3O34A

Crystal structure of trim24 phd-bromo complexed with h3(13-32)k23ac peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
177
Chain Sequence
b'EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 50
structure length 177
sequence length 181
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o34A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o34A01
4AKNA 5BT3A 2I8NA 5LKTA 2YQMA 2NAAA 5HRXA 4IORA 4O72A 4IR5A 5DFBA 3HMFA 4TU6A 2EGPA 4AYCA 2KR4A 5E9KA 4LKAA 2N9GA 5C8GA 5HEMA 5EGUA 4BW1A 5IGLA 4J1PA 4NYWA 5HFRA 4QUUA 2E7OA 3IU5A 3UVDA 2RNXA 2CKLB 5EICA 5EA1A 4QZSA 1RMDA 5EK9A 5E0RA 3N9NA 5B75A 2OXQC 4PTBA 4FO9A 2G4AA 4LJNA 4LZSA 5I89A 2VPEA 3HMEA 2FSAA 4YK0A 4BW3A 4CURA 3O33A 3GV4A 1VYXA 1JSPB 5EWWA 5FH8A 5LUUA 5DFCA 3RCWA 2L5UA 5E9MA 2MIQA 2YSMA 5FH6A 4X2IA 2VPBA 5CQAA 5I7YA 5LJ1A 5D0CA 3JVKA 2ECTA 5I40A 5F60A 4WIVA 5DYUA 5DKDA 4CFKA 5ENJA 3U5JA 5CUEA 4TYLA 1T1HA 4YYHA 2PNXA 4E96A 4N4HA 1ZS5A 4LLBA 4C66A 5A5OA 2L5EA 2NXBA 5F2PA 3KNVA 5B76A 4N4GA 5FEYA 4TS8A 4A4CA 5JWMA 4NUCA 4QR4A 5E9LA 4YBTA 2LGVA 3FL2A 1E4UA 5II2A 2DWWA 2R0YA 3U5MA 4LDFA 4KCXA 5EWVA 4XUBA 2MJVB 3Q2FA 3Q2EA 5FG4A 4NR6A 3MHSA 2L85A 3UV2A 2L80A 1WEWA 3O36A 2RO1A 3C5KA 2KWJA 3ZTGA 5E3DA 1X4JA 2KFTA 5II1A 5FE0A 2L84A 5EI4A 4O7EA 4S3OC 2CT2A 3G0JA 5FB0A 3C6WA 5D25A 1V87A 3UV4A 3PUQA 3ZPV1 2ECWA 2PUYA 5C4QA 4NRAA 4BW2A 1E6IA 4HXLA 5FE6A 5G4SA 3UVYA 5CQ8A 3U5PA 4O64A 3QZSA 4MSXA 4Z1QA 2KTBB 2XEUA 3IHPA 5TDRA 2YYRA 2OSSA 2CSYA 5DKHA 4A9HA 4YBMA 5IGKA 3RPGB 5HFQA 1JM4B 4XUAA 4A9EA 2ECNA 2G43A 5A82A 4CUUA 5CUCA 5EYAF 3U5LA 5EV9A 4QSQA 4LYSA 5F61A 2C2LA 5D3TA 2H0DB 4UIUA 5F63A 3G0LA 2RSDA 5FB1A 2MD8C 5COIA 5FE3A 1WEVA 4J0SA 3ZNIA 5TBNA 2F42A 4L58A 5A5QA 4AP4A 4YH3A 5B79A 1IYMA 5DW1A 3HCUA 5DFDA 5E73A 4R7EA 4LR6A 4Z1SA 2YURA 4FIPA 5E9VA 5HLSA 4AVXA 4TZ2A 1WENA 4CL9A 4PCEA 4KV1A 5F36A 4O78A 4ZQLA 2L75A 1BORA 5TB6A 2Y1NA 4QC1A 4HXRA 5FH7A 1HYIA 5IGNA 5C11A 4NRBA 4XYAA 4FLPA 3EB6A 4XI1A 4YYKA 4A9NA 4A0CD 2RS9B 3SVFA 5DLXA 5CU8A 2R10A 3JVJA 5KO4A 3ZYUA 4HXNA 5E7DA 5FERA 5KHMA 3NXBA 5ENGA 2VJEA 3MUKA 2RNWA 3SOUA 4O7BA 3LQJA 3LRQA 2QIZA 4QSSA 2I50A 1ZBDB 2EA6A 4IC3A 5D1KB 4UYFB 4F3IA 3U5NA 3DAIA 4UYGA 5HQ5A 4J3IA 3QZTA 4OGIA 3QZVA 5HM0A 3UW9A 4CFLA 4LK9A 5G04B 2RFJA 4A9MA 2L0BA 4C9ZA 3N9PA 3ASLA 4B7YC 3U5OA 3N9OA 4KV4A 4QEUA 1N87A 5FFWA 2MNYA 1XWHA 4IC2A 4YABA 4WZ2A 4R8PK 4X3GA 2R0VA 4YC9A 5EP7A 4YBSA 2JMJA 2DVRA 4S3OB 4A49A 2YT5A 2XB1A 2YEMA 4NR9A 4RVRA 4QSTA 5EWHA 4BJXA 2K17A 4IOOA 2E7NA 4TQNA 5DINA 4GNFA 2DATA 4IR4A 2CKLA 2VNFA 4QF3A 3M63A 1CHCA 4QSVA 5J0DA 5KTXA 4PPEA 4LZRA 5A5SA 5H9MA 2JMIA 4XY9A 5F3AA 3O35A 5LJ2A 2H0DA 2DX8A 1WEQA 3PURA 5CZGA 5I29A 2YUCA 2MA5A 3AADA 4Y03A 5CUGA 2LGLA 4YYJA 4HXSA 4MEOA 4NUDA 1HYJA 2YHNA 5CY9A 4J0RA 2C2VS 4UIZA 4HBVA 4CUQA 3P1FA 4CCGX 4NR8A 4YADA 5EISA 1N72A 3I3JA 4L7XA 5B78A 4O7CA 5EPSA 4F52B 3K2JA 5FFVA 2LRIC 4B86C 5I80A 4DONA 5IGMA 3HTKC 4FJCA 4V3KC 5DYXA 2JRJA 5H1VA 1X4UA 4UP5A 2VJFA 4NR4A 5LKXA 2K4DA 4A9JA 1EQFA 2OUOA 2QJ0A 5IIDA 5I7XA 5H1TA 2LXHC 1JM7B 2RNYA 5AD3A 2ZETC 4ZUXU 2WP1A 1WEOA 4A9LA 5G05B 5D3HA 1G25A 5G0FA 4WZ0A 4HXPA 5I88A 5A7CA 4NR7A 4QBMA 1DVPA 4UI9B 5A5NA 5FG6A 3UVWA 4YY4A 4QUTA 4UIWA 5KH7A 4N4IA 2YW5A 4QSUA 2Y1MA 4UITA 2YYNA 4QR3A 2L43A 3SOWA 4OUFA 5TCMA 2D82A 5B77A 3N9LA 2YHOA 5BT4A 5LVRA 2DVQA 2MD7B 4A9IA 2M1RA 2YREA 3V43A 3ZPVE 4W4UA 3TLPA 1WEUA 5F1LA 2OO1A 4QC3A 2KU3A 5D3NA 1JOCA 5CQ5A 4YYIA 1WE9A 2YEKA 2F6NA 5BT5A 5L99A 4YH4A 4MR4A 5D3RA 5ACYA 5CUBA 5FBXA 5KTWA 5ENIA 5EWCA 4ALGA 4TZ8A 5DYCA 5DYAA 5G4RA 1WIMA 4V3LC 4MENA 3L11A 2VPDA 4I7BA 3L1ZB 1X0JA 4IR6A 5ETDA 4UYDA 4ALHA 1WGMA 2HDPA 5EQ1A 4MEQA 5CQ7A 4PS5A 2E3KA 2VPGA 4UIYA 2D9EA 5F1HA 5L8UA 2DVSA 1WUGA 4WHWA 5KTUA 1WILA 2KE1A 2LQ6A 4GNDA 4MEPA 5EWDA 5CRZA 4P5OB 2KYUA 5E9YA 4CUPA 4O70A 2GRCA 4NYXA 2KWNA 4HBYA 3ZYQA 1FBVA 3GL6A 5K29A 4I7DA 4UYHA 4MR5A 3DQVR 4R2YA 1U6GB 2K16A 5EVAA 2VJEB 4YATA 1K2FA 1VD4A 4LADB 1X4IA 3MB3A 2JMDA 4NYVA 5D3LA 4MVTA 5FE5A 2EODA 5LJ0A 2KWKA 4QSPA 1LDKC 5ENHA 4I7CA 4MR6A 5B8DA 4YAXA 5TRBA 4LC2A 1WEEA 4Q6FA 4TT6A 3UVXA 4CLBA 2MA6A 4NXJA 4WHUA 3LQIA 4LRGA 2YSJA 5FG5A 4TU4A 5CQTA 4AYCB 4O71A 5CRMA 2YW8A 4UYFA 2KGIA 2LDRA 3MQMA 4QSWA 2BAYA 5C13A 5HQ7A 3GG3A 2RI7A 4O7AA 4YYDA 2QICA 3O70A 5ENCA 4PY6A 3RPGC 5DLZA 2FUIA 4YYMA 4HBXA 5AMEA 5FDZA 4PKLA 5H85A 5D24A 5LKZA 5HELA 3T6RA 5FE1A 5D1MB 5FE4A 2LSPB 4FK5A 5IBNA 4WZ3B 2KIZA 2G6QA 1F62A 3N9QA 4NN2A 3AQAA 2HYED 3KV6A 5JG6A 4TTEA 3P1EA 3UV5A 2YU4A 3O37A 4NRCA 4CA1A 5D7XA 5CUDA 4HXMA 3PHDA 5CS8A 5FE8A 2M3HA 4NS5A 5EU1A 4O77A 4QSXA 4AUQB 5L97A 4NQNA 1WUMA 5FFYA 4GNEA 4UYEA 5DKAA 4GB0A 3SVHA 4QY4A 5DKCA 3ONIA 4TT2A 4O7FA 5CQ3A 5EM3A 5A83A 3IU6A 1VFYA 5TDWA 2YQLA 2CSZA 3O34A 3SOXA 5DBMA 5HRVA 5L98A 4LZ2A 3EB5A 1WESA 5EPRA 5DY7A 4WA6A 2M6MA 5L8TA 4CUSA 2R0SA 3DWYA 5AIUA 5FE2A 5KH3A 4QYDA 5JI8A 2Y43A 4TKPB 1LDJB 4QYLA 2G45A 5E74A 2VJFB 2DKWA 5HRWA 3HCSA 3HMHA 3P1DA 5DX4A 3M62A 2IDAA 4BBQA 3D7CA 3LJWA 2ECIA 4UIXA 2YDWA 3JVMA 4CUTA 3RTRB 4QEVA 5I86A 3P5OA 5A85A 3HCTA 4HBWA 2KREA 5D1LB 4A4BA 2AN6A 5CQ6A 1JM7A 2M85A 1WEMA 1WEPA 2WP2A 5F25A 4LYWA 3M99A 4UIVA 4YYGA 3JVLA 4QSRA 4N3WA 2I7KA 5A5RA 4NQMA 4ZDTA 5ENFA 5AD2A 3KQIA 1Z60A 5F62A 5CFWA 3P1CA 2E6RA 2LXPC 5D26A 4QF2A 5H1UA 4NR5A 3N9MA 5HCLA 5FE9A 4C67A 2MT5A 3FKMX 2D8SA 4O76A 4A9OA 5CQ4A 5L96A 5C87A 5HQ6A 3LQHA 2YELA 2KWOA 5F5ZA 5CTLA 3DPLR 1FP0A 3MXFA 5CP5A 2H60A 2UZGA 3L1XA 2YQDA 4YY6A 3U5KA 4QNSA 5C85A 5IG6A 3VK6A 5ENBA 5A81A 3MULA 5EPBA 4GPJA 5KH9A 3NG2A 4YYNA 5J3XA 5I83A 3S92A 5TABA 5A5PA 3ZVYA 5HENA 4HXKA 4LYIA 5D3JA 4QR5A 4BW4A 4A9KA 5C7NA 5I1QA 5KU3A 2ECVA 4ZW1A 5LCWB 4Q0NA 2MNZA 5CPEA 4Z6HA 4XY8A 2ECJA 5DW2A 4N4FA 1WFKA 5CUAA 5CGPA 4Q0OA 4QEWA 4BHWA 2K1JA 5LKUA 3KV5A 3LXJA 3S91A 5D3SA 1MM2A 1Z2QA 4UP0A 4OGJA 2E6SA 5E3GA 1MM3A 5HJCA 3MB4A 2F6JA 4HXOA 3T7LA 4IOQA 5AMFA 4QB3A 4TT4A 2DVVA 3ZVZB 5LVQA 2FUUA 4O74A 3MHHA 2ECGA 5D3PA 4A9FA 4ZC9A 5FE7A 4PCIA 4GNGA 3I2DA 4MR3A 1F68A 3SHBA 4O75A 2LGGA 4NUEA 2LN0A 5C89A 2LV9A 5AITA 5E9IA 4Z6IA 5ENEA 3O7AA 2MUMA 4IR3A 2VP7A 1Z6UA 4Z93A 5I3LA 3SVGA 2KGGA 5ETBA 2LGKA
chains in the Genus database with same CATH superfamily
4AKNA 5BT3A 2I8NA 5LKTA 2YQMA 2NAAA 5HRXA 5SVYA 4IORA 4O72A 4IR5A 5DFBA 2OWAA 3HMFA 4TU6A 2EGPA 4AYCA 2KR4A 2L7PA 5E9KA 4LKAA 2N9GA 5C8GA 5HEMA 2P57A 5EGUA 4BW1A 5IGLA 4J1PA 4NYWA 5HFRA 4QUUA 2E7OA 3IU5A 3UVDA 2RNXA 2CKLB 5EICA 5EA1A 4QZSA 1RMDA 5EK9A 5E0RA 3N9NA 5B75A 2OXQC 4PTBA 4FO9A 2G4AA 4LJNA 4LZSA 5I89A 2VPEA 3HMEA 2FSAA 4YK0A 4BW3A 4CURA 3O33A 2EGMA 3GV4A 1VYXA 1JSPB 5EWWA 5FH8A 5LUUA 5DFCA 2FD4A 3RCWA 2L5UA 5E9MA 2MIQA 2YSMA 5FH6A 4X2IA 2VPBA 5CQAA 5I7YA 5LJ1A 5D0CA 3JVKA 2ECTA 5I40A 5F60A 4WIVA 5DYUA 5DKDA 4CFKA 5ENJA 3U5JA 5CUEA 4TYLA 1T1HA 4YYHA 2PNXA 4E96A 4N4HA 1ZS5A 3E2DA 4LLBA 4C66A 5A5OA 2L5EA 2NXBA 5F2PA 3KNVA 5B76A 4N4GA 5FEYA 4TS8A 4A4CA 5JWMA 4NUCA 4QR4A 5E9LA 4YBTA 2LGVA 3FL2A 1E4UA 5II2A 2DWWA 2R0YA 3U5MA 4LDFA 4KCXA 5EWVA 4XUBA 2MJVB 3Q2FA 3Q2EA 5FG4A 4NR6A 3MHSA 2L85A 3UV2A 2L80A 1WEWA 3O36A 2RO1A 3C5KA 2KWJA 3ZTGA 5E3DA 1X4JA 2KFTA 5II1A 1MBMA 5FE0A 2L84A 5EI4A 4O7EA 4S3OC 2JUNA 2CT2A 3G0JA 5FB0A 3C6WA 5D25A 1V87A 4O62A 3UV4A 3PUQA 3ZPV1 2ECWA 2PUYA 5C4QA 4NRAA 4BW2A 1E6IA 4HXLA 5FE6A 5G4SA 3UVYA 5CQ8A 3U5PA 4O64A 3QZSA 4MSXA 4Z1QA 2KTBB 2XEUA 3IHPA 3O47A 2YYRA 5K3QA 5TDRA 2OSSA 2CSYA 5DKHA 4A9HA 4YBMA 5IGKA 3RPGB 5HFQA 1JM4B 4XUAA 4A9EA 2ECNA 2G43A 5A82A 4CUUA 5CUCA 5EYAF 3U5LA 2CRRA 5EV9A 4QSQA 4LYSA 5F61A 2C2LA 5D3TA 2H0DB 4UIUA 5F63A 3G0LA 2RSDA 5FB1A 2MD8C 5COIA 5FE3A 4Z0RA 1WEVA 4J0SA 3ZNIA 5TBNA 2F42A 4L58A 5A5QA 4AP4A 4YH3A 5B79A 1IYMA 5DW1A 3HCUA 5DFDA 5E73A 4R7EA 3SUBA 4LR6A 4Z1SA 2YURA 4FIPA 5E9VA 5HLSA 4AVXA 3DWDA 4TZ2A 1WENA 4CL9A 4PCEA 4KV1A 5F36A 4O78A 4ZQLA 2L75A 1BORA 5TB6A 2Y1NA 4QC1A 4HXRA 5FH7A 1HYIA 5IGNA 5C11A 4NRBA 3LJUX 4XYAA 4FLPA 3EB6A 4XI1A 4YYKA 4A9NA 4A0CD 2RS9B 3SVFA 5DLXA 5CU8A 2JM3A 2R10A 3JVJA 5KO4A 3ZYUA 4HXNA 2XOZA 5E7DA 3FM8C 5KHMA 3NXBA 5FERA 5ENGA 2VJEA 3MUKA 2RNWA 3SOUA 4O7BA 3LQJA 3LRQA 2QIZA 4QSSA 2I50A 1ZBDB 2EA6A 4IC3A 5D1KB 4UYFB 4F3IA 3U5NA 3DAIA 4UYGA 5HQ5A 4J3IA 3QZTA 4OGIA 3QZVA 5HM0A 3UW9A 4CFLA 4LK9A 3VKHA 5G04B 2RFJA 4A9MA 2YVRA 2L0BA 4C9ZA 3N9PA 3ASLA 4B7YC 3U5OA 3N9OA 4KV4A 4QEUA 1N87A 5FFWA 2MNYA 1XWHA 4IC2A 4YABA 4WZ2A 4R8PK 4X3GA 2R0VA 4YC9A 5EP7A 4YBSA 2JMJA 2DVRA 4S3OB 4A49A 2YT5A 2XB1A 2YEMA 3T9KA 4NR9A 4RVRA 4QSTA 5EWHA 4BJXA 2K17A 4IOOA 2E7NA 4TQNA 5DINA 4GNFA 2DATA 4IR4A 2CKLA 2VNFA 4QF3A 3M63A 1CHCA 4QSVA 5J0DA 5KTXA 4PPEA 4LZRA 5A5SA 5H9MA 2JMIA 4XY9A 5F3AA 3O35A 5LJ2A 2H0DA 2DX8A 1WEQA 3PURA 5CZGA 5I29A 2DSMA 2YUCA 2MA5A 3AADA 4Y03A 5CUGA 2LGLA 4YYJA 4HXSA 4MEOA 4NUDA 1HYJA 2YHNA 5CY9A 4J0RA 2C2VS 4UIZA 4HBVA 4CUQA 3P1FA 4CCGX 4NR8A 4YADA 5EISA 1N72A 3I3JA 4L7XA 5B78A 4O7CA 5EPSA 1ZKRA 4F52B 3K2JA 5FFVA 2LRIC 3Q1DA 4B86C 5I80A 4DONA 5IGMA 3HTKC 4FJCA 4V3KC 2KKXA 5DYXA 2JRJA 5H1VA 1X4UA 4UP5A 2VJFA 2XOYA 4NR4A 5LKXA 2K4DA 4A9JA 1EQFA 2OUOA 2QJ0A 5IIDA 5I7XA 5H1TA 2LXHC 1JM7B 2RNYA 5AD3A 2ZETC 4ZUXU 2WP1A 1WEOA 3LVRE 4A9LA 5G05B 5D3HA 1G25A 5G0FA 2CSVA 4WZ0A 4HXPA 5I88A 5A7CA 4NR7A 4QBMA 2IQJA 1DVPA 4UI9B 5A5NA 5FG6A 3UVWA 4YY4A 2CRWA 3KDEC 4QUTA 4UIWA 5KH7A 4N4IA 2YW5A 4QSUA 2Y1MA 4UITA 2YYNA 4QR3A 2L43A 3SOWA 4OUFA 5TCMA 2D82A 5B77A 3N9LA 4QQ4A 2YHOA 5BT4A 5LVRA 2DVQA 2MD7B 4A9IA 2M1RA 2YREA 3V43A 3ZPVE 4W4UA 3TLPA 2RR4A 1WEUA 5F1LA 2OO1A 3PLWA 4QC3A 2KU3A 5D3NA 1JOCA 4AKIA 5CQ5A 4YYIA 1WE9A 3D1BA 2YEKA 2F6NA 5BT5A 5L99A 2XOCA 4YH4A 4MR4A 5D3RA 5ACYA 2LAUA 5CUBA 5FBXA 5KTWA 5ENIA 5EWCA 4ALGA 4TZ8A 5DYCA 5DYAA 5G4RA 1WIMA 4V3LC 4MENA 3L11A 2VPDA 4I7BA 3L1ZB 1X0JA 4IR6A 5ETDA 4UYDA 4ALHA 1WGMA 2HDPA 5EQ1A 5SVIB 4MEQA 5CQ7A 4PS5A 2E3KA 4OGCA 2VPGA 4UIYA 2D9EA 5F1HA 5L8UA 2DVSA 1WUGA 4WHWA 3FJUB 5KTUA 1WILA 2KE1A 2LQ6A 4GNDA 4MEPA 5EWDA 5CRZA 4P5OB 2KYUA 5E9YA 4CUPA 4O70A 2GRCA 4NYXA 2EXUA 2KWNA 4HBYA 3ZYQA 1FBVA 3GL6A 5K29A 4I7DA 4UYHA 4MR5A 3DQVR 4R2YA 1U6GB 2K16A 5EVAA 2VJEB 4YATA 1K2FA 1VD4A 4LADB 1X4IA 3MB3A 2JMDA 4NYVA 5D3LA 4MVTA 5FE5A 2EODA 5LJ0A 2KWKA 4QSPA 1LDKC 5ENHA 4I7CA 4MR6A 5B8DA 4YAXA 5TRBA 4LC2A 1WEEA 2CONA 4Q6FA 4TT6A 3UVXA 4CLBA 2MA6A 4NXJA 4WHUA 3LQIA 4LRGA 2YSJA 5FG5A 4TU4A 5CQTA 4AYCB 4O71A 5CRMA 2YW8A 4UYFA 2KGIA 2LDRA 3MQMA 4QSWA 4F1PA 2BAYA 5C13A 5HQ7A 3GG3A 2RI7A 4O7AA 4YYDA 4AKHA 3H7HA 2QICA 3O70A 5ENCA 4PY6A 3RPGC 5DLZA 2FUIA 3LDYA 4YYMA 4HBXA 5AMEA 5FDZA 4PKLA 5H85A 2KKYA 5D24A 5LKZA 5HELA 3T6RA 5FE1A 5D1MB 5FE4A 2LSPB 4FK5A 5IBNA 4WZ3B 2KIZA 4AKGA 2G6QA 1F62A 3N9QA 4NN2A 3AQAA 2HYED 3KV6A 5JG6A 4TTEA 3P1EA 3UV5A 2YU4A 3O37A 4NRCA 3FAOA 4CA1A 5D7XA 5CUDA 4HXMA 3PHDA 5CS8A 5FE8A 3FEHA 2M3HA 2D8UA 4NS5A 5EU1A 4O77A 4QSXA 4AUQB 5L97A 4NQNA 1WUMA 5FFYA 4GNEA 4UYEA 5DKAA 4GB0A 3SVHA 4QY4A 5DKCA 3ONIA 4TT2A 4O7FA 5CQ3A 5EM3A 5A83A 3IU6A 1VFYA 2MKEA 4OGEA 2YQLA 5SVXA 2CSZA 3O34A 3SOXA 5DBMA 5HRVA 5L98A 4LZ2A 3EB5A 4AI6A 1WESA 5EPRA 5DY7A 4WA6A 2M6MA 5L8TA 4H9DA 4CUSA 2R0SA 3DWYA 5AIUA 3VKGA 5FE2A 5KH3A 4QYDA 5JI8A 2Y43A 4TKPB 1LDJB 4QYLA 2G45A 5E74A 2VJFB 2EJNA 2DKWA 5HRWA 3HCSA 3HMHA 3P1DA 5DX4A 3M62A 3M7KA 2IDAA 4BBQA 3D7CA 3D1DA 3LJWA 2DJAA 4UIXA 2E61A 2YDWA 2ECIA 3JVMA 3MDBC 4CUTA 3RTRB 4QEVA 5I86A 3P5OA 5A85A 3HCTA 4HBWA 2KREA 5D1LB 4A4BA 2AN6A 5CQ6A 4Z0OA 2M85A 1JM7A 1WEMA 1WEPA 2WP2A 5F25A 4LYWA 1DCQA 3M99A 4UIVA 4YYGA 3JVLA 3FANA 4QSRA 4N3WA 2I7KA 5A5RA 4NQMA 4ZDTA 5ENFA 5AD2A 2M13A 3KQIA 1Z60A 5F62A 5CFWA 5TDWA 3P1CA 2E6RA 2LXPC 5D26A 4QF2A 2XP0A 5H1UA 4NR5A 3N9MA 5HCLA 5FE9A 4C67A 2MT5A 3FKMX 2D8SA 4O76A 4A9OA 5CQ4A 5L96A 5C87A 5HQ6A 3LQHA 2YELA 2KWOA 5F5ZA 5CTLA 3DPLR 1FP0A 3MXFA 5CP5A 2H60A 2UZGA 3L1XA 2YQDA 4YY6A 3U5KA 4QNSA 5C85A 5IG6A 3VK6A 5ENBA 5A81A 3MULA 5EPBA 4GPJA 5KH9A 3NG2A 4YYNA 5J3XA 5I83A 3S92A 5TABA 5A5PA 3ZVYA 5HENA 4HXKA 4LYIA 5D3JA 4QR5A 4BW4A 4A9KA 5C7NA 5I1QA 5KU3A 2ECVA 4ZW1A 5LCWB 4Q0NA 2MNZA 5CPEA 4Z6HA 4XY8A 2ECJA 5DW2A 4N4FA 1WFKA 5CUAA 5SVIA 5CGPA 4Q0OA 4QEWA 4BHWA 2K1JA 5LKUA 3JUEA 3KV5A 3LXJA 3S91A 5D3SA 2FFWA 1MM2A 1Z2QA 4UP0A 3LVQE 4OGJA 2E6SA 5E3GA 1MM3A 5HJCA 3MB4A 2F6JA 4HXOA 3T7LA 4IOQA 5AMFA 4QB3A 4TT4A 2DVVA 3ZVZB 5LVQA 2FUUA 4O74A 3MHHA 2ECGA 5D3PA 4A9FA 4ZC9A 5FE7A 4PCIA 4GNGA 3I2DA 4MR3A 1F68A 3SHBA 4O75A 3DDTA 2LGGA 4NUEA 2LN0A 5C89A 2LV9A 5AITA 5E9IA 4Z6IA 2B0OE 5ENEA 3O7AA 2MUMA 4IR3A 2VP7A 1Z6UA 4Z93A 3ERRA 1PUOA 3SVGA 5I3LA 2KGGA 5ETBA 2LGKA
chains in the Genus database with same CATH topology
4AKNA 5BT3A 2I8NA 5LKTA 2YQMA 2NAAA 5HRXA 4IORA 4O72A 4IR5A 5DFBA 3HMFA 4TU6A 2EGPA 4AYCA 2KR4A 5E9KA 4LKAA 2N9GA 5C8GA 5HEMA 5EGUA 4BW1A 5IGLA 4J1PA 4NYWA 5HFRA 4QUUA 2E7OA 3IU5A 3UVDA 2RNXA 2CKLB 5EICA 5EA1A 4QZSA 1RMDA 5EK9A 5E0RA 3N9NA 5B75A 2OXQC 4PTBA 4FO9A 2G4AA 4LJNA 4LZSA 5I89A 2VPEA 3HMEA 2FSAA 4YK0A 4BW3A 4CURA 3O33A 3GV4A 1VYXA 1JSPB 5EWWA 5FH8A 5LUUA 5DFCA 3RCWA 2L5UA 5E9MA 2MIQA 2YSMA 5FH6A 4X2IA 2VPBA 5CQAA 5I7YA 5LJ1A 5D0CA 3JVKA 2ECTA 5I40A 5F60A 4WIVA 5DYUA 5DKDA 4CFKA 5ENJA 3U5JA 5CUEA 4TYLA 1T1HA 4YYHA 2PNXA 4E96A 4N4HA 1ZS5A 4LLBA 4C66A 5A5OA 2L5EA 2NXBA 5F2PA 3KNVA 5B76A 4N4GA 5FEYA 4TS8A 4A4CA 5JWMA 4NUCA 4QR4A 5E9LA 4YBTA 2LGVA 3FL2A 1E4UA 5II2A 2DWWA 2R0YA 3U5MA 4LDFA 4KCXA 5EWVA 4XUBA 2MJVB 3Q2FA 3Q2EA 5FG4A 4NR6A 3MHSA 2L85A 3UV2A 2L80A 1WEWA 3O36A 2RO1A 3C5KA 2KWJA 3ZTGA 5E3DA 1X4JA 2KFTA 5II1A 5FE0A 2L84A 5EI4A 4O7EA 4S3OC 2CT2A 3G0JA 5FB0A 3C6WA 5D25A 1V87A 3UV4A 3PUQA 3ZPV1 2ECWA 2PUYA 5C4QA 4NRAA 4BW2A 1E6IA 4HXLA 5FE6A 5G4SA 3UVYA 5CQ8A 3U5PA 4O64A 3QZSA 4MSXA 4Z1QA 2KTBB 2XEUA 3IHPA 5TDRA 2YYRA 2OSSA 2CSYA 5DKHA 4A9HA 4YBMA 5IGKA 3RPGB 5HFQA 1JM4B 4XUAA 4A9EA 2ECNA 2G43A 5A82A 4CUUA 5CUCA 5EYAF 3U5LA 5EV9A 4QSQA 4LYSA 5F61A 2C2LA 5D3TA 2H0DB 4UIUA 5F63A 3G0LA 2RSDA 5FB1A 2MD8C 5COIA 5FE3A 1WEVA 4J0SA 3ZNIA 5TBNA 2F42A 4L58A 5A5QA 4AP4A 4YH3A 5B79A 1IYMA 5DW1A 3HCUA 5DFDA 5E73A 4R7EA 4LR6A 4Z1SA 2YURA 4FIPA 5E9VA 5HLSA 4AVXA 4TZ2A 1WENA 4CL9A 4PCEA 4KV1A 5F36A 4O78A 4ZQLA 2L75A 1BORA 5TB6A 2Y1NA 4QC1A 4HXRA 5FH7A 1HYIA 5IGNA 5C11A 4NRBA 4XYAA 4FLPA 3EB6A 4XI1A 4YYKA 4A9NA 4A0CD 2RS9B 3SVFA 5DLXA 5CU8A 2R10A 3JVJA 5KO4A 3ZYUA 4HXNA 5E7DA 5FERA 5KHMA 3NXBA 5ENGA 2VJEA 3MUKA 2RNWA 3SOUA 4O7BA 3LQJA 3LRQA 2QIZA 4QSSA 2I50A 1ZBDB 2EA6A 4IC3A 5D1KB 4UYFB 4F3IA 3U5NA 3DAIA 4UYGA 5HQ5A 4J3IA 3QZTA 4OGIA 3QZVA 5HM0A 3UW9A 4CFLA 4LK9A 5G04B 2RFJA 4A9MA 2L0BA 4C9ZA 3N9PA 3ASLA 4B7YC 3U5OA 3N9OA 4KV4A 4QEUA 1N87A 5FFWA 2MNYA 1XWHA 4IC2A 4YABA 4WZ2A 4R8PK 4X3GA 2R0VA 4YC9A 5EP7A 4YBSA 2JMJA 2DVRA 4S3OB 4A49A 2YT5A 2XB1A 2YEMA 4NR9A 4RVRA 4QSTA 5EWHA 4BJXA 2K17A 4IOOA 2E7NA 4TQNA 5DINA 4GNFA 2DATA 4IR4A 2CKLA 2VNFA 4QF3A 3M63A 1CHCA 4QSVA 5J0DA 5KTXA 4PPEA 4LZRA 5A5SA 5H9MA 2JMIA 4XY9A 5F3AA 3O35A 5LJ2A 2H0DA 2DX8A 1WEQA 3PURA 5CZGA 5I29A 2YUCA 2MA5A 3AADA 4Y03A 5CUGA 2LGLA 4YYJA 4HXSA 4MEOA 4NUDA 1HYJA 2YHNA 5CY9A 4J0RA 2C2VS 4UIZA 4HBVA 4CUQA 3P1FA 4CCGX 4NR8A 4YADA 5EISA 1N72A 3I3JA 4L7XA 5B78A 4O7CA 5EPSA 4F52B 3K2JA 5FFVA 2LRIC 4B86C 5I80A 4DONA 5IGMA 3HTKC 4FJCA 4V3KC 5DYXA 2JRJA 5H1VA 1X4UA 4UP5A 2VJFA 4NR4A 5LKXA 2K4DA 4A9JA 1EQFA 2OUOA 2QJ0A 5IIDA 5I7XA 5H1TA 2LXHC 1JM7B 2RNYA 5AD3A 2ZETC 4ZUXU 2WP1A 1WEOA 4A9LA 5G05B 5D3HA 1G25A 5G0FA 4WZ0A 4HXPA 5I88A 5A7CA 4NR7A 4QBMA 1DVPA 4UI9B 5A5NA 5FG6A 3UVWA 4YY4A 4QUTA 4UIWA 5KH7A 4N4IA 2YW5A 4QSUA 2Y1MA 4UITA 2YYNA 4QR3A 2L43A 3SOWA 4OUFA 5TCMA 2D82A 5B77A 3N9LA 2YHOA 5BT4A 5LVRA 2DVQA 2MD7B 4A9IA 2M1RA 2YREA 3V43A 3ZPVE 4W4UA 3TLPA 1WEUA 5F1LA 2OO1A 4QC3A 2KU3A 5D3NA 1JOCA 5CQ5A 4YYIA 1WE9A 2YEKA 2F6NA 5BT5A 5L99A 4YH4A 4MR4A 5D3RA 5ACYA 5CUBA 5FBXA 5KTWA 5ENIA 5EWCA 4ALGA 4TZ8A 5DYCA 5DYAA 5G4RA 1WIMA 4V3LC 4MENA 3L11A 2VPDA 4I7BA 3L1ZB 1X0JA 4IR6A 5ETDA 4UYDA 4ALHA 1WGMA 2HDPA 5EQ1A 4MEQA 5CQ7A 4PS5A 2E3KA 2VPGA 4UIYA 2D9EA 5F1HA 5L8UA 2DVSA 1WUGA 4WHWA 5KTUA 1WILA 2KE1A 2LQ6A 4GNDA 4MEPA 5EWDA 5CRZA 4P5OB 2KYUA 5E9YA 4CUPA 4O70A 2GRCA 4NYXA 2KWNA 4HBYA 3ZYQA 1FBVA 3GL6A 5K29A 4I7DA 4UYHA 4MR5A 3DQVR 4R2YA 1U6GB 2K16A 5EVAA 2VJEB 4YATA 1K2FA 1VD4A 4LADB 1X4IA 3MB3A 2JMDA 4NYVA 5D3LA 4MVTA 5FE5A 2EODA 5LJ0A 2KWKA 4QSPA 1LDKC 5ENHA 4I7CA 4MR6A 5B8DA 4YAXA 5TRBA 4LC2A 1WEEA 4Q6FA 4TT6A 3UVXA 4CLBA 2MA6A 4NXJA 4WHUA 3LQIA 4LRGA 2YSJA 5FG5A 4TU4A 5CQTA 4AYCB 4O71A 5CRMA 2YW8A 4UYFA 2KGIA 2LDRA 3MQMA 4QSWA 2BAYA 5C13A 5HQ7A 3GG3A 2RI7A 4O7AA 4YYDA 2QICA 3O70A 5ENCA 4PY6A 3RPGC 5DLZA 2FUIA 4YYMA 4HBXA 5AMEA 5FDZA 4PKLA 5H85A 5D24A 5LKZA 5HELA 3T6RA 5FE1A 5D1MB 5FE4A 2LSPB 4FK5A 5IBNA 4WZ3B 2KIZA 2G6QA 1F62A 3N9QA 4NN2A 3AQAA 2HYED 3KV6A 5JG6A 4TTEA 3P1EA 3UV5A 2YU4A 3O37A 4NRCA 4CA1A 5D7XA 5CUDA 4HXMA 3PHDA 5CS8A 5FE8A 2M3HA 4NS5A 5EU1A 4O77A 4QSXA 4AUQB 5L97A 4NQNA 1WUMA 5FFYA 4GNEA 4UYEA 5DKAA 4GB0A 3SVHA 4QY4A 5DKCA 3ONIA 4TT2A 4O7FA 5CQ3A 5EM3A 5A83A 3IU6A 1VFYA 5TDWA 2YQLA 2CSZA 3O34A 3SOXA 5DBMA 5HRVA 5L98A 4LZ2A 3EB5A 1WESA 5EPRA 5DY7A 4WA6A 2M6MA 5L8TA 4CUSA 2R0SA 3DWYA 5AIUA 5FE2A 5KH3A 4QYDA 5JI8A 2Y43A 4TKPB 1LDJB 4QYLA 2G45A 5E74A 2VJFB 2DKWA 5HRWA 3HCSA 3HMHA 3P1DA 5DX4A 3M62A 2IDAA 4BBQA 3D7CA 3LJWA 2ECIA 4UIXA 2YDWA 3JVMA 4CUTA 3RTRB 4QEVA 5I86A 3P5OA 5A85A 3HCTA 4HBWA 2KREA 5D1LB 4A4BA 2AN6A 5CQ6A 1JM7A 2M85A 1WEMA 1WEPA 2WP2A 5F25A 4LYWA 3M99A 4UIVA 4YYGA 3JVLA 4QSRA 4N3WA 2I7KA 5A5RA 4NQMA 4ZDTA 5ENFA 5AD2A 3KQIA 1Z60A 5F62A 5CFWA 3P1CA 2E6RA 2LXPC 5D26A 4QF2A 5H1UA 4NR5A 3N9MA 5HCLA 5FE9A 4C67A 2MT5A 3FKMX 2D8SA 4O76A 4A9OA 5CQ4A 5L96A 5C87A 5HQ6A 3LQHA 2YELA 2KWOA 5F5ZA 5CTLA 3DPLR 1FP0A 3MXFA 5CP5A 2H60A 2UZGA 3L1XA 2YQDA 4YY6A 3U5KA 4QNSA 5C85A 5IG6A 3VK6A 5ENBA 5A81A 3MULA 5EPBA 4GPJA 5KH9A 3NG2A 4YYNA 5J3XA 5I83A 3S92A 5TABA 5A5PA 3ZVYA 5HENA 4HXKA 4LYIA 5D3JA 4QR5A 4BW4A 4A9KA 5C7NA 5I1QA 5KU3A 2ECVA 4ZW1A 5LCWB 4Q0NA 2MNZA 5CPEA 4Z6HA 4XY8A 2ECJA 5DW2A 4N4FA 1WFKA 5CUAA 5CGPA 4Q0OA 4QEWA 4BHWA 2K1JA 5LKUA 3KV5A 3LXJA 3S91A 5D3SA 1MM2A 1Z2QA 4UP0A 4OGJA 2E6SA 5E3GA 1MM3A 5HJCA 3MB4A 2F6JA 4HXOA 3T7LA 4IOQA 5AMFA 4QB3A 4TT4A 2DVVA 3ZVZB 5LVQA 2FUUA 4O74A 3MHHA 2ECGA 5D3PA 4A9FA 4ZC9A 5FE7A 4PCIA 4GNGA 3I2DA 4MR3A 1F68A 3SHBA 4O75A 2LGGA 4NUEA 2LN0A 5C89A 2LV9A 5AITA 5E9IA 4Z6IA 5ENEA 3O7AA 2MUMA 4IR3A 2VP7A 1Z6UA 4Z93A 5I3LA 3SVGA 2KGGA 5ETBA 2LGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKN A;  5BT3 A;  2I8N A;  5LKT A;  2YQM A;  2NAA A;  5HRX A;  4IOR A;  4O72 A;  4IR5 A;  5DFB A;  3HMF A;  4TU6 A;  2EGP A;  4AYC A;  2KR4 A;  5E9K A;  4LKA A;  2N9G A;  5C8G A;  5HEM A;  5EGU A;  4BW1 A;  5IGL A;  4J1P A;  4NYW A;  5HFR A;  4QUU A;  2E7O A;  3IU5 A;  3UVD A;  2RNX A;  2CKL B;  5EIC A;  5EA1 A;  4QZS A;  1RMD A;  5EK9 A;  5E0R A;  3N9N A;  5B75 A;  2OXQ C;  4PTB A;  4FO9 A;  2G4A A;  4LJN A;  4LZS A;  5I89 A;  2VPE A;  3HME A;  2FSA A;  4YK0 A;  4BW3 A;  4CUR A;  3O33 A;  3GV4 A;  1VYX A;  1JSP B;  5EWW A;  5FH8 A;  5LUU A;  5DFC A;  3RCW A;  2L5U A;  5E9M A;  2MIQ A;  2YSM A;  5FH6 A;  4X2I A;  2VPB A;  5CQA A;  5I7Y A;  5LJ1 A;  5D0C A;  3JVK A;  2ECT A;  5I40 A;  5F60 A;  4WIV A;  5DYU A;  5DKD A;  4CFK A;  5ENJ A;  3U5J A;  5CUE A;  4TYL A;  1T1H A;  4YYH A;  2PNX A;  4E96 A;  4N4H A;  1ZS5 A;  4LLB A;  4C66 A;  5A5O A;  2L5E A;  2NXB A;  5F2P A;  3KNV A;  5B76 A;  4N4G A;  5FEY A;  4TS8 A;  4A4C A;  5JWM A;  4NUC A;  4QR4 A;  5E9L A;  4YBT A;  2LGV A;  3FL2 A;  1E4U A;  5II2 A;  2DWW A;  2R0Y A;  3U5M A;  4LDF A;  4KCX A;  5EWV A;  4XUB A;  2MJV B;  3Q2F A;  3Q2E A;  5FG4 A;  4NR6 A;  3MHS A;  2L85 A;  3UV2 A;  2L80 A;  1WEW A;  3O36 A;  2RO1 A;  3C5K A;  2KWJ A;  3ZTG A;  5E3D A;  1X4J A;  2KFT A;  5II1 A;  5FE0 A;  2L84 A;  5EI4 A;  4O7E A;  4S3O C;  2CT2 A;  3G0J A;  5FB0 A;  3C6W A;  5D25 A;  1V87 A;  3UV4 A;  3PUQ A;  3ZPV 1;  2ECW A;  2PUY A;  5C4Q A;  4NRA A;  4BW2 A;  1E6I A;  4HXL A;  5FE6 A;  5G4S A;  3UVY A;  5CQ8 A;  3U5P A;  4O64 A;  3QZS A;  4MSX A;  4Z1Q A;  2KTB B;  2XEU A;  3IHP A;  5TDR A;  2YYR A;  2OSS A;  2CSY A;  5DKH A;  4A9H A;  4YBM A;  5IGK A;  3RPG B;  5HFQ A;  1JM4 B;  4XUA A;  4A9E A;  2ECN A;  2G43 A;  5A82 A;  4CUU A;  5CUC A;  5EYA F;  3U5L A;  5EV9 A;  4QSQ A;  4LYS A;  5F61 A;  2C2L A;  5D3T A;  2H0D B;  4UIU A;  5F63 A;  3G0L A;  2RSD A;  5FB1 A;  2MD8 C;  5COI A;  5FE3 A;  1WEV A;  4J0S A;  3ZNI A;  5TBN A;  2F42 A;  4L58 A;  5A5Q A;  4AP4 A;  4YH3 A;  5B79 A;  1IYM A;  5DW1 A;  3HCU A;  5DFD A;  5E73 A;  4R7E A;  4LR6 A;  4Z1S A;  2YUR A;  4FIP A;  5E9V A;  5HLS A;  4AVX A;  4TZ2 A;  1WEN A;  4CL9 A;  4PCE A;  4KV1 A;  5F36 A;  4O78 A;  4ZQL A;  2L75 A;  1BOR A;  5TB6 A;  2Y1N A;  4QC1 A;  4HXR A;  5FH7 A;  1HYI A;  5IGN A;  5C11 A;  4NRB A;  4XYA A;  4FLP A;  3EB6 A;  4XI1 A;  4YYK A;  4A9N A;  4A0C D;  2RS9 B;  3SVF A;  5DLX A;  5CU8 A;  2R10 A;  3JVJ A;  5KO4 A;  3ZYU A;  4HXN A;  5E7D A;  5FER A;  5KHM A;  3NXB A;  5ENG A;  2VJE A;  3MUK A;  2RNW A;  3SOU A;  4O7B A;  3LQJ A;  3LRQ A;  2QIZ A;  4QSS A;  2I50 A;  1ZBD B;  2EA6 A;  4IC3 A;  5D1K B;  4UYF B;  4F3I A;  3U5N A;  3DAI A;  4UYG A;  5HQ5 A;  4J3I A;  3QZT A;  4OGI A;  3QZV A;  5HM0 A;  3UW9 A;  4CFL A;  4LK9 A;  5G04 B;  2RFJ A;  4A9M A;  2L0B A;  4C9Z A;  3N9P A;  3ASL A;  4B7Y C;  3U5O A;  3N9O A;  4KV4 A;  4QEU A;  1N87 A;  5FFW A;  2MNY A;  1XWH A;  4IC2 A;  4YAB A;  4WZ2 A;  4R8P K;  4X3G A;  2R0V A;  4YC9 A;  5EP7 A;  4YBS A;  2JMJ A;  2DVR A;  4S3O B;  4A49 A;  2YT5 A;  2XB1 A;  2YEM A;  4NR9 A;  4RVR A;  4QST A;  5EWH A;  4BJX A;  2K17 A;  4IOO A;  2E7N A;  4TQN A;  5DIN A;  4GNF A;  2DAT A;  4IR4 A;  2CKL A;  2VNF A;  4QF3 A;  3M63 A;  1CHC A;  4QSV A;  5J0D A;  5KTX A;  4PPE A;  4LZR A;  5A5S A;  5H9M A;  2JMI A;  4XY9 A;  5F3A A;  3O35 A;  5LJ2 A;  2H0D A;  2DX8 A;  1WEQ A;  3PUR A;  5CZG A;  5I29 A;  2YUC A;  2MA5 A;  3AAD A;  4Y03 A;  5CUG A;  2LGL A;  4YYJ A;  4HXS A;  4MEO A;  4NUD A;  1HYJ A;  2YHN A;  5CY9 A;  4J0R A;  2C2V S;  4UIZ A;  4HBV A;  4CUQ A;  3P1F A;  4CCG X;  4NR8 A;  4YAD A;  5EIS A;  1N72 A;  3I3J A;  4L7X A;  5B78 A;  4O7C A;  5EPS A;  4F52 B;  3K2J A;  5FFV A;  2LRI C;  4B86 C;  5I80 A;  4DON A;  5IGM A;  3HTK C;  4FJC A;  4V3K C;  5DYX A;  2JRJ A;  5H1V A;  1X4U A;  4UP5 A;  2VJF A;  4NR4 A;  5LKX A;  2K4D A;  4A9J A;  1EQF A;  2OUO A;  2QJ0 A;  5IID A;  5I7X A;  5H1T A;  2LXH C;  1JM7 B;  2RNY A;  5AD3 A;  2ZET C;  4ZUX U;  2WP1 A;  1WEO A;  4A9L A;  5G05 B;  5D3H A;  1G25 A;  5G0F A;  4WZ0 A;  4HXP A;  5I88 A;  5A7C A;  4NR7 A;  4QBM A;  1DVP A;  4UI9 B;  5A5N A;  5FG6 A;  3UVW A;  4YY4 A;  4QUT A;  4UIW A;  5KH7 A;  4N4I A;  2YW5 A;  4QSU A;  2Y1M A;  4UIT A;  2YYN A;  4QR3 A;  2L43 A;  3SOW A;  4OUF A;  5TCM A;  2D82 A;  5B77 A;  3N9L A;  2YHO A;  5BT4 A;  5LVR A;  2DVQ A;  2MD7 B;  4A9I A;  2M1R A;  2YRE A;  3V43 A;  3ZPV E;  4W4U A;  3TLP A;  1WEU A;  5F1L A;  2OO1 A;  4QC3 A;  2KU3 A;  5D3N A;  1JOC A;  5CQ5 A;  4YYI A;  1WE9 A;  2YEK A;  2F6N A;  5BT5 A;  5L99 A;  4YH4 A;  4MR4 A;  5D3R A;  5ACY A;  5CUB A;  5FBX A;  5KTW A;  5ENI A;  5EWC A;  4ALG A;  4TZ8 A;  5DYC A;  5DYA A;  5G4R A;  1WIM A;  4V3L C;  4MEN A;  3L11 A;  2VPD A;  4I7B A;  3L1Z B;  1X0J A;  4IR6 A;  5ETD A;  4UYD A;  4ALH A;  1WGM A;  2HDP A;  5EQ1 A;  4MEQ A;  5CQ7 A;  4PS5 A;  2E3K A;  2VPG A;  4UIY A;  2D9E A;  5F1H A;  5L8U A;  2DVS A;  1WUG A;  4WHW A;  5KTU A;  1WIL A;  2KE1 A;  2LQ6 A;  4GND A;  4MEP A;  5EWD A;  5CRZ A;  4P5O B;  2KYU A;  5E9Y A;  4CUP A;  4O70 A;  2GRC A;  4NYX A;  2KWN A;  4HBY A;  3ZYQ A;  1FBV A;  3GL6 A;  5K29 A;  4I7D A;  4UYH A;  4MR5 A;  3DQV R;  4R2Y A;  1U6G B;  2K16 A;  5EVA A;  2VJE B;  4YAT A;  1K2F A;  1VD4 A;  4LAD B;  1X4I A;  3MB3 A;  2JMD A;  4NYV A;  5D3L A;  4MVT A;  5FE5 A;  2EOD A;  5LJ0 A;  2KWK A;  4QSP A;  1LDK C;  5ENH A;  4I7C A;  4MR6 A;  5B8D A;  4YAX A;  5TRB A;  4LC2 A;  1WEE A;  4Q6F A;  4TT6 A;  3UVX A;  4CLB A;  2MA6 A;  4NXJ A;  4WHU A;  3LQI A;  4LRG A;  2YSJ A;  5FG5 A;  4TU4 A;  5CQT A;  4AYC B;  4O71 A;  5CRM A;  2YW8 A;  4UYF A;  2KGI A;  2LDR A;  3MQM A;  4QSW A;  2BAY A;  5C13 A;  5HQ7 A;  3GG3 A;  2RI7 A;  4O7A A;  4YYD A;  2QIC A;  3O70 A;  5ENC A;  4PY6 A;  3RPG C;  5DLZ A;  2FUI A;  4YYM A;  4HBX A;  5AME A;  5FDZ A;  4PKL A;  5H85 A;  5D24 A;  5LKZ A;  5HEL A;  3T6R A;  5FE1 A;  5D1M B;  5FE4 A;  2LSP B;  4FK5 A;  5IBN A;  4WZ3 B;  2KIZ A;  2G6Q A;  1F62 A;  3N9Q A;  4NN2 A;  3AQA A;  2HYE D;  3KV6 A;  5JG6 A;  4TTE A;  3P1E A;  3UV5 A;  2YU4 A;  3O37 A;  4NRC A;  4CA1 A;  5D7X A;  5CUD A;  4HXM A;  3PHD A;  5CS8 A;  5FE8 A;  2M3H A;  4NS5 A;  5EU1 A;  4O77 A;  4QSX A;  4AUQ B;  5L97 A;  4NQN A;  1WUM A;  5FFY A;  4GNE A;  4UYE A;  5DKA A;  4GB0 A;  3SVH A;  4QY4 A;  5DKC A;  3ONI A;  4TT2 A;  4O7F A;  5CQ3 A;  5EM3 A;  5A83 A;  3IU6 A;  1VFY A;  5TDW A;  2YQL A;  2CSZ A;  3O34 A;  3SOX A;  5DBM A;  5HRV A;  5L98 A;  4LZ2 A;  3EB5 A;  1WES A;  5EPR A;  5DY7 A;  4WA6 A;  2M6M A;  5L8T A;  4CUS A;  2R0S A;  3DWY A;  5AIU A;  5FE2 A;  5KH3 A;  4QYD A;  5JI8 A;  2Y43 A;  4TKP B;  1LDJ B;  4QYL A;  2G45 A;  5E74 A;  2VJF B;  2DKW A;  5HRW A;  3HCS A;  3HMH A;  3P1D A;  5DX4 A;  3M62 A;  2IDA A;  4BBQ A;  3D7C A;  3LJW A;  2ECI A;  4UIX A;  2YDW A;  3JVM A;  4CUT A;  3RTR B;  4QEV A;  5I86 A;  3P5O A;  5A85 A;  3HCT A;  4HBW A;  2KRE A;  5D1L B;  4A4B A;  2AN6 A;  5CQ6 A;  1JM7 A;  2M85 A;  1WEM A;  1WEP A;  2WP2 A;  5F25 A;  4LYW A;  3M99 A;  4UIV A;  4YYG A;  3JVL A;  4QSR A;  4N3W A;  2I7K A;  5A5R A;  4NQM A;  4ZDT A;  5ENF A;  5AD2 A;  3KQI A;  1Z60 A;  5F62 A;  5CFW A;  3P1C A;  2E6R A;  2LXP C;  5D26 A;  4QF2 A;  5H1U A;  4NR5 A;  3N9M A;  5HCL A;  5FE9 A;  4C67 A;  2MT5 A;  3FKM X;  2D8S A;  4O76 A;  4A9O A;  5CQ4 A;  5L96 A;  5C87 A;  5HQ6 A;  3LQH A;  2YEL A;  2KWO A;  5F5Z A;  5CTL A;  3DPL R;  1FP0 A;  3MXF A;  5CP5 A;  2H60 A;  2UZG A;  3L1X A;  2YQD A;  4YY6 A;  3U5K A;  4QNS A;  5C85 A;  5IG6 A;  3VK6 A;  5ENB A;  5A81 A;  3MUL A;  5EPB A;  4GPJ A;  5KH9 A;  3NG2 A;  4YYN A;  5J3X A;  5I83 A;  3S92 A;  5TAB A;  5A5P A;  3ZVY A;  5HEN A;  4HXK A;  4LYI A;  5D3J A;  4QR5 A;  4BW4 A;  4A9K A;  5C7N A;  5I1Q A;  5KU3 A;  2ECV A;  4ZW1 A;  5LCW B;  4Q0N A;  2MNZ A;  5CPE A;  4Z6H A;  4XY8 A;  2ECJ A;  5DW2 A;  4N4F A;  1WFK A;  5CUA A;  5CGP A;  4Q0O A;  4QEW A;  4BHW A;  2K1J A;  5LKU A;  3KV5 A;  3LXJ A;  3S91 A;  5D3S A;  1MM2 A;  1Z2Q A;  4UP0 A;  4OGJ A;  2E6S A;  5E3G A;  1MM3 A;  5HJC A;  3MB4 A;  2F6J A;  4HXO A;  3T7L A;  4IOQ A;  5AMF A;  4QB3 A;  4TT4 A;  2DVV A;  3ZVZ B;  5LVQ A;  2FUU A;  4O74 A;  3MHH A;  2ECG A;  5D3P A;  4A9F A;  4ZC9 A;  5FE7 A;  4PCI A;  4GNG A;  3I2D A;  4MR3 A;  1F68 A;  3SHB A;  4O75 A;  2LGG A;  4NUE A;  2LN0 A;  5C89 A;  2LV9 A;  5AIT A;  5E9I A;  4Z6I A;  5ENE A;  3O7A A;  2MUM A;  4IR3 A;  2VP7 A;  1Z6U A;  4Z93 A;  5I3L A;  3SVG A;  2KGG A;  5ETB A;  2LGK A; 
#chains in the Genus database with same CATH topology
 4AKN A;  5BT3 A;  2I8N A;  5LKT A;  2YQM A;  2NAA A;  5HRX A;  5SVY A;  4IOR A;  4O72 A;  4IR5 A;  5DFB A;  2OWA A;  3HMF A;  4TU6 A;  2EGP A;  4AYC A;  2KR4 A;  2L7P A;  5E9K A;  4LKA A;  2N9G A;  5C8G A;  5HEM A;  2P57 A;  5EGU A;  4BW1 A;  5IGL A;  4J1P A;  4NYW A;  5HFR A;  4QUU A;  2E7O A;  3IU5 A;  3UVD A;  2RNX A;  2CKL B;  5EIC A;  5EA1 A;  4QZS A;  1RMD A;  5EK9 A;  5E0R A;  3N9N A;  5B75 A;  2OXQ C;  4PTB A;  4FO9 A;  2G4A A;  4LJN A;  4LZS A;  5I89 A;  2VPE A;  3HME A;  2FSA A;  4YK0 A;  4BW3 A;  4CUR A;  3O33 A;  2EGM A;  3GV4 A;  1VYX A;  1JSP B;  5EWW A;  5FH8 A;  5LUU A;  5DFC A;  2FD4 A;  3RCW A;  2L5U A;  5E9M A;  2MIQ A;  2YSM A;  5FH6 A;  4X2I A;  2VPB A;  5CQA A;  5I7Y A;  5LJ1 A;  5D0C A;  3JVK A;  2ECT A;  5I40 A;  5F60 A;  4WIV A;  5DYU A;  5DKD A;  4CFK A;  5ENJ A;  3U5J A;  5CUE A;  4TYL A;  1T1H A;  4YYH A;  2PNX A;  4E96 A;  4N4H A;  1ZS5 A;  3E2D A;  4LLB A;  4C66 A;  5A5O A;  2L5E A;  2NXB A;  5F2P A;  3KNV A;  5B76 A;  4N4G A;  5FEY A;  4TS8 A;  4A4C A;  5JWM A;  4NUC A;  4QR4 A;  5E9L A;  4YBT A;  2LGV A;  3FL2 A;  1E4U A;  5II2 A;  2DWW A;  2R0Y A;  3U5M A;  4LDF A;  4KCX A;  5EWV A;  4XUB A;  2MJV B;  3Q2F A;  3Q2E A;  5FG4 A;  4NR6 A;  3MHS A;  2L85 A;  3UV2 A;  2L80 A;  1WEW A;  3O36 A;  2RO1 A;  3C5K A;  2KWJ A;  3ZTG A;  5E3D A;  1X4J A;  2KFT A;  5II1 A;  1MBM A;  5FE0 A;  2L84 A;  5EI4 A;  4O7E A;  4S3O C;  2JUN A;  2CT2 A;  3G0J A;  5FB0 A;  3C6W A;  5D25 A;  1V87 A;  4O62 A;  3UV4 A;  3PUQ A;  3ZPV 1;  2ECW A;  2PUY A;  5C4Q A;  4NRA A;  4BW2 A;  1E6I A;  4HXL A;  5FE6 A;  5G4S A;  3UVY A;  5CQ8 A;  3U5P A;  4O64 A;  3QZS A;  4MSX A;  4Z1Q A;  2KTB B;  2XEU A;  3IHP A;  3O47 A;  2YYR A;  5K3Q A;  5TDR A;  2OSS A;  2CSY A;  5DKH A;  4A9H A;  4YBM A;  5IGK A;  3RPG B;  5HFQ A;  1JM4 B;  4XUA A;  4A9E A;  2ECN A;  2G43 A;  5A82 A;  4CUU A;  5CUC A;  5EYA F;  3U5L A;  2CRR A;  5EV9 A;  4QSQ A;  4LYS A;  5F61 A;  2C2L A;  5D3T A;  2H0D B;  4UIU A;  5F63 A;  3G0L A;  2RSD A;  5FB1 A;  2MD8 C;  5COI A;  5FE3 A;  4Z0R A;  1WEV A;  4J0S A;  3ZNI A;  5TBN A;  2F42 A;  4L58 A;  5A5Q A;  4AP4 A;  4YH3 A;  5B79 A;  1IYM A;  5DW1 A;  3HCU A;  5DFD A;  5E73 A;  4R7E A;  3SUB A;  4LR6 A;  4Z1S A;  2YUR A;  4FIP A;  5E9V A;  5HLS A;  4AVX A;  3DWD A;  4TZ2 A;  1WEN A;  4CL9 A;  4PCE A;  4KV1 A;  5F36 A;  4O78 A;  4ZQL A;  2L75 A;  1BOR A;  5TB6 A;  2Y1N A;  4QC1 A;  4HXR A;  5FH7 A;  1HYI A;  5IGN A;  5C11 A;  4NRB A;  3LJU X;  4XYA A;  4FLP A;  3EB6 A;  4XI1 A;  4YYK A;  4A9N A;  4A0C D;  2RS9 B;  3SVF A;  5DLX A;  5CU8 A;  2JM3 A;  2R10 A;  3JVJ A;  5KO4 A;  3ZYU A;  4HXN A;  2XOZ A;  5E7D A;  3FM8 C;  5KHM A;  3NXB A;  5FER A;  5ENG A;  2VJE A;  3MUK A;  2RNW A;  3SOU A;  4O7B A;  3LQJ A;  3LRQ A;  2QIZ A;  4QSS A;  2I50 A;  1ZBD B;  2EA6 A;  4IC3 A;  5D1K B;  4UYF B;  4F3I A;  3U5N A;  3DAI A;  4UYG A;  5HQ5 A;  4J3I A;  3QZT A;  4OGI A;  3QZV A;  5HM0 A;  3UW9 A;  4CFL A;  4LK9 A;  3VKH A;  5G04 B;  2RFJ A;  4A9M A;  2YVR A;  2L0B A;  4C9Z A;  3N9P A;  3ASL A;  4B7Y C;  3U5O A;  3N9O A;  4KV4 A;  4QEU A;  1N87 A;  5FFW A;  2MNY A;  1XWH A;  4IC2 A;  4YAB A;  4WZ2 A;  4R8P K;  4X3G A;  2R0V A;  4YC9 A;  5EP7 A;  4YBS A;  2JMJ A;  2DVR A;  4S3O B;  4A49 A;  2YT5 A;  2XB1 A;  2YEM A;  3T9K A;  4NR9 A;  4RVR A;  4QST A;  5EWH A;  4BJX A;  2K17 A;  4IOO A;  2E7N A;  4TQN A;  5DIN A;  4GNF A;  2DAT A;  4IR4 A;  2CKL A;  2VNF A;  4QF3 A;  3M63 A;  1CHC A;  4QSV A;  5J0D A;  5KTX A;  4PPE A;  4LZR A;  5A5S A;  5H9M A;  2JMI A;  4XY9 A;  5F3A A;  3O35 A;  5LJ2 A;  2H0D A;  2DX8 A;  1WEQ A;  3PUR A;  5CZG A;  5I29 A;  2DSM A;  2YUC A;  2MA5 A;  3AAD A;  4Y03 A;  5CUG A;  2LGL A;  4YYJ A;  4HXS A;  4MEO A;  4NUD A;  1HYJ A;  2YHN A;  5CY9 A;  4J0R A;  2C2V S;  4UIZ A;  4HBV A;  4CUQ A;  3P1F A;  4CCG X;  4NR8 A;  4YAD A;  5EIS A;  1N72 A;  3I3J A;  4L7X A;  5B78 A;  4O7C A;  5EPS A;  1ZKR A;  4F52 B;  3K2J A;  5FFV A;  2LRI C;  3Q1D A;  4B86 C;  5I80 A;  4DON A;  5IGM A;  3HTK C;  4FJC A;  4V3K C;  2KKX A;  5DYX A;  2JRJ A;  5H1V A;  1X4U A;  4UP5 A;  2VJF A;  2XOY A;  4NR4 A;  5LKX A;  2K4D A;  4A9J A;  1EQF A;  2OUO A;  2QJ0 A;  5IID A;  5I7X A;  5H1T A;  2LXH C;  1JM7 B;  2RNY A;  5AD3 A;  2ZET C;  4ZUX U;  2WP1 A;  1WEO A;  3LVR E;  4A9L A;  5G05 B;  5D3H A;  1G25 A;  5G0F A;  2CSV A;  4WZ0 A;  4HXP A;  5I88 A;  5A7C A;  4NR7 A;  4QBM A;  2IQJ A;  1DVP A;  4UI9 B;  5A5N A;  5FG6 A;  3UVW A;  4YY4 A;  2CRW A;  3KDE C;  4QUT A;  4UIW A;  5KH7 A;  4N4I A;  2YW5 A;  4QSU A;  2Y1M A;  4UIT A;  2YYN A;  4QR3 A;  2L43 A;  3SOW A;  4OUF A;  5TCM A;  2D82 A;  5B77 A;  3N9L A;  4QQ4 A;  2YHO A;  5BT4 A;  5LVR A;  2DVQ A;  2MD7 B;  4A9I A;  2M1R A;  2YRE A;  3V43 A;  3ZPV E;  4W4U A;  3TLP A;  2RR4 A;  1WEU A;  5F1L A;  2OO1 A;  3PLW A;  4QC3 A;  2KU3 A;  5D3N A;  1JOC A;  4AKI A;  5CQ5 A;  4YYI A;  1WE9 A;  3D1B A;  2YEK A;  2F6N A;  5BT5 A;  5L99 A;  2XOC A;  4YH4 A;  4MR4 A;  5D3R A;  5ACY A;  2LAU A;  5CUB A;  5FBX A;  5KTW A;  5ENI A;  5EWC A;  4ALG A;  4TZ8 A;  5DYC A;  5DYA A;  5G4R A;  1WIM A;  4V3L C;  4MEN A;  3L11 A;  2VPD A;  4I7B A;  3L1Z B;  1X0J A;  4IR6 A;  5ETD A;  4UYD A;  4ALH A;  1WGM A;  2HDP A;  5EQ1 A;  5SVI B;  4MEQ A;  5CQ7 A;  4PS5 A;  2E3K A;  4OGC A;  2VPG A;  4UIY A;  2D9E A;  5F1H A;  5L8U A;  2DVS A;  1WUG A;  4WHW A;  3FJU B;  5KTU A;  1WIL A;  2KE1 A;  2LQ6 A;  4GND A;  4MEP A;  5EWD A;  5CRZ A;  4P5O B;  2KYU A;  5E9Y A;  4CUP A;  4O70 A;  2GRC A;  4NYX A;  2EXU A;  2KWN A;  4HBY A;  3ZYQ A;  1FBV A;  3GL6 A;  5K29 A;  4I7D A;  4UYH A;  4MR5 A;  3DQV R;  4R2Y A;  1U6G B;  2K16 A;  5EVA A;  2VJE B;  4YAT A;  1K2F A;  1VD4 A;  4LAD B;  1X4I A;  3MB3 A;  2JMD A;  4NYV A;  5D3L A;  4MVT A;  5FE5 A;  2EOD A;  5LJ0 A;  2KWK A;  4QSP A;  1LDK C;  5ENH A;  4I7C A;  4MR6 A;  5B8D A;  4YAX A;  5TRB A;  4LC2 A;  1WEE A;  2CON A;  4Q6F A;  4TT6 A;  3UVX A;  4CLB A;  2MA6 A;  4NXJ A;  4WHU A;  3LQI A;  4LRG A;  2YSJ A;  5FG5 A;  4TU4 A;  5CQT A;  4AYC B;  4O71 A;  5CRM A;  2YW8 A;  4UYF A;  2KGI A;  2LDR A;  3MQM A;  4QSW A;  4F1P A;  2BAY A;  5C13 A;  5HQ7 A;  3GG3 A;  2RI7 A;  4O7A A;  4YYD A;  4AKH A;  3H7H A;  2QIC A;  3O70 A;  5ENC A;  4PY6 A;  3RPG C;  5DLZ A;  2FUI A;  3LDY A;  4YYM A;  4HBX A;  5AME A;  5FDZ A;  4PKL A;  5H85 A;  2KKY A;  5D24 A;  5LKZ A;  5HEL A;  3T6R A;  5FE1 A;  5D1M B;  5FE4 A;  2LSP B;  4FK5 A;  5IBN A;  4WZ3 B;  2KIZ A;  4AKG A;  2G6Q A;  1F62 A;  3N9Q A;  4NN2 A;  3AQA A;  2HYE D;  3KV6 A;  5JG6 A;  4TTE A;  3P1E A;  3UV5 A;  2YU4 A;  3O37 A;  4NRC A;  3FAO A;  4CA1 A;  5D7X A;  5CUD A;  4HXM A;  3PHD A;  5CS8 A;  5FE8 A;  3FEH A;  2M3H A;  2D8U A;  4NS5 A;  5EU1 A;  4O77 A;  4QSX A;  4AUQ B;  5L97 A;  4NQN A;  1WUM A;  5FFY A;  4GNE A;  4UYE A;  5DKA A;  4GB0 A;  3SVH A;  4QY4 A;  5DKC A;  3ONI A;  4TT2 A;  4O7F A;  5CQ3 A;  5EM3 A;  5A83 A;  3IU6 A;  1VFY A;  2MKE A;  4OGE A;  2YQL A;  5SVX A;  2CSZ A;  3O34 A;  3SOX A;  5DBM A;  5HRV A;  5L98 A;  4LZ2 A;  3EB5 A;  4AI6 A;  1WES A;  5EPR A;  5DY7 A;  4WA6 A;  2M6M A;  5L8T A;  4H9D A;  4CUS A;  2R0S A;  3DWY A;  5AIU A;  3VKG A;  5FE2 A;  5KH3 A;  4QYD A;  5JI8 A;  2Y43 A;  4TKP B;  1LDJ B;  4QYL A;  2G45 A;  5E74 A;  2VJF B;  2EJN A;  2DKW A;  5HRW A;  3HCS A;  3HMH A;  3P1D A;  5DX4 A;  3M62 A;  3M7K A;  2IDA A;  4BBQ A;  3D7C A;  3D1D A;  3LJW A;  2DJA A;  4UIX A;  2E61 A;  2YDW A;  2ECI A;  3JVM A;  3MDB C;  4CUT A;  3RTR B;  4QEV A;  5I86 A;  3P5O A;  5A85 A;  3HCT A;  4HBW A;  2KRE A;  5D1L B;  4A4B A;  2AN6 A;  5CQ6 A;  4Z0O A;  2M85 A;  1JM7 A;  1WEM A;  1WEP A;  2WP2 A;  5F25 A;  4LYW A;  1DCQ A;  3M99 A;  4UIV A;  4YYG A;  3JVL A;  3FAN A;  4QSR A;  4N3W A;  2I7K A;  5A5R A;  4NQM A;  4ZDT A;  5ENF A;  5AD2 A;  2M13 A;  3KQI A;  1Z60 A;  5F62 A;  5CFW A;  5TDW A;  3P1C A;  2E6R A;  2LXP C;  5D26 A;  4QF2 A;  2XP0 A;  5H1U A;  4NR5 A;  3N9M A;  5HCL A;  5FE9 A;  4C67 A;  2MT5 A;  3FKM X;  2D8S A;  4O76 A;  4A9O A;  5CQ4 A;  5L96 A;  5C87 A;  5HQ6 A;  3LQH A;  2YEL A;  2KWO A;  5F5Z A;  5CTL A;  3DPL R;  1FP0 A;  3MXF A;  5CP5 A;  2H60 A;  2UZG A;  3L1X A;  2YQD A;  4YY6 A;  3U5K A;  4QNS A;  5C85 A;  5IG6 A;  3VK6 A;  5ENB A;  5A81 A;  3MUL A;  5EPB A;  4GPJ A;  5KH9 A;  3NG2 A;  4YYN A;  5J3X A;  5I83 A;  3S92 A;  5TAB A;  5A5P A;  3ZVY A;  5HEN A;  4HXK A;  4LYI A;  5D3J A;  4QR5 A;  4BW4 A;  4A9K A;  5C7N A;  5I1Q A;  5KU3 A;  2ECV A;  4ZW1 A;  5LCW B;  4Q0N A;  2MNZ A;  5CPE A;  4Z6H A;  4XY8 A;  2ECJ A;  5DW2 A;  4N4F A;  1WFK A;  5CUA A;  5SVI A;  5CGP A;  4Q0O A;  4QEW A;  4BHW A;  2K1J A;  5LKU A;  3JUE A;  3KV5 A;  3LXJ A;  3S91 A;  5D3S A;  2FFW A;  1MM2 A;  1Z2Q A;  4UP0 A;  3LVQ E;  4OGJ A;  2E6S A;  5E3G A;  1MM3 A;  5HJC A;  3MB4 A;  2F6J A;  4HXO A;  3T7L A;  4IOQ A;  5AMF A;  4QB3 A;  4TT4 A;  2DVV A;  3ZVZ B;  5LVQ A;  2FUU A;  4O74 A;  3MHH A;  2ECG A;  5D3P A;  4A9F A;  4ZC9 A;  5FE7 A;  4PCI A;  4GNG A;  3I2D A;  4MR3 A;  1F68 A;  3SHB A;  4O75 A;  3DDT A;  2LGG A;  4NUE A;  2LN0 A;  5C89 A;  2LV9 A;  5AIT A;  5E9I A;  4Z6I A;  2B0O E;  5ENE A;  3O7A A;  2MUM A;  4IR3 A;  2VP7 A;  1Z6U A;  4Z93 A;  3ERR A;  1PUO A;  3SVG A;  5I3L A;  2KGG A;  5ETB A;  2LGK A; 
#chains in the Genus database with same CATH homology
 4AKN A;  5BT3 A;  2I8N A;  5LKT A;  2YQM A;  2NAA A;  5HRX A;  4IOR A;  4O72 A;  4IR5 A;  5DFB A;  3HMF A;  4TU6 A;  2EGP A;  4AYC A;  2KR4 A;  5E9K A;  4LKA A;  2N9G A;  5C8G A;  5HEM A;  5EGU A;  4BW1 A;  5IGL A;  4J1P A;  4NYW A;  5HFR A;  4QUU A;  2E7O A;  3IU5 A;  3UVD A;  2RNX A;  2CKL B;  5EIC A;  5EA1 A;  4QZS A;  1RMD A;  5EK9 A;  5E0R A;  3N9N A;  5B75 A;  2OXQ C;  4PTB A;  4FO9 A;  2G4A A;  4LJN A;  4LZS A;  5I89 A;  2VPE A;  3HME A;  2FSA A;  4YK0 A;  4BW3 A;  4CUR A;  3O33 A;  3GV4 A;  1VYX A;  1JSP B;  5EWW A;  5FH8 A;  5LUU A;  5DFC A;  3RCW A;  2L5U A;  5E9M A;  2MIQ A;  2YSM A;  5FH6 A;  4X2I A;  2VPB A;  5CQA A;  5I7Y A;  5LJ1 A;  5D0C A;  3JVK A;  2ECT A;  5I40 A;  5F60 A;  4WIV A;  5DYU A;  5DKD A;  4CFK A;  5ENJ A;  3U5J A;  5CUE A;  4TYL A;  1T1H A;  4YYH A;  2PNX A;  4E96 A;  4N4H A;  1ZS5 A;  4LLB A;  4C66 A;  5A5O A;  2L5E A;  2NXB A;  5F2P A;  3KNV A;  5B76 A;  4N4G A;  5FEY A;  4TS8 A;  4A4C A;  5JWM A;  4NUC A;  4QR4 A;  5E9L A;  4YBT A;  2LGV A;  3FL2 A;  1E4U A;  5II2 A;  2DWW A;  2R0Y A;  3U5M A;  4LDF A;  4KCX A;  5EWV A;  4XUB A;  2MJV B;  3Q2F A;  3Q2E A;  5FG4 A;  4NR6 A;  3MHS A;  2L85 A;  3UV2 A;  2L80 A;  1WEW A;  3O36 A;  2RO1 A;  3C5K A;  2KWJ A;  3ZTG A;  5E3D A;  1X4J A;  2KFT A;  5II1 A;  5FE0 A;  2L84 A;  5EI4 A;  4O7E A;  4S3O C;  2CT2 A;  3G0J A;  5FB0 A;  3C6W A;  5D25 A;  1V87 A;  3UV4 A;  3PUQ A;  3ZPV 1;  2ECW A;  2PUY A;  5C4Q A;  4NRA A;  4BW2 A;  1E6I A;  4HXL A;  5FE6 A;  5G4S A;  3UVY A;  5CQ8 A;  3U5P A;  4O64 A;  3QZS A;  4MSX A;  4Z1Q A;  2KTB B;  2XEU A;  3IHP A;  5TDR A;  2YYR A;  2OSS A;  2CSY A;  5DKH A;  4A9H A;  4YBM A;  5IGK A;  3RPG B;  5HFQ A;  1JM4 B;  4XUA A;  4A9E A;  2ECN A;  2G43 A;  5A82 A;  4CUU A;  5CUC A;  5EYA F;  3U5L A;  5EV9 A;  4QSQ A;  4LYS A;  5F61 A;  2C2L A;  5D3T A;  2H0D B;  4UIU A;  5F63 A;  3G0L A;  2RSD A;  5FB1 A;  2MD8 C;  5COI A;  5FE3 A;  1WEV A;  4J0S A;  3ZNI A;  5TBN A;  2F42 A;  4L58 A;  5A5Q A;  4AP4 A;  4YH3 A;  5B79 A;  1IYM A;  5DW1 A;  3HCU A;  5DFD A;  5E73 A;  4R7E A;  4LR6 A;  4Z1S A;  2YUR A;  4FIP A;  5E9V A;  5HLS A;  4AVX A;  4TZ2 A;  1WEN A;  4CL9 A;  4PCE A;  4KV1 A;  5F36 A;  4O78 A;  4ZQL A;  2L75 A;  1BOR A;  5TB6 A;  2Y1N A;  4QC1 A;  4HXR A;  5FH7 A;  1HYI A;  5IGN A;  5C11 A;  4NRB A;  4XYA A;  4FLP A;  3EB6 A;  4XI1 A;  4YYK A;  4A9N A;  4A0C D;  2RS9 B;  3SVF A;  5DLX A;  5CU8 A;  2R10 A;  3JVJ A;  5KO4 A;  3ZYU A;  4HXN A;  5E7D A;  5FER A;  5KHM A;  3NXB A;  5ENG A;  2VJE A;  3MUK A;  2RNW A;  3SOU A;  4O7B A;  3LQJ A;  3LRQ A;  2QIZ A;  4QSS A;  2I50 A;  1ZBD B;  2EA6 A;  4IC3 A;  5D1K B;  4UYF B;  4F3I A;  3U5N A;  3DAI A;  4UYG A;  5HQ5 A;  4J3I A;  3QZT A;  4OGI A;  3QZV A;  5HM0 A;  3UW9 A;  4CFL A;  4LK9 A;  5G04 B;  2RFJ A;  4A9M A;  2L0B A;  4C9Z A;  3N9P A;  3ASL A;  4B7Y C;  3U5O A;  3N9O A;  4KV4 A;  4QEU A;  1N87 A;  5FFW A;  2MNY A;  1XWH A;  4IC2 A;  4YAB A;  4WZ2 A;  4R8P K;  4X3G A;  2R0V A;  4YC9 A;  5EP7 A;  4YBS A;  2JMJ A;  2DVR A;  4S3O B;  4A49 A;  2YT5 A;  2XB1 A;  2YEM A;  4NR9 A;  4RVR A;  4QST A;  5EWH A;  4BJX A;  2K17 A;  4IOO A;  2E7N A;  4TQN A;  5DIN A;  4GNF A;  2DAT A;  4IR4 A;  2CKL A;  2VNF A;  4QF3 A;  3M63 A;  1CHC A;  4QSV A;  5J0D A;  5KTX A;  4PPE A;  4LZR A;  5A5S A;  5H9M A;  2JMI A;  4XY9 A;  5F3A A;  3O35 A;  5LJ2 A;  2H0D A;  2DX8 A;  1WEQ A;  3PUR A;  5CZG A;  5I29 A;  2YUC A;  2MA5 A;  3AAD A;  4Y03 A;  5CUG A;  2LGL A;  4YYJ A;  4HXS A;  4MEO A;  4NUD A;  1HYJ A;  2YHN A;  5CY9 A;  4J0R A;  2C2V S;  4UIZ A;  4HBV A;  4CUQ A;  3P1F A;  4CCG X;  4NR8 A;  4YAD A;  5EIS A;  1N72 A;  3I3J A;  4L7X A;  5B78 A;  4O7C A;  5EPS A;  4F52 B;  3K2J A;  5FFV A;  2LRI C;  4B86 C;  5I80 A;  4DON A;  5IGM A;  3HTK C;  4FJC A;  4V3K C;  5DYX A;  2JRJ A;  5H1V A;  1X4U A;  4UP5 A;  2VJF A;  4NR4 A;  5LKX A;  2K4D A;  4A9J A;  1EQF A;  2OUO A;  2QJ0 A;  5IID A;  5I7X A;  5H1T A;  2LXH C;  1JM7 B;  2RNY A;  5AD3 A;  2ZET C;  4ZUX U;  2WP1 A;  1WEO A;  4A9L A;  5G05 B;  5D3H A;  1G25 A;  5G0F A;  4WZ0 A;  4HXP A;  5I88 A;  5A7C A;  4NR7 A;  4QBM A;  1DVP A;  4UI9 B;  5A5N A;  5FG6 A;  3UVW A;  4YY4 A;  4QUT A;  4UIW A;  5KH7 A;  4N4I A;  2YW5 A;  4QSU A;  2Y1M A;  4UIT A;  2YYN A;  4QR3 A;  2L43 A;  3SOW A;  4OUF A;  5TCM A;  2D82 A;  5B77 A;  3N9L A;  2YHO A;  5BT4 A;  5LVR A;  2DVQ A;  2MD7 B;  4A9I A;  2M1R A;  2YRE A;  3V43 A;  3ZPV E;  4W4U A;  3TLP A;  1WEU A;  5F1L A;  2OO1 A;  4QC3 A;  2KU3 A;  5D3N A;  1JOC A;  5CQ5 A;  4YYI A;  1WE9 A;  2YEK A;  2F6N A;  5BT5 A;  5L99 A;  4YH4 A;  4MR4 A;  5D3R A;  5ACY A;  5CUB A;  5FBX A;  5KTW A;  5ENI A;  5EWC A;  4ALG A;  4TZ8 A;  5DYC A;  5DYA A;  5G4R A;  1WIM A;  4V3L C;  4MEN A;  3L11 A;  2VPD A;  4I7B A;  3L1Z B;  1X0J A;  4IR6 A;  5ETD A;  4UYD A;  4ALH A;  1WGM A;  2HDP A;  5EQ1 A;  4MEQ A;  5CQ7 A;  4PS5 A;  2E3K A;  2VPG A;  4UIY A;  2D9E A;  5F1H A;  5L8U A;  2DVS A;  1WUG A;  4WHW A;  5KTU A;  1WIL A;  2KE1 A;  2LQ6 A;  4GND A;  4MEP A;  5EWD A;  5CRZ A;  4P5O B;  2KYU A;  5E9Y A;  4CUP A;  4O70 A;  2GRC A;  4NYX A;  2KWN A;  4HBY A;  3ZYQ A;  1FBV A;  3GL6 A;  5K29 A;  4I7D A;  4UYH A;  4MR5 A;  3DQV R;  4R2Y A;  1U6G B;  2K16 A;  5EVA A;  2VJE B;  4YAT A;  1K2F A;  1VD4 A;  4LAD B;  1X4I A;  3MB3 A;  2JMD A;  4NYV A;  5D3L A;  4MVT A;  5FE5 A;  2EOD A;  5LJ0 A;  2KWK A;  4QSP A;  1LDK C;  5ENH A;  4I7C A;  4MR6 A;  5B8D A;  4YAX A;  5TRB A;  4LC2 A;  1WEE A;  4Q6F A;  4TT6 A;  3UVX A;  4CLB A;  2MA6 A;  4NXJ A;  4WHU A;  3LQI A;  4LRG A;  2YSJ A;  5FG5 A;  4TU4 A;  5CQT A;  4AYC B;  4O71 A;  5CRM A;  2YW8 A;  4UYF A;  2KGI A;  2LDR A;  3MQM A;  4QSW A;  2BAY A;  5C13 A;  5HQ7 A;  3GG3 A;  2RI7 A;  4O7A A;  4YYD A;  2QIC A;  3O70 A;  5ENC A;  4PY6 A;  3RPG C;  5DLZ A;  2FUI A;  4YYM A;  4HBX A;  5AME A;  5FDZ A;  4PKL A;  5H85 A;  5D24 A;  5LKZ A;  5HEL A;  3T6R A;  5FE1 A;  5D1M B;  5FE4 A;  2LSP B;  4FK5 A;  5IBN A;  4WZ3 B;  2KIZ A;  2G6Q A;  1F62 A;  3N9Q A;  4NN2 A;  3AQA A;  2HYE D;  3KV6 A;  5JG6 A;  4TTE A;  3P1E A;  3UV5 A;  2YU4 A;  3O37 A;  4NRC A;  4CA1 A;  5D7X A;  5CUD A;  4HXM A;  3PHD A;  5CS8 A;  5FE8 A;  2M3H A;  4NS5 A;  5EU1 A;  4O77 A;  4QSX A;  4AUQ B;  5L97 A;  4NQN A;  1WUM A;  5FFY A;  4GNE A;  4UYE A;  5DKA A;  4GB0 A;  3SVH A;  4QY4 A;  5DKC A;  3ONI A;  4TT2 A;  4O7F A;  5CQ3 A;  5EM3 A;  5A83 A;  3IU6 A;  1VFY A;  5TDW A;  2YQL A;  2CSZ A;  3O34 A;  3SOX A;  5DBM A;  5HRV A;  5L98 A;  4LZ2 A;  3EB5 A;  1WES A;  5EPR A;  5DY7 A;  4WA6 A;  2M6M A;  5L8T A;  4CUS A;  2R0S A;  3DWY A;  5AIU A;  5FE2 A;  5KH3 A;  4QYD A;  5JI8 A;  2Y43 A;  4TKP B;  1LDJ B;  4QYL A;  2G45 A;  5E74 A;  2VJF B;  2DKW A;  5HRW A;  3HCS A;  3HMH A;  3P1D A;  5DX4 A;  3M62 A;  2IDA A;  4BBQ A;  3D7C A;  3LJW A;  2ECI A;  4UIX A;  2YDW A;  3JVM A;  4CUT A;  3RTR B;  4QEV A;  5I86 A;  3P5O A;  5A85 A;  3HCT A;  4HBW A;  2KRE A;  5D1L B;  4A4B A;  2AN6 A;  5CQ6 A;  1JM7 A;  2M85 A;  1WEM A;  1WEP A;  2WP2 A;  5F25 A;  4LYW A;  3M99 A;  4UIV A;  4YYG A;  3JVL A;  4QSR A;  4N3W A;  2I7K A;  5A5R A;  4NQM A;  4ZDT A;  5ENF A;  5AD2 A;  3KQI A;  1Z60 A;  5F62 A;  5CFW A;  3P1C A;  2E6R A;  2LXP C;  5D26 A;  4QF2 A;  5H1U A;  4NR5 A;  3N9M A;  5HCL A;  5FE9 A;  4C67 A;  2MT5 A;  3FKM X;  2D8S A;  4O76 A;  4A9O A;  5CQ4 A;  5L96 A;  5C87 A;  5HQ6 A;  3LQH A;  2YEL A;  2KWO A;  5F5Z A;  5CTL A;  3DPL R;  1FP0 A;  3MXF A;  5CP5 A;  2H60 A;  2UZG A;  3L1X A;  2YQD A;  4YY6 A;  3U5K A;  4QNS A;  5C85 A;  5IG6 A;  3VK6 A;  5ENB A;  5A81 A;  3MUL A;  5EPB A;  4GPJ A;  5KH9 A;  3NG2 A;  4YYN A;  5J3X A;  5I83 A;  3S92 A;  5TAB A;  5A5P A;  3ZVY A;  5HEN A;  4HXK A;  4LYI A;  5D3J A;  4QR5 A;  4BW4 A;  4A9K A;  5C7N A;  5I1Q A;  5KU3 A;  2ECV A;  4ZW1 A;  5LCW B;  4Q0N A;  2MNZ A;  5CPE A;  4Z6H A;  4XY8 A;  2ECJ A;  5DW2 A;  4N4F A;  1WFK A;  5CUA A;  5CGP A;  4Q0O A;  4QEW A;  4BHW A;  2K1J A;  5LKU A;  3KV5 A;  3LXJ A;  3S91 A;  5D3S A;  1MM2 A;  1Z2Q A;  4UP0 A;  4OGJ A;  2E6S A;  5E3G A;  1MM3 A;  5HJC A;  3MB4 A;  2F6J A;  4HXO A;  3T7L A;  4IOQ A;  5AMF A;  4QB3 A;  4TT4 A;  2DVV A;  3ZVZ B;  5LVQ A;  2FUU A;  4O74 A;  3MHH A;  2ECG A;  5D3P A;  4A9F A;  4ZC9 A;  5FE7 A;  4PCI A;  4GNG A;  3I2D A;  4MR3 A;  1F68 A;  3SHB A;  4O75 A;  2LGG A;  4NUE A;  2LN0 A;  5C89 A;  2LV9 A;  5AIT A;  5E9I A;  4Z6I A;  5ENE A;  3O7A A;  2MUM A;  4IR3 A;  2VP7 A;  1Z6U A;  4Z93 A;  5I3L A;  3SVG A;  2KGG A;  5ETB A;  2LGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...