3O34A

Crystal structure of trim24 phd-bromo complexed with h3(13-32)k23ac peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
177
Chain Sequence
EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 50
structure length 177
sequence length 181
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o34A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o34A01
3MUKA 3FL2A 4R8PK 4YBSA 4TS8A 5FE3A 1VYXA 2LGGA 4NR5A 4O7AA 3RCWA 5F60A 4QSUA 4NYXA 5D3SA 5FERA 2G4AA 4PTBA 5D1MB 4CFKA 2LRIC 5F25A 4CLBA 2ECWA 2YQLA 4N4GA 5I86A 5D3PA 2MD7B 4HBYA 4HXLA 5D3JA 3L1XA 5FE1A 4QC3A 4WA6A 4E96A 3M99A 5EWDA 2GRCA 4NR6A 5DBMA 3P1DA 4HXPA 4HXOA 4YK0A 5DW1A 2YREA 2HDPA 4QF2A 4BW1A 2R0YA 2YEKA 2QICA 2RNXA 4O7CA 2F6JA 4Q0OA 4UIUA 2BAYA 3PUQA 5EPRA 5I3LA 5HLSA 4YYGA 3IHPA 4QSPA 2PUYA 3MHSA 2C2LA 4N4HA 5L8TA 4PKLA 5CTLA 5AITA 4O77A 4QYLA 2ZETC 4AP4A 4UIYA 4YYMA 5C4QA 5CQAA 5DY7A 5E73A 1X0JA 2KYUA 2K4DA 5ENJA 5C13A 2LQ6A 4WHWA 2E6RA 3ONIA 1IYMA 4QSVA 4TU4A 3D7CA 2ECGA 1WEUA 3HMHA 2G45A 1WEPA 4O70A 5EWCA 1G25A 5FE6A 5HQ6A 2YURA 3GV4A 5CFWA 5CZGA 5EISA 5F63A 2DVVA 4YAXA 5FFYA 4BW3A 1K2FA 5FG4A 4YY4A 3UV2A 5FB0A 4CUSA 4J3IA 5J0DA 2KU3A 5A5SA 5B8DA 4MR5A 3P1FA 5EPSA 5ENGA 4Q6FA 3JVLA 1WEMA 2G43A 4KCXA 3N9LA 4YBMA 5BT5A 5EWWA 5IGKA 5A82A 1V87A 4YYKA 4I7DA 4BHWA 1LDJB 4NR9A 4I7BA 4NQMA 3M63A 2NXBA 5B78A 4OGJA 2KTBB 5CUAA 5CQ8A 5ETBA 4HXNA 5II2A 4ALGA 1EQFA 4UP0A 4N3WA 4UP5A 5FE2A 4QB3A 4R2YA 1JM7A 5A83A 4NYWA 2L43A 2KGGA 2CT2A 2YEMA 2UZGA 5II1A 3O70A 3N9NA 4CUQA 2KE1A 5EVAA 1JM7B 4GB0A 5LVRA 5ENIA 5HRXA 2CKLA 2VPBA 4NQNA 2E7OA 1X4IA 2YSMA 4AVXA 3ZYUA 4P5OB 4PCEA 5COIA 2E7NA 5TBNA 3ZNIA 4UYHA 3UVWA 2CKLB 3SOUA 4BW2A 4YYDA 4PY6A 3ZPVE 2MA5A 4QSQA 5B77A 4Z1SA 5HEMA 5H1TA 5HENA 2E3KA 3G0LA 3DWYA 4NS5A 5ENHA 5F2PA 4UIZA 5FE7A 2ECVA 3O34A 4YBTA 4W4UA 4XYAA 5EI4A 2L75A 4R7EA 5EQ1A 5LJ1A 4UIWA 5DYAA 5K29A 3UV4A 5AIUA 5CUBA 4QR4A 4QSWA 4GNEA 4A9FA 4QYDA 5E9KA 5A5RA 2VPEA 5CY9A 3KNVA 2ECJA 5IBNA 2LXPC 2YU4A 3RPGC 1X4UA 4QC1A 5TB6A 3N9MA 4LYIA 3O37A 2K16A 3L1ZB 4F52B 5CRMA 2WP2A 1WESA 2Y43A 4MEQA 4YABA 4A9LA 4J1PA 5F3AA 2LGLA 4QSRA 5TRBA 5DYUA 4A4BA 1Z6UA 5FE4A 1WEWA 1Z60A 4A9EA 3AADA 3O33A 4LZ2A 5BT4A 4QSXA 1ZS5A 4WZ0A 4J0SA 5D3NA 4YH3A 5I88A 1WIMA 2VJEA 4NN2A 2L5EA 3DAIA 4TU6A 4LZSA 4QBMA 4WHUA 2KREA 5I89A 5DLZA 2KFTA 2KWNA 4LYWA 4YC9A 4MSXA 4GNGA 4TZ8A 5I7XA 2VJEB 3T6RA 5D25A 5FG6A 4MR3A 4O72A 5E74A 2IDAA 3N9OA 4WZ2A 5E9VA 3P1CA 2L80A 5FE9A 5C8GA 3SOWA 2L5UA 5DFCA 2VPDA 3LXJA 5CP5A 5ENEA 5D1KB 4NUEA 2YQDA 3LQIA 4BJXA 2K17A 5ETDA 2LGKA 3ZVZB 2FUIA 3T7LA 2RSDA 1U6GB 5KH9A 4AUQB 2YELA 4CFLA 3G0JA 5LKZA 4LLBA 5G05B 5C89A 2F42A 3HCTA 5J3XA 3U5PA 3KV6A 4MVTA 3SHBA 2F6NA 4YYIA 5A5QA 2R0SA 5IGMA 5G0FA 3RPGB 4O78A 4YYNA 5E7DA 3JVKA 4Y03A 4GNDA 4C9ZA 4FK5A 3S91A 4XI1A 5CPEA 4O71A 4QNSA 4TZ2A 5L98A 5IGLA 5D3TA 5HQ5A 1MM3A 4GNFA 5EP7A 5CQ5A 5FH6A 1N72A 2VJFA 4CURA 4UYDA 4PCIA 4TT4A 4YYJA 2MJVB 3HMEA 4ZQLA 1F62A 2VJFB 5LKXA 2MNZA 5E9IA 3EB6A 4V3LC 2D82A 2N9GA 3QZVA 4B86C 4BW4A 5FE5A 5KO4A 1T1HA 5IG6A 5DINA 5EWVA 5HM0A 1HYJA 4O7EA 5HRWA 4TT2A 5FH7A 5AD2A 2LSPB 5EGUA 5LJ2A 5C7NA 4ZUXU 3MULA 4UITA 1F68A 4B7YC 5AMFA 3UVDA 5D3HA 2JRJA 5G4SA 5KTXA 5FFVA 4ZW1A 5CUDA 1ZBDB 4TT6A 1WUMA 4A9IA 3IU6A 5DX4A 3DQVR 3FKMX 2YDWA 4LADB 3GG3A 4N4IA 5H9MA 1JSPB 4KV1A 2EODA 2AN6A 5G4RA 5I1QA 3U5JA 3HCSA 4Z93A 1LDKC 5C85A 1Z2QA 4LZRA 4HBVA 3MB4A 4QEUA 5A7CA 2KWOA 2YYRA 5LUUA 1DVPA 4XUBA 2QJ0A 2YHNA 5G04B 5FE0A 1HYIA 4O7FA 2OO1A 5CUGA 4NYVA 4A9KA 5F1LA 1FP0A 5A81A 1WGMA 2DKWA 1WUGA 3LRQA 5FEYA 3O7AA 4L58A 5E0RA 4NXJA 5EWHA 5LVQA 5ENFA 2MA6A 5D7XA 5A5NA 4CL9A 2LXHC 4N4FA 4UIVA 4IR4A 1VD4A 1WFKA 4MENA 3C6WA 4QSSA 4QUTA 4YH4A 2XEUA 4IORA 5TABA 5I29A 3ZYQA 4PPEA 5EK9A 3ASLA 3PHDA 2MIQA 4A4CA 2ECIA 5LKTA 5EV9A 5B75A 4NR4A 2LN0A 2NAAA 2PNXA 4LRGA 2H0DA 4ZDTA 3JVJA 3MXFA 4FO9A 3RTRB 4O76A 5FBXA 3SOXA 4CUTA 3MQMA 4O64A 5FH8A 2Y1NA 4HXMA 2D9EA 5C87A 4V3KC 2H0DB 3O35A 4ALHA 4F3IA 3ZPV1 5CUEA 5LKUA 4O75A 5FB1A 2DATA 2DWWA 4LR6A 4QY4A 2L0BA 5TDWA 3Q2EA 2ECTA 2G6QA 3O36A 5FFWA 2OSSA 4MEOA 2CSZA 2MD8C 5HCLA 5CU8A 4Q0NA 4HXKA 5FE8A 3SVGA 1WE9A 5DYCA 2VPGA 5D3LA 1WENA 2KIZA 4IR3A 2VNFA 4A0CD 1CHCA 5D1LB 4YY6A 5CQ7A 4TQNA 4XY8A 2R10A 5IGNA 5CS8A 5HRVA 2L85A 5DKCA 3LQJA 3LQHA 5E9LA 2JMJA 2DX8A 3KQIA 1WILA 2RNWA 5B79A 5ACYA 1RMDA 4TTEA 3VK6A 5IIDA 5B76A 5BT3A 5DFBA 4MEPA 4LDFA 5ENBA 4LKAA 3QZSA 4QR3A 2RNYA 2M6MA 2DVRA 4QEWA 5A85A 4C67A 5A5OA 3KV5A 4UI9B 2I50A 3NXBA 2KWKA 2Y1MA 1MM2A 4UYEA 4QSTA 2RO1A 4X3GA 5F36A 2D8SA 5DKAA 5L96A 3HMFA 4OGIA 2ECNA 5DYXA 5C11A 3U5KA 5CQ3A 5HFRA 5CQ6A 4NR7A 4QUUA 5HQ7A 2MUMA 2YUCA 2H60A 2KGIA 5DKDA 3ZVYA 4NR8A 4FLPA 4UYGA 2FSAA 5ENCA 5HELA 5I80A 3N9PA 5KTWA 4C66A 5F62A 5KH3A 4O7BA 2HYED 2FUUA 5L99A 5LCWB 4KV4A 4NRBA 4A9NA 3I3JA 4HXSA 5A5PA 2JMDA 5KU3A 5CUCA 4WZ3B 5DKHA 5TCMA 1E4UA 4CUPA 4X2IA 3UW9A 2MT5A 5E3GA 4L7XA 4NRAA 2C2VS 4IR5A 2E6SA 1JOCA 1JM4B 2VP7A 4LK9A 5EU1A 3U5LA 5F5ZA 3PURA 5H85A 2YT5A 5EM3A 5LJ0A 2OUOA 5CQ4A 5L97A 4A9OA 2R0VA 2WP1A 3K2JA 5HFQA 1X4JA 4AYCA 4RVRA 1VFYA 4A9JA 5CQTA 5D0CA 4TKPB 3Q2FA 4NUDA 4YADA 4LJNA 4LC2A 5JG6A 5DW2A 3ZTGA 3JVMA 4J0RA 5KTUA 4Z6HA 3I2DA 4S3OC 4AYCB 2OXQC 3DPLR 4HBXA 4I7CA 4WIVA 3MHHA 4UIXA 3UVXA 3U5NA 3UV5A 4CUUA 1N87A 1WEQA 2YW8A 2YW5A 4MR6A 4UYFA 2M85A 4ZC9A 5AMEA 4XY9A 2YQMA 5I40A 2I8NA 4UYFB 5E9MA 2LDRA 3L11A 3TLPA 3SVHA 2EA6A 4A49A 2RFJA 5F61A 3SVFA 5H1VA 4HBWA 5DFDA 2KR4A 4XUAA 5EYAF 4MR4A 5KHMA 3EB5A 5HJCA 4AKNA 2KWJA 2EGPA 4QF3A 3HTKC 2XB1A 4IR6A 4GPJA 4A9HA 2YHOA 4IC2A 3M62A 2I7KA 4A9MA 4CCGX 2MNYA 1FBVA 4QEVA 5D26A 5D3RA 1XWHA 5D24A 2RS9B 5TDRA 3P5OA 5E3DA 3LJWA 3V43A 3QZTA 4YYHA 3U5MA 3MB3A 5EA1A 2M1RA 1WEEA 5JWMA 4PS5A 4TYLA 3AQAA 1WEOA 4FJCA 5E9YA 5EICA 4IOOA 5FG5A 2RI7A 2LV9A 3P1EA 4CA1A 2YSJA 4IC3A 4YATA 5H1UA 1E6IA 4HXRA 4LYSA 5I83A 4S3OB 1WEVA 4QZSA 1BORA 3N9QA 3UVYA 4Z6IA 3IU5A 2QIZA 2JMIA 5L8UA 5DLXA 4OUFA 3NG2A 2DVQA 4BBQA 2L84A 4Z1QA 3C5KA 5CGPA 5AD3A 2K1JA 4FIPA 2DVSA 3GL6A 4IOQA 4NUCA 2YYNA 5CRZA 5F1HA 5I7YA 3U5OA 2LGVA 3S92A 4QR5A 5EPBA 4DONA 4O74A 5JI8A 3HCUA 5KH7A 5FDZA 2CSYA 4NRCA 2M3HA
chains in the Genus database with same CATH superfamily
3MUKA 3FL2A 3SUBA 4R8PK 4YBSA 4TS8A 5FE3A 1VYXA 2LGGA 4NR5A 4O7AA 3RCWA 5F60A 4QSUA 4NYXA 5D3SA 5FERA 2G4AA 4PTBA 5D1MB 4CFKA 2LRIC 5F25A 4CLBA 2ECWA 2YQLA 4N4GA 5I86A 5D3PA 2MD7B 4HBYA 4HXLA 5D3JA 3L1XA 5FE1A 4QC3A 4WA6A 4E96A 3M99A 5EWDA 2GRCA 4NR6A 5DBMA 3P1DA 4HXPA 4HXOA 4YK0A 3FAOA 5DW1A 2YREA 2EJNA 2LAUA 2HDPA 4QF2A 4BW1A 2R0YA 2YEKA 2QICA 2RNXA 4O7CA 2F6JA 4Q0OA 4UIUA 2BAYA 3PUQA 5EPRA 5I3LA 5HLSA 4YYGA 3IHPA 4QSPA 3KDEC 2PUYA 3MHSA 2C2LA 4N4HA 5L8TA 4PKLA 5CTLA 5AITA 5K3QA 4O77A 4QYLA 2ZETC 4AP4A 4UIYA 4YYMA 5C4QA 5CQAA 5DY7A 5E73A 1X0JA 2KYUA 2K4DA 5ENJA 5C13A 2LQ6A 2XP0A 5SVIA 4WHWA 2E6RA 3ONIA 1IYMA 4QSVA 4TU4A 3D7CA 2ECGA 1WEUA 3HMHA 2G45A 1WEPA 4O70A 5EWCA 1G25A 5FE6A 5HQ6A 2YURA 3GV4A 5CFWA 5CZGA 5EISA 5F63A 2DVVA 4YAXA 5FFYA 4BW3A 1K2FA 5FG4A 4AKIA 4YY4A 3UV2A 5FB0A 4CUSA 4J3IA 5J0DA 2KU3A 5A5SA 5B8DA 4MR5A 3P1FA 5EPSA 5ENGA 4Q6FA 3JVLA 1WEMA 2G43A 4KCXA 3N9LA 4YBMA 5BT5A 5EWWA 5IGKA 5A82A 1V87A 4YYKA 4I7DA 4BHWA 1LDJB 3VKHA 4NR9A 4I7BA 4NQMA 3M63A 2NXBA 5B78A 4OGJA 2KTBB 5CUAA 5CQ8A 5ETBA 4HXNA 5II2A 2CONA 4ALGA 1EQFA 4UP0A 4N3WA 4UP5A 5FE2A 4QB3A 4R2YA 1JM7A 5A83A 4NYWA 2L43A 2KGGA 2CT2A 2YEMA 2UZGA 5II1A 4OGCA 3O70A 3N9NA 4CUQA 2KE1A 5EVAA 1JM7B 4GB0A 5LVRA 5ENIA 5HRXA 2CKLA 2CSVA 4NQNA 2VPBA 3JUEA 2E7OA 1X4IA 2CRWA 2YSMA 3ZYUA 4P5OB 4AVXA 4PCEA 5COIA 2E7NA 5TBNA 3ZNIA 4UYHA 3UVWA 2CKLB 3SOUA 4BW2A 2DSMA 4YYDA 4PY6A 3ZPVE 2MA5A 4QSQA 5B77A 4Z1SA 5HEMA 5H1TA 5HENA 2E3KA 3G0LA 3DWYA 4NS5A 5ENHA 5F2PA 4UIZA 5FE7A 2ECVA 3O34A 4YBTA 4W4UA 4XYAA 5EI4A 2L75A 4R7EA 5EQ1A 5LJ1A 4UIWA 5DYAA 5K29A 3UV4A 5AIUA 5CUBA 4QR4A 4QSWA 4GNEA 4A9FA 4AI6A 4QYDA 5E9KA 5A5RA 2VPEA 3ERRA 5CY9A 3KNVA 2ECJA 5IBNA 2LXPC 2YU4A 3RPGC 1X4UA 4QC1A 5TB6A 3N9MA 4LYIA 3O37A 2K16A 3L1ZB 4Z0RA 4F52B 3DWDA 5CRMA 2WP2A 1WESA 2Y43A 4MEQA 4YABA 1ZKRA 4J1PA 4A9LA 5F3AA 2LGLA 4QSRA 5TRBA 5DYUA 4A4BA 1Z6UA 5FE4A 1WEWA 1Z60A 4A9EA 3AADA 3O33A 4LZ2A 5BT4A 4QSXA 1ZS5A 4WZ0A 4J0SA 5D3NA 4YH3A 5I88A 1WIMA 2VJEA 4NN2A 2L5EA 3DAIA 4TU6A 4LZSA 4QBMA 4WHUA 2KREA 5I89A 5DLZA 2KFTA 2KWNA 4LYWA 4YC9A 4MSXA 4GNGA 3FJUB 4TZ8A 5I7XA 2VJEB 3T6RA 5D25A 5FG6A 4MR3A 4O72A 5E74A 2IDAA 3N9OA 4WZ2A 5E9VA 3P1CA 2L80A 5FE9A 5C8GA 3FM8C 2L5UA 5DFCA 3SOWA 2VPDA 3LXJA 5CP5A 3Q1DA 5ENEA 5D1KB 4NUEA 2YQDA 3LQIA 4BJXA 2K17A 5ETDA 2KKXA 2LGKA 2FUIA 3T7LA 3ZVZB 2RSDA 1U6GB 5KH9A 4AUQB 2YELA 4CFLA 3G0JA 5LKZA 4LLBA 5G05B 5C89A 2F42A 3HCTA 5J3XA 3U5PA 3KV6A 4MVTA 3SHBA 2F6NA 4YYIA 5A5QA 2R0SA 5IGMA 4AKHA 5G0FA 3RPGB 4O78A 4YYNA 5E7DA 3JVKA 4Y03A 4GNDA 4C9ZA 4FK5A 2OWAA 3S91A 4XI1A 5CPEA 4O71A 4QNSA 4TZ2A 5L98A 5IGLA 2IQJA 5D3TA 5HQ5A 1MM3A 4GNFA 5EP7A 5CQ5A 5FH6A 1N72A 2VJFA 4CURA 4UYDA 4PCIA 4TT4A 4YYJA 2MJVB 3HMEA 4ZQLA 1F62A 2VJFB 5LKXA 2MNZA 5E9IA 3EB6A 4V3LC 2YVRA 2L7PA 2D82A 4QQ4A 2N9GA 3MDBC 3QZVA 4B86C 4BW4A 5FE5A 5KO4A 1T1HA 5IG6A 5DINA 5EWVA 5HM0A 1HYJA 4O7EA 1MBMA 5HRWA 4TT2A 5FH7A 3LDYA 5AD2A 2LSPB 5EGUA 5LJ2A 5C7NA 4ZUXU 3MULA 4UITA 1F68A 4B7YC 5AMFA 3UVDA 5D3HA 2JRJA 5G4SA 5KTXA 5FFVA 4ZW1A 5CUDA 1ZBDB 4TT6A 1WUMA 4A9IA 3IU6A 5DX4A 3DQVR 3FKMX 2YDWA 2KKYA 4LADB 3GG3A 4N4IA 5H9MA 1JSPB 2D8UA 4KV1A 2EODA 2AN6A 5G4RA 5I1QA 3U5JA 3HCSA 4Z93A 4F1PA 1LDKC 5C85A 1Z2QA 4LZRA 2JUNA 4HBVA 3MB4A 4QEUA 2FFWA 5A7CA 2KWOA 2YYRA 5LUUA 1DVPA 4XUBA 2QJ0A 2YHNA 5G04B 5FE0A 1HYIA 4O7FA 2OO1A 5CUGA 4NYVA 4A9KA 5F1LA 1FP0A 3D1BA 5A81A 1WGMA 2DKWA 1WUGA 3LRQA 3D1DA 5FEYA 3O7AA 4L58A 5E0RA 4NXJA 4OGEA 5EWHA 5LVQA 5ENFA 2MA6A 3T9KA 5D7XA 5A5NA 4CL9A 2LXHC 4N4FA 4UIVA 4IR4A 1VD4A 3E2DA 1WFKA 4MENA 3C6WA 4QSSA 4QUTA 4YH4A 2XEUA 3FEHA 4IORA 5TABA 5I29A 3ZYQA 4PPEA 5EK9A 3ASLA 3PHDA 2MIQA 4A4CA 2ECIA 5LKTA 5EV9A 5B75A 4NR4A 2LN0A 2NAAA 2PNXA 4LRGA 2H0DA 4ZDTA 3JVJA 3MXFA 4FO9A 3RTRB 4O76A 5FBXA 3SOXA 4CUTA 3MQMA 4O64A 5FH8A 2Y1NA 4HXMA 2D9EA 5C87A 4V3KC 2H0DB 3O35A 4ALHA 4F3IA 3ZPV1 5CUEA 5LKUA 4O75A 5FB1A 2DATA 2DWWA 4LR6A 4QY4A 2L0BA 5TDWA 3Q2EA 2ECTA 2EXUA 2G6QA 3O36A 3M7KA 5FFWA 2OSSA 4MEOA 2CSZA 2MD8C 5HCLA 2M13A 5CU8A 4Q0NA 4HXKA 5FE8A 3SVGA 1WE9A 5DYCA 2VPGA 5D3LA 1WENA 2KIZA 4IR3A 2VNFA 4A0CD 1CHCA 2XOZA 5D1LB 4YY6A 5CQ7A 4TQNA 4XY8A 2R10A 5IGNA 5CS8A 5HRVA 2L85A 5DKCA 3LQJA 3LQHA 5E9LA 2P57A 2JMJA 2DX8A 3KQIA 1WILA 2RNWA 5B79A 5ACYA 1RMDA 4TTEA 3VK6A 5IIDA 5B76A 5BT3A 5DFBA 4MEPA 4LDFA 5ENBA 4LKAA 3QZSA 4QR3A 2RNYA 2M6MA 3H7HA 2DVRA 4QEWA 5A85A 4C67A 5A5OA 3KV5A 4UI9B 2I50A 3NXBA 2KWKA 2Y1MA 1MM2A 4UYEA 4QSTA 2RO1A 4X3GA 5F36A 2D8SA 5DKAA 5L96A 3HMFA 4OGIA 2ECNA 3FANA 5DYXA 2JM3A 3U5KA 5CQ3A 2XOCA 3LVQE 5C11A 5HFRA 5CQ6A 4NR7A 4QUUA 5HQ7A 2MUMA 2YUCA 2H60A 2KGIA 5DKDA 3ZVYA 4NR8A 4FLPA 4UYGA 2FSAA 5ENCA 5HELA 5I80A 3N9PA 5KTWA 4C66A 5F62A 5KH3A 4O7BA 2HYED 2FUUA 5L99A 5LCWB 4KV4A 4NRBA 4A9NA 3I3JA 4HXSA 5A5PA 2JMDA 5KU3A 5CUCA 4WZ3B 5DKHA 5TCMA 1E4UA 4CUPA 4X2IA 3UW9A 2MT5A 5E3GA 4L7XA 4NRAA 2C2VS 4IR5A 2MKEA 2E6SA 1JOCA 1JM4B 2VP7A 4LK9A 5EU1A 1PUOA 3U5LA 5F5ZA 3DDTA 3PURA 5H85A 2YT5A 5EM3A 5LJ0A 2OUOA 5CQ4A 5L97A 4A9OA 2R0VA 2WP1A 3K2JA 5HFQA 5SVIB 1X4JA 4AYCA 4RVRA 1VFYA 4A9JA 5CQTA 5D0CA 4TKPB 3Q2FA 4NUDA 4YADA 4LJNA 4LC2A 5JG6A 5DW2A 3ZTGA 3JVMA 4J0RA 5KTUA 4Z6HA 3I2DA 4S3OC 4AYCB 2OXQC 3DPLR 5SVYA 4HBXA 4I7CA 4WIVA 3MHHA 4UIXA 3UVXA 3U5NA 3UV5A 4CUUA 1N87A 1WEQA 2YW8A 2YW5A 4MR6A 4UYFA 2M85A 4ZC9A 2E61A 5AMEA 4XY9A 2YQMA 5I40A 2I8NA 4UYFB 5E9MA 2LDRA 3L11A 3TLPA 3SVHA 2EA6A 4A49A 2RFJA 5F61A 3SVFA 5H1VA 4HBWA 5DFDA 3LVRE 2KR4A 4XUAA 5EYAF 3O47A 4MR4A 5KHMA 3EB5A 2RR4A 5HJCA 4AKNA 2KWJA 2EGPA 4QF3A 2DJAA 1DCQA 3HTKC 2XB1A 4IR6A 4GPJA 4A9HA 2YHOA 4IC2A 3M62A 4H9DA 2I7KA 4A9MA 4CCGX 2MNYA 1FBVA 4QEVA 5D26A 5D3RA 1XWHA 5D24A 2RS9B 5TDRA 3P5OA 5E3DA 3LJWA 3V43A 3QZTA 4YYHA 3U5MA 3MB3A 5EA1A 2M1RA 1WEEA 2EGMA 5JWMA 4PS5A 4TYLA 3AQAA 1WEOA 4FJCA 5E9YA 4Z0OA 5EICA 4IOOA 5FG5A 2RI7A 2LV9A 3P1EA 4CA1A 2YSJA 4IC3A 4YATA 3PLWA 5H1UA 1E6IA 4HXRA 4LYSA 5I83A 4S3OB 1WEVA 4QZSA 1BORA 3N9QA 2FD4A 3UVYA 4O62A 4Z6IA 3IU5A 2QIZA 2JMIA 3LJUX 5L8UA 4AKGA 5DLXA 4OUFA 3NG2A 2DVQA 4BBQA 2L84A 4Z1QA 2B0OE 5CGPA 5AD3A 2K1JA 3C5KA 4FIPA 2DVSA 3GL6A 4IOQA 4NUCA 2YYNA 5CRZA 5F1HA 5I7YA 3U5OA 2LGVA 3S92A 2XOYA 4QR5A 5EPBA 2CRRA 4DONA 4O74A 3VKGA 5JI8A 3HCUA 5KH7A 5FDZA 2CSYA 5SVXA 4NRCA 2M3HA
chains in the Genus database with same CATH topology
3MUKA 3FL2A 4R8PK 4YBSA 4TS8A 5FE3A 1VYXA 2LGGA 4NR5A 4O7AA 3RCWA 5F60A 4QSUA 4NYXA 5D3SA 5FERA 2G4AA 4PTBA 5D1MB 4CFKA 2LRIC 5F25A 4CLBA 2ECWA 2YQLA 4N4GA 5I86A 5D3PA 2MD7B 4HBYA 4HXLA 5D3JA 3L1XA 5FE1A 4QC3A 4WA6A 4E96A 3M99A 5EWDA 2GRCA 4NR6A 5DBMA 3P1DA 4HXPA 4HXOA 4YK0A 5DW1A 2YREA 2HDPA 4QF2A 4BW1A 2R0YA 2YEKA 2QICA 2RNXA 4O7CA 2F6JA 4Q0OA 4UIUA 2BAYA 3PUQA 5EPRA 5I3LA 5HLSA 4YYGA 3IHPA 4QSPA 2PUYA 3MHSA 2C2LA 4N4HA 5L8TA 4PKLA 5CTLA 5AITA 4O77A 4QYLA 2ZETC 4AP4A 4UIYA 4YYMA 5C4QA 5CQAA 5DY7A 5E73A 1X0JA 2KYUA 2K4DA 5ENJA 5C13A 2LQ6A 4WHWA 2E6RA 3ONIA 1IYMA 4QSVA 4TU4A 3D7CA 2ECGA 1WEUA 3HMHA 2G45A 1WEPA 4O70A 5EWCA 1G25A 5FE6A 5HQ6A 2YURA 3GV4A 5CFWA 5CZGA 5EISA 5F63A 2DVVA 4YAXA 5FFYA 4BW3A 1K2FA 5FG4A 4YY4A 3UV2A 5FB0A 4CUSA 4J3IA 5J0DA 2KU3A 5A5SA 5B8DA 4MR5A 3P1FA 5EPSA 5ENGA 4Q6FA 3JVLA 1WEMA 2G43A 4KCXA 3N9LA 4YBMA 5BT5A 5EWWA 5IGKA 5A82A 1V87A 4YYKA 4I7DA 4BHWA 1LDJB 4NR9A 4I7BA 4NQMA 3M63A 2NXBA 5B78A 4OGJA 2KTBB 5CUAA 5CQ8A 5ETBA 4HXNA 5II2A 4ALGA 1EQFA 4UP0A 4N3WA 4UP5A 5FE2A 4QB3A 4R2YA 1JM7A 5A83A 4NYWA 2L43A 2KGGA 2CT2A 2YEMA 2UZGA 5II1A 3O70A 3N9NA 4CUQA 2KE1A 5EVAA 1JM7B 4GB0A 5LVRA 5ENIA 5HRXA 2CKLA 2VPBA 4NQNA 2E7OA 1X4IA 2YSMA 4AVXA 3ZYUA 4P5OB 4PCEA 5COIA 2E7NA 5TBNA 3ZNIA 4UYHA 3UVWA 2CKLB 3SOUA 4BW2A 4YYDA 4PY6A 3ZPVE 2MA5A 4QSQA 5B77A 4Z1SA 5HEMA 5H1TA 5HENA 2E3KA 3G0LA 3DWYA 4NS5A 5ENHA 5F2PA 4UIZA 5FE7A 2ECVA 3O34A 4YBTA 4W4UA 4XYAA 5EI4A 2L75A 4R7EA 5EQ1A 5LJ1A 4UIWA 5DYAA 5K29A 3UV4A 5AIUA 5CUBA 4QR4A 4QSWA 4GNEA 4A9FA 4QYDA 5E9KA 5A5RA 2VPEA 5CY9A 3KNVA 2ECJA 5IBNA 2LXPC 2YU4A 3RPGC 1X4UA 4QC1A 5TB6A 3N9MA 4LYIA 3O37A 2K16A 3L1ZB 4F52B 5CRMA 2WP2A 1WESA 2Y43A 4MEQA 4YABA 4A9LA 4J1PA 5F3AA 2LGLA 4QSRA 5TRBA 5DYUA 4A4BA 1Z6UA 5FE4A 1WEWA 1Z60A 4A9EA 3AADA 3O33A 4LZ2A 5BT4A 4QSXA 1ZS5A 4WZ0A 4J0SA 5D3NA 4YH3A 5I88A 1WIMA 2VJEA 4NN2A 2L5EA 3DAIA 4TU6A 4LZSA 4QBMA 4WHUA 2KREA 5I89A 5DLZA 2KFTA 2KWNA 4LYWA 4YC9A 4MSXA 4GNGA 4TZ8A 5I7XA 2VJEB 3T6RA 5D25A 5FG6A 4MR3A 4O72A 5E74A 2IDAA 3N9OA 4WZ2A 5E9VA 3P1CA 2L80A 5FE9A 5C8GA 3SOWA 2L5UA 5DFCA 2VPDA 3LXJA 5CP5A 5ENEA 5D1KB 4NUEA 2YQDA 3LQIA 4BJXA 2K17A 5ETDA 2LGKA 3ZVZB 2FUIA 3T7LA 2RSDA 1U6GB 5KH9A 4AUQB 2YELA 4CFLA 3G0JA 5LKZA 4LLBA 5G05B 5C89A 2F42A 3HCTA 5J3XA 3U5PA 3KV6A 4MVTA 3SHBA 2F6NA 4YYIA 5A5QA 2R0SA 5IGMA 5G0FA 3RPGB 4O78A 4YYNA 5E7DA 3JVKA 4Y03A 4GNDA 4C9ZA 4FK5A 3S91A 4XI1A 5CPEA 4O71A 4QNSA 4TZ2A 5L98A 5IGLA 5D3TA 5HQ5A 1MM3A 4GNFA 5EP7A 5CQ5A 5FH6A 1N72A 2VJFA 4CURA 4UYDA 4PCIA 4TT4A 4YYJA 2MJVB 3HMEA 4ZQLA 1F62A 2VJFB 5LKXA 2MNZA 5E9IA 3EB6A 4V3LC 2D82A 2N9GA 3QZVA 4B86C 4BW4A 5FE5A 5KO4A 1T1HA 5IG6A 5DINA 5EWVA 5HM0A 1HYJA 4O7EA 5HRWA 4TT2A 5FH7A 5AD2A 2LSPB 5EGUA 5LJ2A 5C7NA 4ZUXU 3MULA 4UITA 1F68A 4B7YC 5AMFA 3UVDA 5D3HA 2JRJA 5G4SA 5KTXA 5FFVA 4ZW1A 5CUDA 1ZBDB 4TT6A 1WUMA 4A9IA 3IU6A 5DX4A 3DQVR 3FKMX 2YDWA 4LADB 3GG3A 4N4IA 5H9MA 1JSPB 4KV1A 2EODA 2AN6A 5G4RA 5I1QA 3U5JA 3HCSA 4Z93A 1LDKC 5C85A 1Z2QA 4LZRA 4HBVA 3MB4A 4QEUA 5A7CA 2KWOA 2YYRA 5LUUA 1DVPA 4XUBA 2QJ0A 2YHNA 5G04B 5FE0A 1HYIA 4O7FA 2OO1A 5CUGA 4NYVA 4A9KA 5F1LA 1FP0A 5A81A 1WGMA 2DKWA 1WUGA 3LRQA 5FEYA 3O7AA 4L58A 5E0RA 4NXJA 5EWHA 5LVQA 5ENFA 2MA6A 5D7XA 5A5NA 4CL9A 2LXHC 4N4FA 4UIVA 4IR4A 1VD4A 1WFKA 4MENA 3C6WA 4QSSA 4QUTA 4YH4A 2XEUA 4IORA 5TABA 5I29A 3ZYQA 4PPEA 5EK9A 3ASLA 3PHDA 2MIQA 4A4CA 2ECIA 5LKTA 5EV9A 5B75A 4NR4A 2LN0A 2NAAA 2PNXA 4LRGA 2H0DA 4ZDTA 3JVJA 3MXFA 4FO9A 3RTRB 4O76A 5FBXA 3SOXA 4CUTA 3MQMA 4O64A 5FH8A 2Y1NA 4HXMA 2D9EA 5C87A 4V3KC 2H0DB 3O35A 4ALHA 4F3IA 3ZPV1 5CUEA 5LKUA 4O75A 5FB1A 2DATA 2DWWA 4LR6A 4QY4A 2L0BA 5TDWA 3Q2EA 2ECTA 2G6QA 3O36A 5FFWA 2OSSA 4MEOA 2CSZA 2MD8C 5HCLA 5CU8A 4Q0NA 4HXKA 5FE8A 3SVGA 1WE9A 5DYCA 2VPGA 5D3LA 1WENA 2KIZA 4IR3A 2VNFA 4A0CD 1CHCA 5D1LB 4YY6A 5CQ7A 4TQNA 4XY8A 2R10A 5IGNA 5CS8A 5HRVA 2L85A 5DKCA 3LQJA 3LQHA 5E9LA 2JMJA 2DX8A 3KQIA 1WILA 2RNWA 5B79A 5ACYA 1RMDA 4TTEA 3VK6A 5IIDA 5B76A 5BT3A 5DFBA 4MEPA 4LDFA 5ENBA 4LKAA 3QZSA 4QR3A 2RNYA 2M6MA 2DVRA 4QEWA 5A85A 4C67A 5A5OA 3KV5A 4UI9B 2I50A 3NXBA 2KWKA 2Y1MA 1MM2A 4UYEA 4QSTA 2RO1A 4X3GA 5F36A 2D8SA 5DKAA 5L96A 3HMFA 4OGIA 2ECNA 5DYXA 5C11A 3U5KA 5CQ3A 5HFRA 5CQ6A 4NR7A 4QUUA 5HQ7A 2MUMA 2YUCA 2H60A 2KGIA 5DKDA 3ZVYA 4NR8A 4FLPA 4UYGA 2FSAA 5ENCA 5HELA 5I80A 3N9PA 5KTWA 4C66A 5F62A 5KH3A 4O7BA 2HYED 2FUUA 5L99A 5LCWB 4KV4A 4NRBA 4A9NA 3I3JA 4HXSA 5A5PA 2JMDA 5KU3A 5CUCA 4WZ3B 5DKHA 5TCMA 1E4UA 4CUPA 4X2IA 3UW9A 2MT5A 5E3GA 4L7XA 4NRAA 2C2VS 4IR5A 2E6SA 1JOCA 1JM4B 2VP7A 4LK9A 5EU1A 3U5LA 5F5ZA 3PURA 5H85A 2YT5A 5EM3A 5LJ0A 2OUOA 5CQ4A 5L97A 4A9OA 2R0VA 2WP1A 3K2JA 5HFQA 1X4JA 4AYCA 4RVRA 1VFYA 4A9JA 5CQTA 5D0CA 4TKPB 3Q2FA 4NUDA 4YADA 4LJNA 4LC2A 5JG6A 5DW2A 3ZTGA 3JVMA 4J0RA 5KTUA 4Z6HA 3I2DA 4S3OC 4AYCB 2OXQC 3DPLR 4HBXA 4I7CA 4WIVA 3MHHA 4UIXA 3UVXA 3U5NA 3UV5A 4CUUA 1N87A 1WEQA 2YW8A 2YW5A 4MR6A 4UYFA 2M85A 4ZC9A 5AMEA 4XY9A 2YQMA 5I40A 2I8NA 4UYFB 5E9MA 2LDRA 3L11A 3TLPA 3SVHA 2EA6A 4A49A 2RFJA 5F61A 3SVFA 5H1VA 4HBWA 5DFDA 2KR4A 4XUAA 5EYAF 4MR4A 5KHMA 3EB5A 5HJCA 4AKNA 2KWJA 2EGPA 4QF3A 3HTKC 2XB1A 4IR6A 4GPJA 4A9HA 2YHOA 4IC2A 3M62A 2I7KA 4A9MA 4CCGX 2MNYA 1FBVA 4QEVA 5D26A 5D3RA 1XWHA 5D24A 2RS9B 5TDRA 3P5OA 5E3DA 3LJWA 3V43A 3QZTA 4YYHA 3U5MA 3MB3A 5EA1A 2M1RA 1WEEA 5JWMA 4PS5A 4TYLA 3AQAA 1WEOA 4FJCA 5E9YA 5EICA 4IOOA 5FG5A 2RI7A 2LV9A 3P1EA 4CA1A 2YSJA 4IC3A 4YATA 5H1UA 1E6IA 4HXRA 4LYSA 5I83A 4S3OB 1WEVA 4QZSA 1BORA 3N9QA 3UVYA 4Z6IA 3IU5A 2QIZA 2JMIA 5L8UA 5DLXA 4OUFA 3NG2A 2DVQA 4BBQA 2L84A 4Z1QA 3C5KA 5CGPA 5AD3A 2K1JA 4FIPA 2DVSA 3GL6A 4IOQA 4NUCA 2YYNA 5CRZA 5F1HA 5I7YA 3U5OA 2LGVA 3S92A 4QR5A 5EPBA 4DONA 4O74A 5JI8A 3HCUA 5KH7A 5FDZA 2CSYA 4NRCA 2M3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUK A;  3FL2 A;  4R8P K;  4YBS A;  4TS8 A;  5FE3 A;  1VYX A;  2LGG A;  4NR5 A;  4O7A A;  3RCW A;  5F60 A;  4QSU A;  4NYX A;  5D3S A;  5FER A;  2G4A A;  4PTB A;  5D1M B;  4CFK A;  2LRI C;  5F25 A;  4CLB A;  2ECW A;  2YQL A;  4N4G A;  5I86 A;  5D3P A;  2MD7 B;  4HBY A;  4HXL A;  5D3J A;  3L1X A;  5FE1 A;  4QC3 A;  4WA6 A;  4E96 A;  3M99 A;  5EWD A;  2GRC A;  4NR6 A;  5DBM A;  3P1D A;  4HXP A;  4HXO A;  4YK0 A;  5DW1 A;  2YRE A;  2HDP A;  4QF2 A;  4BW1 A;  2R0Y A;  2YEK A;  2QIC A;  2RNX A;  4O7C A;  2F6J A;  4Q0O A;  4UIU A;  2BAY A;  3PUQ A;  5EPR A;  5I3L A;  5HLS A;  4YYG A;  3IHP A;  4QSP A;  2PUY A;  3MHS A;  2C2L A;  4N4H A;  5L8T A;  4PKL A;  5CTL A;  5AIT A;  4O77 A;  4QYL A;  2ZET C;  4AP4 A;  4UIY A;  4YYM A;  5C4Q A;  5CQA A;  5DY7 A;  5E73 A;  1X0J A;  2KYU A;  2K4D A;  5ENJ A;  5C13 A;  2LQ6 A;  4WHW A;  2E6R A;  3ONI A;  1IYM A;  4QSV A;  4TU4 A;  3D7C A;  2ECG A;  1WEU A;  3HMH A;  2G45 A;  1WEP A;  4O70 A;  5EWC A;  1G25 A;  5FE6 A;  5HQ6 A;  2YUR A;  3GV4 A;  5CFW A;  5CZG A;  5EIS A;  5F63 A;  2DVV A;  4YAX A;  5FFY A;  4BW3 A;  1K2F A;  5FG4 A;  4YY4 A;  3UV2 A;  5FB0 A;  4CUS A;  4J3I A;  5J0D A;  2KU3 A;  5A5S A;  5B8D A;  4MR5 A;  3P1F A;  5EPS A;  5ENG A;  4Q6F A;  3JVL A;  1WEM A;  2G43 A;  4KCX A;  3N9L A;  4YBM A;  5BT5 A;  5EWW A;  5IGK A;  5A82 A;  1V87 A;  4YYK A;  4I7D A;  4BHW A;  1LDJ B;  4NR9 A;  4I7B A;  4NQM A;  3M63 A;  2NXB A;  5B78 A;  4OGJ A;  2KTB B;  5CUA A;  5CQ8 A;  5ETB A;  4HXN A;  5II2 A;  4ALG A;  1EQF A;  4UP0 A;  4N3W A;  4UP5 A;  5FE2 A;  4QB3 A;  4R2Y A;  1JM7 A;  5A83 A;  4NYW A;  2L43 A;  2KGG A;  2CT2 A;  2YEM A;  2UZG A;  5II1 A;  3O70 A;  3N9N A;  4CUQ A;  2KE1 A;  5EVA A;  1JM7 B;  4GB0 A;  5LVR A;  5ENI A;  5HRX A;  2CKL A;  2VPB A;  4NQN A;  2E7O A;  1X4I A;  2YSM A;  4AVX A;  3ZYU A;  4P5O B;  4PCE A;  5COI A;  2E7N A;  5TBN A;  3ZNI A;  4UYH A;  3UVW A;  2CKL B;  3SOU A;  4BW2 A;  4YYD A;  4PY6 A;  3ZPV E;  2MA5 A;  4QSQ A;  5B77 A;  4Z1S A;  5HEM A;  5H1T A;  5HEN A;  2E3K A;  3G0L A;  3DWY A;  4NS5 A;  5ENH A;  5F2P A;  4UIZ A;  5FE7 A;  2ECV A;  3O34 A;  4YBT A;  4W4U A;  4XYA A;  5EI4 A;  2L75 A;  4R7E A;  5EQ1 A;  5LJ1 A;  4UIW A;  5DYA A;  5K29 A;  3UV4 A;  5AIU A;  5CUB A;  4QR4 A;  4QSW A;  4GNE A;  4A9F A;  4QYD A;  5E9K A;  5A5R A;  2VPE A;  5CY9 A;  3KNV A;  2ECJ A;  5IBN A;  2LXP C;  2YU4 A;  3RPG C;  1X4U A;  4QC1 A;  5TB6 A;  3N9M A;  4LYI A;  3O37 A;  2K16 A;  3L1Z B;  4F52 B;  5CRM A;  2WP2 A;  1WES A;  2Y43 A;  4MEQ A;  4YAB A;  4A9L A;  4J1P A;  5F3A A;  2LGL A;  4QSR A;  5TRB A;  5DYU A;  4A4B A;  1Z6U A;  5FE4 A;  1WEW A;  1Z60 A;  4A9E A;  3AAD A;  3O33 A;  4LZ2 A;  5BT4 A;  4QSX A;  1ZS5 A;  4WZ0 A;  4J0S A;  5D3N A;  4YH3 A;  5I88 A;  1WIM A;  2VJE A;  4NN2 A;  2L5E A;  3DAI A;  4TU6 A;  4LZS A;  4QBM A;  4WHU A;  2KRE A;  5I89 A;  5DLZ A;  2KFT A;  2KWN A;  4LYW A;  4YC9 A;  4MSX A;  4GNG A;  4TZ8 A;  5I7X A;  2VJE B;  3T6R A;  5D25 A;  5FG6 A;  4MR3 A;  4O72 A;  5E74 A;  2IDA A;  3N9O A;  4WZ2 A;  5E9V A;  3P1C A;  2L80 A;  5FE9 A;  5C8G A;  3SOW A;  2L5U A;  5DFC A;  2VPD A;  3LXJ A;  5CP5 A;  5ENE A;  5D1K B;  4NUE A;  2YQD A;  3LQI A;  4BJX A;  2K17 A;  5ETD A;  2LGK A;  3ZVZ B;  2FUI A;  3T7L A;  2RSD A;  1U6G B;  5KH9 A;  4AUQ B;  2YEL A;  4CFL A;  3G0J A;  5LKZ A;  4LLB A;  5G05 B;  5C89 A;  2F42 A;  3HCT A;  5J3X A;  3U5P A;  3KV6 A;  4MVT A;  3SHB A;  2F6N A;  4YYI A;  5A5Q A;  2R0S A;  5IGM A;  5G0F A;  3RPG B;  4O78 A;  4YYN A;  5E7D A;  3JVK A;  4Y03 A;  4GND A;  4C9Z A;  4FK5 A;  3S91 A;  4XI1 A;  5CPE A;  4O71 A;  4QNS A;  4TZ2 A;  5L98 A;  5IGL A;  5D3T A;  5HQ5 A;  1MM3 A;  4GNF A;  5EP7 A;  5CQ5 A;  5FH6 A;  1N72 A;  2VJF A;  4CUR A;  4UYD A;  4PCI A;  4TT4 A;  4YYJ A;  2MJV B;  3HME A;  4ZQL A;  1F62 A;  2VJF B;  5LKX A;  2MNZ A;  5E9I A;  3EB6 A;  4V3L C;  2D82 A;  2N9G A;  3QZV A;  4B86 C;  4BW4 A;  5FE5 A;  5KO4 A;  1T1H A;  5IG6 A;  5DIN A;  5EWV A;  5HM0 A;  1HYJ A;  4O7E A;  5HRW A;  4TT2 A;  5FH7 A;  5AD2 A;  2LSP B;  5EGU A;  5LJ2 A;  5C7N A;  4ZUX U;  3MUL A;  4UIT A;  1F68 A;  4B7Y C;  5AMF A;  3UVD A;  5D3H A;  2JRJ A;  5G4S A;  5KTX A;  5FFV A;  4ZW1 A;  5CUD A;  1ZBD B;  4TT6 A;  1WUM A;  4A9I A;  3IU6 A;  5DX4 A;  3DQV R;  3FKM X;  2YDW A;  4LAD B;  3GG3 A;  4N4I A;  5H9M A;  1JSP B;  4KV1 A;  2EOD A;  2AN6 A;  5G4R A;  5I1Q A;  3U5J A;  3HCS A;  4Z93 A;  1LDK C;  5C85 A;  1Z2Q A;  4LZR A;  4HBV A;  3MB4 A;  4QEU A;  5A7C A;  2KWO A;  2YYR A;  5LUU A;  1DVP A;  4XUB A;  2QJ0 A;  2YHN A;  5G04 B;  5FE0 A;  1HYI A;  4O7F A;  2OO1 A;  5CUG A;  4NYV A;  4A9K A;  5F1L A;  1FP0 A;  5A81 A;  1WGM A;  2DKW A;  1WUG A;  3LRQ A;  5FEY A;  3O7A A;  4L58 A;  5E0R A;  4NXJ A;  5EWH A;  5LVQ A;  5ENF A;  2MA6 A;  5D7X A;  5A5N A;  4CL9 A;  2LXH C;  4N4F A;  4UIV A;  4IR4 A;  1VD4 A;  1WFK A;  4MEN A;  3C6W A;  4QSS A;  4QUT A;  4YH4 A;  2XEU A;  4IOR A;  5TAB A;  5I29 A;  3ZYQ A;  4PPE A;  5EK9 A;  3ASL A;  3PHD A;  2MIQ A;  4A4C A;  2ECI A;  5LKT A;  5EV9 A;  5B75 A;  4NR4 A;  2LN0 A;  2NAA A;  2PNX A;  4LRG A;  2H0D A;  4ZDT A;  3JVJ A;  3MXF A;  4FO9 A;  3RTR B;  4O76 A;  5FBX A;  3SOX A;  4CUT A;  3MQM A;  4O64 A;  5FH8 A;  2Y1N A;  4HXM A;  2D9E A;  5C87 A;  4V3K C;  2H0D B;  3O35 A;  4ALH A;  4F3I A;  3ZPV 1;  5CUE A;  5LKU A;  4O75 A;  5FB1 A;  2DAT A;  2DWW A;  4LR6 A;  4QY4 A;  2L0B A;  5TDW A;  3Q2E A;  2ECT A;  2G6Q A;  3O36 A;  5FFW A;  2OSS A;  4MEO A;  2CSZ A;  2MD8 C;  5HCL A;  5CU8 A;  4Q0N A;  4HXK A;  5FE8 A;  3SVG A;  1WE9 A;  5DYC A;  2VPG A;  5D3L A;  1WEN A;  2KIZ A;  4IR3 A;  2VNF A;  4A0C D;  1CHC A;  5D1L B;  4YY6 A;  5CQ7 A;  4TQN A;  4XY8 A;  2R10 A;  5IGN A;  5CS8 A;  5HRV A;  2L85 A;  5DKC A;  3LQJ A;  3LQH A;  5E9L A;  2JMJ A;  2DX8 A;  3KQI A;  1WIL A;  2RNW A;  5B79 A;  5ACY A;  1RMD A;  4TTE A;  3VK6 A;  5IID A;  5B76 A;  5BT3 A;  5DFB A;  4MEP A;  4LDF A;  5ENB A;  4LKA A;  3QZS A;  4QR3 A;  2RNY A;  2M6M A;  2DVR A;  4QEW A;  5A85 A;  4C67 A;  5A5O A;  3KV5 A;  4UI9 B;  2I50 A;  3NXB A;  2KWK A;  2Y1M A;  1MM2 A;  4UYE A;  4QST A;  2RO1 A;  4X3G A;  5F36 A;  2D8S A;  5DKA A;  5L96 A;  3HMF A;  4OGI A;  2ECN A;  5DYX A;  5C11 A;  3U5K A;  5CQ3 A;  5HFR A;  5CQ6 A;  4NR7 A;  4QUU A;  5HQ7 A;  2MUM A;  2YUC A;  2H60 A;  2KGI A;  5DKD A;  3ZVY A;  4NR8 A;  4FLP A;  4UYG A;  2FSA A;  5ENC A;  5HEL A;  5I80 A;  3N9P A;  5KTW A;  4C66 A;  5F62 A;  5KH3 A;  4O7B A;  2HYE D;  2FUU A;  5L99 A;  5LCW B;  4KV4 A;  4NRB A;  4A9N A;  3I3J A;  4HXS A;  5A5P A;  2JMD A;  5KU3 A;  5CUC A;  4WZ3 B;  5DKH A;  5TCM A;  1E4U A;  4CUP A;  4X2I A;  3UW9 A;  2MT5 A;  5E3G A;  4L7X A;  4NRA A;  2C2V S;  4IR5 A;  2E6S A;  1JOC A;  1JM4 B;  2VP7 A;  4LK9 A;  5EU1 A;  3U5L A;  5F5Z A;  3PUR A;  5H85 A;  2YT5 A;  5EM3 A;  5LJ0 A;  2OUO A;  5CQ4 A;  5L97 A;  4A9O A;  2R0V A;  2WP1 A;  3K2J A;  5HFQ A;  1X4J A;  4AYC A;  4RVR A;  1VFY A;  4A9J A;  5CQT A;  5D0C A;  4TKP B;  3Q2F A;  4NUD A;  4YAD A;  4LJN A;  4LC2 A;  5JG6 A;  5DW2 A;  3ZTG A;  3JVM A;  4J0R A;  5KTU A;  4Z6H A;  3I2D A;  4S3O C;  4AYC B;  2OXQ C;  3DPL R;  4HBX A;  4I7C A;  4WIV A;  3MHH A;  4UIX A;  3UVX A;  3U5N A;  3UV5 A;  4CUU A;  1N87 A;  1WEQ A;  2YW8 A;  2YW5 A;  4MR6 A;  4UYF A;  2M85 A;  4ZC9 A;  5AME A;  4XY9 A;  2YQM A;  5I40 A;  2I8N A;  4UYF B;  5E9M A;  2LDR A;  3L11 A;  3TLP A;  3SVH A;  2EA6 A;  4A49 A;  2RFJ A;  5F61 A;  3SVF A;  5H1V A;  4HBW A;  5DFD A;  2KR4 A;  4XUA A;  5EYA F;  4MR4 A;  5KHM A;  3EB5 A;  5HJC A;  4AKN A;  2KWJ A;  2EGP A;  4QF3 A;  3HTK C;  2XB1 A;  4IR6 A;  4GPJ A;  4A9H A;  2YHO A;  4IC2 A;  3M62 A;  2I7K A;  4A9M A;  4CCG X;  2MNY A;  1FBV A;  4QEV A;  5D26 A;  5D3R A;  1XWH A;  5D24 A;  2RS9 B;  5TDR A;  3P5O A;  5E3D A;  3LJW A;  3V43 A;  3QZT A;  4YYH A;  3U5M A;  3MB3 A;  5EA1 A;  2M1R A;  1WEE A;  5JWM A;  4PS5 A;  4TYL A;  3AQA A;  1WEO A;  4FJC A;  5E9Y A;  5EIC A;  4IOO A;  5FG5 A;  2RI7 A;  2LV9 A;  3P1E A;  4CA1 A;  2YSJ A;  4IC3 A;  4YAT A;  5H1U A;  1E6I A;  4HXR A;  4LYS A;  5I83 A;  4S3O B;  1WEV A;  4QZS A;  1BOR A;  3N9Q A;  3UVY A;  4Z6I A;  3IU5 A;  2QIZ A;  2JMI A;  5L8U A;  5DLX A;  4OUF A;  3NG2 A;  2DVQ A;  4BBQ A;  2L84 A;  4Z1Q A;  3C5K A;  5CGP A;  5AD3 A;  2K1J A;  4FIP A;  2DVS A;  3GL6 A;  4IOQ A;  4NUC A;  2YYN A;  5CRZ A;  5F1H A;  5I7Y A;  3U5O A;  2LGV A;  3S92 A;  4QR5 A;  5EPB A;  4DON A;  4O74 A;  5JI8 A;  3HCU A;  5KH7 A;  5FDZ A;  2CSY A;  4NRC A;  2M3H A; 
#chains in the Genus database with same CATH topology
 3MUK A;  3FL2 A;  3SUB A;  4R8P K;  4YBS A;  4TS8 A;  5FE3 A;  1VYX A;  2LGG A;  4NR5 A;  4O7A A;  3RCW A;  5F60 A;  4QSU A;  4NYX A;  5D3S A;  5FER A;  2G4A A;  4PTB A;  5D1M B;  4CFK A;  2LRI C;  5F25 A;  4CLB A;  2ECW A;  2YQL A;  4N4G A;  5I86 A;  5D3P A;  2MD7 B;  4HBY A;  4HXL A;  5D3J A;  3L1X A;  5FE1 A;  4QC3 A;  4WA6 A;  4E96 A;  3M99 A;  5EWD A;  2GRC A;  4NR6 A;  5DBM A;  3P1D A;  4HXP A;  4HXO A;  4YK0 A;  3FAO A;  5DW1 A;  2YRE A;  2EJN A;  2LAU A;  2HDP A;  4QF2 A;  4BW1 A;  2R0Y A;  2YEK A;  2QIC A;  2RNX A;  4O7C A;  2F6J A;  4Q0O A;  4UIU A;  2BAY A;  3PUQ A;  5EPR A;  5I3L A;  5HLS A;  4YYG A;  3IHP A;  4QSP A;  3KDE C;  2PUY A;  3MHS A;  2C2L A;  4N4H A;  5L8T A;  4PKL A;  5CTL A;  5AIT A;  5K3Q A;  4O77 A;  4QYL A;  2ZET C;  4AP4 A;  4UIY A;  4YYM A;  5C4Q A;  5CQA A;  5DY7 A;  5E73 A;  1X0J A;  2KYU A;  2K4D A;  5ENJ A;  5C13 A;  2LQ6 A;  2XP0 A;  5SVI A;  4WHW A;  2E6R A;  3ONI A;  1IYM A;  4QSV A;  4TU4 A;  3D7C A;  2ECG A;  1WEU A;  3HMH A;  2G45 A;  1WEP A;  4O70 A;  5EWC A;  1G25 A;  5FE6 A;  5HQ6 A;  2YUR A;  3GV4 A;  5CFW A;  5CZG A;  5EIS A;  5F63 A;  2DVV A;  4YAX A;  5FFY A;  4BW3 A;  1K2F A;  5FG4 A;  4AKI A;  4YY4 A;  3UV2 A;  5FB0 A;  4CUS A;  4J3I A;  5J0D A;  2KU3 A;  5A5S A;  5B8D A;  4MR5 A;  3P1F A;  5EPS A;  5ENG A;  4Q6F A;  3JVL A;  1WEM A;  2G43 A;  4KCX A;  3N9L A;  4YBM A;  5BT5 A;  5EWW A;  5IGK A;  5A82 A;  1V87 A;  4YYK A;  4I7D A;  4BHW A;  1LDJ B;  3VKH A;  4NR9 A;  4I7B A;  4NQM A;  3M63 A;  2NXB A;  5B78 A;  4OGJ A;  2KTB B;  5CUA A;  5CQ8 A;  5ETB A;  4HXN A;  5II2 A;  2CON A;  4ALG A;  1EQF A;  4UP0 A;  4N3W A;  4UP5 A;  5FE2 A;  4QB3 A;  4R2Y A;  1JM7 A;  5A83 A;  4NYW A;  2L43 A;  2KGG A;  2CT2 A;  2YEM A;  2UZG A;  5II1 A;  4OGC A;  3O70 A;  3N9N A;  4CUQ A;  2KE1 A;  5EVA A;  1JM7 B;  4GB0 A;  5LVR A;  5ENI A;  5HRX A;  2CKL A;  2CSV A;  4NQN A;  2VPB A;  3JUE A;  2E7O A;  1X4I A;  2CRW A;  2YSM A;  3ZYU A;  4P5O B;  4AVX A;  4PCE A;  5COI A;  2E7N A;  5TBN A;  3ZNI A;  4UYH A;  3UVW A;  2CKL B;  3SOU A;  4BW2 A;  2DSM A;  4YYD A;  4PY6 A;  3ZPV E;  2MA5 A;  4QSQ A;  5B77 A;  4Z1S A;  5HEM A;  5H1T A;  5HEN A;  2E3K A;  3G0L A;  3DWY A;  4NS5 A;  5ENH A;  5F2P A;  4UIZ A;  5FE7 A;  2ECV A;  3O34 A;  4YBT A;  4W4U A;  4XYA A;  5EI4 A;  2L75 A;  4R7E A;  5EQ1 A;  5LJ1 A;  4UIW A;  5DYA A;  5K29 A;  3UV4 A;  5AIU A;  5CUB A;  4QR4 A;  4QSW A;  4GNE A;  4A9F A;  4AI6 A;  4QYD A;  5E9K A;  5A5R A;  2VPE A;  3ERR A;  5CY9 A;  3KNV A;  2ECJ A;  5IBN A;  2LXP C;  2YU4 A;  3RPG C;  1X4U A;  4QC1 A;  5TB6 A;  3N9M A;  4LYI A;  3O37 A;  2K16 A;  3L1Z B;  4Z0R A;  4F52 B;  3DWD A;  5CRM A;  2WP2 A;  1WES A;  2Y43 A;  4MEQ A;  4YAB A;  1ZKR A;  4J1P A;  4A9L A;  5F3A A;  2LGL A;  4QSR A;  5TRB A;  5DYU A;  4A4B A;  1Z6U A;  5FE4 A;  1WEW A;  1Z60 A;  4A9E A;  3AAD A;  3O33 A;  4LZ2 A;  5BT4 A;  4QSX A;  1ZS5 A;  4WZ0 A;  4J0S A;  5D3N A;  4YH3 A;  5I88 A;  1WIM A;  2VJE A;  4NN2 A;  2L5E A;  3DAI A;  4TU6 A;  4LZS A;  4QBM A;  4WHU A;  2KRE A;  5I89 A;  5DLZ A;  2KFT A;  2KWN A;  4LYW A;  4YC9 A;  4MSX A;  4GNG A;  3FJU B;  4TZ8 A;  5I7X A;  2VJE B;  3T6R A;  5D25 A;  5FG6 A;  4MR3 A;  4O72 A;  5E74 A;  2IDA A;  3N9O A;  4WZ2 A;  5E9V A;  3P1C A;  2L80 A;  5FE9 A;  5C8G A;  3FM8 C;  2L5U A;  5DFC A;  3SOW A;  2VPD A;  3LXJ A;  5CP5 A;  3Q1D A;  5ENE A;  5D1K B;  4NUE A;  2YQD A;  3LQI A;  4BJX A;  2K17 A;  5ETD A;  2KKX A;  2LGK A;  2FUI A;  3T7L A;  3ZVZ B;  2RSD A;  1U6G B;  5KH9 A;  4AUQ B;  2YEL A;  4CFL A;  3G0J A;  5LKZ A;  4LLB A;  5G05 B;  5C89 A;  2F42 A;  3HCT A;  5J3X A;  3U5P A;  3KV6 A;  4MVT A;  3SHB A;  2F6N A;  4YYI A;  5A5Q A;  2R0S A;  5IGM A;  4AKH A;  5G0F A;  3RPG B;  4O78 A;  4YYN A;  5E7D A;  3JVK A;  4Y03 A;  4GND A;  4C9Z A;  4FK5 A;  2OWA A;  3S91 A;  4XI1 A;  5CPE A;  4O71 A;  4QNS A;  4TZ2 A;  5L98 A;  5IGL A;  2IQJ A;  5D3T A;  5HQ5 A;  1MM3 A;  4GNF A;  5EP7 A;  5CQ5 A;  5FH6 A;  1N72 A;  2VJF A;  4CUR A;  4UYD A;  4PCI A;  4TT4 A;  4YYJ A;  2MJV B;  3HME A;  4ZQL A;  1F62 A;  2VJF B;  5LKX A;  2MNZ A;  5E9I A;  3EB6 A;  4V3L C;  2YVR A;  2L7P A;  2D82 A;  4QQ4 A;  2N9G A;  3MDB C;  3QZV A;  4B86 C;  4BW4 A;  5FE5 A;  5KO4 A;  1T1H A;  5IG6 A;  5DIN A;  5EWV A;  5HM0 A;  1HYJ A;  4O7E A;  1MBM A;  5HRW A;  4TT2 A;  5FH7 A;  3LDY A;  5AD2 A;  2LSP B;  5EGU A;  5LJ2 A;  5C7N A;  4ZUX U;  3MUL A;  4UIT A;  1F68 A;  4B7Y C;  5AMF A;  3UVD A;  5D3H A;  2JRJ A;  5G4S A;  5KTX A;  5FFV A;  4ZW1 A;  5CUD A;  1ZBD B;  4TT6 A;  1WUM A;  4A9I A;  3IU6 A;  5DX4 A;  3DQV R;  3FKM X;  2YDW A;  2KKY A;  4LAD B;  3GG3 A;  4N4I A;  5H9M A;  1JSP B;  2D8U A;  4KV1 A;  2EOD A;  2AN6 A;  5G4R A;  5I1Q A;  3U5J A;  3HCS A;  4Z93 A;  4F1P A;  1LDK C;  5C85 A;  1Z2Q A;  4LZR A;  2JUN A;  4HBV A;  3MB4 A;  4QEU A;  2FFW A;  5A7C A;  2KWO A;  2YYR A;  5LUU A;  1DVP A;  4XUB A;  2QJ0 A;  2YHN A;  5G04 B;  5FE0 A;  1HYI A;  4O7F A;  2OO1 A;  5CUG A;  4NYV A;  4A9K A;  5F1L A;  1FP0 A;  3D1B A;  5A81 A;  1WGM A;  2DKW A;  1WUG A;  3LRQ A;  3D1D A;  5FEY A;  3O7A A;  4L58 A;  5E0R A;  4NXJ A;  4OGE A;  5EWH A;  5LVQ A;  5ENF A;  2MA6 A;  3T9K A;  5D7X A;  5A5N A;  4CL9 A;  2LXH C;  4N4F A;  4UIV A;  4IR4 A;  1VD4 A;  3E2D A;  1WFK A;  4MEN A;  3C6W A;  4QSS A;  4QUT A;  4YH4 A;  2XEU A;  3FEH A;  4IOR A;  5TAB A;  5I29 A;  3ZYQ A;  4PPE A;  5EK9 A;  3ASL A;  3PHD A;  2MIQ A;  4A4C A;  2ECI A;  5LKT A;  5EV9 A;  5B75 A;  4NR4 A;  2LN0 A;  2NAA A;  2PNX A;  4LRG A;  2H0D A;  4ZDT A;  3JVJ A;  3MXF A;  4FO9 A;  3RTR B;  4O76 A;  5FBX A;  3SOX A;  4CUT A;  3MQM A;  4O64 A;  5FH8 A;  2Y1N A;  4HXM A;  2D9E A;  5C87 A;  4V3K C;  2H0D B;  3O35 A;  4ALH A;  4F3I A;  3ZPV 1;  5CUE A;  5LKU A;  4O75 A;  5FB1 A;  2DAT A;  2DWW A;  4LR6 A;  4QY4 A;  2L0B A;  5TDW A;  3Q2E A;  2ECT A;  2EXU A;  2G6Q A;  3O36 A;  3M7K A;  5FFW A;  2OSS A;  4MEO A;  2CSZ A;  2MD8 C;  5HCL A;  2M13 A;  5CU8 A;  4Q0N A;  4HXK A;  5FE8 A;  3SVG A;  1WE9 A;  5DYC A;  2VPG A;  5D3L A;  1WEN A;  2KIZ A;  4IR3 A;  2VNF A;  4A0C D;  1CHC A;  2XOZ A;  5D1L B;  4YY6 A;  5CQ7 A;  4TQN A;  4XY8 A;  2R10 A;  5IGN A;  5CS8 A;  5HRV A;  2L85 A;  5DKC A;  3LQJ A;  3LQH A;  5E9L A;  2P57 A;  2JMJ A;  2DX8 A;  3KQI A;  1WIL A;  2RNW A;  5B79 A;  5ACY A;  1RMD A;  4TTE A;  3VK6 A;  5IID A;  5B76 A;  5BT3 A;  5DFB A;  4MEP A;  4LDF A;  5ENB A;  4LKA A;  3QZS A;  4QR3 A;  2RNY A;  2M6M A;  3H7H A;  2DVR A;  4QEW A;  5A85 A;  4C67 A;  5A5O A;  3KV5 A;  4UI9 B;  2I50 A;  3NXB A;  2KWK A;  2Y1M A;  1MM2 A;  4UYE A;  4QST A;  2RO1 A;  4X3G A;  5F36 A;  2D8S A;  5DKA A;  5L96 A;  3HMF A;  4OGI A;  2ECN A;  3FAN A;  5DYX A;  2JM3 A;  3U5K A;  5CQ3 A;  2XOC A;  3LVQ E;  5C11 A;  5HFR A;  5CQ6 A;  4NR7 A;  4QUU A;  5HQ7 A;  2MUM A;  2YUC A;  2H60 A;  2KGI A;  5DKD A;  3ZVY A;  4NR8 A;  4FLP A;  4UYG A;  2FSA A;  5ENC A;  5HEL A;  5I80 A;  3N9P A;  5KTW A;  4C66 A;  5F62 A;  5KH3 A;  4O7B A;  2HYE D;  2FUU A;  5L99 A;  5LCW B;  4KV4 A;  4NRB A;  4A9N A;  3I3J A;  4HXS A;  5A5P A;  2JMD A;  5KU3 A;  5CUC A;  4WZ3 B;  5DKH A;  5TCM A;  1E4U A;  4CUP A;  4X2I A;  3UW9 A;  2MT5 A;  5E3G A;  4L7X A;  4NRA A;  2C2V S;  4IR5 A;  2MKE A;  2E6S A;  1JOC A;  1JM4 B;  2VP7 A;  4LK9 A;  5EU1 A;  1PUO A;  3U5L A;  5F5Z A;  3DDT A;  3PUR A;  5H85 A;  2YT5 A;  5EM3 A;  5LJ0 A;  2OUO A;  5CQ4 A;  5L97 A;  4A9O A;  2R0V A;  2WP1 A;  3K2J A;  5HFQ A;  5SVI B;  1X4J A;  4AYC A;  4RVR A;  1VFY A;  4A9J A;  5CQT A;  5D0C A;  4TKP B;  3Q2F A;  4NUD A;  4YAD A;  4LJN A;  4LC2 A;  5JG6 A;  5DW2 A;  3ZTG A;  3JVM A;  4J0R A;  5KTU A;  4Z6H A;  3I2D A;  4S3O C;  4AYC B;  2OXQ C;  3DPL R;  5SVY A;  4HBX A;  4I7C A;  4WIV A;  3MHH A;  4UIX A;  3UVX A;  3U5N A;  3UV5 A;  4CUU A;  1N87 A;  1WEQ A;  2YW8 A;  2YW5 A;  4MR6 A;  4UYF A;  2M85 A;  4ZC9 A;  2E61 A;  5AME A;  4XY9 A;  2YQM A;  5I40 A;  2I8N A;  4UYF B;  5E9M A;  2LDR A;  3L11 A;  3TLP A;  3SVH A;  2EA6 A;  4A49 A;  2RFJ A;  5F61 A;  3SVF A;  5H1V A;  4HBW A;  5DFD A;  3LVR E;  2KR4 A;  4XUA A;  5EYA F;  3O47 A;  4MR4 A;  5KHM A;  3EB5 A;  2RR4 A;  5HJC A;  4AKN A;  2KWJ A;  2EGP A;  4QF3 A;  2DJA A;  1DCQ A;  3HTK C;  2XB1 A;  4IR6 A;  4GPJ A;  4A9H A;  2YHO A;  4IC2 A;  3M62 A;  4H9D A;  2I7K A;  4A9M A;  4CCG X;  2MNY A;  1FBV A;  4QEV A;  5D26 A;  5D3R A;  1XWH A;  5D24 A;  2RS9 B;  5TDR A;  3P5O A;  5E3D A;  3LJW A;  3V43 A;  3QZT A;  4YYH A;  3U5M A;  3MB3 A;  5EA1 A;  2M1R A;  1WEE A;  2EGM A;  5JWM A;  4PS5 A;  4TYL A;  3AQA A;  1WEO A;  4FJC A;  5E9Y A;  4Z0O A;  5EIC A;  4IOO A;  5FG5 A;  2RI7 A;  2LV9 A;  3P1E A;  4CA1 A;  2YSJ A;  4IC3 A;  4YAT A;  3PLW A;  5H1U A;  1E6I A;  4HXR A;  4LYS A;  5I83 A;  4S3O B;  1WEV A;  4QZS A;  1BOR A;  3N9Q A;  2FD4 A;  3UVY A;  4O62 A;  4Z6I A;  3IU5 A;  2QIZ A;  2JMI A;  3LJU X;  5L8U A;  4AKG A;  5DLX A;  4OUF A;  3NG2 A;  2DVQ A;  4BBQ A;  2L84 A;  4Z1Q A;  2B0O E;  5CGP A;  5AD3 A;  2K1J A;  3C5K A;  4FIP A;  2DVS A;  3GL6 A;  4IOQ A;  4NUC A;  2YYN A;  5CRZ A;  5F1H A;  5I7Y A;  3U5O A;  2LGV A;  3S92 A;  2XOY A;  4QR5 A;  5EPB A;  2CRR A;  4DON A;  4O74 A;  3VKG A;  5JI8 A;  3HCU A;  5KH7 A;  5FDZ A;  2CSY A;  5SVX A;  4NRC A;  2M3H A; 
#chains in the Genus database with same CATH homology
 3MUK A;  3FL2 A;  4R8P K;  4YBS A;  4TS8 A;  5FE3 A;  1VYX A;  2LGG A;  4NR5 A;  4O7A A;  3RCW A;  5F60 A;  4QSU A;  4NYX A;  5D3S A;  5FER A;  2G4A A;  4PTB A;  5D1M B;  4CFK A;  2LRI C;  5F25 A;  4CLB A;  2ECW A;  2YQL A;  4N4G A;  5I86 A;  5D3P A;  2MD7 B;  4HBY A;  4HXL A;  5D3J A;  3L1X A;  5FE1 A;  4QC3 A;  4WA6 A;  4E96 A;  3M99 A;  5EWD A;  2GRC A;  4NR6 A;  5DBM A;  3P1D A;  4HXP A;  4HXO A;  4YK0 A;  5DW1 A;  2YRE A;  2HDP A;  4QF2 A;  4BW1 A;  2R0Y A;  2YEK A;  2QIC A;  2RNX A;  4O7C A;  2F6J A;  4Q0O A;  4UIU A;  2BAY A;  3PUQ A;  5EPR A;  5I3L A;  5HLS A;  4YYG A;  3IHP A;  4QSP A;  2PUY A;  3MHS A;  2C2L A;  4N4H A;  5L8T A;  4PKL A;  5CTL A;  5AIT A;  4O77 A;  4QYL A;  2ZET C;  4AP4 A;  4UIY A;  4YYM A;  5C4Q A;  5CQA A;  5DY7 A;  5E73 A;  1X0J A;  2KYU A;  2K4D A;  5ENJ A;  5C13 A;  2LQ6 A;  4WHW A;  2E6R A;  3ONI A;  1IYM A;  4QSV A;  4TU4 A;  3D7C A;  2ECG A;  1WEU A;  3HMH A;  2G45 A;  1WEP A;  4O70 A;  5EWC A;  1G25 A;  5FE6 A;  5HQ6 A;  2YUR A;  3GV4 A;  5CFW A;  5CZG A;  5EIS A;  5F63 A;  2DVV A;  4YAX A;  5FFY A;  4BW3 A;  1K2F A;  5FG4 A;  4YY4 A;  3UV2 A;  5FB0 A;  4CUS A;  4J3I A;  5J0D A;  2KU3 A;  5A5S A;  5B8D A;  4MR5 A;  3P1F A;  5EPS A;  5ENG A;  4Q6F A;  3JVL A;  1WEM A;  2G43 A;  4KCX A;  3N9L A;  4YBM A;  5BT5 A;  5EWW A;  5IGK A;  5A82 A;  1V87 A;  4YYK A;  4I7D A;  4BHW A;  1LDJ B;  4NR9 A;  4I7B A;  4NQM A;  3M63 A;  2NXB A;  5B78 A;  4OGJ A;  2KTB B;  5CUA A;  5CQ8 A;  5ETB A;  4HXN A;  5II2 A;  4ALG A;  1EQF A;  4UP0 A;  4N3W A;  4UP5 A;  5FE2 A;  4QB3 A;  4R2Y A;  1JM7 A;  5A83 A;  4NYW A;  2L43 A;  2KGG A;  2CT2 A;  2YEM A;  2UZG A;  5II1 A;  3O70 A;  3N9N A;  4CUQ A;  2KE1 A;  5EVA A;  1JM7 B;  4GB0 A;  5LVR A;  5ENI A;  5HRX A;  2CKL A;  2VPB A;  4NQN A;  2E7O A;  1X4I A;  2YSM A;  4AVX A;  3ZYU A;  4P5O B;  4PCE A;  5COI A;  2E7N A;  5TBN A;  3ZNI A;  4UYH A;  3UVW A;  2CKL B;  3SOU A;  4BW2 A;  4YYD A;  4PY6 A;  3ZPV E;  2MA5 A;  4QSQ A;  5B77 A;  4Z1S A;  5HEM A;  5H1T A;  5HEN A;  2E3K A;  3G0L A;  3DWY A;  4NS5 A;  5ENH A;  5F2P A;  4UIZ A;  5FE7 A;  2ECV A;  3O34 A;  4YBT A;  4W4U A;  4XYA A;  5EI4 A;  2L75 A;  4R7E A;  5EQ1 A;  5LJ1 A;  4UIW A;  5DYA A;  5K29 A;  3UV4 A;  5AIU A;  5CUB A;  4QR4 A;  4QSW A;  4GNE A;  4A9F A;  4QYD A;  5E9K A;  5A5R A;  2VPE A;  5CY9 A;  3KNV A;  2ECJ A;  5IBN A;  2LXP C;  2YU4 A;  3RPG C;  1X4U A;  4QC1 A;  5TB6 A;  3N9M A;  4LYI A;  3O37 A;  2K16 A;  3L1Z B;  4F52 B;  5CRM A;  2WP2 A;  1WES A;  2Y43 A;  4MEQ A;  4YAB A;  4A9L A;  4J1P A;  5F3A A;  2LGL A;  4QSR A;  5TRB A;  5DYU A;  4A4B A;  1Z6U A;  5FE4 A;  1WEW A;  1Z60 A;  4A9E A;  3AAD A;  3O33 A;  4LZ2 A;  5BT4 A;  4QSX A;  1ZS5 A;  4WZ0 A;  4J0S A;  5D3N A;  4YH3 A;  5I88 A;  1WIM A;  2VJE A;  4NN2 A;  2L5E A;  3DAI A;  4TU6 A;  4LZS A;  4QBM A;  4WHU A;  2KRE A;  5I89 A;  5DLZ A;  2KFT A;  2KWN A;  4LYW A;  4YC9 A;  4MSX A;  4GNG A;  4TZ8 A;  5I7X A;  2VJE B;  3T6R A;  5D25 A;  5FG6 A;  4MR3 A;  4O72 A;  5E74 A;  2IDA A;  3N9O A;  4WZ2 A;  5E9V A;  3P1C A;  2L80 A;  5FE9 A;  5C8G A;  3SOW A;  2L5U A;  5DFC A;  2VPD A;  3LXJ A;  5CP5 A;  5ENE A;  5D1K B;  4NUE A;  2YQD A;  3LQI A;  4BJX A;  2K17 A;  5ETD A;  2LGK A;  3ZVZ B;  2FUI A;  3T7L A;  2RSD A;  1U6G B;  5KH9 A;  4AUQ B;  2YEL A;  4CFL A;  3G0J A;  5LKZ A;  4LLB A;  5G05 B;  5C89 A;  2F42 A;  3HCT A;  5J3X A;  3U5P A;  3KV6 A;  4MVT A;  3SHB A;  2F6N A;  4YYI A;  5A5Q A;  2R0S A;  5IGM A;  5G0F A;  3RPG B;  4O78 A;  4YYN A;  5E7D A;  3JVK A;  4Y03 A;  4GND A;  4C9Z A;  4FK5 A;  3S91 A;  4XI1 A;  5CPE A;  4O71 A;  4QNS A;  4TZ2 A;  5L98 A;  5IGL A;  5D3T A;  5HQ5 A;  1MM3 A;  4GNF A;  5EP7 A;  5CQ5 A;  5FH6 A;  1N72 A;  2VJF A;  4CUR A;  4UYD A;  4PCI A;  4TT4 A;  4YYJ A;  2MJV B;  3HME A;  4ZQL A;  1F62 A;  2VJF B;  5LKX A;  2MNZ A;  5E9I A;  3EB6 A;  4V3L C;  2D82 A;  2N9G A;  3QZV A;  4B86 C;  4BW4 A;  5FE5 A;  5KO4 A;  1T1H A;  5IG6 A;  5DIN A;  5EWV A;  5HM0 A;  1HYJ A;  4O7E A;  5HRW A;  4TT2 A;  5FH7 A;  5AD2 A;  2LSP B;  5EGU A;  5LJ2 A;  5C7N A;  4ZUX U;  3MUL A;  4UIT A;  1F68 A;  4B7Y C;  5AMF A;  3UVD A;  5D3H A;  2JRJ A;  5G4S A;  5KTX A;  5FFV A;  4ZW1 A;  5CUD A;  1ZBD B;  4TT6 A;  1WUM A;  4A9I A;  3IU6 A;  5DX4 A;  3DQV R;  3FKM X;  2YDW A;  4LAD B;  3GG3 A;  4N4I A;  5H9M A;  1JSP B;  4KV1 A;  2EOD A;  2AN6 A;  5G4R A;  5I1Q A;  3U5J A;  3HCS A;  4Z93 A;  1LDK C;  5C85 A;  1Z2Q A;  4LZR A;  4HBV A;  3MB4 A;  4QEU A;  5A7C A;  2KWO A;  2YYR A;  5LUU A;  1DVP A;  4XUB A;  2QJ0 A;  2YHN A;  5G04 B;  5FE0 A;  1HYI A;  4O7F A;  2OO1 A;  5CUG A;  4NYV A;  4A9K A;  5F1L A;  1FP0 A;  5A81 A;  1WGM A;  2DKW A;  1WUG A;  3LRQ A;  5FEY A;  3O7A A;  4L58 A;  5E0R A;  4NXJ A;  5EWH A;  5LVQ A;  5ENF A;  2MA6 A;  5D7X A;  5A5N A;  4CL9 A;  2LXH C;  4N4F A;  4UIV A;  4IR4 A;  1VD4 A;  1WFK A;  4MEN A;  3C6W A;  4QSS A;  4QUT A;  4YH4 A;  2XEU A;  4IOR A;  5TAB A;  5I29 A;  3ZYQ A;  4PPE A;  5EK9 A;  3ASL A;  3PHD A;  2MIQ A;  4A4C A;  2ECI A;  5LKT A;  5EV9 A;  5B75 A;  4NR4 A;  2LN0 A;  2NAA A;  2PNX A;  4LRG A;  2H0D A;  4ZDT A;  3JVJ A;  3MXF A;  4FO9 A;  3RTR B;  4O76 A;  5FBX A;  3SOX A;  4CUT A;  3MQM A;  4O64 A;  5FH8 A;  2Y1N A;  4HXM A;  2D9E A;  5C87 A;  4V3K C;  2H0D B;  3O35 A;  4ALH A;  4F3I A;  3ZPV 1;  5CUE A;  5LKU A;  4O75 A;  5FB1 A;  2DAT A;  2DWW A;  4LR6 A;  4QY4 A;  2L0B A;  5TDW A;  3Q2E A;  2ECT A;  2G6Q A;  3O36 A;  5FFW A;  2OSS A;  4MEO A;  2CSZ A;  2MD8 C;  5HCL A;  5CU8 A;  4Q0N A;  4HXK A;  5FE8 A;  3SVG A;  1WE9 A;  5DYC A;  2VPG A;  5D3L A;  1WEN A;  2KIZ A;  4IR3 A;  2VNF A;  4A0C D;  1CHC A;  5D1L B;  4YY6 A;  5CQ7 A;  4TQN A;  4XY8 A;  2R10 A;  5IGN A;  5CS8 A;  5HRV A;  2L85 A;  5DKC A;  3LQJ A;  3LQH A;  5E9L A;  2JMJ A;  2DX8 A;  3KQI A;  1WIL A;  2RNW A;  5B79 A;  5ACY A;  1RMD A;  4TTE A;  3VK6 A;  5IID A;  5B76 A;  5BT3 A;  5DFB A;  4MEP A;  4LDF A;  5ENB A;  4LKA A;  3QZS A;  4QR3 A;  2RNY A;  2M6M A;  2DVR A;  4QEW A;  5A85 A;  4C67 A;  5A5O A;  3KV5 A;  4UI9 B;  2I50 A;  3NXB A;  2KWK A;  2Y1M A;  1MM2 A;  4UYE A;  4QST A;  2RO1 A;  4X3G A;  5F36 A;  2D8S A;  5DKA A;  5L96 A;  3HMF A;  4OGI A;  2ECN A;  5DYX A;  5C11 A;  3U5K A;  5CQ3 A;  5HFR A;  5CQ6 A;  4NR7 A;  4QUU A;  5HQ7 A;  2MUM A;  2YUC A;  2H60 A;  2KGI A;  5DKD A;  3ZVY A;  4NR8 A;  4FLP A;  4UYG A;  2FSA A;  5ENC A;  5HEL A;  5I80 A;  3N9P A;  5KTW A;  4C66 A;  5F62 A;  5KH3 A;  4O7B A;  2HYE D;  2FUU A;  5L99 A;  5LCW B;  4KV4 A;  4NRB A;  4A9N A;  3I3J A;  4HXS A;  5A5P A;  2JMD A;  5KU3 A;  5CUC A;  4WZ3 B;  5DKH A;  5TCM A;  1E4U A;  4CUP A;  4X2I A;  3UW9 A;  2MT5 A;  5E3G A;  4L7X A;  4NRA A;  2C2V S;  4IR5 A;  2E6S A;  1JOC A;  1JM4 B;  2VP7 A;  4LK9 A;  5EU1 A;  3U5L A;  5F5Z A;  3PUR A;  5H85 A;  2YT5 A;  5EM3 A;  5LJ0 A;  2OUO A;  5CQ4 A;  5L97 A;  4A9O A;  2R0V A;  2WP1 A;  3K2J A;  5HFQ A;  1X4J A;  4AYC A;  4RVR A;  1VFY A;  4A9J A;  5CQT A;  5D0C A;  4TKP B;  3Q2F A;  4NUD A;  4YAD A;  4LJN A;  4LC2 A;  5JG6 A;  5DW2 A;  3ZTG A;  3JVM A;  4J0R A;  5KTU A;  4Z6H A;  3I2D A;  4S3O C;  4AYC B;  2OXQ C;  3DPL R;  4HBX A;  4I7C A;  4WIV A;  3MHH A;  4UIX A;  3UVX A;  3U5N A;  3UV5 A;  4CUU A;  1N87 A;  1WEQ A;  2YW8 A;  2YW5 A;  4MR6 A;  4UYF A;  2M85 A;  4ZC9 A;  5AME A;  4XY9 A;  2YQM A;  5I40 A;  2I8N A;  4UYF B;  5E9M A;  2LDR A;  3L11 A;  3TLP A;  3SVH A;  2EA6 A;  4A49 A;  2RFJ A;  5F61 A;  3SVF A;  5H1V A;  4HBW A;  5DFD A;  2KR4 A;  4XUA A;  5EYA F;  4MR4 A;  5KHM A;  3EB5 A;  5HJC A;  4AKN A;  2KWJ A;  2EGP A;  4QF3 A;  3HTK C;  2XB1 A;  4IR6 A;  4GPJ A;  4A9H A;  2YHO A;  4IC2 A;  3M62 A;  2I7K A;  4A9M A;  4CCG X;  2MNY A;  1FBV A;  4QEV A;  5D26 A;  5D3R A;  1XWH A;  5D24 A;  2RS9 B;  5TDR A;  3P5O A;  5E3D A;  3LJW A;  3V43 A;  3QZT A;  4YYH A;  3U5M A;  3MB3 A;  5EA1 A;  2M1R A;  1WEE A;  5JWM A;  4PS5 A;  4TYL A;  3AQA A;  1WEO A;  4FJC A;  5E9Y A;  5EIC A;  4IOO A;  5FG5 A;  2RI7 A;  2LV9 A;  3P1E A;  4CA1 A;  2YSJ A;  4IC3 A;  4YAT A;  5H1U A;  1E6I A;  4HXR A;  4LYS A;  5I83 A;  4S3O B;  1WEV A;  4QZS A;  1BOR A;  3N9Q A;  3UVY A;  4Z6I A;  3IU5 A;  2QIZ A;  2JMI A;  5L8U A;  5DLX A;  4OUF A;  3NG2 A;  2DVQ A;  4BBQ A;  2L84 A;  4Z1Q A;  3C5K A;  5CGP A;  5AD3 A;  2K1J A;  4FIP A;  2DVS A;  3GL6 A;  4IOQ A;  4NUC A;  2YYN A;  5CRZ A;  5F1H A;  5I7Y A;  3U5O A;  2LGV A;  3S92 A;  4QR5 A;  5EPB A;  4DON A;  4O74 A;  5JI8 A;  3HCU A;  5KH7 A;  5FDZ A;  2CSY A;  4NRC A;  2M3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...