3O34A

Crystal structure of trim24 phd-bromo complexed with h3(13-32)k23ac peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
177
Chain Sequence
EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 177
sequence length 181
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o34A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o34A01
5FE8A 4Z1QA 4KCXA 5LKZA 4CCGX 4QSPA 4B7YC 2CSYA 4NR5A 3O36A 1X4IA 4WHWA 4QSUA 5II2A 4A4BA 5FH8A 2GRCA 2R0VA 3N9MA 2QJ0A 5CTLA 3NG2A 3GG3A 5EWHA 5DKAA 4NQMA 5CQ5A 2CKLA 4GNEA 4DONA 4B86C 5BT4A 2YQMA 5AIUA 5D3LA 2E6SA 2EODA 5KH9A 4QSTA 2M6MA 4QSQA 4QEUA 5E9VA 5FB0A 4AP4A 4HXPA 4Y03A 5G4SA 4IR3A 5HM0A 5J3XA 5COIA 4NS5A 4QR5A 3P1EA 5D1MB 4CL9A 3ZPVE 5I89A 5ENGA 4IR6A 4WIVA 5CU8A 5D7XA 2XB1A 4RVRA 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 4LYIA 3U5LA 5EV9A 2KFTA 4ZC9A 5CY9A 4PTBA 2L75A 4YH3A 1E6IA 4YADA 5FE5A 4BW1A 3U5MA 4YBMA 4A9LA 4XY9A 5EI4A 5EA1A 5KTUA 5AITA 5DKDA 4UIVA 4Z6IA 4E96A 1WESA 2ECIA 4O70A 4QEVA 3KV6A 5DKHA 5EQ1A 2RSDA 2I8NA 4N4IA 1F62A 4A9FA 4J1PA 4MENA 1VD4A 4UYHA 4LKAA 2RS9B 5EK9A 3DPLR 5F36A 4UP5A 4ZUXU 2ECWA 4BW2A 4UYGA 4TT4A 2YYNA 2E3KA 2K1JA 4AUQB 5D24A 5E9IA 5C87A 2M85A 3LRQA 2MNZA 5F61A 5ENJA 3P1DA 5LKUA 5F63A 2VJFA 4UITA 2K16A 4NN2A 2KE1A 4NR8A 3O37A 4UIZA 2LN0A 3PHDA 4MR6A 5CFWA 4O7FA 5FE4A 3N9OA 5F1HA 3DAIA 2NAAA 5ENIA 1WUGA 2LGVA 4AYCA 4CUPA 2C2LA 4QSWA 5HEMA 4J3IA 4W4UA 5B8DA 3JVJA 2YHNA 5CGPA 5KU3A 2D8SA 2ECGA 5EWCA 5F1LA 5D3NA 2L85A 5I40A 2KWKA 2KWOA 5EGUA 2MT5A 5EP7A 2G43A 2Y1MA 5FFYA 4PS5A 3PUQA 5I80A 1LDKC 2LGKA 4I7BA 3MHSA 5IGNA 3S91A 4XUAA 5C11A 5L98A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 3JVKA 4IOOA 4N3WA 2BAYA 5K29A 5KHMA 3PURA 1MM2A 5FB1A 5L96A 3UVXA 4CUSA 5LVQA 5A83A 2LV9A 5B77A 4KV1A 2RFJA 4TS8A 5D3TA 5EU1A 4CFLA 5TDWA 2KWNA 5DLZA 3LJWA 3MQMA 4TZ2A 5CP5A 4NUEA 2E7NA 4GNGA 4Q0NA 4O7BA 4HXKA 2LGGA 1WIMA 5A85A 4UIWA 4N4GA 4A9MA 3U5OA 5EPSA 2G6QA 2I50A 5DINA 2KR4A 1K2FA 2NXBA 2D82A 3RPGB 4N4HA 5E7DA 5JWMA 5II1A 5CRMA 5A81A 4I7DA 5E9KA 3UVWA 5FG5A 5EWDA 4TTEA 5D0CA 5E74A 5DKCA 2LXHC 2ZETC 4OUFA 1WEQA 2VJEB 4PCEA 4P5OB 5HRWA 3RTRB 3T6RA 5D1KB 4UYFA 2N9GA 2KTBB 5BT5A 2VP7A 4AVXA 3ZVYA 4YYIA 5G05B 4UYEA 4TU4A 5J0DA 1FBVA 2LRIC 5CUAA 4UYDA 4NRCA 4GPJA 4O7EA 4MSXA 4LYSA 4YY4A 4NYVA 3MHHA 1XWHA 4UYFB 3O35A 5C7NA 4F52B 4HXSA 5E3GA 4WZ3B 2VJEA 2H60A 4UI9B 5E9YA 5FE2A 2LQ6A 3HMHA 4O72A 2R0YA 2HYED 5DW1A 5B75A 1WEEA 2JMDA 1Z6UA 4PCIA 2PUYA 1WEVA 2L43A 2JRJA 5L8UA 1WEPA 2KIZA 5CQ7A 3D7CA 4CA1A 4A4CA 3ONIA 4XYAA 4NUDA 4KV4A 4NQNA 4A9KA 5FH7A 5FFVA 4NRBA 5CQ4A 5AD3A 3I3JA 5A5QA 5IGMA 4BW3A 4A9HA 4WA6A 3ZTGA 3G0JA 3MULA 3AADA 5A5PA 5A5NA 1WEUA 4FIPA 2YSJA 2KGIA 5ENBA 2R0SA 4F3IA 4NYXA 4QUTA 2KU3A 1JSPB 5TRBA 5F60A 5B79A 2RNXA 3GL6A 3LQHA 5FG4A 4O76A 5E3DA 4MR3A 4YYGA 2M1RA 3ASLA 3T7LA 5KH7A 5IGLA 4LZRA 5E0RA 2AN6A 5ACYA 4MR4A 4AKNA 2YEKA 5B76A 5CUGA 5DYAA 1LDJB 2L5EA 3UVDA 1WENA 2VNFA 4A0CD 4O71A 5H1TA 3UV5A 3I2DA 4YABA 3P5OA 3MUKA 5EWVA 2FUIA 2K17A 4ZQLA 4NRAA 4LZSA 5FDZA 5I88A 4HBWA 3SVGA 3UV4A 4QYLA 4NR4A 5CQTA 4QEWA 2CSZA 4TYLA 2LXPC 3P1FA 4QSVA 2PNXA 3UV2A 5H1UA 5ENFA 3K2JA 4QSXA 2F42A 5AMEA 4MVTA 2VJFB 4FLPA 3JVLA 5F3AA 3UVYA 5H85A 1RMDA 1X0JA 4ALHA 3AQAA 5IGKA 2YSMA 4R2YA 5DY7A 3IU5A 2YQDA 4NR7A 5CQ8A 5D25A 5HFQA 1ZBDB 4GB0A 4A9NA 3ZYQA 2R10A 2Y43A 4UIUA 4Z93A 4NXJA 4C66A 5DYCA 2RO1A 4NUCA 4TQNA 2CKLB 5LKXA 4LK9A 2LSPB 4L58A 4IC2A 2JMJA 4TKPB 2OSSA 4CUQA 5CUCA 5EISA 4A9JA 3Q2EA 4NYWA 4BJXA 5I7XA 5JI8A 3ZNIA 5CUEA 5FE0A 1U6GB 5CUBA 5EWWA 4LYWA 4O75A 4CUTA 4QBMA 5KTWA 5D3PA 3KNVA 3SOXA 4O7AA 2YELA 4HBVA 5I7YA 2KGGA 2QICA 2UZGA 4C9ZA 4IR5A 3QZVA 3U5KA 4YYJA 2DX8A 3C5KA 2OXQC 4QB3A 4GNFA 5ENHA 2YUCA 5EVAA 5TABA 5EM3A 3O33A 5HENA 5F25A 5CRZA 2E7OA 5EPRA 4FJCA 2ECVA 4CURA 1VFYA 2K4DA 5FFWA 4QNSA 5I3LA 1ZS5A 4TU6A 2WP1A 4LLBA 5LKTA 5FERA 2EA6A 4YBTA 1CHCA 5C89A 4V3KC 3SOWA 2MJVB 3GV4A 5A5OA 3MB4A 5I1QA 4QR4A 5CPEA 4YYMA 1DVPA 4AYCB 4YATA 1N87A 5ENCA 2DVSA 4R8PK 1IYMA 5DFBA 5ETDA 2FUUA 2MUMA 3DWYA 3LXJA 4N4FA 3HCTA 5CS8A 5DFCA 5D1LB 4MEOA 5FBXA 4QY4A 4CFKA 1JM4B 4WZ2A 3L1XA 4HXOA 2CT2A 5FEYA 4L7XA 4LZ2A 2IDAA 3MXFA 2VPBA 3ZPV1 3N9NA 4TT6A 4TT2A 4PY6A 5FG6A 4HXRA 1G25A 5D3JA 5F2PA 1WEMA 2ECTA 4O64A 2KWJA 4QF2A 4O77A 4QZSA 5TBNA 5IG6A 4R7EA 3HMEA 5KTXA 1N72A 4GNDA 3JVMA 3L11A 2LGLA 3L1ZB 3VK6A 5L97A 3N9PA 2H0DB 2WP2A 4NR9A 4YY6A 2RNYA 5EICA 1JOCA 2MA5A 4WHUA 2L0BA 5HQ5A 1V87A 2F6JA 4CLBA 3O7AA 3KQIA 2ECNA 2YDWA 4YYKA 2OO1A 2QIZA 4YH4A 4QC1A 1Z60A 4MEPA 2DWWA 3IHPA 4PPEA 4Z1SA 5L8TA 5CZGA 3LQJA 4IORA 1EQFA 3M63A 3UW9A 5E9MA 3SOUA 3N9LA 5HQ6A 5IIDA 2MNYA 4LR6A 5I86A 4PKLA 1T1HA 2HDPA 5DX4A 1WGMA 4WZ0A 5FE1A 5DW2A 4NR6A 2KREA 3ZVZB 5G4RA 2Y1NA 1VYXA 5A5RA 4QC3A 2G4AA 5JG6A 5FE3A 3EB6A 5FH6A 5DFDA 3ZYUA 3QZTA 4QSRA 2E6RA 4XI1A 3FKMX 4S3OC 3C6WA 4LC2A 4O7CA 4FO9A 4UIXA 3HMFA 5DYUA 2EGPA 3HCSA 4A9OA 2YT5A 1HYJA 4X2IA 3TLPA 3O70A 5C85A 5D3SA 5E73A 5C4QA 4TZ8A 5I29A 4A9IA 2RNWA 5EYAF 5D3HA 3G0LA 5HFRA 5A82A 2XEUA 4S3OB 2YEMA 5KO4A 4LADB 5LUUA 3QZSA 4Q0OA 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4HXNA 5C8GA 4LJNA 5HLSA 5D26A 2YURA 5LVRA 4YYDA 2L5UA 5HJCA 5AMFA 4IOQA 3V43A 1WE9A 4HXMA 2DVRA 2YREA 2F6NA 4LDFA 3RCWA 2MD8C 5IBNA 2VPDA 2YYRA 2ECJA 3HTKC 4Z6HA 5HRXA 5H1VA 4MR5A 1WEOA 5F62A 4YBSA 2DKWA 3P1CA 5LJ0A 5ETBA 3HCUA 3SVFA 5FE6A 2OUOA 5CQAA 2MA6A 4HXLA 5C13A 5G04B 5D3RA 3EB5A 3M99A 4XY8A 3SVHA 3DQVR 4QYDA 1WFKA 4ZDTA 2YW5A 5LJ2A 4I7CA 2L80A 5TB6A 4QSSA 1WILA 5HQ7A 5A7CA 4IR4A 4QF3A 4YAXA 4QUUA 5B78A 4HBYA 5FE9A 2LDRA 5TDRA 5CQ6A 2YW8A 4UP0A 3FL2A 4OGIA 3SHBA 5DYXA 5HELA 3RPGC 5CUDA 2DVVA 2MIQA 4HBXA 5HRVA 3O34A 4O74A 4OGJA 2RI7A 5LCWB 2MD7B 3NXBA 5CQ3A 3LQIA 4BW4A 3Q2FA 3U5JA 5HCLA 2L84A 5LJ1A 4O78A 2FSAA 5E9LA 2DVQA 2D9EA 2YHOA 3U5NA 5I83A 5AD2A 1HYIA 5EPBA 4J0RA 4QR3A 2C2VS 2G45A 3S92A 2DATA 4MEQA 4YK0A 3U5PA 2H0DA 4IC3A 4BHWA 1WUMA 3MB3A 5F5ZA 5L99A 3N9QA 1X4JA 4LRGA 4UIYA 4A49A 5DBMA 4YYHA 4C67A 2YQLA 1E4UA 4J0SA 4YYNA 2KYUA 5ENEA 2VPEA 4BBQA 5TCMA 1JM7A 5BT3A 4XUBA 4ALGA 2I7KA 4CUUA 4ZW1A 2JMIA 3IU6A 5DLXA 4A9EA 5FE7A 2M3HA 5H9MA 5A5SA 1F68A
chains in the Genus database with same CATH superfamily
2XOZA 5FE8A 4Z1QA 4KCXA 5LKZA 4CCGX 4QSPA 4B7YC 2CSYA 4NR5A 3O36A 1X4IA 4WHWA 4QSUA 5II2A 4A4BA 5FH8A 2GRCA 2JUNA 2R0VA 3N9MA 2QJ0A 5CTLA 3NG2A 3GG3A 5EWHA 5DKAA 4NQMA 5CQ5A 2CKLA 4GNEA 4DONA 4B86C 5BT4A 2YQMA 5AIUA 4Z0RA 5D3LA 2E6SA 2EODA 5KH9A 4QSTA 2M6MA 4QSQA 4QEUA 5E9VA 5FB0A 4AP4A 4HXPA 4Y03A 5G4SA 4IR3A 5HM0A 5J3XA 5COIA 4NS5A 4QR5A 3P1EA 5D1MB 4CL9A 3ZPVE 5I89A 5ENGA 3ERRA 4IR6A 4WIVA 5CU8A 5D7XA 2XB1A 4RVRA 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 4LYIA 3U5LA 2E61A 5EV9A 2KFTA 3DWDA 4ZC9A 5CY9A 4PTBA 2L75A 4YH3A 1E6IA 4YADA 5FE5A 4BW1A 3U5MA 4YBMA 4A9LA 4XY9A 5EI4A 5EA1A 5KTUA 5AITA 5DKDA 4UIVA 4Z6IA 4E96A 1WESA 2ECIA 4O70A 4QEVA 3KV6A 5DKHA 5EQ1A 2RSDA 2I8NA 4N4IA 1F62A 4A9FA 4J1PA 4MENA 1MBMA 1VD4A 4UYHA 4LKAA 2RS9B 5EK9A 3DPLR 5SVYA 5F36A 4Z0OA 4UP5A 4ZUXU 2ECWA 4BW2A 4UYGA 4TT4A 2YYNA 5SVIB 2E3KA 2K1JA 4AUQB 5D24A 5E9IA 5C87A 2M85A 3LRQA 2MNZA 5F61A 5ENJA 3P1DA 3PLWA 5LKUA 5F63A 2VJFA 4UITA 2K16A 4NN2A 2KE1A 4NR8A 3O37A 4UIZA 2LN0A 3PHDA 4MR6A 5CFWA 4O7FA 5FE4A 3N9OA 5F1HA 3DAIA 3D1BA 2NAAA 5ENIA 3MDBC 1WUGA 2LGVA 4AYCA 4CUPA 2C2LA 4QSWA 2YVRA 5HEMA 4J3IA 4W4UA 5B8DA 3JVJA 2YHNA 5CGPA 5KU3A 2D8SA 2ECGA 2IQJA 5EWCA 5F1LA 5D3NA 2L85A 5I40A 2KWKA 2KWOA 5EGUA 2MT5A 5EP7A 2G43A 2Y1MA 5FFYA 4PS5A 3PUQA 5I80A 1LDKC 2LGKA 4I7BA 3MHSA 5IGNA 3S91A 4XUAA 3LVQE 5C11A 5L98A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 3JVKA 4IOOA 4N3WA 2BAYA 5K29A 5KHMA 3PURA 1MM2A 5FB1A 5L96A 3UVXA 4CUSA 5LVQA 5A83A 2LV9A 5B77A 4KV1A 2RFJA 4TS8A 5D3TA 5EU1A 4CFLA 5TDWA 2KWNA 5DLZA 2D8UA 3LJWA 3MQMA 4TZ2A 5CP5A 4NUEA 2E7NA 4GNGA 4Q0NA 4O7BA 4HXKA 2LGGA 1WIMA 5A85A 4UIWA 4N4GA 4A9MA 3U5OA 5EPSA 2G6QA 2I50A 3KDEC 5DINA 2KR4A 1K2FA 2NXBA 2D82A 3RPGB 4N4HA 4H9DA 5E7DA 5JWMA 5II1A 2LAUA 5CRMA 5A81A 4I7DA 5E9KA 3UVWA 3KNVA 5FG5A 5EWDA 4TTEA 5D0CA 5E74A 5DKCA 2LXHC 2ZETC 4OUFA 1WEQA 2VJEB 4PCEA 4P5OB 5HRWA 3RTRB 3T6RA 5D1KB 4UYFA 3E2DA 2N9GA 2KTBB 5BT5A 2VP7A 4AVXA 3ZVYA 4YYIA 5G05B 4UYEA 4TU4A 5J0DA 1FBVA 2LRIC 5CUAA 4UYDA 1PUOA 4NRCA 4GPJA 4O7EA 4MSXA 4LYSA 4YY4A 4NYVA 3MHHA 1XWHA 4UYFB 3O35A 5C7NA 4F52B 4HXSA 5E3GA 4WZ3B 2VJEA 2H60A 4UI9B 5E9YA 5FE2A 3JUEA 2LQ6A 3HMHA 4O72A 2R0YA 2HYED 5DW1A 5B75A 1WEEA 2JMDA 1Z6UA 4PCIA 2PUYA 1WEVA 2L43A 2JRJA 5L8UA 1WEPA 2KIZA 5CQ7A 3D7CA 4CA1A 4A4CA 3ONIA 4XYAA 4NUDA 4KV4A 4NQNA 4A9KA 5FH7A 2L7PA 5FFVA 4NRBA 5CQ4A 4AI6A 2FD4A 5AD3A 3I3JA 5A5QA 5IGMA 4BW3A 3FM8C 4A9HA 4WA6A 3ZTGA 3G0JA 3MULA 3AADA 5A5PA 5A5NA 1WEUA 4FIPA 2YSJA 2KGIA 2DSMA 2B0OE 5SVIA 5ENBA 2R0SA 4F3IA 4NYXA 4QUTA 3VKGA 2KU3A 1JSPB 5TRBA 5F60A 5B79A 2RNXA 3GL6A 3LQHA 5FG4A 4O76A 5E3DA 4MR3A 4YYGA 2M1RA 3ASLA 3T7LA 5KH7A 5IGLA 4LZRA 5E0RA 2AN6A 5ACYA 4MR4A 4AKNA 2YEKA 5B76A 5CUGA 5DYAA 1LDJB 2L5EA 3UVDA 1WENA 2VNFA 4A0CD 3H7HA 4O71A 5H1TA 3UV5A 3I2DA 4YABA 3P5OA 3MUKA 5EWVA 2FUIA 2K17A 4ZQLA 4NRAA 4LZSA 5FDZA 5I88A 4AKHA 4HBWA 3SVGA 3UV4A 4QYLA 4NR4A 5CQTA 4QEWA 2CSZA 4TYLA 2LXPC 3P1FA 4QSVA 2PNXA 2KKXA 3UV2A 2CSVA 5H1UA 5ENFA 3LJUX 3K2JA 4QSXA 2F42A 5AMEA 4MVTA 2VJFB 2EJNA 3JVLA 4FLPA 5F3AA 5H85A 3UVYA 1RMDA 1X0JA 4ALHA 3AQAA 4OGCA 5IGKA 2YSMA 4R2YA 5DY7A 3IU5A 2YQDA 4NR7A 5CQ8A 5D25A 5HFQA 1ZBDB 4GB0A 4A9NA 3ZYQA 2R10A 2Y43A 4UIUA 4Z93A 4NXJA 4C66A 5DYCA 2RO1A 4NUCA 4TQNA 2CKLB 5LKXA 4LK9A 2LSPB 4L58A 4IC2A 4QQ4A 2JMJA 4TKPB 2OSSA 4CUQA 5CUCA 5EISA 4A9JA 3Q2EA 4NYWA 4BJXA 1DCQA 5I7XA 5JI8A 3ZNIA 5CUEA 5FE0A 1U6GB 5CUBA 5EWWA 4LYWA 4O75A 4CUTA 4QBMA 5KTWA 5D3PA 2XOCA 2FFWA 3DDTA 4O7AA 2YELA 4HBVA 5I7YA 2KGGA 2QICA 2UZGA 4C9ZA 4IR5A 3QZVA 3U5KA 4YYJA 2DX8A 3C5KA 2OXQC 4QB3A 4GNFA 5ENHA 2KKYA 2YUCA 2CRRA 5EVAA 5TABA 5EM3A 3O33A 5HENA 5F25A 5CRZA 2E7OA 5EPRA 4FJCA 2ECVA 4CURA 2EGMA 1VFYA 2K4DA 5FFWA 4QNSA 5I3LA 1ZS5A 4TU6A 2EXUA 2WP1A 4LLBA 5LKTA 5FERA 2EA6A 4YBTA 1CHCA 5C89A 4V3KC 3SOWA 2MJVB 3GV4A 5A5OA 3MB4A 5I1QA 4QR4A 5CPEA 4YYMA 1DVPA 4AYCB 4YATA 1N87A 5ENCA 2DVSA 4R8PK 1IYMA 5DFBA 5ETDA 2FUUA 2MUMA 3DWYA 3LXJA 4N4FA 3HCTA 5CS8A 5DFCA 5D1LB 4MEOA 5FBXA 4QY4A 4CFKA 3O47A 1JM4B 4WZ2A 3L1XA 4HXOA 2CT2A 5FEYA 4L7XA 4LZ2A 2IDAA 3MXFA 2VPBA 3ZPV1 3N9NA 4TT6A 4TT2A 4PY6A 5FG6A 3FJUB 4HXRA 1G25A 5D3JA 4O62A 5F2PA 1WEMA 2ECTA 4AKIA 2KWJA 4O64A 4QF2A 4O77A 4QZSA 5TBNA 5IG6A 4R7EA 3SUBA 3HMEA 5KTXA 1N72A 4GNDA 3JVMA 3L11A 2LGLA 3L1ZB 3VK6A 5L97A 3N9PA 2H0DB 2WP2A 4NR9A 4YY6A 2RNYA 5EICA 1JOCA 2MA5A 4WHUA 2L0BA 5HQ5A 1V87A 2F6JA 4CLBA 3O7AA 3KQIA 2ECNA 2YDWA 4YYKA 2OO1A 2QIZA 4YH4A 4QC1A 1Z60A 4MEPA 2DWWA 3IHPA 4PPEA 4Z1SA 5L8TA 3T9KA 5CZGA 3LQJA 4IORA 2OWAA 1EQFA 3M63A 3Q1DA 3UW9A 5E9MA 3SOUA 3N9LA 4AKGA 5HQ6A 5IIDA 2MNYA 4LR6A 5I86A 4PKLA 1T1HA 2HDPA 5DX4A 1WGMA 4WZ0A 5FE1A 5DW2A 3M7KA 4NR6A 2KREA 2P57A 3ZVZB 5G4RA 2CONA 2Y1NA 1VYXA 5A5RA 4QC3A 2CRWA 3LVRE 2G4AA 5JG6A 3FEHA 5FE3A 3EB6A 3VKHA 5FH6A 5DFDA 3ZYUA 3QZTA 4QSRA 2E6RA 4XI1A 3FKMX 4S3OC 3C6WA 4LC2A 4O7CA 4FO9A 4UIXA 3HMFA 5DYUA 2EGPA 3HCSA 4A9OA 2YT5A 1HYJA 4X2IA 3TLPA 3O70A 5C85A 5D3SA 5E73A 5C4QA 4TZ8A 5I29A 4A9IA 2RNWA 5EYAF 5D3HA 3G0LA 5HFRA 5A82A 2XEUA 4S3OB 5SVXA 2YEMA 5KO4A 4LADB 5LUUA 3QZSA 4Q0OA 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4HXNA 5C8GA 4LJNA 5HLSA 3SOXA 5D26A 2M13A 2YURA 5LVRA 4YYDA 2L5UA 5HJCA 5AMFA 4IOQA 4OGEA 3V43A 1WE9A 4HXMA 2DVRA 2YREA 2F6NA 4LDFA 3RCWA 2MD8C 5IBNA 2VPDA 2YYRA 2ECJA 2RR4A 3HTKC 4Z6HA 5HRXA 5H1VA 4MR5A 1WEOA 5F62A 4YBSA 2DKWA 3P1CA 5LJ0A 5ETBA 3HCUA 3SVFA 5FE6A 2OUOA 5CQAA 2MA6A 4HXLA 5C13A 5G04B 5D3RA 3EB5A 3M99A 4F1PA 4XY8A 3SVHA 3DQVR 4QYDA 1WFKA 4ZDTA 2YW5A 5LJ2A 4I7CA 2L80A 5TB6A 4QSSA 1WILA 5HQ7A 5A7CA 4IR4A 2MKEA 4QF3A 4YAXA 4QUUA 3FAOA 5B78A 4HBYA 5FE9A 2LDRA 3LDYA 5TDRA 5CQ6A 2YW8A 4UP0A 3FANA 4OGIA 3FL2A 3SHBA 5DYXA 5HELA 3RPGC 5CUDA 2DVVA 2MIQA 4HBXA 5HRVA 3O34A 4O74A 4OGJA 2RI7A 5LCWB 2MD7B 3NXBA 5CQ3A 3LQIA 2XOYA 4BW4A 2DJAA 3Q2FA 3U5JA 5HCLA 2L84A 5LJ1A 4O78A 2FSAA 5E9LA 2DVQA 2JM3A 1ZKRA 2D9EA 2XP0A 2YHOA 3U5NA 5I83A 5K3QA 5AD2A 1HYIA 5EPBA 4J0RA 4QR3A 2C2VS 2G45A 3S92A 2DATA 4MEQA 4YK0A 3U5PA 2H0DA 4IC3A 4BHWA 1WUMA 3MB3A 5F5ZA 5L99A 3N9QA 1X4JA 4LRGA 4UIYA 4A49A 5DBMA 4YYHA 4C67A 2YQLA 1E4UA 3D1DA 4J0SA 4YYNA 5ENEA 2KYUA 2VPEA 5TCMA 4BBQA 1JM7A 5BT3A 4XUBA 4ALGA 2I7KA 4CUUA 4ZW1A 2JMIA 3IU6A 5DLXA 4A9EA 5FE7A 2M3HA 5H9MA 5A5SA 1F68A
chains in the Genus database with same CATH topology
5FE8A 4Z1QA 4KCXA 5LKZA 4CCGX 4QSPA 4B7YC 2CSYA 4NR5A 3O36A 1X4IA 4WHWA 4QSUA 5II2A 4A4BA 5FH8A 2GRCA 2R0VA 3N9MA 2QJ0A 5CTLA 3NG2A 3GG3A 5EWHA 5DKAA 4NQMA 5CQ5A 2CKLA 4GNEA 4DONA 4B86C 5BT4A 2YQMA 5AIUA 5D3LA 2E6SA 2EODA 5KH9A 4QSTA 2M6MA 4QSQA 4QEUA 5E9VA 5FB0A 4AP4A 4HXPA 4Y03A 5G4SA 4IR3A 5HM0A 5J3XA 5COIA 4NS5A 4QR5A 3P1EA 5D1MB 4CL9A 3ZPVE 5I89A 5ENGA 4IR6A 4WIVA 5CU8A 5D7XA 2XB1A 4RVRA 3KV5A 4Q6FA 1MM3A 4V3LC 1X4UA 1WEWA 1BORA 4FK5A 4LYIA 3U5LA 5EV9A 2KFTA 4ZC9A 5CY9A 4PTBA 2L75A 4YH3A 1E6IA 4YADA 5FE5A 4BW1A 3U5MA 4YBMA 4A9LA 4XY9A 5EI4A 5EA1A 5KTUA 5AITA 5DKDA 4UIVA 4Z6IA 4E96A 1WESA 2ECIA 4O70A 4QEVA 3KV6A 5DKHA 5EQ1A 2RSDA 2I8NA 4N4IA 1F62A 4A9FA 4J1PA 4MENA 1VD4A 4UYHA 4LKAA 2RS9B 5EK9A 3DPLR 5F36A 4UP5A 4ZUXU 2ECWA 4BW2A 4UYGA 4TT4A 2YYNA 2E3KA 2K1JA 4AUQB 5D24A 5E9IA 5C87A 2M85A 3LRQA 2MNZA 5F61A 5ENJA 3P1DA 5LKUA 5F63A 2VJFA 4UITA 2K16A 4NN2A 2KE1A 4NR8A 3O37A 4UIZA 2LN0A 3PHDA 4MR6A 5CFWA 4O7FA 5FE4A 3N9OA 5F1HA 3DAIA 2NAAA 5ENIA 1WUGA 2LGVA 4AYCA 4CUPA 2C2LA 4QSWA 5HEMA 4J3IA 4W4UA 5B8DA 3JVJA 2YHNA 5CGPA 5KU3A 2D8SA 2ECGA 5EWCA 5F1LA 5D3NA 2L85A 5I40A 2KWKA 2KWOA 5EGUA 2MT5A 5EP7A 2G43A 2Y1MA 5FFYA 4PS5A 3PUQA 5I80A 1LDKC 2LGKA 4I7BA 3MHSA 5IGNA 3S91A 4XUAA 5C11A 5L98A 2VPGA 3M62A 4YC9A 1Z2QA 4X3GA 3JVKA 4IOOA 4N3WA 2BAYA 5K29A 5KHMA 3PURA 1MM2A 5FB1A 5L96A 3UVXA 4CUSA 5LVQA 5A83A 2LV9A 5B77A 4KV1A 2RFJA 4TS8A 5D3TA 5EU1A 4CFLA 5TDWA 2KWNA 5DLZA 3LJWA 3MQMA 4TZ2A 5CP5A 4NUEA 2E7NA 4GNGA 4Q0NA 4O7BA 4HXKA 2LGGA 1WIMA 5A85A 4UIWA 4N4GA 4A9MA 3U5OA 5EPSA 2G6QA 2I50A 5DINA 2KR4A 1K2FA 2NXBA 2D82A 3RPGB 4N4HA 5E7DA 5JWMA 5II1A 5CRMA 5A81A 4I7DA 5E9KA 3UVWA 5FG5A 5EWDA 4TTEA 5D0CA 5E74A 5DKCA 2LXHC 2ZETC 4OUFA 1WEQA 2VJEB 4PCEA 4P5OB 5HRWA 3RTRB 3T6RA 5D1KB 4UYFA 2N9GA 2KTBB 5BT5A 2VP7A 4AVXA 3ZVYA 4YYIA 5G05B 4UYEA 4TU4A 5J0DA 1FBVA 2LRIC 5CUAA 4UYDA 4NRCA 4GPJA 4O7EA 4MSXA 4LYSA 4YY4A 4NYVA 3MHHA 1XWHA 4UYFB 3O35A 5C7NA 4F52B 4HXSA 5E3GA 4WZ3B 2VJEA 2H60A 4UI9B 5E9YA 5FE2A 2LQ6A 3HMHA 4O72A 2R0YA 2HYED 5DW1A 5B75A 1WEEA 2JMDA 1Z6UA 4PCIA 2PUYA 1WEVA 2L43A 2JRJA 5L8UA 1WEPA 2KIZA 5CQ7A 3D7CA 4CA1A 4A4CA 3ONIA 4XYAA 4NUDA 4KV4A 4NQNA 4A9KA 5FH7A 5FFVA 4NRBA 5CQ4A 5AD3A 3I3JA 5A5QA 5IGMA 4BW3A 4A9HA 4WA6A 3ZTGA 3G0JA 3MULA 3AADA 5A5PA 5A5NA 1WEUA 4FIPA 2YSJA 2KGIA 5ENBA 2R0SA 4F3IA 4NYXA 4QUTA 2KU3A 1JSPB 5TRBA 5F60A 5B79A 2RNXA 3GL6A 3LQHA 5FG4A 4O76A 5E3DA 4MR3A 4YYGA 2M1RA 3ASLA 3T7LA 5KH7A 5IGLA 4LZRA 5E0RA 2AN6A 5ACYA 4MR4A 4AKNA 2YEKA 5B76A 5CUGA 5DYAA 1LDJB 2L5EA 3UVDA 1WENA 2VNFA 4A0CD 4O71A 5H1TA 3UV5A 3I2DA 4YABA 3P5OA 3MUKA 5EWVA 2FUIA 2K17A 4ZQLA 4NRAA 4LZSA 5FDZA 5I88A 4HBWA 3SVGA 3UV4A 4QYLA 4NR4A 5CQTA 4QEWA 2CSZA 4TYLA 2LXPC 3P1FA 4QSVA 2PNXA 3UV2A 5H1UA 5ENFA 3K2JA 4QSXA 2F42A 5AMEA 4MVTA 2VJFB 4FLPA 3JVLA 5F3AA 3UVYA 5H85A 1RMDA 1X0JA 4ALHA 3AQAA 5IGKA 2YSMA 4R2YA 5DY7A 3IU5A 2YQDA 4NR7A 5CQ8A 5D25A 5HFQA 1ZBDB 4GB0A 4A9NA 3ZYQA 2R10A 2Y43A 4UIUA 4Z93A 4NXJA 4C66A 5DYCA 2RO1A 4NUCA 4TQNA 2CKLB 5LKXA 4LK9A 2LSPB 4L58A 4IC2A 2JMJA 4TKPB 2OSSA 4CUQA 5CUCA 5EISA 4A9JA 3Q2EA 4NYWA 4BJXA 5I7XA 5JI8A 3ZNIA 5CUEA 5FE0A 1U6GB 5CUBA 5EWWA 4LYWA 4O75A 4CUTA 4QBMA 5KTWA 5D3PA 3KNVA 3SOXA 4O7AA 2YELA 4HBVA 5I7YA 2KGGA 2QICA 2UZGA 4C9ZA 4IR5A 3QZVA 3U5KA 4YYJA 2DX8A 3C5KA 2OXQC 4QB3A 4GNFA 5ENHA 2YUCA 5EVAA 5TABA 5EM3A 3O33A 5HENA 5F25A 5CRZA 2E7OA 5EPRA 4FJCA 2ECVA 4CURA 1VFYA 2K4DA 5FFWA 4QNSA 5I3LA 1ZS5A 4TU6A 2WP1A 4LLBA 5LKTA 5FERA 2EA6A 4YBTA 1CHCA 5C89A 4V3KC 3SOWA 2MJVB 3GV4A 5A5OA 3MB4A 5I1QA 4QR4A 5CPEA 4YYMA 1DVPA 4AYCB 4YATA 1N87A 5ENCA 2DVSA 4R8PK 1IYMA 5DFBA 5ETDA 2FUUA 2MUMA 3DWYA 3LXJA 4N4FA 3HCTA 5CS8A 5DFCA 5D1LB 4MEOA 5FBXA 4QY4A 4CFKA 1JM4B 4WZ2A 3L1XA 4HXOA 2CT2A 5FEYA 4L7XA 4LZ2A 2IDAA 3MXFA 2VPBA 3ZPV1 3N9NA 4TT6A 4TT2A 4PY6A 5FG6A 4HXRA 1G25A 5D3JA 5F2PA 1WEMA 2ECTA 4O64A 2KWJA 4QF2A 4O77A 4QZSA 5TBNA 5IG6A 4R7EA 3HMEA 5KTXA 1N72A 4GNDA 3JVMA 3L11A 2LGLA 3L1ZB 3VK6A 5L97A 3N9PA 2H0DB 2WP2A 4NR9A 4YY6A 2RNYA 5EICA 1JOCA 2MA5A 4WHUA 2L0BA 5HQ5A 1V87A 2F6JA 4CLBA 3O7AA 3KQIA 2ECNA 2YDWA 4YYKA 2OO1A 2QIZA 4YH4A 4QC1A 1Z60A 4MEPA 2DWWA 3IHPA 4PPEA 4Z1SA 5L8TA 5CZGA 3LQJA 4IORA 1EQFA 3M63A 3UW9A 5E9MA 3SOUA 3N9LA 5HQ6A 5IIDA 2MNYA 4LR6A 5I86A 4PKLA 1T1HA 2HDPA 5DX4A 1WGMA 4WZ0A 5FE1A 5DW2A 4NR6A 2KREA 3ZVZB 5G4RA 2Y1NA 1VYXA 5A5RA 4QC3A 2G4AA 5JG6A 5FE3A 3EB6A 5FH6A 5DFDA 3ZYUA 3QZTA 4QSRA 2E6RA 4XI1A 3FKMX 4S3OC 3C6WA 4LC2A 4O7CA 4FO9A 4UIXA 3HMFA 5DYUA 2EGPA 3HCSA 4A9OA 2YT5A 1HYJA 4X2IA 3TLPA 3O70A 5C85A 5D3SA 5E73A 5C4QA 4TZ8A 5I29A 4A9IA 2RNWA 5EYAF 5D3HA 3G0LA 5HFRA 5A82A 2XEUA 4S3OB 2YEMA 5KO4A 4LADB 5LUUA 3QZSA 4Q0OA 1FP0A 5KH3A 5G0FA 2YU4A 1JM7B 4HXNA 5C8GA 4LJNA 5HLSA 5D26A 2YURA 5LVRA 4YYDA 2L5UA 5HJCA 5AMFA 4IOQA 3V43A 1WE9A 4HXMA 2DVRA 2YREA 2F6NA 4LDFA 3RCWA 2MD8C 5IBNA 2VPDA 2YYRA 2ECJA 3HTKC 4Z6HA 5HRXA 5H1VA 4MR5A 1WEOA 5F62A 4YBSA 2DKWA 3P1CA 5LJ0A 5ETBA 3HCUA 3SVFA 5FE6A 2OUOA 5CQAA 2MA6A 4HXLA 5C13A 5G04B 5D3RA 3EB5A 3M99A 4XY8A 3SVHA 3DQVR 4QYDA 1WFKA 4ZDTA 2YW5A 5LJ2A 4I7CA 2L80A 5TB6A 4QSSA 1WILA 5HQ7A 5A7CA 4IR4A 4QF3A 4YAXA 4QUUA 5B78A 4HBYA 5FE9A 2LDRA 5TDRA 5CQ6A 2YW8A 4UP0A 3FL2A 4OGIA 3SHBA 5DYXA 5HELA 3RPGC 5CUDA 2DVVA 2MIQA 4HBXA 5HRVA 3O34A 4O74A 4OGJA 2RI7A 5LCWB 2MD7B 3NXBA 5CQ3A 3LQIA 4BW4A 3Q2FA 3U5JA 5HCLA 2L84A 5LJ1A 4O78A 2FSAA 5E9LA 2DVQA 2D9EA 2YHOA 3U5NA 5I83A 5AD2A 1HYIA 5EPBA 4J0RA 4QR3A 2C2VS 2G45A 3S92A 2DATA 4MEQA 4YK0A 3U5PA 2H0DA 4IC3A 4BHWA 1WUMA 3MB3A 5F5ZA 5L99A 3N9QA 1X4JA 4LRGA 4UIYA 4A49A 5DBMA 4YYHA 4C67A 2YQLA 1E4UA 4J0SA 4YYNA 2KYUA 5ENEA 2VPEA 4BBQA 5TCMA 1JM7A 5BT3A 4XUBA 4ALGA 2I7KA 4CUUA 4ZW1A 2JMIA 3IU6A 5DLXA 4A9EA 5FE7A 2M3HA 5H9MA 5A5SA 1F68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FE8 A;  4Z1Q A;  4KCX A;  5LKZ A;  4CCG X;  4QSP A;  4B7Y C;  2CSY A;  4NR5 A;  3O36 A;  1X4I A;  4WHW A;  4QSU A;  5II2 A;  4A4B A;  5FH8 A;  2GRC A;  2R0V A;  3N9M A;  2QJ0 A;  5CTL A;  3NG2 A;  3GG3 A;  5EWH A;  5DKA A;  4NQM A;  5CQ5 A;  2CKL A;  4GNE A;  4DON A;  4B86 C;  5BT4 A;  2YQM A;  5AIU A;  5D3L A;  2E6S A;  2EOD A;  5KH9 A;  4QST A;  2M6M A;  4QSQ A;  4QEU A;  5E9V A;  5FB0 A;  4AP4 A;  4HXP A;  4Y03 A;  5G4S A;  4IR3 A;  5HM0 A;  5J3X A;  5COI A;  4NS5 A;  4QR5 A;  3P1E A;  5D1M B;  4CL9 A;  3ZPV E;  5I89 A;  5ENG A;  4IR6 A;  4WIV A;  5CU8 A;  5D7X A;  2XB1 A;  4RVR A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  4LYI A;  3U5L A;  5EV9 A;  2KFT A;  4ZC9 A;  5CY9 A;  4PTB A;  2L75 A;  4YH3 A;  1E6I A;  4YAD A;  5FE5 A;  4BW1 A;  3U5M A;  4YBM A;  4A9L A;  4XY9 A;  5EI4 A;  5EA1 A;  5KTU A;  5AIT A;  5DKD A;  4UIV A;  4Z6I A;  4E96 A;  1WES A;  2ECI A;  4O70 A;  4QEV A;  3KV6 A;  5DKH A;  5EQ1 A;  2RSD A;  2I8N A;  4N4I A;  1F62 A;  4A9F A;  4J1P A;  4MEN A;  1VD4 A;  4UYH A;  4LKA A;  2RS9 B;  5EK9 A;  3DPL R;  5F36 A;  4UP5 A;  4ZUX U;  2ECW A;  4BW2 A;  4UYG A;  4TT4 A;  2YYN A;  2E3K A;  2K1J A;  4AUQ B;  5D24 A;  5E9I A;  5C87 A;  2M85 A;  3LRQ A;  2MNZ A;  5F61 A;  5ENJ A;  3P1D A;  5LKU A;  5F63 A;  2VJF A;  4UIT A;  2K16 A;  4NN2 A;  2KE1 A;  4NR8 A;  3O37 A;  4UIZ A;  2LN0 A;  3PHD A;  4MR6 A;  5CFW A;  4O7F A;  5FE4 A;  3N9O A;  5F1H A;  3DAI A;  2NAA A;  5ENI A;  1WUG A;  2LGV A;  4AYC A;  4CUP A;  2C2L A;  4QSW A;  5HEM A;  4J3I A;  4W4U A;  5B8D A;  3JVJ A;  2YHN A;  5CGP A;  5KU3 A;  2D8S A;  2ECG A;  5EWC A;  5F1L A;  5D3N A;  2L85 A;  5I40 A;  2KWK A;  2KWO A;  5EGU A;  2MT5 A;  5EP7 A;  2G43 A;  2Y1M A;  5FFY A;  4PS5 A;  3PUQ A;  5I80 A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  5IGN A;  3S91 A;  4XUA A;  5C11 A;  5L98 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  3JVK A;  4IOO A;  4N3W A;  2BAY A;  5K29 A;  5KHM A;  3PUR A;  1MM2 A;  5FB1 A;  5L96 A;  3UVX A;  4CUS A;  5LVQ A;  5A83 A;  2LV9 A;  5B77 A;  4KV1 A;  2RFJ A;  4TS8 A;  5D3T A;  5EU1 A;  4CFL A;  5TDW A;  2KWN A;  5DLZ A;  3LJW A;  3MQM A;  4TZ2 A;  5CP5 A;  4NUE A;  2E7N A;  4GNG A;  4Q0N A;  4O7B A;  4HXK A;  2LGG A;  1WIM A;  5A85 A;  4UIW A;  4N4G A;  4A9M A;  3U5O A;  5EPS A;  2G6Q A;  2I50 A;  5DIN A;  2KR4 A;  1K2F A;  2NXB A;  2D82 A;  3RPG B;  4N4H A;  5E7D A;  5JWM A;  5II1 A;  5CRM A;  5A81 A;  4I7D A;  5E9K A;  3UVW A;  5FG5 A;  5EWD A;  4TTE A;  5D0C A;  5E74 A;  5DKC A;  2LXH C;  2ZET C;  4OUF A;  1WEQ A;  2VJE B;  4PCE A;  4P5O B;  5HRW A;  3RTR B;  3T6R A;  5D1K B;  4UYF A;  2N9G A;  2KTB B;  5BT5 A;  2VP7 A;  4AVX A;  3ZVY A;  4YYI A;  5G05 B;  4UYE A;  4TU4 A;  5J0D A;  1FBV A;  2LRI C;  5CUA A;  4UYD A;  4NRC A;  4GPJ A;  4O7E A;  4MSX A;  4LYS A;  4YY4 A;  4NYV A;  3MHH A;  1XWH A;  4UYF B;  3O35 A;  5C7N A;  4F52 B;  4HXS A;  5E3G A;  4WZ3 B;  2VJE A;  2H60 A;  4UI9 B;  5E9Y A;  5FE2 A;  2LQ6 A;  3HMH A;  4O72 A;  2R0Y A;  2HYE D;  5DW1 A;  5B75 A;  1WEE A;  2JMD A;  1Z6U A;  4PCI A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  5L8U A;  1WEP A;  2KIZ A;  5CQ7 A;  3D7C A;  4CA1 A;  4A4C A;  3ONI A;  4XYA A;  4NUD A;  4KV4 A;  4NQN A;  4A9K A;  5FH7 A;  5FFV A;  4NRB A;  5CQ4 A;  5AD3 A;  3I3J A;  5A5Q A;  5IGM A;  4BW3 A;  4A9H A;  4WA6 A;  3ZTG A;  3G0J A;  3MUL A;  3AAD A;  5A5P A;  5A5N A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  5ENB A;  2R0S A;  4F3I A;  4NYX A;  4QUT A;  2KU3 A;  1JSP B;  5TRB A;  5F60 A;  5B79 A;  2RNX A;  3GL6 A;  3LQH A;  5FG4 A;  4O76 A;  5E3D A;  4MR3 A;  4YYG A;  2M1R A;  3ASL A;  3T7L A;  5KH7 A;  5IGL A;  4LZR A;  5E0R A;  2AN6 A;  5ACY A;  4MR4 A;  4AKN A;  2YEK A;  5B76 A;  5CUG A;  5DYA A;  1LDJ B;  2L5E A;  3UVD A;  1WEN A;  2VNF A;  4A0C D;  4O71 A;  5H1T A;  3UV5 A;  3I2D A;  4YAB A;  3P5O A;  3MUK A;  5EWV A;  2FUI A;  2K17 A;  4ZQL A;  4NRA A;  4LZS A;  5FDZ A;  5I88 A;  4HBW A;  3SVG A;  3UV4 A;  4QYL A;  4NR4 A;  5CQT A;  4QEW A;  2CSZ A;  4TYL A;  2LXP C;  3P1F A;  4QSV A;  2PNX A;  3UV2 A;  5H1U A;  5ENF A;  3K2J A;  4QSX A;  2F42 A;  5AME A;  4MVT A;  2VJF B;  4FLP A;  3JVL A;  5F3A A;  3UVY A;  5H85 A;  1RMD A;  1X0J A;  4ALH A;  3AQA A;  5IGK A;  2YSM A;  4R2Y A;  5DY7 A;  3IU5 A;  2YQD A;  4NR7 A;  5CQ8 A;  5D25 A;  5HFQ A;  1ZBD B;  4GB0 A;  4A9N A;  3ZYQ A;  2R10 A;  2Y43 A;  4UIU A;  4Z93 A;  4NXJ A;  4C66 A;  5DYC A;  2RO1 A;  4NUC A;  4TQN A;  2CKL B;  5LKX A;  4LK9 A;  2LSP B;  4L58 A;  4IC2 A;  2JMJ A;  4TKP B;  2OSS A;  4CUQ A;  5CUC A;  5EIS A;  4A9J A;  3Q2E A;  4NYW A;  4BJX A;  5I7X A;  5JI8 A;  3ZNI A;  5CUE A;  5FE0 A;  1U6G B;  5CUB A;  5EWW A;  4LYW A;  4O75 A;  4CUT A;  4QBM A;  5KTW A;  5D3P A;  3KNV A;  3SOX A;  4O7A A;  2YEL A;  4HBV A;  5I7Y A;  2KGG A;  2QIC A;  2UZG A;  4C9Z A;  4IR5 A;  3QZV A;  3U5K A;  4YYJ A;  2DX8 A;  3C5K A;  2OXQ C;  4QB3 A;  4GNF A;  5ENH A;  2YUC A;  5EVA A;  5TAB A;  5EM3 A;  3O33 A;  5HEN A;  5F25 A;  5CRZ A;  2E7O A;  5EPR A;  4FJC A;  2ECV A;  4CUR A;  1VFY A;  2K4D A;  5FFW A;  4QNS A;  5I3L A;  1ZS5 A;  4TU6 A;  2WP1 A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  4YBT A;  1CHC A;  5C89 A;  4V3K C;  3SOW A;  2MJV B;  3GV4 A;  5A5O A;  3MB4 A;  5I1Q A;  4QR4 A;  5CPE A;  4YYM A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  5ENC A;  2DVS A;  4R8P K;  1IYM A;  5DFB A;  5ETD A;  2FUU A;  2MUM A;  3DWY A;  3LXJ A;  4N4F A;  3HCT A;  5CS8 A;  5DFC A;  5D1L B;  4MEO A;  5FBX A;  4QY4 A;  4CFK A;  1JM4 B;  4WZ2 A;  3L1X A;  4HXO A;  2CT2 A;  5FEY A;  4L7X A;  4LZ2 A;  2IDA A;  3MXF A;  2VPB A;  3ZPV 1;  3N9N A;  4TT6 A;  4TT2 A;  4PY6 A;  5FG6 A;  4HXR A;  1G25 A;  5D3J A;  5F2P A;  1WEM A;  2ECT A;  4O64 A;  2KWJ A;  4QF2 A;  4O77 A;  4QZS A;  5TBN A;  5IG6 A;  4R7E A;  3HME A;  5KTX A;  1N72 A;  4GND A;  3JVM A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  5L97 A;  3N9P A;  2H0D B;  2WP2 A;  4NR9 A;  4YY6 A;  2RNY A;  5EIC A;  1JOC A;  2MA5 A;  4WHU A;  2L0B A;  5HQ5 A;  1V87 A;  2F6J A;  4CLB A;  3O7A A;  3KQI A;  2ECN A;  2YDW A;  4YYK A;  2OO1 A;  2QIZ A;  4YH4 A;  4QC1 A;  1Z60 A;  4MEP A;  2DWW A;  3IHP A;  4PPE A;  4Z1S A;  5L8T A;  5CZG A;  3LQJ A;  4IOR A;  1EQF A;  3M63 A;  3UW9 A;  5E9M A;  3SOU A;  3N9L A;  5HQ6 A;  5IID A;  2MNY A;  4LR6 A;  5I86 A;  4PKL A;  1T1H A;  2HDP A;  5DX4 A;  1WGM A;  4WZ0 A;  5FE1 A;  5DW2 A;  4NR6 A;  2KRE A;  3ZVZ B;  5G4R A;  2Y1N A;  1VYX A;  5A5R A;  4QC3 A;  2G4A A;  5JG6 A;  5FE3 A;  3EB6 A;  5FH6 A;  5DFD A;  3ZYU A;  3QZT A;  4QSR A;  2E6R A;  4XI1 A;  3FKM X;  4S3O C;  3C6W A;  4LC2 A;  4O7C A;  4FO9 A;  4UIX A;  3HMF A;  5DYU A;  2EGP A;  3HCS A;  4A9O A;  2YT5 A;  1HYJ A;  4X2I A;  3TLP A;  3O70 A;  5C85 A;  5D3S A;  5E73 A;  5C4Q A;  4TZ8 A;  5I29 A;  4A9I A;  2RNW A;  5EYA F;  5D3H A;  3G0L A;  5HFR A;  5A82 A;  2XEU A;  4S3O B;  2YEM A;  5KO4 A;  4LAD B;  5LUU A;  3QZS A;  4Q0O A;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4HXN A;  5C8G A;  4LJN A;  5HLS A;  5D26 A;  2YUR A;  5LVR A;  4YYD A;  2L5U A;  5HJC A;  5AMF A;  4IOQ A;  3V43 A;  1WE9 A;  4HXM A;  2DVR A;  2YRE A;  2F6N A;  4LDF A;  3RCW A;  2MD8 C;  5IBN A;  2VPD A;  2YYR A;  2ECJ A;  3HTK C;  4Z6H A;  5HRX A;  5H1V A;  4MR5 A;  1WEO A;  5F62 A;  4YBS A;  2DKW A;  3P1C A;  5LJ0 A;  5ETB A;  3HCU A;  3SVF A;  5FE6 A;  2OUO A;  5CQA A;  2MA6 A;  4HXL A;  5C13 A;  5G04 B;  5D3R A;  3EB5 A;  3M99 A;  4XY8 A;  3SVH A;  3DQV R;  4QYD A;  1WFK A;  4ZDT A;  2YW5 A;  5LJ2 A;  4I7C A;  2L80 A;  5TB6 A;  4QSS A;  1WIL A;  5HQ7 A;  5A7C A;  4IR4 A;  4QF3 A;  4YAX A;  4QUU A;  5B78 A;  4HBY A;  5FE9 A;  2LDR A;  5TDR A;  5CQ6 A;  2YW8 A;  4UP0 A;  3FL2 A;  4OGI A;  3SHB A;  5DYX A;  5HEL A;  3RPG C;  5CUD A;  2DVV A;  2MIQ A;  4HBX A;  5HRV A;  3O34 A;  4O74 A;  4OGJ A;  2RI7 A;  5LCW B;  2MD7 B;  3NXB A;  5CQ3 A;  3LQI A;  4BW4 A;  3Q2F A;  3U5J A;  5HCL A;  2L84 A;  5LJ1 A;  4O78 A;  2FSA A;  5E9L A;  2DVQ A;  2D9E A;  2YHO A;  3U5N A;  5I83 A;  5AD2 A;  1HYI A;  5EPB A;  4J0R A;  4QR3 A;  2C2V S;  2G45 A;  3S92 A;  2DAT A;  4MEQ A;  4YK0 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  1WUM A;  3MB3 A;  5F5Z A;  5L99 A;  3N9Q A;  1X4J A;  4LRG A;  4UIY A;  4A49 A;  5DBM A;  4YYH A;  4C67 A;  2YQL A;  1E4U A;  4J0S A;  4YYN A;  2KYU A;  5ENE A;  2VPE A;  4BBQ A;  5TCM A;  1JM7 A;  5BT3 A;  4XUB A;  4ALG A;  2I7K A;  4CUU A;  4ZW1 A;  2JMI A;  3IU6 A;  5DLX A;  4A9E A;  5FE7 A;  2M3H A;  5H9M A;  5A5S A;  1F68 A; 
#chains in the Genus database with same CATH topology
 2XOZ A;  5FE8 A;  4Z1Q A;  4KCX A;  5LKZ A;  4CCG X;  4QSP A;  4B7Y C;  2CSY A;  4NR5 A;  3O36 A;  1X4I A;  4WHW A;  4QSU A;  5II2 A;  4A4B A;  5FH8 A;  2GRC A;  2JUN A;  2R0V A;  3N9M A;  2QJ0 A;  5CTL A;  3NG2 A;  3GG3 A;  5EWH A;  5DKA A;  4NQM A;  5CQ5 A;  2CKL A;  4GNE A;  4DON A;  4B86 C;  5BT4 A;  2YQM A;  5AIU A;  4Z0R A;  5D3L A;  2E6S A;  2EOD A;  5KH9 A;  4QST A;  2M6M A;  4QSQ A;  4QEU A;  5E9V A;  5FB0 A;  4AP4 A;  4HXP A;  4Y03 A;  5G4S A;  4IR3 A;  5HM0 A;  5J3X A;  5COI A;  4NS5 A;  4QR5 A;  3P1E A;  5D1M B;  4CL9 A;  3ZPV E;  5I89 A;  5ENG A;  3ERR A;  4IR6 A;  4WIV A;  5CU8 A;  5D7X A;  2XB1 A;  4RVR A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  4LYI A;  3U5L A;  2E61 A;  5EV9 A;  2KFT A;  3DWD A;  4ZC9 A;  5CY9 A;  4PTB A;  2L75 A;  4YH3 A;  1E6I A;  4YAD A;  5FE5 A;  4BW1 A;  3U5M A;  4YBM A;  4A9L A;  4XY9 A;  5EI4 A;  5EA1 A;  5KTU A;  5AIT A;  5DKD A;  4UIV A;  4Z6I A;  4E96 A;  1WES A;  2ECI A;  4O70 A;  4QEV A;  3KV6 A;  5DKH A;  5EQ1 A;  2RSD A;  2I8N A;  4N4I A;  1F62 A;  4A9F A;  4J1P A;  4MEN A;  1MBM A;  1VD4 A;  4UYH A;  4LKA A;  2RS9 B;  5EK9 A;  3DPL R;  5SVY A;  5F36 A;  4Z0O A;  4UP5 A;  4ZUX U;  2ECW A;  4BW2 A;  4UYG A;  4TT4 A;  2YYN A;  5SVI B;  2E3K A;  2K1J A;  4AUQ B;  5D24 A;  5E9I A;  5C87 A;  2M85 A;  3LRQ A;  2MNZ A;  5F61 A;  5ENJ A;  3P1D A;  3PLW A;  5LKU A;  5F63 A;  2VJF A;  4UIT A;  2K16 A;  4NN2 A;  2KE1 A;  4NR8 A;  3O37 A;  4UIZ A;  2LN0 A;  3PHD A;  4MR6 A;  5CFW A;  4O7F A;  5FE4 A;  3N9O A;  5F1H A;  3DAI A;  3D1B A;  2NAA A;  5ENI A;  3MDB C;  1WUG A;  2LGV A;  4AYC A;  4CUP A;  2C2L A;  4QSW A;  2YVR A;  5HEM A;  4J3I A;  4W4U A;  5B8D A;  3JVJ A;  2YHN A;  5CGP A;  5KU3 A;  2D8S A;  2ECG A;  2IQJ A;  5EWC A;  5F1L A;  5D3N A;  2L85 A;  5I40 A;  2KWK A;  2KWO A;  5EGU A;  2MT5 A;  5EP7 A;  2G43 A;  2Y1M A;  5FFY A;  4PS5 A;  3PUQ A;  5I80 A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  5IGN A;  3S91 A;  4XUA A;  3LVQ E;  5C11 A;  5L98 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  3JVK A;  4IOO A;  4N3W A;  2BAY A;  5K29 A;  5KHM A;  3PUR A;  1MM2 A;  5FB1 A;  5L96 A;  3UVX A;  4CUS A;  5LVQ A;  5A83 A;  2LV9 A;  5B77 A;  4KV1 A;  2RFJ A;  4TS8 A;  5D3T A;  5EU1 A;  4CFL A;  5TDW A;  2KWN A;  5DLZ A;  2D8U A;  3LJW A;  3MQM A;  4TZ2 A;  5CP5 A;  4NUE A;  2E7N A;  4GNG A;  4Q0N A;  4O7B A;  4HXK A;  2LGG A;  1WIM A;  5A85 A;  4UIW A;  4N4G A;  4A9M A;  3U5O A;  5EPS A;  2G6Q A;  2I50 A;  3KDE C;  5DIN A;  2KR4 A;  1K2F A;  2NXB A;  2D82 A;  3RPG B;  4N4H A;  4H9D A;  5E7D A;  5JWM A;  5II1 A;  2LAU A;  5CRM A;  5A81 A;  4I7D A;  5E9K A;  3UVW A;  3KNV A;  5FG5 A;  5EWD A;  4TTE A;  5D0C A;  5E74 A;  5DKC A;  2LXH C;  2ZET C;  4OUF A;  1WEQ A;  2VJE B;  4PCE A;  4P5O B;  5HRW A;  3RTR B;  3T6R A;  5D1K B;  4UYF A;  3E2D A;  2N9G A;  2KTB B;  5BT5 A;  2VP7 A;  4AVX A;  3ZVY A;  4YYI A;  5G05 B;  4UYE A;  4TU4 A;  5J0D A;  1FBV A;  2LRI C;  5CUA A;  4UYD A;  1PUO A;  4NRC A;  4GPJ A;  4O7E A;  4MSX A;  4LYS A;  4YY4 A;  4NYV A;  3MHH A;  1XWH A;  4UYF B;  3O35 A;  5C7N A;  4F52 B;  4HXS A;  5E3G A;  4WZ3 B;  2VJE A;  2H60 A;  4UI9 B;  5E9Y A;  5FE2 A;  3JUE A;  2LQ6 A;  3HMH A;  4O72 A;  2R0Y A;  2HYE D;  5DW1 A;  5B75 A;  1WEE A;  2JMD A;  1Z6U A;  4PCI A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  5L8U A;  1WEP A;  2KIZ A;  5CQ7 A;  3D7C A;  4CA1 A;  4A4C A;  3ONI A;  4XYA A;  4NUD A;  4KV4 A;  4NQN A;  4A9K A;  5FH7 A;  2L7P A;  5FFV A;  4NRB A;  5CQ4 A;  4AI6 A;  2FD4 A;  5AD3 A;  3I3J A;  5A5Q A;  5IGM A;  4BW3 A;  3FM8 C;  4A9H A;  4WA6 A;  3ZTG A;  3G0J A;  3MUL A;  3AAD A;  5A5P A;  5A5N A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  2DSM A;  2B0O E;  5SVI A;  5ENB A;  2R0S A;  4F3I A;  4NYX A;  4QUT A;  3VKG A;  2KU3 A;  1JSP B;  5TRB A;  5F60 A;  5B79 A;  2RNX A;  3GL6 A;  3LQH A;  5FG4 A;  4O76 A;  5E3D A;  4MR3 A;  4YYG A;  2M1R A;  3ASL A;  3T7L A;  5KH7 A;  5IGL A;  4LZR A;  5E0R A;  2AN6 A;  5ACY A;  4MR4 A;  4AKN A;  2YEK A;  5B76 A;  5CUG A;  5DYA A;  1LDJ B;  2L5E A;  3UVD A;  1WEN A;  2VNF A;  4A0C D;  3H7H A;  4O71 A;  5H1T A;  3UV5 A;  3I2D A;  4YAB A;  3P5O A;  3MUK A;  5EWV A;  2FUI A;  2K17 A;  4ZQL A;  4NRA A;  4LZS A;  5FDZ A;  5I88 A;  4AKH A;  4HBW A;  3SVG A;  3UV4 A;  4QYL A;  4NR4 A;  5CQT A;  4QEW A;  2CSZ A;  4TYL A;  2LXP C;  3P1F A;  4QSV A;  2PNX A;  2KKX A;  3UV2 A;  2CSV A;  5H1U A;  5ENF A;  3LJU X;  3K2J A;  4QSX A;  2F42 A;  5AME A;  4MVT A;  2VJF B;  2EJN A;  3JVL A;  4FLP A;  5F3A A;  5H85 A;  3UVY A;  1RMD A;  1X0J A;  4ALH A;  3AQA A;  4OGC A;  5IGK A;  2YSM A;  4R2Y A;  5DY7 A;  3IU5 A;  2YQD A;  4NR7 A;  5CQ8 A;  5D25 A;  5HFQ A;  1ZBD B;  4GB0 A;  4A9N A;  3ZYQ A;  2R10 A;  2Y43 A;  4UIU A;  4Z93 A;  4NXJ A;  4C66 A;  5DYC A;  2RO1 A;  4NUC A;  4TQN A;  2CKL B;  5LKX A;  4LK9 A;  2LSP B;  4L58 A;  4IC2 A;  4QQ4 A;  2JMJ A;  4TKP B;  2OSS A;  4CUQ A;  5CUC A;  5EIS A;  4A9J A;  3Q2E A;  4NYW A;  4BJX A;  1DCQ A;  5I7X A;  5JI8 A;  3ZNI A;  5CUE A;  5FE0 A;  1U6G B;  5CUB A;  5EWW A;  4LYW A;  4O75 A;  4CUT A;  4QBM A;  5KTW A;  5D3P A;  2XOC A;  2FFW A;  3DDT A;  4O7A A;  2YEL A;  4HBV A;  5I7Y A;  2KGG A;  2QIC A;  2UZG A;  4C9Z A;  4IR5 A;  3QZV A;  3U5K A;  4YYJ A;  2DX8 A;  3C5K A;  2OXQ C;  4QB3 A;  4GNF A;  5ENH A;  2KKY A;  2YUC A;  2CRR A;  5EVA A;  5TAB A;  5EM3 A;  3O33 A;  5HEN A;  5F25 A;  5CRZ A;  2E7O A;  5EPR A;  4FJC A;  2ECV A;  4CUR A;  2EGM A;  1VFY A;  2K4D A;  5FFW A;  4QNS A;  5I3L A;  1ZS5 A;  4TU6 A;  2EXU A;  2WP1 A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  4YBT A;  1CHC A;  5C89 A;  4V3K C;  3SOW A;  2MJV B;  3GV4 A;  5A5O A;  3MB4 A;  5I1Q A;  4QR4 A;  5CPE A;  4YYM A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  5ENC A;  2DVS A;  4R8P K;  1IYM A;  5DFB A;  5ETD A;  2FUU A;  2MUM A;  3DWY A;  3LXJ A;  4N4F A;  3HCT A;  5CS8 A;  5DFC A;  5D1L B;  4MEO A;  5FBX A;  4QY4 A;  4CFK A;  3O47 A;  1JM4 B;  4WZ2 A;  3L1X A;  4HXO A;  2CT2 A;  5FEY A;  4L7X A;  4LZ2 A;  2IDA A;  3MXF A;  2VPB A;  3ZPV 1;  3N9N A;  4TT6 A;  4TT2 A;  4PY6 A;  5FG6 A;  3FJU B;  4HXR A;  1G25 A;  5D3J A;  4O62 A;  5F2P A;  1WEM A;  2ECT A;  4AKI A;  2KWJ A;  4O64 A;  4QF2 A;  4O77 A;  4QZS A;  5TBN A;  5IG6 A;  4R7E A;  3SUB A;  3HME A;  5KTX A;  1N72 A;  4GND A;  3JVM A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  5L97 A;  3N9P A;  2H0D B;  2WP2 A;  4NR9 A;  4YY6 A;  2RNY A;  5EIC A;  1JOC A;  2MA5 A;  4WHU A;  2L0B A;  5HQ5 A;  1V87 A;  2F6J A;  4CLB A;  3O7A A;  3KQI A;  2ECN A;  2YDW A;  4YYK A;  2OO1 A;  2QIZ A;  4YH4 A;  4QC1 A;  1Z60 A;  4MEP A;  2DWW A;  3IHP A;  4PPE A;  4Z1S A;  5L8T A;  3T9K A;  5CZG A;  3LQJ A;  4IOR A;  2OWA A;  1EQF A;  3M63 A;  3Q1D A;  3UW9 A;  5E9M A;  3SOU A;  3N9L A;  4AKG A;  5HQ6 A;  5IID A;  2MNY A;  4LR6 A;  5I86 A;  4PKL A;  1T1H A;  2HDP A;  5DX4 A;  1WGM A;  4WZ0 A;  5FE1 A;  5DW2 A;  3M7K A;  4NR6 A;  2KRE A;  2P57 A;  3ZVZ B;  5G4R A;  2CON A;  2Y1N A;  1VYX A;  5A5R A;  4QC3 A;  2CRW A;  3LVR E;  2G4A A;  5JG6 A;  3FEH A;  5FE3 A;  3EB6 A;  3VKH A;  5FH6 A;  5DFD A;  3ZYU A;  3QZT A;  4QSR A;  2E6R A;  4XI1 A;  3FKM X;  4S3O C;  3C6W A;  4LC2 A;  4O7C A;  4FO9 A;  4UIX A;  3HMF A;  5DYU A;  2EGP A;  3HCS A;  4A9O A;  2YT5 A;  1HYJ A;  4X2I A;  3TLP A;  3O70 A;  5C85 A;  5D3S A;  5E73 A;  5C4Q A;  4TZ8 A;  5I29 A;  4A9I A;  2RNW A;  5EYA F;  5D3H A;  3G0L A;  5HFR A;  5A82 A;  2XEU A;  4S3O B;  5SVX A;  2YEM A;  5KO4 A;  4LAD B;  5LUU A;  3QZS A;  4Q0O A;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4HXN A;  5C8G A;  4LJN A;  5HLS A;  3SOX A;  5D26 A;  2M13 A;  2YUR A;  5LVR A;  4YYD A;  2L5U A;  5HJC A;  5AMF A;  4IOQ A;  4OGE A;  3V43 A;  1WE9 A;  4HXM A;  2DVR A;  2YRE A;  2F6N A;  4LDF A;  3RCW A;  2MD8 C;  5IBN A;  2VPD A;  2YYR A;  2ECJ A;  2RR4 A;  3HTK C;  4Z6H A;  5HRX A;  5H1V A;  4MR5 A;  1WEO A;  5F62 A;  4YBS A;  2DKW A;  3P1C A;  5LJ0 A;  5ETB A;  3HCU A;  3SVF A;  5FE6 A;  2OUO A;  5CQA A;  2MA6 A;  4HXL A;  5C13 A;  5G04 B;  5D3R A;  3EB5 A;  3M99 A;  4F1P A;  4XY8 A;  3SVH A;  3DQV R;  4QYD A;  1WFK A;  4ZDT A;  2YW5 A;  5LJ2 A;  4I7C A;  2L80 A;  5TB6 A;  4QSS A;  1WIL A;  5HQ7 A;  5A7C A;  4IR4 A;  2MKE A;  4QF3 A;  4YAX A;  4QUU A;  3FAO A;  5B78 A;  4HBY A;  5FE9 A;  2LDR A;  3LDY A;  5TDR A;  5CQ6 A;  2YW8 A;  4UP0 A;  3FAN A;  4OGI A;  3FL2 A;  3SHB A;  5DYX A;  5HEL A;  3RPG C;  5CUD A;  2DVV A;  2MIQ A;  4HBX A;  5HRV A;  3O34 A;  4O74 A;  4OGJ A;  2RI7 A;  5LCW B;  2MD7 B;  3NXB A;  5CQ3 A;  3LQI A;  2XOY A;  4BW4 A;  2DJA A;  3Q2F A;  3U5J A;  5HCL A;  2L84 A;  5LJ1 A;  4O78 A;  2FSA A;  5E9L A;  2DVQ A;  2JM3 A;  1ZKR A;  2D9E A;  2XP0 A;  2YHO A;  3U5N A;  5I83 A;  5K3Q A;  5AD2 A;  1HYI A;  5EPB A;  4J0R A;  4QR3 A;  2C2V S;  2G45 A;  3S92 A;  2DAT A;  4MEQ A;  4YK0 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  1WUM A;  3MB3 A;  5F5Z A;  5L99 A;  3N9Q A;  1X4J A;  4LRG A;  4UIY A;  4A49 A;  5DBM A;  4YYH A;  4C67 A;  2YQL A;  1E4U A;  3D1D A;  4J0S A;  4YYN A;  5ENE A;  2KYU A;  2VPE A;  5TCM A;  4BBQ A;  1JM7 A;  5BT3 A;  4XUB A;  4ALG A;  2I7K A;  4CUU A;  4ZW1 A;  2JMI A;  3IU6 A;  5DLX A;  4A9E A;  5FE7 A;  2M3H A;  5H9M A;  5A5S A;  1F68 A; 
#chains in the Genus database with same CATH homology
 5FE8 A;  4Z1Q A;  4KCX A;  5LKZ A;  4CCG X;  4QSP A;  4B7Y C;  2CSY A;  4NR5 A;  3O36 A;  1X4I A;  4WHW A;  4QSU A;  5II2 A;  4A4B A;  5FH8 A;  2GRC A;  2R0V A;  3N9M A;  2QJ0 A;  5CTL A;  3NG2 A;  3GG3 A;  5EWH A;  5DKA A;  4NQM A;  5CQ5 A;  2CKL A;  4GNE A;  4DON A;  4B86 C;  5BT4 A;  2YQM A;  5AIU A;  5D3L A;  2E6S A;  2EOD A;  5KH9 A;  4QST A;  2M6M A;  4QSQ A;  4QEU A;  5E9V A;  5FB0 A;  4AP4 A;  4HXP A;  4Y03 A;  5G4S A;  4IR3 A;  5HM0 A;  5J3X A;  5COI A;  4NS5 A;  4QR5 A;  3P1E A;  5D1M B;  4CL9 A;  3ZPV E;  5I89 A;  5ENG A;  4IR6 A;  4WIV A;  5CU8 A;  5D7X A;  2XB1 A;  4RVR A;  3KV5 A;  4Q6F A;  1MM3 A;  4V3L C;  1X4U A;  1WEW A;  1BOR A;  4FK5 A;  4LYI A;  3U5L A;  5EV9 A;  2KFT A;  4ZC9 A;  5CY9 A;  4PTB A;  2L75 A;  4YH3 A;  1E6I A;  4YAD A;  5FE5 A;  4BW1 A;  3U5M A;  4YBM A;  4A9L A;  4XY9 A;  5EI4 A;  5EA1 A;  5KTU A;  5AIT A;  5DKD A;  4UIV A;  4Z6I A;  4E96 A;  1WES A;  2ECI A;  4O70 A;  4QEV A;  3KV6 A;  5DKH A;  5EQ1 A;  2RSD A;  2I8N A;  4N4I A;  1F62 A;  4A9F A;  4J1P A;  4MEN A;  1VD4 A;  4UYH A;  4LKA A;  2RS9 B;  5EK9 A;  3DPL R;  5F36 A;  4UP5 A;  4ZUX U;  2ECW A;  4BW2 A;  4UYG A;  4TT4 A;  2YYN A;  2E3K A;  2K1J A;  4AUQ B;  5D24 A;  5E9I A;  5C87 A;  2M85 A;  3LRQ A;  2MNZ A;  5F61 A;  5ENJ A;  3P1D A;  5LKU A;  5F63 A;  2VJF A;  4UIT A;  2K16 A;  4NN2 A;  2KE1 A;  4NR8 A;  3O37 A;  4UIZ A;  2LN0 A;  3PHD A;  4MR6 A;  5CFW A;  4O7F A;  5FE4 A;  3N9O A;  5F1H A;  3DAI A;  2NAA A;  5ENI A;  1WUG A;  2LGV A;  4AYC A;  4CUP A;  2C2L A;  4QSW A;  5HEM A;  4J3I A;  4W4U A;  5B8D A;  3JVJ A;  2YHN A;  5CGP A;  5KU3 A;  2D8S A;  2ECG A;  5EWC A;  5F1L A;  5D3N A;  2L85 A;  5I40 A;  2KWK A;  2KWO A;  5EGU A;  2MT5 A;  5EP7 A;  2G43 A;  2Y1M A;  5FFY A;  4PS5 A;  3PUQ A;  5I80 A;  1LDK C;  2LGK A;  4I7B A;  3MHS A;  5IGN A;  3S91 A;  4XUA A;  5C11 A;  5L98 A;  2VPG A;  3M62 A;  4YC9 A;  1Z2Q A;  4X3G A;  3JVK A;  4IOO A;  4N3W A;  2BAY A;  5K29 A;  5KHM A;  3PUR A;  1MM2 A;  5FB1 A;  5L96 A;  3UVX A;  4CUS A;  5LVQ A;  5A83 A;  2LV9 A;  5B77 A;  4KV1 A;  2RFJ A;  4TS8 A;  5D3T A;  5EU1 A;  4CFL A;  5TDW A;  2KWN A;  5DLZ A;  3LJW A;  3MQM A;  4TZ2 A;  5CP5 A;  4NUE A;  2E7N A;  4GNG A;  4Q0N A;  4O7B A;  4HXK A;  2LGG A;  1WIM A;  5A85 A;  4UIW A;  4N4G A;  4A9M A;  3U5O A;  5EPS A;  2G6Q A;  2I50 A;  5DIN A;  2KR4 A;  1K2F A;  2NXB A;  2D82 A;  3RPG B;  4N4H A;  5E7D A;  5JWM A;  5II1 A;  5CRM A;  5A81 A;  4I7D A;  5E9K A;  3UVW A;  5FG5 A;  5EWD A;  4TTE A;  5D0C A;  5E74 A;  5DKC A;  2LXH C;  2ZET C;  4OUF A;  1WEQ A;  2VJE B;  4PCE A;  4P5O B;  5HRW A;  3RTR B;  3T6R A;  5D1K B;  4UYF A;  2N9G A;  2KTB B;  5BT5 A;  2VP7 A;  4AVX A;  3ZVY A;  4YYI A;  5G05 B;  4UYE A;  4TU4 A;  5J0D A;  1FBV A;  2LRI C;  5CUA A;  4UYD A;  4NRC A;  4GPJ A;  4O7E A;  4MSX A;  4LYS A;  4YY4 A;  4NYV A;  3MHH A;  1XWH A;  4UYF B;  3O35 A;  5C7N A;  4F52 B;  4HXS A;  5E3G A;  4WZ3 B;  2VJE A;  2H60 A;  4UI9 B;  5E9Y A;  5FE2 A;  2LQ6 A;  3HMH A;  4O72 A;  2R0Y A;  2HYE D;  5DW1 A;  5B75 A;  1WEE A;  2JMD A;  1Z6U A;  4PCI A;  2PUY A;  1WEV A;  2L43 A;  2JRJ A;  5L8U A;  1WEP A;  2KIZ A;  5CQ7 A;  3D7C A;  4CA1 A;  4A4C A;  3ONI A;  4XYA A;  4NUD A;  4KV4 A;  4NQN A;  4A9K A;  5FH7 A;  5FFV A;  4NRB A;  5CQ4 A;  5AD3 A;  3I3J A;  5A5Q A;  5IGM A;  4BW3 A;  4A9H A;  4WA6 A;  3ZTG A;  3G0J A;  3MUL A;  3AAD A;  5A5P A;  5A5N A;  1WEU A;  4FIP A;  2YSJ A;  2KGI A;  5ENB A;  2R0S A;  4F3I A;  4NYX A;  4QUT A;  2KU3 A;  1JSP B;  5TRB A;  5F60 A;  5B79 A;  2RNX A;  3GL6 A;  3LQH A;  5FG4 A;  4O76 A;  5E3D A;  4MR3 A;  4YYG A;  2M1R A;  3ASL A;  3T7L A;  5KH7 A;  5IGL A;  4LZR A;  5E0R A;  2AN6 A;  5ACY A;  4MR4 A;  4AKN A;  2YEK A;  5B76 A;  5CUG A;  5DYA A;  1LDJ B;  2L5E A;  3UVD A;  1WEN A;  2VNF A;  4A0C D;  4O71 A;  5H1T A;  3UV5 A;  3I2D A;  4YAB A;  3P5O A;  3MUK A;  5EWV A;  2FUI A;  2K17 A;  4ZQL A;  4NRA A;  4LZS A;  5FDZ A;  5I88 A;  4HBW A;  3SVG A;  3UV4 A;  4QYL A;  4NR4 A;  5CQT A;  4QEW A;  2CSZ A;  4TYL A;  2LXP C;  3P1F A;  4QSV A;  2PNX A;  3UV2 A;  5H1U A;  5ENF A;  3K2J A;  4QSX A;  2F42 A;  5AME A;  4MVT A;  2VJF B;  4FLP A;  3JVL A;  5F3A A;  3UVY A;  5H85 A;  1RMD A;  1X0J A;  4ALH A;  3AQA A;  5IGK A;  2YSM A;  4R2Y A;  5DY7 A;  3IU5 A;  2YQD A;  4NR7 A;  5CQ8 A;  5D25 A;  5HFQ A;  1ZBD B;  4GB0 A;  4A9N A;  3ZYQ A;  2R10 A;  2Y43 A;  4UIU A;  4Z93 A;  4NXJ A;  4C66 A;  5DYC A;  2RO1 A;  4NUC A;  4TQN A;  2CKL B;  5LKX A;  4LK9 A;  2LSP B;  4L58 A;  4IC2 A;  2JMJ A;  4TKP B;  2OSS A;  4CUQ A;  5CUC A;  5EIS A;  4A9J A;  3Q2E A;  4NYW A;  4BJX A;  5I7X A;  5JI8 A;  3ZNI A;  5CUE A;  5FE0 A;  1U6G B;  5CUB A;  5EWW A;  4LYW A;  4O75 A;  4CUT A;  4QBM A;  5KTW A;  5D3P A;  3KNV A;  3SOX A;  4O7A A;  2YEL A;  4HBV A;  5I7Y A;  2KGG A;  2QIC A;  2UZG A;  4C9Z A;  4IR5 A;  3QZV A;  3U5K A;  4YYJ A;  2DX8 A;  3C5K A;  2OXQ C;  4QB3 A;  4GNF A;  5ENH A;  2YUC A;  5EVA A;  5TAB A;  5EM3 A;  3O33 A;  5HEN A;  5F25 A;  5CRZ A;  2E7O A;  5EPR A;  4FJC A;  2ECV A;  4CUR A;  1VFY A;  2K4D A;  5FFW A;  4QNS A;  5I3L A;  1ZS5 A;  4TU6 A;  2WP1 A;  4LLB A;  5LKT A;  5FER A;  2EA6 A;  4YBT A;  1CHC A;  5C89 A;  4V3K C;  3SOW A;  2MJV B;  3GV4 A;  5A5O A;  3MB4 A;  5I1Q A;  4QR4 A;  5CPE A;  4YYM A;  1DVP A;  4AYC B;  4YAT A;  1N87 A;  5ENC A;  2DVS A;  4R8P K;  1IYM A;  5DFB A;  5ETD A;  2FUU A;  2MUM A;  3DWY A;  3LXJ A;  4N4F A;  3HCT A;  5CS8 A;  5DFC A;  5D1L B;  4MEO A;  5FBX A;  4QY4 A;  4CFK A;  1JM4 B;  4WZ2 A;  3L1X A;  4HXO A;  2CT2 A;  5FEY A;  4L7X A;  4LZ2 A;  2IDA A;  3MXF A;  2VPB A;  3ZPV 1;  3N9N A;  4TT6 A;  4TT2 A;  4PY6 A;  5FG6 A;  4HXR A;  1G25 A;  5D3J A;  5F2P A;  1WEM A;  2ECT A;  4O64 A;  2KWJ A;  4QF2 A;  4O77 A;  4QZS A;  5TBN A;  5IG6 A;  4R7E A;  3HME A;  5KTX A;  1N72 A;  4GND A;  3JVM A;  3L11 A;  2LGL A;  3L1Z B;  3VK6 A;  5L97 A;  3N9P A;  2H0D B;  2WP2 A;  4NR9 A;  4YY6 A;  2RNY A;  5EIC A;  1JOC A;  2MA5 A;  4WHU A;  2L0B A;  5HQ5 A;  1V87 A;  2F6J A;  4CLB A;  3O7A A;  3KQI A;  2ECN A;  2YDW A;  4YYK A;  2OO1 A;  2QIZ A;  4YH4 A;  4QC1 A;  1Z60 A;  4MEP A;  2DWW A;  3IHP A;  4PPE A;  4Z1S A;  5L8T A;  5CZG A;  3LQJ A;  4IOR A;  1EQF A;  3M63 A;  3UW9 A;  5E9M A;  3SOU A;  3N9L A;  5HQ6 A;  5IID A;  2MNY A;  4LR6 A;  5I86 A;  4PKL A;  1T1H A;  2HDP A;  5DX4 A;  1WGM A;  4WZ0 A;  5FE1 A;  5DW2 A;  4NR6 A;  2KRE A;  3ZVZ B;  5G4R A;  2Y1N A;  1VYX A;  5A5R A;  4QC3 A;  2G4A A;  5JG6 A;  5FE3 A;  3EB6 A;  5FH6 A;  5DFD A;  3ZYU A;  3QZT A;  4QSR A;  2E6R A;  4XI1 A;  3FKM X;  4S3O C;  3C6W A;  4LC2 A;  4O7C A;  4FO9 A;  4UIX A;  3HMF A;  5DYU A;  2EGP A;  3HCS A;  4A9O A;  2YT5 A;  1HYJ A;  4X2I A;  3TLP A;  3O70 A;  5C85 A;  5D3S A;  5E73 A;  5C4Q A;  4TZ8 A;  5I29 A;  4A9I A;  2RNW A;  5EYA F;  5D3H A;  3G0L A;  5HFR A;  5A82 A;  2XEU A;  4S3O B;  2YEM A;  5KO4 A;  4LAD B;  5LUU A;  3QZS A;  4Q0O A;  1FP0 A;  5KH3 A;  5G0F A;  2YU4 A;  1JM7 B;  4HXN A;  5C8G A;  4LJN A;  5HLS A;  5D26 A;  2YUR A;  5LVR A;  4YYD A;  2L5U A;  5HJC A;  5AMF A;  4IOQ A;  3V43 A;  1WE9 A;  4HXM A;  2DVR A;  2YRE A;  2F6N A;  4LDF A;  3RCW A;  2MD8 C;  5IBN A;  2VPD A;  2YYR A;  2ECJ A;  3HTK C;  4Z6H A;  5HRX A;  5H1V A;  4MR5 A;  1WEO A;  5F62 A;  4YBS A;  2DKW A;  3P1C A;  5LJ0 A;  5ETB A;  3HCU A;  3SVF A;  5FE6 A;  2OUO A;  5CQA A;  2MA6 A;  4HXL A;  5C13 A;  5G04 B;  5D3R A;  3EB5 A;  3M99 A;  4XY8 A;  3SVH A;  3DQV R;  4QYD A;  1WFK A;  4ZDT A;  2YW5 A;  5LJ2 A;  4I7C A;  2L80 A;  5TB6 A;  4QSS A;  1WIL A;  5HQ7 A;  5A7C A;  4IR4 A;  4QF3 A;  4YAX A;  4QUU A;  5B78 A;  4HBY A;  5FE9 A;  2LDR A;  5TDR A;  5CQ6 A;  2YW8 A;  4UP0 A;  3FL2 A;  4OGI A;  3SHB A;  5DYX A;  5HEL A;  3RPG C;  5CUD A;  2DVV A;  2MIQ A;  4HBX A;  5HRV A;  3O34 A;  4O74 A;  4OGJ A;  2RI7 A;  5LCW B;  2MD7 B;  3NXB A;  5CQ3 A;  3LQI A;  4BW4 A;  3Q2F A;  3U5J A;  5HCL A;  2L84 A;  5LJ1 A;  4O78 A;  2FSA A;  5E9L A;  2DVQ A;  2D9E A;  2YHO A;  3U5N A;  5I83 A;  5AD2 A;  1HYI A;  5EPB A;  4J0R A;  4QR3 A;  2C2V S;  2G45 A;  3S92 A;  2DAT A;  4MEQ A;  4YK0 A;  3U5P A;  2H0D A;  4IC3 A;  4BHW A;  1WUM A;  3MB3 A;  5F5Z A;  5L99 A;  3N9Q A;  1X4J A;  4LRG A;  4UIY A;  4A49 A;  5DBM A;  4YYH A;  4C67 A;  2YQL A;  1E4U A;  4J0S A;  4YYN A;  2KYU A;  5ENE A;  2VPE A;  4BBQ A;  5TCM A;  1JM7 A;  5BT3 A;  4XUB A;  4ALG A;  2I7K A;  4CUU A;  4ZW1 A;  2JMI A;  3IU6 A;  5DLX A;  4A9E A;  5FE7 A;  2M3H A;  5H9M A;  5A5S A;  1F68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...