URYR 5FEUA 2HDOA 3FUWA 3MRVA 3OQVA 3AP2A 3C3EA 1KI6A 2R1ZA 4G0QA 4NS4A 4PGGA 3R3WA 4W5OA 5FTKA 1IJKA 3RTDA 4PG5A 2QP4A 3GLHA 2I34A 1YOVA 4ZAXA 5HIMA 4YJ2A 3W8FA 4ZOBA 3JQ7B 2H9AA 4YFYA 1NI5A 3SIRA 4BATA 4MVJE 3GT3A 2DPMA 2Q1XA 3M5PA 1WHTA 1BX0A 4GFDA 4MI3A 5IH3A 3NHWA 2JLSA 5JPDA 1DELA 5DP1A 3JYPA 3KE9A 2I6TA 1JTFA 5CJ2A 2AF3C 1OYOA 2GCNA 3X2EA 4EY6A 4CW7A 4EY3A 5KB3A 3JZIA 4MCIA 1E2DA 1QX4A 3NM6B 5JXGA 5FLYA 2B61A 1J24A 1O03A 3UJ7A 4RPHA 2ZE5A 4IQ4A 2Y1FA 3TLXA 2NYAA 3OOSA 4I6EA 4EYOA 1PW7A 1EXNA 1L4LA 1PWZA 2X5NA 3L18A 4W99A 5AESA 1EJ0A 4UAGA 2VJOA 3VR4H 1K88A 2CD7A 2O52A 5IC6A 4WOJA 4DHWA 2PUAA 3KTAB 4I4TA 4MHSA 1USKA 2YBDA 4N01A 4YDQA 3DBHB 4J91A 1CJUC 2EOAA 1FQWA 1VTKA 1RYHA 2IUSA 2Y9PB 3GN1A 4YMSA 9ATCA 1EVJA 3AKYA 4FC6A 5K3EA 2H7YA 2CT8A 1K8XB 2DTEA 2Q1YA 2XIJA 1V8BA 1VM6A 2P9HA 2OKGA 1GGHA 3VKHA 2QT9A 1C81A 4FWBA 1MT0A 2O1XA 5D2CA 4E7PA 1NUSA 1E3DA 1MF7A 2NPIA 1X8LA 1X1RA 2V7GA 2DERA 4LHZA 1Q5PA 3S7TA 3PHCA 3K32A 1G3IA 4R2XA 1WLSA 4BX9A 2Z6AA 1D6MA 2QMYA 5TQVA 1OF1A 2B5VA 2VFAA 2GF9A 2VP2A 3WRWA 1UXJA 2QE7D 4N6GA 3ISJA 1ZXXA 2E5LB 1FLDA 1E3EA 2NOAA 4P54A 4XYMA 1G17A 4KNVA 4TV9F 3KWFA 4NOJA 1WOYA 3N2YA 1Q0HA 4W1QA 4DZTA 1WG8A 3W2HA 4ZICA 3NFRA 2Y1LA 4JYAB 1LBEA 3ZX4A 5ICCA 2I67A 2LIPA 4Y8VA 4DR7B 3GN2A 5FUMA 1L5HA 1TMYA 3FKSD 2J0EA 4EW1A 5F33A 5FFNA 5HMMA 1WQ4A 3AZOA 4NOMA 5CYPA 5HUJA 2IITA 1YZVA 2O0KA 1AKNA 1XMQB 2OTCA 2XUZA 3PK0A 4LZPA 4XFDA 2AJTA 2NU9A 2REBA 2F43A 1AGYA 2I0FA 4OVKA 5BW8A 4C0LA 1DS6A 2V74B 3ML1A 1QIEA 2WNIA 4GPEA 4AIRA 2IZ0A 3G7SA 3BFXA 2Q6IA 3DCYA 3Q7QA 3TRDA 3VOAA 1KC3A 3D5EA 1BG6A 1YS4A 1MO6A 2W2PA 3JQ8B 4ZAYA 4RO0A 3GCDA 3IOMA 3RSCA 3ICCA 4G5QA 3C7TA 2BZSA 4Z7QB 2O8NA 3LA8A 3U19A 1WZ2A 4E12A 4PSKA 4WTOA 4M88A 4L02A 3SZRA 1SC1A 1KFCB 4Y6GB 3CH4B 1LW6E 3CMCO 2Z2IA 3E48A 3C3YA 4MS3B 3I28A 1WKBA 4E5YA 5EJ7A 1XBTA 2D5CA 1UDCA 5DK6A 2BOVA 2GPTA 1CR1A 3M6UA 4PZPA 4GS5A 3TK1A 5B57C 4C9BA 4E46A 2EDAA 2JAXA 3U26A 2B82A 2YV1A 3F6BX 1QWOA 2R5WA 5KDOA 2GI4A 5CVDA 4DR4B 2ZTUA 3TBHA 2IDJA 1E4EA 1YHNA 5GJBA 4TVSA 4RF5A 2IHTA 3GRVA 1Z68A 2YN2A 4EKEA 1NJ2A 1Z3CA 5K4AA 3ACCA 2BFCA 5C5EA 4QYSA 3ZXXA 2NU7B 4BV8A 3GNQA 1UWVA 1I94B 2LRHA 3GT0A 1E7SA 4TTRA 3ZGVA 4XM2A 4O3MA 2FFHA 3SJ7A 5KYXA 4MP6A 3LF1A 3HWWA 5BWBA 3Q0EA 2P2GA 5FBWB 2OV3A 4AP5A 2OO5A 1Z37A 3N87A 4HPXB 3BD7A 2BHRA 4YMHA 1FQJA 2QVXX 4BB9A 4IDAA 2UKDA 5BNIA 4LSWA 3VUFA 2ZYGA 2W0SA 1C4OA 2FWJA 3K6JA 5SV2A 4EZEA 2N46A 5BSRA 5L7TA 3TFOA 1HE2A 4EHDA 4ZJYA 1THGA 2P1DA 3BD9A 3UAZA 1YJQA 3RUIA 3CUYA 3PS9A 1XQWA 4JODA 5EUQB 1VG8A 3BVPA 2ZPTX 1DWQA 5H9VA 5JC8A 1KQOA 1SKYB 1V47A 2P6OA 2VDPB 3UUGA 3R5XA 3RFTA 1L5WA 1YA6A 2NSDA 4P98A 2XBMA 2HA6A 4WLUA 4RY8A 4WKNA 5ALEA 1WZIA 2H07A 1EWQA 1FRZA 1AZWA 3LWDA 4TSFA 2OORA 4PYRA 2J59A 4N54A 3GAAA 4Y2SA 3LG2A 4E0BA 5JLJA 1KAMA 3GUUA 2X0KA 2PWAA 4QX6A 1SQGA 3DZJA 3H11A 4PQFA 4D80A 2Q3MA 3T3DA 5I9SA 3RS8A 4BGIA 1CCWA 1P9NA 2AW5A 1X7WB 1QH8A 5L3VA 1C8VB 3M4JA 1MOQA 4R3UC 3TM5A 2NO1A 5K8TA 2Y9MB 5CNMA 3FZQA 3TQCA 4X90A 1KWKA 4BP8A 3MGCA 4XGNA 3NT2A 1RRVA 3TBFA 3SWWA 1QQ6A 2FZLA 1ZUWA 4IJ6A 1WW8A 3Q10A 5G0VA 4U7PB 7AT1A 3VJRA 3CEMA 1TYCA 2FX3A 4YCJA 4HAWA 3EUEA 2QAGA 5DE3A 1L5GB 3L6BA 4EECA 2XMPA 4BNFA 2PWZA 3RVLA 4OKIA 4AECA 4J0JA 5D3KA 4IUCS 4R41A 1X7GA 2FJPA 1JSXA 4YJ2B 1GARA 5EUCA 2O14A 3D4BA 4ECEA 3P2KA 1QDUA 3JU3A 4DYDA 5KPDA 1EDDA 3AUUA 2Q8QA 5EOVA 1J1UA 3QVKA 4E30A 4ZOLB 3UPTA 1PJAA 1XZHA 3ETEA 1RYNA 1MH9A 3QZUA 2CZQA 3CGWA 3N0TA 4RD6A 3ZCUA 4G5SA 3GDWA 1SUWA 4NBKA 3R7FA 5GIPE 1IXZA 2ZSJA 2V7EA 5LKAA 4O4LF 1F9EA 3QKWA 3A2MA 3R3XA 2IV3A 1VBKA 2MT9A 2O8CB 2FPGB 2JLRA 2Q0XA 1EDEA 3C5WP 4QOHA 4RS4A 4BO2A 2HLHA 3I42A 2PLNA 5KOHA 2B2NA 4WGFA 4MS1A 4FX5A 1EUDB 3QMWA 5EPEA 4V0OA 1Z2EA 4KB5A 2HNAA 1E5TA 4DIUA 3N8IA 3OFND 5EHZA 1D3AA 3TOCA 4CU5A 2P0AA 5IXSA 4C87A 3VJKA 1MOSA 1UEIA 2XBLA 1NI4A 4Q48A 4LHYA 3HB0A 3P0JA 4TTPA 2LCQA 3VYSB 2C82A 2PHZA 3TFWA 4HAXA 1LSJA 2C3MA 2XDAA 3QMMA 2C7PA 4LDZA 3AHHA 1XVVA 1O54A 2H57A 3O4GA 1TU3A 4O33A 1PJQA 3SIXA 3PR1A 2R00C 4US0R 5CURA 4XVCA 1DWOA 1EP9A 3G5AA 2UYYA 5HUQA 2FK8A 2WAYA 4R9UC 4MPDA 3UB2A 3AETA 3J81A 4HUQA 1C9MA 2EHDA 1BDMA 2I2AA 2I78A 1I2CA 5IAKA 4MYSA 1GDTA 3CKLA 2RBGA 1CP3A 2OXFA 2P2YA 4EYGA 4ZHQB 1VHWA 1M83A 1DT5A 1J8MF 2JFHA 1N7JA 1C2YA 3JD3A 4ZZ2A 2QG9A 4EA8A 4KXFB 3IAUA 1AQUA 4ARBA 3D7MA 2C5SA 1B42A 2VQDA 1CRLA 3H5RA 3KKPA 3QQ5A 4N3AA 4YRDA 2A92A 1BHJA 4C5AA 4EHNA 1IONA 4FE4A 4NL4H 3C3XA 1B6TA 2JFXA 4PZCA 5HTKA 4MWEA 1QO7A 2X4DA 4EO4A 2IXAA 2SKEA 3DBOB 1T4GA 5BPHA 1X6VA 2FVYA 3O4FA 1CZUA 2OOSA 4FW8A 4NH4A 4K0KB 1J70A 2O8EA 4FS8A 3WR5A 1L8OA 1REQB 2XUHA 2ZXEA 1V4BA 3KYJB 3V8PA 1UUFA 1Z39A 2O2HA 5F5NA 4G85A 2XGMA 4QRDA 4FX2A 3HCNA 4Y0AA 4WXMA 2NVBA 3P0IA 4KC0A 3PRYA 3JQGB 3HVIA 4TQUS 3I2FA 3PGVA 2HHAA 3SQOA 1E3WA 1W1IA 1FS5A 2WI8A 3QHQA 4JCOA 4NCHA 3RAPR 3V55A 4GXNA 4P7FA 1E8NA 4JLAA 3T41A 5KTNA 5A4DA 3U40A 2IEZA 1JNXX 3OOJA 5COBA 3VR6A 3RYIA 1Z2PX 3EQZA 4RKWA 3ABSB 3FNRA 1A9OA 4N18A 4NTZA 1XZGA 3JQAA 2G25A 3KJZA 3O3OB 3ZIUA 2ZR8A 3O4IA 3SM3A 2B99A 3HI4A 3NKVA 2EJTA 5AVXA 3H5VA 2HV8A 3O8BA 1GUDA 1Q7GA 1GG8A 2BKLA 3QOYA 3HB9A 4KXUA 3A1NA 3NIFB 4IQFA 2OXTA 4KWIA 3A7EA 1HSOA 1H4SA 4UBMA 5EMKA 3AY0A 3KHUA 4NIMA 4ZRDA 3STXA 4N76A 4UATA 3WP0A 3BKWA 3V4LA 3EDMA 3DTYA 5AW6A 4LDJA 1ZGHA 2BKUA 3TZBA 1XWWA 5GQSA 1XQ1A 4CG3A 2OCBA 2PH7A 3IA7A 2IXTA 4KQ9A 4DA0A 4PLYA 5FBKA 2HL6A 2R47A 5GADl 4DWVA 5LMCA 4G0WA 2D7CA 4RA9A 2GEJA 3E05A 3EHEA 3JAWA 1F0NA 3TCKA 5L3RA 3D8NA 3H13A 1M34E 4G07A 5LUBA 2ZB4A 1NBEA 1YS1X 4HGPA 4M8NE 4X84A 1U0EA 1UBJS 3C3PA 5L3QB 3BDAA 1ULHA 2HIMA 2WYHA 2A3RA 2FSSA 3EWSA 5AKEA 1KDVA 5DNCA 1D03A 2J3HA 5REQB 1ENYA 3LBNA 5FLEX 2MIIA 2XCSB 4IJUA 5HYVA 5FNVB 3OFKA 3QBJA 2NUTB 4JLWA 4UTRA 1H22A 2HH9A 4GYJA 4CL2A 5EC8A 2IF2A 2IVFA 1ZOOA 4FUTA 5BUCA 5HNKA 4L85A 1Y4UA 2YW9A 4BO4A 1DBQA 3VI4B 1QKJA 2FWMX 5ICEA 5BQ3A 2YR0A 2FG6C 3BHIA 1GO2A 5IVDA 4KWTA 5IM4A 4B3MB 3W6NA 2O05A 4ZVMA 1GTMA 4RVFA 1RU3A 4V0ME 3TJRA 4RYDA 3PYLA 5HKBA 1JFVA 4A10A 3EUWA 2JS7A 1WF6A 2H0AA 3FOZA 3UWPA 1ZOIA 3ZCPA 4L16A 4ZQIA 1YR9A 3QLUC 3QLEA 1GQOA 2XNDA 1RTKA 1VA4A 3RC3A 4FE3A 1YFZA 4NZNA 3LW7A 4Q19A 3H7IA 1C4KA 2OV8A 4GPBA 5L6LB 3AHEA 4E11A 1BX1A 1IN4A 1VE1A 5E1OA 1XJQA 3IBTA 4HLQB 1NV8A 4QDOA 2DAPA 2K7ZA 1ADYA 1HLFA 3ADKA 2LKDA 3FH0A 4NZ9A 4O8ZA 3S27A 5JV5A 2AS0A 5ADUS 4D9EA 1UXIA 5E9JA 5CEFA 1E9SA 4B82A 2VDRB 5BW6B 1BU8A 2ECOA 3SLRA 4B09A 5KYKA 1N32B 3AF0A 3EPLA 2AR0A 1MMFB 5ALYA 3OSUA 4KPFC 2YVKA 3ES9A 4HSGA 1MJFA 3L82B 1XWIA 1N7HA 2BPOA 2YHIA 3FGNA 4YGYA 1WZNA 2GYUA 2OL4A 3A1SA 3N1UA 3QHAA 1C7JA 4TXHA 4X3OA 5AOAA 4KSYA 2WG1A 2M6SA 3GJYA 2QRJA 3NT4A 1PI3A 3PZRA 3CIFA 4W7SA 1NYLA 3KFVA 5G2OA 3EA5A 5IHPA 1NXVA 1R37A 5CJPA 5AVUA 3F74A 1BS9A 3JWGA 2G17A 1HDEA 2PLWA 3KOUA 5F1KA 2R751 5HGXA 2QORA 3EVEA 3WB1A 4U2GA 4Z49A 3EMDA 3OOHA 2CXOA 4RF2A 1NFFA 4NICA 1Q7BA 1BMFA 2ZB7A 4IDGA 3F46A 5A05A 1NSTA 2I87A 3RQIA 3FWPA 2XNSA 3I0ZA 3CXUA 3MLAA 4QDXA 3T7CA 2VP0A 5D8DA 4ZEVA 2H5EA 2HGZA 3FTEA 2WYIA 5ALIA 2G06A 1Y3IA 1T25A 4YECA 3K9GA 1CRQA 3M33A 3R3ZA 4IIVA 2B0JA 4PC7A 5EMNA 5K0CA 1B43A 3TGPA 5K4HA 1NR5A 1R0BA 4ACBA 4BHTA 3ILYA 1JQDA 4IJVA 1SOAA 2OT3B 2XDYA 3DLIA 5IAGA 3QUTA 3NC1C 5EXEA 4MP8A 4RANA 5AW5A 5HKLA 1XLUA 4ENTA 4Z0TA 1E0AA 3NAZA 1DI0A 2VDQB 3M1AA 5ARDA 2ZSFA 4PSUA 4Q7JB 2R1VA 4NCKA 4MLPA 3B6ZA 2EGUA 4L2IA 1Z07A 5LP6B 1E92A 1NAHA 1DKLA 1RXIA 1W8IA 2FWIA 5IFKA 3HO8A 4D96A 1S2MA 3IIIA 4HDCA 1UBOS 3UAGA 5IJ9B 1FNDA 4N40A 2FCRA 4QBGB 4H7PA 3I9JA 4DJEC 3O75A 4TTIA 3S3TA 4G56A 2VF5X 3IHKA 1QRDA 4PWZA 4ZCPA 4C4SA 5U1PA 4OGFA 1SC3A 4HYYA 4O2BA 1DAFA 3BE8A 3L8YA 1FFGA 4F85A 1RIIA 3WOVA 3ZXSA 3FYTA 4BE4A 2RC6A 1I4EB 2OC9A 4WCFA 4CEIB 2R7LA 3U61B 2RKOA 2GTPA 1DGQA 5A3SA 3V4SA 621PA 3L7BA 3SVZA 1COWA 1PO7A 1SOUA 3LL4A 3N58A 3V42A 3ER9A 1ONBA 4BC1A 1NG1A 1CERA 1K7XB 4ML3A 4Q4LA 1UFVA 5D00A 5EWMB 1JA1A 2IU0A 4QGBA 2YRWA 1MJHA 3EXHA 3MN1A 5AQ1A 4MDYA 5LXTF 1V1JA 5CB6A 4MWZA 3ONVA 4RLHA 1SBHA 3SZOA 4DPLA 1SHZA 3V7YA 1GU1A 1YR6A 5G41A 1D6SA 4UBOA 1PQWA 1QO9A 3GJTA 4J3NA 1KJJA 1ZA2A 1XX6A 2RGRA 4LYHA 4M9QA 1V3QE 3HCBA 1AGXA 1G8MA 1O57A 2HB6A 5JJBA 4NYJR 4N5HX 1EI9A 4Z86A 2HK7A 2HWKA 2AMLA 4PSDA 1KHHA 4OQFA 4R2LA 4JI3B 1J2TA 4CMIA 1E6MA 2XA2A 1EFHA 1FFCA 1JKIA 3CH5A 4PSAA 4YRPA 1KVTA 2EQAA 2WSMA 3GP5A 4CKZA 1HURA 3BZUA 1M8JA 2DQKA 3OE5A 4CFSA 4OQQA 4Y2YA 4UHHA 3D4PA 2QXUA 4XDGA 2F1OA 2UZ3A 5DEIA 3HR8A 5G3ZA 1U7WA 3R7WA 1SD1A 2J1LA 4HAYA 3UXMA 1LSUA 1CJBA 4EPRA 2VXOA 1K98A 1QCZA 1UBRS 1XNHA 1ULBA 1W581 2R8RA 2ZWAA 3DEIA 4L51A 5DV9A 2NZVG 4FKZA 1YCFA 3EXIA 3HB7A 1IDOA 4UC0A 2JAHA 3VX4A 4EGQA 4TLCA 1ZZGA 3O7MA 4CL8A 2HXGA 3UMJA 1PLLA 3VHLB 1NOJA 1HM5A 3U4IA 2JL1A 4LWZA 4AZSA 4RWZA 3OOEA 1W94A 2EX4A 2WNSA 4B3JA 1RKVA 4OXIA 4RK6A 4MQLA 1XRQA 1RJ9A 1YBHA 2RHBA 4WLEA 2PNJA 2JHGA 3RHFA 5JSUA 5COQA 2R62A 2BGUA 2JGKA 2FZ4A 1SGWA 2WJ3A 2Q3BA 1CJSA 2ZRGA 5COAA 4C7XA 2YDXA 1KO1A 2XCIA 2BI8A 4E31A 3PFNA 1P7VA 2HWYA 2W8ZA 3BULA 4GQAA 3ZY3A 1L6RA 4LZZA 1HL7A 4QECA 4YR9A 2BEUA 1IZ8A 1K92A 1E5VA 3P5BA 4LNUB 3E1KA 4JT4A 5H68A 2Q6VA 3S8EA 3HBJA 4DG9A 1XQ6A 1JQEA 1NVWQ 1FFBA 2DTDA 2W43A 4DVGA 2CLLB 1BCSB 2CLDX 1LWOA 3C14C 4FQ7A 4JWKA 2ODTX 2H11A 2CVQA 3WGZA 3K35A 1GL6A 3ZTTA 1ADJA 4PAGA 2IOFA 3TNYA 3MINB 4Q15A 2HPHA 3GHYA 4QPDA 1NZJA 1J09A 4AU1A 2ZE7A 4RPIA 4CIAA 4WRRA 2CCGA 2I22A 1JFLA 1Z4IA 4ARZB 5AVTA 2J08A 2BRUC 1QX3A 2CNWA 1XHLA 1AE1A 1ZD9A 3AKEA 4NONA 4F60A 4OFBA 4Q4HB 2GA9A 1RJWA 3UC9A 4ZHSA 1UFRA 3MMNA 4EI7A 4UE6A 4QOEA 4R05A 4EZBA 2ZROA 3O38A 2G67A 4BVJA 3KAQA 2O5CA 4UEKA 3CZPA 2YTZA 5HF8A 4CL3A 5IDXA 4BU1A 4D4JA 1QF7A 1SVNA 1W4AA 3DEJA 3H2BA 1B2LA 3HN7A 3DCJA 3MT7A 2PK3A 4EL5A 4UDOA 1IH8A 2ACKA 1NKTA 1YVEI 4P53A 4BQFA 4R68A 4RIHA 3NX4A 4U00A 4EJFA 4XJSA 3UWKA 3F3MA 4IQGA 4UBLA 3S0JA 1RZRA 1ZBQA 5JS2A 4QSHA 3ZDFA 4CN8A 5JQGB 4MYUA 3V4VB 5AI9A 3GEHA 3M6AA 2GEVA 3CPSA 5KOIA 4J7CA 1G55A 2C3YA 2ZSUA 3DSRA 1TA4A 4BS9A 3K15A 1JDZA 1GZ4A 3GX1A 2QM8A 4IJMA 5K3BA 3OZAA 1M2FA 2UZAA 2HRQA 2IC5A 2RI0A 2YMPA 3D6NB 5FCDA 5IAEA 4DCSA 4TKUA 1IM5A 2G77B 2HJ9A 2ZREA 4S1TA 5JS8A 1HNZB 3OIGA 3MRTA 1TK9A 2BJVA 3Q3GE 4TMWA 1JHPA 1ZD2P 4H1VA 1CQJB 3CLSC 1E5DA 3FTQA 1TTPB 2OD9A 2QSYA 3RYTC 4KXQA 5AVSA 2Z43A 1G60A 1UXKA 2IXGA 4FJ2A 4JKIA 4JR1A 4XB6B 1PFYA 1G0OA 1XZKA 3IIEA 3L7NA 5K03A 1GTSA 3WRYA 1V8DA 1R88A 4FZRA 4L6CA 4Z9XA 2JG3A 2PUVA 3RKRA 4KE8A 4R4JA 3OU2A 5EJGA 3U9TA 1CWUA 1QHSA 4XB2A 1GTRA 2RHMA 3Q5EA 4HAVA 5AH0A 2ZSDA 3ZWQA 2UXDB 1P91A 1YIDA 1XYYA 2I4MA 4HJXA 3NBFA 4BO9A 3INNA 1FVOA 4ESOA 3QA3E 5K51A 3DP9A 5AVWA 1ZXBA 2PMBA 2G5GX 2CJXA 2JD2A 2AC2A 3KTOA 3NDJA 4LV8B 4Y2HA 5ELLA 4W5TA 2YWEA 4PO3X 4TS3A 4YRTA 2QRHA 1J8YF 1QIDA 3MD0A 1DFGA 3CF2A 4HDQB 1HEIA 1L5RA 2PRZA 5BORA 3H05A 1YE8A 5KOYA 1OHHA 1ZL0A 3FCSB 4OGLA 2P3SA 3S2EA 1M1ZA 4CQMB 2C92A 3UYLA 3G85A 1VHDA 2XKBA 5IWAB 2QRGA 3CUKA 3HB1A 1B41A 4DIFA 4YRNA 1M66A 1WMAA 4ZVRA 1P9WA 5GONB 3GRFA 2QTNA 2KI5A 2ZR0A 2Q3EA 1KETA 1PR1A 2W6CX 3FI0A 1JDBB 3IALA 2GA8A 2VUUA 4WNCA 5CW1A 3BWXA 1D2RA 2O2SA 1INLA 3NONA 2GB4A 3GMDA 4GZMA 1QZXA 1MB2A 1M0TA 4DAEA 1E1CA 4BNWA 2GEKA 2CK3D 3BICA 3EUFA 4W5NA 1AUQA 1LLQA 4WX2B 1A69A 3SI7A 4CUZA 4ENVA 3GLFE 3K0EA 1T1RA 4M83A 3IUMA 4O29A 3GI1A 1AXGA 4O4LA 2WVAA 4BFCA 2J0UB 5JCOC 4GKJB 3I2GA 3IEIA 4PO9A 1PQUA 3F73A 1D5WA 4UBNA 1XHEA 4NNJA 2VJCA 3G02A 3P0RA 4TTVA 2ZRJA 3RVJA 1P1HA 2Z6VA 3T7SA 5DGXA 4QWWA 3BRCA 3AR6A 1NXQA 1NLZA 1QCDA 4IIHA 3QBTA 4DIOA 2BF7A 3T35A 4PY2A 1PV4A 2WPDD 4L3WA 5BV2P 3HL0A 3ORRA 5LPNA 4K9MA 4GMFA 4Y2QA 5CDFA 3PEUA 2FX2A 4QXQA 1P77A 4B3FX 1L5HB 5DIZA 1NDHA 5L3QA 1JA9A 1T8SA 2QR3A 3GBSA 3PGJA 3Q0IA 4IVPA 4RA6A 3KYBA 4B4OA 1FTNA 1XPJA 1LLCA 4US1R 821PA 2XD9A 3KZ1E 5FOVA 3REFA 3WGVA 4RA9B 2WD7B 2C03A 1L8LA 3MYYA 3VA7A 1RABA 1TT7A 3IVAA 4NV0A 5DI3B 2EKZA 1G1MA 4P7GA 2DPLA 3UA4A 1ECJA 4E94A 3L0BA 4U7WA 4X3CA 5ALFA 3R7NA 1GUFA 4B7AA 4DNFA 1TVKA 1HUQA 1WVGA 2EGHA 2QL7A 2V5VA 3QFSA 1G9SA 2FUNB 1XLWA 2JEZA 2LVBA 3ETHA 1V6CA 2HQBA 4HPJB 3GT7A 1T8WA 4N8EA 3T38A 1RMTA 4ESHA 3EAFA 5F23A 3GK3A 3PT5A 2AV6A 4LGYA 2O19A 1VI5A 4ES6A 4R2WA 2GKSA 4EB6B 4E5NA 2VJBA 4UCXA 3EGDB 3GU3A 4LQDA 1B00A 4C20A 1AU9A 3U7HB 3IC5A 2GASA 2A9VA 1HDCA 4JQYA 2FEOA 4HZIA 1GSAA 1ORTA 2VNAA 4U4AA 4TSRA 3R7WB 1ESDA 2IEYA 5DIFA 2XNCA 1JDJA 4WZAB 1HEUA 4EDHA 1LD3A 2ZWOA 1DX4A 1JA0A 5D5PA 1EK6A 2V6IA 2V9PA 3CSDA 5KJ1A 2XMGA 3MCAA 4C2AA 4CKXA 1O3YA 3TI7A 4R40A 2I6XA 1CIJA 2OFWA 3A9UA 4YMIA 5FPTA 1NOKA 2LWIA 1A82A 5LZ7A 3VR5A 1L4EA 1LRJA 3GIWA 4OK3A 2CV0A 1MC8A 4DLBA 4PSCA 3Q3VA 4CTJA 5TJHA 1H0SA 3NB0A 3RK1A 4EY7A 3E27A 1GCIA 4RFLA 1U2GA 4M8IA 1TB4A 4C0JA 1N8SA 3Q3JB 1D2NA 1YJCA 3WNZA 3LMKA 3ZPXA 2CDCA 1ZK3A 5DYTA 4RY2A 3TLCA 3UK1A 2IHJA 5CDHA 3ADDA 1TYDE 1IC6A 4DLUA 4MCAA 1P44A 2ADOA 2NTNA 2PJDA 4BX2A 1YUNA 3I39X 3Q2OA 4QLAA 3HU2A 3AHFA 4IHKA 1ZBDA 5J5AA 1E5QA 3OM1A 4HNAA 3UW3A 1KSGA 4JJ4A 1RFLA 1IY8A 3T5GA 3T5CA 1Y5MA 4G0UA 1MEOA 1Q3KA 4RIGA 3W5UA 1Z5WA 1CF9A 3OWOA 3ZWAA 1WSDA 3JQGA 2FG5A 1FYXA 4A5SA 4MMYB 3WV5A 2QENA 4MRMB 5LBIA 4OXRA 4EY4A 4JSTA 4Q47A 1LGYA 2X8BA 3QENA 4EB0A 2Z58A 1OXSC 1EQ2A 4OLJA 4PICA 1CS0B 1BS2A 1XDGA 3GLIA 2AK2A 1TL7C 2Q4RA 4L8YA 4PS1A 4K05A 2X7XA 3ZQKA 4B7CA 4W5RA 1OT5A 3Q4GA 3IKTA 3OLQA 2C2KA 4QDJA 2OPHA 1Q2XA 1L7MA 2BFFB 2PXCA 4GL2A 3A3YA 1HV8A 1RD4A 1Z7BA 3LKDA 2C57A 3WK6A 2PNFA 5BSHA 3MTBA 4K87A 1OLOA 3S8YA 1AKVA 1L4YA 5AJZA 1RVDA 3AW8A 2ROQA 2QG4A 3BKXA 3MGBA 4KDCA 3GWZA 3KZXA 4BYGA 4RDXA 3J80A 1NIPA 3T7JA 1IHOA 3C41J 4BO1A 2HHHB 2X0RA 3GMSA 2J7PD 1ZD3A 3KKLA 3ZGNA 1WOMA 1G63A 1ZK4A 4YAEA 3J7AC 4DLSA 3OLWA 4JEUA 2ZI7A 1KEUA 2DFVA 1O0BA 1DEAA 2E4ZA 1P5JA 4IOMA 1JQ3A 3ZLBA 1EE1A 1XTJA 1I9CA 2BSAA 2KW5A 4BWYA 1DOHA 3PL5A 2ZZMA 1XALA 3PNBA 4P7JA 2OQRA 1ILWA 2Q27A 1PFKA 2CNKA 5EP1A 3WYAA 1FDTA 3BF8A 4CQNA 4YFVA 4Y1RA 2VZ8A 3P2OA 1ZN8A 4MI6A 3WI7A 3QHPA 1R3DA 3H0CA 4LZJA 1ZJWA 5T5QA 1Z8FA 2H1FA 3IOYA 3OQ6A 2QY6A 3N0VA 3P2JA 1DTEA 2V4MA 4KHPB 5F7OA 2V7PA 1EUDA 3F7NA 3FDJA 3P1JA 3PC8A 4BRSA 2EERA 1U7XA 3LKVA 4JUFA 4ENPA 2D5AA 3GARA 1YNSA 1CDOA 4MWDA 4PYKA 4MVCA 4IFBA 4QWMA 4ZZ0A 2IEGA 4U8HA 2IP4A 1EWVA 1GPUA 2H54A 1PT8A 1AKTA 1JE0A 2LZ0A 2XVZA 3DL7A 4BUZA 5KSYA 1I7QB 2IZOA 2JGFA 4EW2A 3RUPA 2FSVC 5ELXA 2W93A 4NDZA 4IMIB 2A7XA 4YT5A 4GM4A 3WWYA 5EP2A 3FR7A 3PG5A 1CUGA 1HYGA 3NHSA 1EYZA 4ZRMA 5FR1A 5FA5A 3B8EA 1YZUA 4BX8A 1Z29A 2EYUA 1IBSA 1OLXB 5KU7A 1HL3A 4B3DA 4K9DA 2UZ1A 5JADA 1UL1X 3USCS 1QVZA 3IAM6 2J7KA 2Q3JA 1KE1A 1W8DA 5EXTA 2C2OA 1IEXA 2JEOA 2KLHA 4JP1A 1PGJA 1SUIA 1HDXA 2H4JA 4RY0A 2WEKA 2GPNA 3AUSA 2J5RA 3CZ5A 3G6KA 3EZXA 3K9LA 4M1TA 4TUYF 4Y9TA 3UWOA 5BW4A 3I5XA 1GFWA 4XVHA 2VQFB 1PZGA 4LF5B 4RJTA 2A5JA 4CMBA 2RBKA 3LVQE 5JBQA 1U8UA 1P5HA 4MOWA 1C5KA 1WA5A 4ZQBA 3VX3A 4E33A 2RGXA 2O3QA 4ZI7B 2HV9A 3TPZA 4JCCA 1F6DA 1YACA 1YQQA 4IS3A 1F8GA 2AB0A 2BUAA 2YHIB 3OHPA 1WP9A 2GM5A 2P9YA 2PRIA 4FW9A 3TZCA 1NVAA 3N9IA 3RVQA 4H1WA 1PHRA 1U11A 2DCMA 3V3KA 2WM8A 1JVBA 1U1EA 3D5QA 1VIDA 3M4NA 2YUTA 3DO8A 2I62A 1E1QD 3N76A 3R4CA 4MYRA 5BQ5A 4E2ZA 1IL0A 3ESXA 2QJTA 5ANRB 5CAEB 4B4VA 4YV2A 3F9RA 1NG9A 1LI5A 2F7SA 2DECA 1HQDA 3F6PA 2OO7A 1R0SA 5TMDA 2Z1DA 5I9NA 1DINA 5LQMA 4O5OA 4BNIA 2Y1XA 3VU3A 2VJDA 1AC5A 1JEQB 2RE8A 1ZIOA 2JAQA 2PX4A 3KDPA 4XYBA 4F7WA 4KVZA 2NZUG 3IQWA 3QV2A 5DGDA 3TGLA 4TL9A 4RE5A 1HY3A 3K5HA 1OU4A 2OGUA 2XYHA 2XTAA 4M0FA 2W90A 4LXGA 4Q7LA 1C0IA 3JASA 3TSOA 3AVVA 3LF2A 3OTQA 1C3LA 1IY1A 3KB2A 3CWQA 3KT0A 3WDMA 2M32A 2ODWA 1Q1QA 1FLVA 3K16A 1Y1RA 2W6PA 2JJ1D 2ZYIA 3OKAA 4R81A 5J59A 1L7PA 4BNYA 2OHVA 1NF8A 3ABZA 2P9BA 3GFTA 3H2YA 3URKA 2FSGA 4QICA 2GNAA 2IYOA 3SHQA 1G38A 4J2TA 4ER3A 4J2HA 1DIBA 3OIYA 3OHMA 2OCAA 1G2PA 3OQOA 2PS1A 1GQRA 1U99A 1TLLA 3FHJA 3FPFA 3M9LA 3BMXA 4AF8A 5AVZA 3D4IA 2GSDA 4LXXA 3QI2A 1CJTC 4S2UA 2A9OA 3RGGA 5ICFA 4P4SB 1PAUA 2FDRA 3I6IA 5KDDA 5L4SA 2P6NA 4MAMA 1QPZA 1FU4A 1U9YA 3QM1A 1YZFA 2CGEA 2ZWMA 4CEHA 2HX1A 1L7XA 2WU1A 2WTBA 4NV3A 1K3UB 3UKOA 1T34A 4D3YA 4YCCA 2R4TA 2QRZA 2C8LA 4QOFA 2CUTA 4QNMA 1RPZA 5BRNA 1X7ZB 4R8RA 2JAUA 5IS2A 2D0OB 2EJWA 2BEWB 3UJAA 2E2WA 4AY6A 4X91A 4U5XA 3SYTA 1BQ4A 2P9TA 3CSSA 4KBGA 3SQXA 2ZZKA 1Y98A 1TUBA 3CLHA 3WYGA 1NFRA 4OEHA 2QX4A 3OQIB 3SZ3A 1QGOA 3LFTA 1XE3A 4BMPB 4Q9IA 4OQDA 1YL7A 3AHCA 4GLOA 2Y2UA 5K3CA 2BMEA 3R7DA 3JALA 3KUDA 4YDHB 5DYGA 3RJ5A 1CC1S 5JNSA 3GRAA 2J6IA 2ZVJA 3A6LA 4RD0A 4D44A 1Y1SA 2Y4NA 3C3KA 2VKTA 5TMPA 5TF0A 1A9PA 3B78A 1RWKA 2AFIE 3EW9A 2GJSA 3BCHA 4KO2S 3TTVA 4KSBA 3GROA 1MHTA 3MGKA 3W5DA 3IB6A 4ID9A 4AN1A 2O48X 2W0MA 2J46A 1ZY2A 1KBZA 2XZPA 4RVDA 5M34A 4PPQA 3DL4A 2NADA 4Q37A 1JQKA 1PUXA 3HI6A 4N03A 2ODPA 3TI9A 3AF6A 3EIXA 1QK5A 2V1XA 3UFXB 3GJ0A 4EITA 3NBQA 4HGZA 2X1HA 2JLCA 3MT8A 3NEYA 2WPNA 1UMDA 3SSMA 3FOBA 1NF9A 3A11A 1YUMA 4IVRA 4MK4A 1KVQA 5FX2A 2IOFK 2ES4A 3R1IA 3HXPA 1OYYA 4QFMA 5DCLA 2Q41A 1PR4A 1RXEA 2Q3CA 3PXBA 1NR1A 5CXUA 5EE0A 2W7TA 1COZA 1VBNA 5E6UB 3SQWA 2CVZA 4Z0PA 4BMCA 2VTBA 3QFTA 5AICA 1OA0A 1N7IA 2EL9A 3QEMA 3AI7A 4NNOA 1JPNA 3CLTD 5A9RA 3DLBA 3IVGA 4WVLA 4TS1A 5KX5B 1O5IA 2QVZX 4NOKA 1ZCFA 2A0UA 4KQJA 1EFRD 1MVNA 1QFJA 4HHEA 1JKFA 4O4LB 5LOVB 1QU2A 4W1SA 1DMSA 2B8JA 2BFOA 5DM1A 3SX4A 3CV3A 2ZCVA 3LYLA 2YWRA 3TIFA 3BHMA 1MG0A 1AKUA 1GYQA 3F8WA 5DO9A 3NMUF 3FKSA 1WCXA 3I92A 4JBYA 1G7RA 3E1SA 1RAIA 2JHPA 4HNUA 3GCZA 3HRHA 4ZZ1A 3RIEA 5M7EA 1K7EB 4DR2B 1KMMA 4MW2A 2QAIA 2P4QA 3BH7A 4RQAA 3BAZA 1O6FA 3Q1LA 4XJXA 4F4HA 2CL6X 1DTSA 5C53B 1D1SA 1JIVA 5HJ5A 3IBYA 3TX6A 1BXZA 4FWIB 1ZNZA 3M9XA 4KK4A 1QIGA 4BEVA 1GZ5A 1WU7A 5KYXB 1Q3HA 3KTDA 5MN4A 1UH5A 1DAMA 1GADO 2WUGA 2ZUWA 3OCWA 4II7A 3UJ8A 3UJCA 3V1UA 4ETMA 5ADHA 1A5ZA 5FOSA 5I8PA 2GAJA 4GC9A 4KQEA 3PHJA 3GVCA 4ONEA 5JCJD 4P0PB 3OZVA 5G4KB 1QH8B 1QANA 2YJ5A 3O2SB 3EDQA 4XZ3A 3GFSA 5BO5A 2NYVA 1QBGA 2JIPA 3ZJUA 2BE9A 2R5FA 2TMDA 4GX0A 3VNRA 4CE6A 1CY0A 3T9DA 3IDOA 1WD7A 1PZXA 3BJZA 3H5LA 3ITEA 2J31A 1PCXA 2W4QA 2GARA 3DEFA 2GTHA 1XO1A 1XTPA 4P22A 4KAXA 4YRAA 1A27A 1RKBA 3ND7A 4INZA 3RABA 1TKRA 3NCHA 4XKJA 3U1BA 3CLRD 1Q1BA 1Y6QA 2AMFA 3W90A 1QVAA 2AI1A 3JYHA 2WWWA 3VDRA 3VSAA 3WAGA 4GX2A 5EJ5A 1XR3A 3UV6A 4RJLA 3WTCA 3ODPA 4BB6A 5E6RA 3ZHSA 4Q12A 3OT5A 2H4ZA 2D8AA 3HYRA 5C8ZA 1G3QA 4RABA 3ASUA 4K03A 1X42A 1BVYF 1IMOA 1FVFA 1G18A 1OXMA 2KHZA 2V8BA 2ZE8A 3M4XA 1U9IA 3VM6A 4OUDA 4A26A 3BRSA 2E89A 1OWMA 4FEGA 4YNBA 1G66A 4DV1B 5DM2A 3UT0A 2A0KA 3L7OA 4LRUA 3ONNA 3ND5A 2OZLA 2XBUA 4PX3A 2JCSA 1QC5B 3MJVA 1B8PA 3NWPA 1U1FA 3HKDA 4LMRA 4JKYA 5EWLB 5B1HA 2DHEA 4JMLA 3DDUA 6LDHA 1OZHA 1BDBA 4MR9A 5D86A 2VP3A 5HKAA 3PFBA 1NUPA 3QJYA 1SBCA 2ZB2A 3HCRA 2R8EA 2OLKA 4DG5A 1UBKS 2VC2B 1K0FA 3ZI7A 1JKMA 5HQJA 5AOVA 4RGBA 2HKIA 1L5LA 3WWCA 4JLNA 4XWAA 4UXJA 2NO0A 3B9PA 5A02A 3HJCA 1SM4A 4M9SA 4YJ2F 5HM8A 2FWRA 1M2JA 5CGZA 4ZVPA 1FTGA 2VYQA 3CKKA 3OC0A 4OBEA 4BZZA 3PB3A 3GAZA 1A97A 5AVVA 2D1RA 1GPYA 4YDSA 5EN4A 1J99A 2GESA 5I01A 4LJ8A 1JF8A 2OM2A 2F2TA 5A4IS 1NSYA 2C4MA 3PXCX 1C9YA 3QEJA 1DC5A 3L2OB 3T99A 1IHUA 1ESEA 1FNNA 1MKYA 3ESQA 3T0FA 5ALJA 1TTTA 1JHVA 5CBKA 1YB4A 2IHUA 1TEHA 3OPMA 4YRZA 1THTA 1H2EA 2D74A 3K6KA 4Q3AA 2PL1A 4Q18A 4LOHA 3NEJA 3NDIA 3JWHA 2C9CA 1EIZA 3K0FA 4JHLA 2JJ2A 4CKCA 6PFKA 3AM3A 1N2ZA 1XMSA 3X3HA 1ETUA 4RPCA 4JI1B 2EWMA 1UPFA 2VAXA 4RK0A 5EJFA 4A0GA 1HDRA 3V7NA 3EEFA 2A0YA 1U2TA 2Z56A 1I1NA 2RONA 1Z0FA 3ESRA 3IHWA 3IX7A 4KQGA 4R9VA 4U2KA 3KXKA 4B6RA 2GWRA 1D8AA 3UNXA 4CGYA 4ZYVA 3DLPX 2HYDA 1ZEJA 3PFIA 5HSGA 2AZ4A 4J8PA 3E7PA 4R3WA 5TR9A 3C39A 1K7YA 2YXLA 3U2QA 4BN4A 4F3NA 1PBTA 2VF4X 5JC1A 3EA0A 2HRBA 5CVUA 1EP2B 1JEOA 1G6KA 1PZHA 4LKOA 4LX8A 4KVFA 4BTVA 3OJXA 2PRKA 4S1WA 4HN2A 1QV6A 3VPHA 1QF9A 1KYZA 4JP2A 4X7PA 2W6QA 3OU6A 2B4AA 2HEIA 1KVRA 2G9ZA 3H97A 2H2DA 4JLJA 4OL9A 1M10A 4BNVA 3V1YA 3G79A 4ZCIA 2HOQA 4QUIA 5TPZD 3KPUA 1BU5A 4H4DA 4EJMA 1KIAA 1VP3A 1YB5A 3QVGB 2IA5A 5B3AA 4C78A 5K7SA 1EUCA 3MSCA 2AG5A 2ODEA 3BDVA 2F9FA 3HJRA 2QG6A 1JAYA 3B5JA 1CY8A 3A25A 3PV0A 3Q8WA 4GX1A 2OB2A 2VNKA 1PNVA 2ZETA 4ZZIA 5A3QA 2RH4A 2GYYA 3UOAB 2X0IA 2I6SA 5AM3A 2A7QA 3KOYA 5K0GA 3UMMA 2Z8YA 3EVBA 4RIFA 4G97A 1AKRA 2ZYVX 1E3LA 4GPAA 4PG7A 4Z9YA 3L7AA 2ZRDA 1OI4A 3DH0A 4IZOA 1XVTA 3W2FA 2GAOA 3A0UA 4BLTA 3H1PA 2F3PA 1JKJA 2B1GA 4DN6A 1XQVA 1OLXA 2P35A 3UT5A 4FMCB 1PJ2A 1GIAA 2JHAA 3T6KA 4BFSA 1U5AA 2MYPA 2ACWA 3CONA 3HJGA 2ZDGA 4RLFA 4TXNA 2IWRA 3CU5A 1D1TA 1HMPA 2DWUA 1XVAA 5KTRA 4MA0A 3HDQA 2ODAA 5AJHA 3D7LA 3IEUA 4BDSA 5DMXA 4Z0HO 5G1OA 4MX8A 2DT5A 2RHCA 3LL7A 5F76A 5FNVF 1CQXA 1JJ7A 3S40A 1CV2A 1SMKA 3Q41A 2GHIA 4AJOA 2J6BA 5FADA 2AT1A 4BVAA 5JJLA 2QR5A 4JS0A 1V96A 1NDQA 5JBIA 2A9KA 4BQOA 3E70C 1PR9A 3ZJ5A 5IAJA 5EJEA 3K9NA 3PF8A 1GU0A 2D2VA 4Y2TA 4DLAA 1G2IA 4FGJA 3NHBA 4PBSA 4F8JA 3BXHA 1ZSNA 1R3UA 2O0JA 2QNBA 3KR9A 5IZCC 1SR8A 3ND6A 2CMFA 1BMTA 3IUNA 5JAOA 5JIBA 5CLJA 4CCSA 3JYOA 3WLRA 3W5IA 3FHCB 4FYMA 4WACA 3OFNA 4B4DA 3PEWA 4RD3A 3LT2A 1ZD8A 2QTVB 4N9WA 5AKGA 4IQ8A 4ASUA 1S3GA 4KAFA 1LDMA 2BFWA 1UC9A 4CKEB 1VL0A 2Y76A 5JMOA 5IDWA 3PXDA 1FMTA 1QRAA 1RWBA 1Y6ZA 1FFAA 3CSUA 4IR7A 4PCVA 5DHUA 4WOCA 4XDYA 5C35A 1IHYA 4BIMA 1NJSA 3C45A 3ZGZA 5I45A 3D6AA 3KOZA 5BUQA 1WD5A 2Z3ZA 2GK7A 4DCPA 5CXXA 2PR7A 2QJFA 1COWD 1NNUA 3G0IA 1W47A 1JH8A 3O74A 4KE7A 5KNLA 2NXCA 2K7FA 5L4LA 4KFCA 5CDUA 4KO3S 4XCVA 3RIMA 1SN7A 3OTHA 4A36A 1V5EA 4IIJB 3ELWA 3HKCA 4HGOA 3RAJA 3VO2A 2Y1KA 4FSXA 4ER7A 4F3RA 2HA5A 5HZKA 1QYRA 1WRBA 4BN0A 3LC2O 4RKFA 4A4DA 1Y1PA 4UOZA 1TNDA 1U2SA 5C7IO 3CUTA 4BIIA 2HJVA 1Y33E 1RMYA 1UJ5A 2FFQA 3L6CA 4ZDWA 5BXQC 2TYSB 4I5GA 1GILA 3DOUA 4TMVA 1KY2A 4F4UA 1UBHS 1DBPA 1SOVA 2Q1TA 5BOSB 1W5AA 1GTL1 3KK0A 1X8JA 4PW0A 4GI7A 2CFSA 4QU8A 1L5OA 4YI3A 4PHTA 5LZ2A 1ECPA 4KQWA 3T1QA 1MO5A 1QE0A 3WL5A 2HSWA 2VI5A 4H1HA 4D0RA 1II8B 4ABYA 3OTGA 4HXGA 1WL8A 1P0FA 1VFPA 2JKVA 1ML3A 4YO8A 4F5DA 3QVLA 1BDJA 4TXLA 2P91A 5HR5A 3SYRA 1D0SA 1RC0A 1LLDA 1E0KA 1HYBA 1TJ4A 2SCUA 1XTIA 3BK1A 3DXZA 2CBXA 4M46A 4UASA 1MIHA 5KX5F 3HCEA 3EH1A 3KKOA 3SHFA 5LXTA 3EXAA 1JMVA 4WFJA 3OESA 4QASA 721PA 4YPOA 4ALKA 1L7DA 3AVPA 3QVMA 3NBXX 4KR2A 2O2JA 2NV2B 4CKWA 4DUGD 4UAJA 3M70A 4A9AA 4POOA 3JARB 4NU5A 1U7ZA 3IEKA 2ISQA 4JJIA 3H9BA 3EIHA 1I7LA 4TKVA 1NW8A 3E5RA 4G41A 3WGUA 3H18A 1P45A 1E4OA 2Z83A 1M5TA 2QS9A 3FTFA 1JEEA 3DOCA 3IYLW 4FONA 5DX8A 5EPUA 2R79A 2CLEB 3C6QA 4KDFA 3RS9A 1E9DA 1IY0A 3FPCA 1WCYA 4X44A 3NH6A 3TOSA 4F86A 3OZXA 1L1RA 1AMUA 1VKOA 2E82A 3V7WA 1BCRA 2C2XA 2VBIA 4DEYA 1E79A 1X0VA 4YV7A 3OLCX 2D0IA 4IIFA 4L75A 1I0ZA 5I7SA 3JATB 1TPYA 4Q24A 4Q9NA 1ADCA 2VZLA 4L4RA 1ZNWA 3KFXA 5KWVA 1SUPA 4AQYB 1MAAA 1MW8X 1TK2A 3RVSA 2CDAA 5HQ3B 2AD1A 4IO0A 2XADA 3ZHXA 2FNAA 2YKGA 2ERCA 1RJDA 3DULA 2PSDA 4IO1A 3N7AA 4UU0A 1KOLA 5CLQA 1N2CB 1NVMB 3P94A 4KTTE 1ZJYA 4MV3A 4MR8B 2EQBA 4E5SA 3UBTA 3VDQA 3CNLA 2ATXA 2FQQA 2H7XA 2QUJA 1D04A 4JYBA 1QCCA 3EIUA 3WAJA 3E6AA 3DLTA 2L18A 4DPKA 1P81A 2IPXA 3A10A 1V16A 1RS0A 3SSOA 1KI4A 4PLWA 1WMBA 1TZKA 5EIAA 2R48A 3O92A 1Q20A 1EUYA 2HRDA 4XUEA 3EGOA 1PLKA 4RVHA 3W8RA 3QG5A 3UCXA 1B16A 3EGIA 4F2DA 2WOJA 3ZTWA 3NBZC 3ZD9A 2OY0A 3W1VA 3SE7A 1MTOA 3V4FA 2FEPA 2PA3A 3RHSA 3UAVA 1M67A 3MB8A 4M0UA 3EVGA 1JS1X 4BQSA 4C2UA 4LC1A 1BDIA 1GQQA 1M2KA 3EPPA 3NBKA 2WJYA 4KV7A 1HFEL 3G2OA 2G1JA 2H52A 4IILA 5DNYB 1P61B 3KU1A 1S89A 3TF5A 2AEEA 5JJCA 3HWX1 1E9RA 3UJBA 2UYCA 4B6QA 3BH6A 4MVJI 3AEUA 3DV2A 2X0JA 4X85A 2BISA 2FW9A 4HH4A 3JR3A 1AM4D 4AJEA 3ERCA 1KC1A 3L43A 1TYAE 5F9FA 2VLBA 1G1AA 1KO4A 3KT8A 3LDGA 4MR8A 4AS2A 3MTAA 2CLKB 4H0CA 3EFOB 3VTKA 4XOUA 1O7JA 2P65A 2Z08A 4AWXA 4B44A 5EP4A 1PJCA 1U94A 3VR4D 4YP7A 4C6SA 4WBNF 3LSTA 3VH3A 2AOUB 4HEQA 4HB4A 2B9VA 4P3XA 5F2EA 3HSSA 1VSVA 3DT8A 1DOAA 1X9HA 5LM3A 2ZYHA 4ZT2A 3BMCB 1II9A 3IESA 1KAQA 2WT4A 5I9MA 2ZBPA 1G6Q1 4H60A 2PUDA 3G2QA 2IXDA 4Z51A 4U2EA 4JI8B 2I1VB 1U2DA 3S99A 4CIWA 1G9TA 1W5TA 2GRUA 5DXJA 2GZHA 2YJGA 3U4HA 2ZITA 4CLRB 2D3TA 5C37A 4FMDB 2JLAA 2WNHA 1DQNA 3KBBA 2ZR7A 4FD3A 2YYSA 4X24A 1VMIA 3KWLA 3IIMA 3R7SA 1OD6A 2C04A 2HUNA 2J41A 3C4JA 1JLHA 4B6EA 2JD0A 3AJAA 5DASA 1L1EA 2WF7A 3VHXB 4Z53A 1B74A 4MXDA 1SA0A 1GNQA 2H8GA 1A4UA 4BMXA 3IKLA 2ID9A 4NXMB 1B0AA 1WE2A 1PFGA 4PQYA 3FYCA 3H4IA 5LQAA 4KW7A 1OXUA 2IVZA 3K1AB 5LDGA 4ZI3A 3TR6A 2ZI6A 2W6ID 4CUKA 2UUCB 1LJUA 3C15C 2EF1A 1YBAA 4QGGA 1SQ6A 3EOZA 4OHCA 5LMUB 3AHJA 4K6OA 3OPQA 4C0KA 4U5QA 3VVMA 2IYVA 1JI3A 3IEVA 1QSGA 1USWA 4LAFA 2O0LA 4HGQA 3F1LA 2W6MA 1D6NA 3JALB 3OQPA 5ERXA 2G7MC 2XDQA 5LBUA 1U1DA 3ETCA 2C5GA 4UAVA 5AQEA 3SKVA 1N92A 4EVRA 2FUG6 3PQEA 3OZEA 1CJMA 4U0KA 2PSSA 4DMMA 1NXOA 3SYKA 5DNVA 3IP6A 1E61A 1QGAA 3U7QB 4X95A 3U44B 3IPLA 5B7GA 4YAUA 2CHGA 5IEBA 2W2MA 4OAOA 1C1XA 2YWJA 3KO8A 4BECA 3UA3A 2PBZA 4U7GA 3I12A 2O50A 1ZJ5A 3F67A 4I1VA 4CIYA 2ID7A 4GM1A 1N2CE 1DWPA 2WZCA 2LBPA 2PMCA 3U39A 4UTXA 1Q0SA 3QG1A 2V7TA 5FUVA 4TRNA 5AWFC 1JTVA 2V98A 1N9GA 2CXNA 1ODKA 3K2EA 2NVWA 4HWKA 3ODGA 3OP4A 4FDMA 3LTNC 3DOOA 3NP7A 4A0RA 3FOFC 4TWAA 2G3YA 1F7VA 3BCRA 5D84A 3RTGA 1WZUA 3V00A 2PCLA 4CMAA 4TWRA 3EPRA 1VHTA 4BO3A 5IJ0B 1SOWA 1U0SY 2V55B 1AGPA 1WDTA 3EX7C 3LLUA 3PC2A 1U0NA 2P41A 4KODA 5KU1A 1OWNA 4IHJB 1PW5A 1K7FB 5BMVA 4O4HB 4CM4B 2AA3A 1Z4MA 1JDNA 1YR8A 3AVQA 1UZUA 4ZPXA 1UM9A 3V7FA 2BUBA 2FMUA 4I9NA 4MLCA 4YJ3F 2GBFA 1E79D 1B0UA 3U44A 2G1PA 1GD1O 4NJMB 4B45A 3OEED 1GFZA 2LD4A 3HJFA 1NXTA 4TMYA 3OOWA 3P96A 1D1QA 2POCA 1XQYA 4M1SA 2JLUA 1AT1A 1U2ZA 3L0DA 2EFEB 3T15A 5IKPA 5GINE 1RYYA 2JIQA 3AKDA 2QJOA 4KDRA 4QQNA 4RFSB 1D8TA 1HT3A 1I51A 4DEVA 4DQVA 3HZZA 4D0LB 3NATA 2XECA 4EB3A 4NU0A 3FWNA 1G9XA 3OEHD 1IYZA 1E1NA 4WFIA 5D5QA 1KKMA 3TD9A 4CKYA 2I6QA 4Y9UA 3T7RA 1OILA 4LZWA 5ALOA 2XLBA 2PX2A 4KTVE 2YW2A 2QBYA 2FFBA 1EHYA 2HF8A 5LMNB 1TA0A 1LC3A 1B3RA 2C07A 3Q5DA 3F6EX 1ISFA 3ORFA 1NBAA 5EIBC 3S1LA 1HMYA 5ABPA 3EGXB 1BJTA 2ZG6A 4LRWA 5ERYA 1AGNA 1QVVA 2BUCA 3IKMB 1T1EA 4J4HA 3RVDA 2C31A 2I4OA 3HV2A 4FEEA 4BV2A 3K0HA 1UFQA 3VI3B 4QM7A 4UM9B 3IJRA 1UDAA 4MUJA 5G4KA 5LWHA 2XMCA 1D6JA 4QHSA 4YJFB 1GEEA 1XU9A 5FF9A 3ZGXA 3JD1A 2OG1A 4JIGA 3BPSA 4AY3A 1C9NA 3WNCA 3SEAA 4C0QC 4ZHQF 4JXXA 1IEQA 1RAFA 1LS1A 1YBMA 1YA8A 1R8JA 2EW2A 2IYAA 2J9GA 2ZRLA 4JC5A 1F1BA 1L4NA 1ZMRA 3C7KA 2VCEA 5F2OA 4N5LA 1DE0A 1SBNE 1YH3A 4QOSA 4BVFA 2A2ZA 2AOWA 3IELA 1W0JD 1YCDA 5LUAA 2CNOA 4DNPA 5CG2A 5FV7A 1P0CA 3FYSA 4L72A 5BYBA 3FAZA 5BQPA 3HXKA 3IODA 1FCJA 2HT6A 4UDYX 2J67A 4XOIA 1L4BA 4PC1A 2XCOA 1NVFA 2ZJBA 3TTUA 1YI1A 1M1NB 3NHAA 3HG7A 4G36A 5BT9A 3BDIA 2DWPA 3C1AA 3FVTA 4BGVA 2XJ9A 2AN4A 2I7CA 3LUBA 1XOIA 4O2BF 4OHRA 3O4VA 5H70A 3OU7A 4DVJA 3K73O 3ZVLA 1W25A 1RXSA 1IBKB 1V37A 3A4VA 3H9JA 3TFQA 1ZQ9A 3ABOB 1DIAA 4G0XA 3KQNA 2QRQA 2GN8A 2V6BA 4FFDA 2OK7A 5FB3A 5ULLA 1XCLA 3MGGA 1J90A 4FYXA 1NQOA 1ZA1A 4TLLB 5BSGA 1N8KA 1Z0KA 4OKNA 3R5JA 1AK2A 4FMBB 2M6LA 2QPTA 3CRRA 3UC5A 1RJ9B 1O4VA 1XQ9A 2AEMA 3FCYA 4OU5A 2VZEA 1A8HA 5IX8A 1AIPA 3X1JA 4N5NA 4KQ2A 4H3KB 1Y3BE 1NW5A 2E7ZA 4FR5A 3CCCA 4CLOB 5KTOA 2VPYA 4G81A 3PTZA 1QPBA 4LBYA 2CJWB 4WMLA 3LYAA 4KYIB 4A3SA 4FDLA 1HYHA 3TIXB 4PYNA 5EQFA 1TCVA 4DADA 4AG6A 3W4IA 1Y8QB 2I33A 2JLBA 4NG4A 3EDCA 2P3OA 4A5OA 4E6EA 1H8HA 5TS2A 2HADA 2ZU0C 1LDGA 3KQPA 3DNFA 2AF4C 3KS9A 2QTFA 5BN5B 1TVMA 2ASVA 2QAJA 3A2LA 4JJ8A 4G4IA 3RSSA 1K9SA 3TMYA 2PX8A 1V1MA 1X8KA 4R1QA 4AUEA 4FHFA 1GZUA 4N7JA 2X40A 4WY2A 3HEMA 1NF2A 2VRCD 4JGBA 1EFAA 3TLGA 1ECFA 1NN1A 2QE7A 3E58A 5DCUA 1P7CA 1BQ3A 4LS3A 5FP0A 2COEA 5GM1A 3CF0A 2IS4A 1U5BA 4IEFB 2PL3A 1NBMA 1YA4A 5E6UA 1YB7A 1HDYA 2RGUA 4FFPA 3P0FA 1ZH2A 2C4TA 1EFPB 5FOUA 2HCFA 2XSZA 2EYQA 1WXEA 2Y27A 4LK3A 4R9NA 4W6QA 5CVEA 3W5JA 2CFOA 4RZSA 4MDEA 1FXWF 4TZKA 1TGYA 2NVUA 1XA3A 2PRSA 2WFLB 4PXSA 3UFXA 2WA1A 3LBHA 2XYPA 2ZJ4A 3C6ZA 1UJ6A 2IU3A 3WB9A 4OQNA 1GFIA 2PWYA 4AJHA 3ANXA 2KLBA 3REGA 2KX7A 5FBZA 1FLAA 3BWVA 5JHGB 2VUIB 2XB6A 3E8SA 4QVGA 4WBSA 3UOGA 5T57A 3WLOA 2Q1SA 2QI9F 1BHO1 2R87A 4M9ZA 3QRWA 4N7RA 5BN5A 2V5UA 3L6EA 1OOEA 3ROFA 4QU0A 1ZH8A 3LUKA 1E1LA 2DP4E 1Z4LA 5EGSA 5FUWA 5P8WA 2PMEA 1YCGA 3X1XA 2V7UA 3TLZA 2D0PB 1NRWA 1VHQA 2QNRA 2J9XB 3KM0A 5K0EA 3UO8B 1RADA 3QEKA 5JY6A 4OYHA 3RF6A 5LYJA 1YBVA 3SMQA 3QE0A 4EO9A 1W4BA 1FY2A 4QFBA 4RMJA 4YUWA 4E08A 4IDNA 3BG5A 2PMWB 3DTTA 2NXWA 2VYFA 4NY1A 2FGJA 2WY2D 2VSYA 1T9KA 2X5OA 3PRKE 2XXAB 1PNOA 3KQQA 4UQOA 1TZ2A 3Q8MA 1XJ0A 3RSGA 3R3HA 2DFPA 1CIVA 3CS3A 3ZZUA 3AR9A 4OHUA 3GJ3A 4M7OA 5CXSA 4QOGA 5EE9A 1X2EA 4F6RB 2XVYA 4LCEA 4EG0A 4FM9A 1RNLA 4GWGA 2OCDA 4D9JA 4MJ3A 1AO3A 1WDWB 2I71A 2LR0A 4DMFA 2P9JA 2QX7A 2EFDB 3FWYA 1V95A 3GDFA 3LRPA 4H7HA 1CIPA 5LQRA 3RK0A 3S2ZA 1QIJA 2W2KB 4J75A 5AM1A 4ZT7A 5A3VA 4C43A 2P2LA 1SULA 1PL0A 2H48A 1N6OA 1TVCA 4WI1A 1ILEA 1TIBA 1YS6A 4D57A 3IPCA 1VSUA 3GR6A 5D01A 4H1TA 1GPAA 4ND1A 3NOQA 3WL7A 2FRXA 5JDIA 1QP7A 1U3GA 2YOGA 3SYMA 2HXYA 1ZUNA 1Z2DA 1ODLA 2WIBA 1T4MA 1R16A 2BI7A 1MCZA 1JLRA 1DO8A 1T3ZA 1U7DA 2QMUA 3LUPA 3F97A 4MO9A 2Q6OA 4PHHA 2DVMA 1FTYA 2GD0A 1LVUA 1T4CA 3K2QA 4IIJF 3GFFA 2BN4A 4PV7A 4R1TA 3SQMA 3ZE6A 1VI2A 1IM2A 4AQDA 5EG5A 1CHDA 1SBQA 5JSZA 3STVA 1HDZA 3IKJA 4OP1A 4P7BA 3A04A 2X1VA 3BTSA 4FINA 1SVWA 4I1OA 3UHPA 2WTMA 5IABA 1UBFA 5ISMA 5E3JA 2W4IA 3I6MA 3K05A 4URVR 3OA0A 5LZ9A 3NQ41 4JBIA 3U9LA 3RS2A 2Q5JA 3B70A 1F0PA 1XZLA 4ZCMA 1KKLA 1TQHA 3LT1A 3P20A 3OEWA 1ADFA 3PC8C 4Q4JB 2D62A 2BY4A 2HU8A 3UT5B 2DFDA 3QBVA 3CN9A 1YHYA 3KXIA 5JVDF 2O5EA 3EULA 3H2ZA 4M36A 3L4EA 1I1OA 2AHOA 3OIDA 4EEKA 1UBCA 1E58A 4WHMA 1XNRB 4F2GA 4KXNA 2GVNA 3IV7A 3ENKA 4GBED 1GSIA 3FNIA 3IUBA 2VHZA 4YROA 5A4KA 4RSHA 9MHTA 1ST3A 3IFSA 4HF7A 4K3VA 5E9WA 4CLRA 3K9WA 3OQBA 3Q6NA 4PQGA 4BRZA 1B0PA 2ZRCA 2RCNA 3CUEF 4P4NA 5AYVA 2OOKA 2QMEA 3W1WA 1H6AA 1IK6A 4FEAA 4RFSA 4HUTA 2X2PA 1K4KA 5JSYA 1Y5LA 2Q4TA 2WZDA 4XQGA 5EZQA 2WRZA 3QE2A 4QPPA 4ZVTA 5FPHA 2X76A 3JD0A 4I8DA 1JEYB 1DQRA 3QH4A 4L4YA 3UGQA 1R8QA 1RHMA 2IYYA 5DMHA 4B85A 4DQLA 1J42A 1RCFA 4ZK2A 3Q3HA 3R3YA 5EXDA 2YXNA 2WHRA 1MG5A 3QPCA 1ULUA 1R5OA 4FN4A 2P5UA 4XWYA 4PFKA 4D9GA 1M8KA 1BA2A 1E59A 1ONSA 4G0YA 4ZT4A 5CR9A 2W2QA 4B84A 4CL0A 4OXQA 1QUEA 4UNSA 5HBGA 1G2QA 1YDFA 5EYPB 4KE9A 4WXHA 4CT5A 5BSVA 3QITA 2AFHB 2H7VA 4LWQA 1A96A 1XKQA 1OZFA 3CM0A 3RU9A 1O6BA 4HEHA 4KO1S 1FZQA 4HVTA 3IGFA 3SJZA 3HKBB 3UMBA 1UANA 1YIOA 2X8AA 3KX2A 4W9NC 2O2DA 4O2AF 1L5NA 5JAZA 2ZUEA 2C4NA 5LVAA 3KTFA 1PNRA 1FVHA 1PJTA 3LUCA 1Q21A 3N59A 4IIEA 1F3LA 4XWKA 2ZPAA 1BWPA 1O6GA 2RCYA 3AK4A 3R9XA 1RQNA 3DVAB 3WRVA 1KPIA 2YMQA 3C8DA 4IDPA 4O2AA 5I4KA 1II0A 2F67A 3DR5A 1GFSA 3D3WA 1PZFA 4U6QA 1N8TA 1D5CA 2QTMA 4H9GA 2GEUA 3CPHA 2SICE 3QIVA 1M34B 3IQEA 4ESVA 2QX8A 1CQJA 5NLLA 6NULA 1UK7A 3KBOA 3WK5A 8LDHA 1JR3E 1I3LA 2AN9A 2AZMA 4O4JF 1U28C 3RU7A 4QDUA 1WAMA 4KIGA 4L8VA 4G0OA 1C3VA 2FETA 3IQGX 5CMLA 2IEAA 3PHHA 2VL7A 3ENZA 1T9AA 3D7NA 3JATA 4TM8A 5IJ0A 3UK2A 2C8KA 1KZ9A 3ANYB 2N9UA 3LQQA 5MGNA 1DQSA 4IZHA 4RAQA 3MS7A 1CNMA 1G8GA 1BKYA 2EIXA 1FP2A 2O7VA 1WLYA 1QH0A 4RC9A 3WJ7A 3T9EA 3PDWA 4OIFA 4IHAA 4JI7B 4U8GA 1XMIA 3RWBA 2DMRA 4HRYA 3CEPB 3TNFA 4NCIA 4BQPA 1IAQA 1QHHB 3V9PA 1E62A 2GLUA 2NU8B 4DSOA 1M6YA 1M5UA 3RYHB 4QIHA 2YZ2A 1Z6XA 4PAWA 1RQXA 3DM9B 1H9AA 2BI4A 3QVJA 4TQGA 4CKWB 4UD6A 4ZIRA 9GPBA 5K0ZA 2ZYUX 2GPWA 2B9EA 2YC2C 3E2IA 5E8RA 4BNMA 2ANCA 3LX5A 4PZAA 2O2CA 5E95A 1P4RA 4BZQA 4OUDB 1S96A 2YFHA 1X94A 2R66A 1QKIA 1JBEA 2BRUA 4GBMA 4R6XA 1M1YE 2FOXA 2C97A 3ZUPA 4QBFA 4CVNA 4DTCA 3EVCA 5B1EA 1K6IA 1ETHA 2ATVA 4HQKA 5LNK6 3GGPA 2GM3A 5LP6C 3R5FA 1SVMA 1MVLA 1RAGA 1DG3A 2XB9A 1WBJB 3NV7A 3EG9A 1NVBA 4OB7A 3RRJA 3DOEA 4LDRA 3V1KA 1PWEA 2OCKA 4G8DA 5J23A 3PIRA 1DEHA 2H5JA 5AUNB 3P8ZA 4U2BA 1U3TA 4WKBA 1T9DA 3HEBA 4CIVA 3C1UA 4QUEA 4V0SA 4ROTA 1CLEA 3ITNA 4R31A 1VXRA 5E7JA 4C4RA 5EIFA 4L0MA 3KKZA 2WIKA 4L1KA 3INYA 4GPD1 2QR2A 2CL5A 1SZJG 2MOKA 4H6PA 4PEVA 4REQB 4DJJA 5KWSA 1QU3A 1UDBA 2OAEA 1IAVA 3O7WA 4Q9DA 2W2OA 4R3NA 4UU8A 3GGDA 4O4IA 1JL3A 3EODA 1Z4JA 5HCIA 1I2ZA 2F8MA 4F9FA 5J4VA 3PPXA 1L7NA 2I66A 2PEYA 2SNIE 3CG0A 3BGSA 3HZHA 4MRRA 4NFHA 4D3XA 3OHSX 4EG7A 4BFUA 2G1AA 4RH1A 2FK7A 1MRNA 4JUIA 2WW8A 1C14A 3Q15C 2MU1A 3D7RA 3EXHC 4G0MA 3WC4A 3ET5A 3DAHA 5LNK1 2EJCA 4NEGA 4B2PA 3D64A 3EWNA 4QQ8A 3NOOA 1N3YA 3ZYCA 1P8AA 4TZ6A 4QAQA 1YE5A 4C05A 3T1OA 3UJNA 3B2QA 3WLFA 4AX8A 1XTVA 3KJXA 5BR8B 3VSEA 2PVSA 2C4HA 5JBNA 2O5RA 3IE1A 3LP8A 2FFAA 1GGEA 4F06A 4GKVA 4MEAA 1JJAA 2WU4A 2YINC 3FTPA 3OBIA 5IC4A 4RIIA 3NALA 4HFMA 3F78A 5FPPA 5FLKA 5IXYA 5DXFA 3DMPA 3AG5A 2WAOA 4CM5A 3CTPA 1Y7LA 3C3WA 3FD8A 3IUJA 3MBKA 2WWTA 5ICMA 3QXHA 4ARSA 1U98A 1ZD1A 2QV0A 1LXCA 3F6YA 2HSGA 3HCAA 4BKUA 2BFBA 3IILA 4PNZA 5BXYA 2QAGB 3OG9A 4PTZA 5EE1A 3IBCA 4JNKA 5JCZA 3NVDA 3W9SA 1W0KD 4ZP1A 1FRQA 2D06A 3A4YA 4NULA 2PYDA 2GUWA 1H0KA 2CXQA 2QTTA 5A5GA 1AJEA 1EKXA 4UEOA 4D0GA 1LH0A 3CVVA 4OLAA 3HFRA 1G20A 2COUA 3GFQA 1GT6A 4RF4A 3F96A 5AJUA 3R6DA 3S70A 2J3JA 4FFMA 4COOA 4ZT6A 2C7QA 4INJA 1ZRNA 3DPSA 1SVUA 1PBNA 3HYTA 4LYGA 2O7QA 3OF2A 1QOQB 4O4IB 4Q02A 4DLYA 1UBGA 4DL9A 1E0JA 5GOTA 3R9WA 1XZ8A 3QU5A 4B9EA 1K08A 4Q3BA 3ST7A 1YRAA 3QNUA 1DBWA 1LDBA 4JI0B 3PUIA