3O34A

Crystal structure of trim24 phd-bromo complexed with h3(13-32)k23ac peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
177
Chain Sequence
EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 50
structure length 177
sequence length 181
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o34A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o34A01
4BW4A 5FH7A 2EGPA 4A9KA 3P5OA 5DFDA 3P1DA 4Z6IA 2UZGA 2OSSA 5CQ6A 5TRBA 4CURA 5B79A 4HXPA 5KTUA 4HXLA 2DVRA 2R0YA 4UIXA 2KYUA 5COIA 3P1FA 5E73A 4FLPA 3MHHA 5DYAA 3DPLR 2R0SA 3GL6A 4QF3A 5DKAA 3ZNIA 2I8NA 5A5SA 3ZPV1 5FE7A 5HRXA 5DLZA 5CRMA 3M99A 5E9MA 1DVPA 4TZ2A 4UYDA 5LCWB 5IGKA 4XUBA 5DBMA 5CQTA 2R10A 5CQ5A 5F1HA 3HMFA 4UITA 4KCXA 2YQDA 4LKAA 3N9LA 2HDPA 4NQMA 5I89A 4XI1A 3DAIA 3FL2A 3M63A 3Q2EA 4QEWA 2FSAA 5C4QA 4Z1QA 1WUMA 5E9VA 2LGLA 4YYGA 3Q2FA 4IORA 5F25A 2L5UA 3O35A 1FP0A 4PS5A 2DATA 2YT5A 2KWOA 1WEMA 2YURA 3KQIA 4MVTA 5F3AA 4WIVA 1Z6UA 3LJWA 2F6JA 5IBNA 5HQ7A 3I3JA 3RCWA 5CQAA 4LADB 4F3IA 3UVXA 5E9IA 2CT2A 3JVKA 5D7XA 5CTLA 4UYGA 4QR4A 4YYIA 2RSDA 5EPRA 4LC2A 2AN6A 5E3DA 4HBWA 2G6QA 4O64A 5G4RA 1JOCA 5AD3A 4O75A 5CPEA 4Q6FA 5EISA 4TT6A 4NYWA 5FH6A 1LDJB 2F42A 3SOXA 3HCUA 5ENFA 4HXRA 5CUDA 3T6RA 5HENA 3PHDA 5EWVA 3U5LA 4QYDA 4QB3A 4WHWA 3O7AA 5D1KB 5C8GA 5FE4A 2EA6A 4NUEA 1Z60A 4UIUA 5H9MA 4MR6A 2Y1MA 4YBTA 3LQIA 4YBSA 1N87A 3KV5A 5TBNA 2LRIC 2H0DA 5A7CA 1WEPA 3G0LA 3UVWA 2LN0A 3U5MA 2KWNA 3DQVR 3C5KA 4IR6A 5KH9A 2DVVA 4PCEA 4Q0NA 5HFRA 4BHWA 2D82A 2K17A 2LDRA 2L5EA 4NR6A 4O7BA 1CHCA 4QSVA 1T1HA 5H85A 3U5KA 1IYMA 2JMJA 2M3HA 2BAYA 5F61A 3U5PA 2MA5A 2LXHC 5CUCA 4NUDA 4QSPA 5KTWA 2KREA 4LYIA 4YATA 2GRCA 5HEMA 4YYHA 2YQLA 1X4IA 2C2VS 4A9NA 5I1QA 5ENEA 2G4AA 5FG4A 2E6SA 4YABA 5G05B 4QSWA 5D3TA 4WZ2A 4UYFA 5TB6A 3RTRB 3L1ZB 2LXPC 5LVRA 4NR4A 2KE1A 2L43A 5FEYA 5F62A 5EV9A 3MQMA 5CY9A 5FFWA 2K16A 5F63A 5L8TA 3GV4A 4LLBA 2XB1A 2LSPB 3O37A 3K2JA 4YYMA 4MR4A 2KGGA 3MUKA 1JM4B 5E0RA 4GNDA 5A5QA 5G4SA 4YYDA 2RNWA 2MUMA 5KU3A 4TU4A 2VPDA 4QEUA 3RPGB 5FFYA 3AQAA 2YHOA 1JM7A 4A9JA 4YH3A 3SOUA 5D3NA 4QC1A 4LJNA 3U5NA 5JWMA 4TU6A 4NRCA 3U5OA 4LDFA 4GNGA 4E96A 4YH4A 3L1XA 2F6NA 4HXOA 5II2A 4OGJA 4BW3A 3I2DA 2VJFA 2MJVB 2NAAA 5B75A 4YAXA 5TCMA 5D1MB 5TDRA 3ZTGA 4IR5A 4AYCB 5II1A 4CUTA 4CUUA 4NUCA 3L11A 5A83A 5F5ZA 5LJ2A 5EICA 4ALGA 5LVQA 4C66A 2ECWA 2YELA 4O76A 5AMFA 1XWHA 2YHNA 3S92A 5J0DA 4I7DA 4NYXA 5FE6A 4YC9A 3N9QA 5FE3A 4YYJA 4O70A 4QSUA 3N9NA 4YYKA 4UYEA 4C9ZA 2NXBA 3UVDA 5FE5A 5LKZA 5F2PA 3HCSA 2KU3A 5EI4A 2DVSA 2CSYA 4LRGA 5AITA 2WP1A 5EVAA 3NXBA 4PCIA 4BBQA 3UV2A 3PURA 4A9EA 4I7BA 5D26A 2VJEA 4O71A 2VPGA 5F1LA 3LXJA 4UI9B 4QUUA 1N72A 5BT5A 4XYAA 4NS5A 2QIZA 4WHUA 2MIQA 5D25A 5HCLA 5IIDA 1MM2A 2OXQC 4QR3A 5L96A 5DW1A 5LUUA 5CQ3A 4NR8A 2YREA 4DONA 1LDKC 4GB0A 4TT2A 5DYCA 4A9IA 3IU5A 3O33A 5KHMA 2VPBA 4CA1A 5JG6A 3C6WA 1HYIA 5KH3A 5ENCA 3V43A 3SVHA 4L7XA 2MNZA 4YADA 1WEUA 5A81A 4J0RA 4O7EA 4QY4A 5DLXA 5L8UA 4MEPA 5CUGA 3UV5A 5D3RA 5DW2A 4Z93A 5LKTA 2E7NA 2YQMA 5A5OA 4AKNA 5I40A 3DWYA 3UV4A 2JRJA 5J3XA 5ETBA 2RS9B 5AMEA 5D0CA 5ENHA 5HFQA 5HQ6A 3T7LA 5FH8A 2DKWA 5KH7A 2ECVA 5G04B 4N4FA 5A85A 5E9LA 4OUFA 4QF2A 2L75A 4TT4A 5L98A 5B77A 3U5JA 4UYHA 4CUSA 2KFTA 2LGGA 5FB0A 4A9FA 5ENJA 5CQ4A 2RO1A 2YYNA 4IR4A 4BJXA 4UP5A 1WFKA 5TDWA 1FBVA 2I50A 4HBYA 2KWKA 3O70A 1E4UA 2YUCA 4A49A 4FK5A 3ZPVE 3UVYA 3MHSA 2KR4A 5BT3A 3D7CA 4Z1SA 5FE1A 4TTEA 1VD4A 5CP5A 4GNEA 5KO4A 3ASLA 2G45A 3HMEA 1WIMA 2IDAA 4O77A 2L80A 4R2YA 5EM3A 1K2FA 1WILA 5H1VA 2ZETC 4NRBA 4TS8A 5FDZA 5CGPA 5C7NA 2YEMA 4A9OA 4L58A 4QZSA 2KIZA 2L85A 1EQFA 3P1CA 5CS8A 5FG5A 4YYNA 3QZVA 2OUOA 4LZSA 1WGMA 4I7CA 5C89A 2MD8C 4QR5A 1G25A 2YW5A 4MEQA 4ALHA 5FE9A 4A9LA 4BW1A 5ACYA 3PUQA 5HRVA 4B86C 4WZ0A 5EWWA 4B7YC 3ONIA 5HQ5A 2ECTA 2DVQA 1E6IA 4OGIA 5I80A 1VYXA 5ENIA 3ZVZB 2MD7B 5EPSA 4NR9A 2DX8A 4FO9A 1U6GB 5FERA 4ZQLA 3IU6A 5D3SA 2D9EA 5HM0A 5IG6A 4NR5A 3HTKC 2KTBB 4UIZA 1ZS5A 5FE2A 5AD2A 2LV9A 3AADA 5I88A 4IR3A 4J1PA 4WZ3B 4X2IA 1X4UA 4XUAA 2CKLB 4UIWA 2MA6A 3LQJA 3MULA 3O34A 4IC3A 3KV6A 5DX4A 4O78A 5F60A 4MENA 5JI8A 3VK6A 5C13A 4IOOA 4BW2A 5EPBA 2OO1A 4AP4A 4QUTA 2LGKA 2XEUA 4J3IA 2G43A 4N4GA 5DFBA 5BT4A 2L84A 2ECJA 5DINA 4O7FA 3EB5A 5D24A 5HJCA 4FJCA 2PUYA 5DKCA 2M6MA 4UP0A 4LYSA 5EP7A 5FE0A 5A5RA 5CUBA 4CLBA 4XY8A 4O7CA 5D3PA 5A5PA 4W4UA 5FBXA 5H1TA 4QEVA 5CFWA 1F68A 4R8PK 4MR3A 2WP2A 3N9PA 2H60A 3JVJA 3QZSA 5EWDA 3LQHA 4NR7A 5E3GA 4Y03A 5FB1A 5FFVA 4A4CA 2K1JA 4AVXA 4NXJA 4UYFB 2HYED 3EB6A 2E3KA 2YEKA 4A9MA 4YY4A 2KGIA 3MXFA 3ZYQA 4NYVA 4CUPA 5DYUA 2LGVA 4TZ8A 5I7XA 3NG2A 4MR5A 5A5NA 2MNYA 4PPEA 5DY7A 4N4IA 5CRZA 2RNXA 3O36A 1RMDA 1WE9A 2VNFA 2RI7A 1WEOA 2K4DA 4ZDTA 2YU4A 1WUGA 5C11A 5CUEA 4Z6HA 3G0JA 3LRQA 5ETDA 2YYRA 4LK9A 1X4JA 2JMDA 5AIUA 4IOQA 2QICA 3ZVYA 4C67A 5I86A 4HXNA 4KV1A 5D3LA 3N9MA 1JM7B 5FE8A 3M62A 5CQ7A 4TYLA 5E74A 4TQNA 4HXKA 2FUIA 5CU8A 2FUUA 5L97A 5D3HA 1V87A 4QYLA 5CQ8A 4AUQB 4YY6A 1HYJA 2MT5A 4J0SA 5G0FA 2JMIA 1Z2QA 3JVMA 4MEOA 4YK0A 4V3KC 2VJFB 1ZBDB 3SVFA 3FKMX 3SOWA 5D3JA 1X0JA 2YDWA 2Y1NA 5CUAA 5L99A 5ENBA 4GPJA 5B78A 3GG3A 5K29A 3KNVA 4NRAA 5IGMA 4ZW1A 4CUQA 4HBXA 4IC2A 4QSTA 2PNXA 5HLSA 4UIYA 5EWCA 4O72A 5EA1A 1WEQA 2ECIA 5DYXA 5HELA 4O7AA 4S3OC 5EWHA 3SVGA 5IGNA 4YBMA 2EODA 2VPEA 2RFJA 5I83A 4QSSA 4X3GA 2YW8A 4N4HA 1WEVA 2ECNA 2CKLA 4A4BA 4LZ2A 4AYCA 3HCTA 2E7OA 4S3OB 2VJEB 5DKHA 5E9YA 4PTBA 4UIVA 5ENGA 1WEEA 4NN2A 4V3LC 2M1RA 5D1LB 3ZYUA 5E7DA 5FG6A 3QZTA 5DFCA 5C87A 5KTXA 1JSPB 2ECGA 3MB3A 2QJ0A 4O74A 5EYAF 5E9KA 2RNYA 5C85A 5EU1A 1BORA 4CCGX 5TABA 2N9GA 3TLPA 4QC3A 3SHBA 3MB4A 5IGLA 4QSRA 2L0BA 4HXSA 2R0VA 1MM3A 4MSXA 2C2LA 4HXMA 3UW9A 4CFLA 2VP7A 4A0CD 3S91A 3IHPA 4CL9A 4FIPA 2KWJA 4PY6A 5CZGA 1VFYA 2I7KA 5H1UA 2E6RA 3N9OA 1F62A 5EQ1A 4RVRA 2M85A 2YSMA 4QNSA 4QSQA 2D8SA 4N3WA 2Y43A 4HBVA 4TKPB 5EK9A 5EGUA 4PKLA 3JVLA 1WENA 4NQNA 4R7EA 5HRWA 4QSXA 5A82A 5B8DA 3HMHA 3RPGC 4A9HA 5B76A 5I3LA 3P1EA 4GNFA 4LYWA 4Q0OA 5I29A 5LKXA 5DKDA 2YSJA 4CFKA 2LQ6A 5F36A 5LJ0A 2CSZA 2H0DB 4WA6A 5I7YA 2DWWA 4XY9A 4ZC9A 4KV4A 4LZRA 5LKUA 4F52B 4ZUXU 1WESA 1WEWA 4QBMA 4P5OB 4LR6A 5LJ1A
chains in the Genus database with same CATH superfamily
4BW4A 5FH7A 2EGPA 4A9KA 3P5OA 5DFDA 3P1DA 4Z6IA 2UZGA 2OSSA 5CQ6A 5TRBA 4CURA 5B79A 4HXPA 5KTUA 4HXLA 2DVRA 2R0YA 4UIXA 2KYUA 5COIA 3P1FA 5E73A 4FLPA 3MHHA 5DYAA 3DPLR 2R0SA 3GL6A 4QF3A 5DKAA 3ZNIA 2I8NA 5A5SA 3ZPV1 5FE7A 5HRXA 5DLZA 5CRMA 3M99A 5E9MA 1DVPA 4TZ2A 4UYDA 5LCWB 5IGKA 4XUBA 5DBMA 5CQTA 2R10A 5CQ5A 5F1HA 3HMFA 4UITA 4KCXA 2YQDA 4LKAA 3N9LA 2HDPA 4NQMA 2RR4A 5I89A 4XI1A 3LJUX 3DAIA 3FL2A 3M63A 3Q2EA 4QEWA 2FSAA 5C4QA 4Z1QA 1WUMA 5E9VA 2LGLA 4YYGA 3Q2FA 4IORA 5F25A 2L5UA 3O35A 1FP0A 4PS5A 2DATA 2YT5A 2KWOA 1WEMA 2YURA 3KQIA 4MVTA 5F3AA 4WIVA 1Z6UA 3LJWA 4AKGA 2F6JA 5IBNA 1PUOA 5HQ7A 3I3JA 3RCWA 5CQAA 4LADB 4F3IA 3UVXA 5E9IA 2CT2A 3JVKA 5D7XA 5SVIB 5CTLA 4UYGA 4QR4A 4YYIA 2RSDA 5EPRA 4LC2A 2AN6A 5E3DA 4HBWA 2G6QA 4O64A 5G4RA 1JOCA 5AD3A 4O75A 5CPEA 4Q6FA 5EISA 1G25A 4TT6A 4NYWA 5FH6A 1LDJB 2F42A 3SOXA 5SVXA 3HCUA 5ENFA 4HXRA 5CUDA 3T6RA 5HENA 3PHDA 5EWVA 3U5LA 4QYDA 4QB3A 4WHWA 3O7AA 5D1KB 5C8GA 5FE4A 2EA6A 4NUEA 1Z60A 4UIUA 5H9MA 4MR6A 2Y1MA 4YBTA 3LQIA 3FM8C 4YBSA 1N87A 3KV5A 5TBNA 2LRIC 2H0DA 5A7CA 1WEPA 3FJUB 1MBMA 3G0LA 3UVWA 2LN0A 3U5MA 2KWNA 3DQVR 3C5KA 4IR6A 5KH9A 2DVVA 4PCEA 4Q0NA 5HFRA 4BHWA 2D82A 2K17A 2LDRA 2P57A 2L5EA 2KKXA 4NR6A 3LVQE 4O7BA 1CHCA 4QSVA 1T1HA 5H85A 2DSMA 3U5KA 1IYMA 2JMJA 2M3HA 2BAYA 5F61A 3U5PA 2MA5A 2LXHC 5CUCA 4NUDA 4QSPA 5KTWA 2KREA 4LYIA 4YATA 2GRCA 5HEMA 4YYHA 2YQLA 1X4IA 2C2VS 4A9NA 5I1QA 5ENEA 2G4AA 1ZKRA 5FG4A 2E6SA 4YABA 5G05B 4QSWA 5D3TA 4WZ2A 4UYFA 5TB6A 3RTRB 3L1ZB 2LXPC 5LVRA 4NR4A 2KE1A 2L43A 5FEYA 5F62A 5EV9A 3MQMA 5CY9A 5FFWA 2K16A 5F63A 5L8TA 3GV4A 4LLBA 2XB1A 2LSPB 3O37A 2KKYA 3K2JA 4YYMA 4MR4A 2KGGA 3MUKA 1JM4B 5E0RA 4GNDA 5A5QA 5G4SA 4YYDA 2JUNA 2RNWA 2MUMA 5KU3A 4TU4A 2VPDA 4QEUA 3RPGB 5FFYA 3O47A 3AQAA 2YHOA 1JM7A 4A9JA 4YH3A 3SOUA 5D3NA 4QC1A 4LJNA 3U5NA 5JWMA 2FD4A 4TU6A 4NRCA 3U5OA 4LDFA 4GNGA 4E96A 4YH4A 3L1XA 5K3QA 2B0OE 5SVIA 2F6NA 4HXOA 5II2A 4OGJA 4BW3A 3I2DA 2VJFA 2MJVB 2NAAA 5B75A 4YAXA 5TCMA 5D1MB 5TDRA 3ZTGA 4IR5A 4AYCB 5II1A 4CUTA 4CUUA 4NUCA 3L11A 5A83A 5F5ZA 5LJ2A 5EICA 4ALGA 5LVQA 4C66A 2ECWA 2YELA 4O76A 5AMFA 1XWHA 2YHNA 3S92A 5J0DA 4I7DA 4NYXA 5FE6A 4YC9A 3N9QA 5FE3A 4YYJA 4O70A 4QSUA 3N9NA 4YYKA 4UYEA 4C9ZA 2NXBA 3UVDA 5FE5A 5LKZA 2M13A 5F2PA 3MDBC 3HCSA 2KU3A 5EI4A 2DVSA 2CSYA 4LRGA 5AITA 2WP1A 5EVAA 3NXBA 4PCIA 4BBQA 3UV2A 3PURA 4A9EA 2E61A 4I7BA 5D26A 2VJEA 4O71A 2VPGA 5F1LA 3LXJA 4UI9B 4QUUA 1N72A 5BT5A 4XYAA 4NS5A 2QIZA 4WHUA 2MIQA 2D8UA 5D25A 5HCLA 5IIDA 1MM2A 2OXQC 4QR3A 2XP0A 5L96A 5DW1A 5LUUA 4Z0OA 5CQ3A 4NR8A 2YREA 4DONA 1LDKC 4GB0A 2JM3A 4TT2A 5DYCA 4A9IA 3IU5A 3O33A 5KHMA 3LVRE 2VPBA 4CA1A 5JG6A 3C6WA 1HYIA 5KH3A 5ENCA 3V43A 3JUEA 3SVHA 4AI6A 2CRWA 4L7XA 2MNZA 4YADA 2CONA 1WEUA 5A81A 4J0RA 4O7EA 4QY4A 5DLXA 5L8UA 4MEPA 5CUGA 3UV5A 5D3RA 5DW2A 4Z93A 5LKTA 3VKHA 2E7NA 2LAUA 2YQMA 5A5OA 4AKNA 5I40A 3DWYA 3UV4A 2JRJA 5J3XA 5ETBA 2RS9B 5AMEA 5D0CA 5ENHA 5HFQA 5HQ6A 3T7LA 5FH8A 2DKWA 5KH7A 2ECVA 5G04B 4N4FA 5A85A 5E9LA 4OUFA 2IQJA 4QF2A 2L75A 4TT4A 5L98A 5B77A 3U5JA 4UYHA 4CUSA 4OGCA 2KFTA 2LGGA 5FB0A 4A9FA 5ENJA 5CQ4A 2RO1A 2YYNA 4IR4A 4BJXA 4UP5A 1WFKA 5TDWA 1FBVA 2I50A 4HBYA 2KWKA 3O70A 1E4UA 2YUCA 4A49A 4FK5A 3ZPVE 3UVYA 3MHSA 2KR4A 5BT3A 3D7CA 4Z1SA 5FE1A 4TTEA 1VD4A 5CP5A 4GNEA 5KO4A 3ASLA 2G45A 3HMEA 1WIMA 2IDAA 4O77A 2L80A 4R2YA 5EM3A 1K2FA 1WILA 5H1VA 2ZETC 4NRBA 4TS8A 5FDZA 5CGPA 5C7NA 2YEMA 4A9OA 4L58A 4QZSA 2KIZA 2L85A 1EQFA 3DDTA 3P1CA 5CS8A 5FG5A 4YYNA 4F1PA 3VKGA 3QZVA 2OUOA 4LZSA 1WGMA 4I7CA 5C89A 2CSVA 4QR5A 2MD8C 2YW5A 4MEQA 4ALHA 5FE9A 4A9LA 4BW1A 5ACYA 3PUQA 5HRVA 4B86C 4WZ0A 5EWWA 4B7YC 3ONIA 5HQ5A 2ECTA 2DVQA 1E6IA 4OGIA 5I80A 1VYXA 5ENIA 3ZVZB 2MD7B 5EPSA 4NR9A 2DX8A 3M7KA 4FO9A 1U6GB 5FERA 4ZQLA 3IU6A 5D3SA 2D9EA 5HM0A 5IG6A 4NR5A 3HTKC 2KTBB 4UIZA 1ZS5A 5FE2A 5AD2A 2LV9A 3Q1DA 3AADA 5I88A 4IR3A 4OGEA 4J1PA 4WZ3B 4X2IA 1X4UA 4XUAA 2CKLB 4UIWA 2L7PA 2MA6A 3LQJA 3FEHA 3MULA 3O34A 4IC3A 3KV6A 5DX4A 4O78A 5F60A 4MENA 5JI8A 3VK6A 3ERRA 3PLWA 5C13A 4IOOA 4BW2A 5EPBA 2OO1A 4AP4A 4QUTA 2LGKA 2XEUA 3T9KA 4J3IA 2G43A 4N4GA 5DFBA 5BT4A 2L84A 2ECJA 5DINA 4O7FA 3EB5A 5D24A 5HJCA 4FJCA 2PUYA 5DKCA 3DWDA 2M6MA 4UP0A 4LYSA 5EP7A 5FE0A 5A5RA 5CUBA 4CLBA 4XY8A 4O7CA 5D3PA 5A5PA 2XOCA 4W4UA 5FBXA 5H1TA 4QEVA 5CFWA 1F68A 4R8PK 4MR3A 2WP2A 3N9PA 2H60A 3JVJA 3QZSA 5EWDA 3LQHA 4NR7A 5E3GA 4Y03A 5FB1A 5FFVA 4A4CA 2K1JA 4AVXA 4NXJA 4UYFB 2HYED 3EB6A 2E3KA 2YEKA 4A9MA 4YY4A 2XOZA 2KGIA 3MXFA 3ZYQA 4AKIA 4NYVA 4CUPA 5DYUA 2LGVA 4TZ8A 5I7XA 3NG2A 4MR5A 5A5NA 2MNYA 4PPEA 5DY7A 4N4IA 5CRZA 2RNXA 3O36A 1RMDA 1WE9A 2VNFA 2RI7A 1WEOA 2K4DA 4ZDTA 2YU4A 1WUGA 5C11A 5CUEA 4Z6HA 3FANA 3D1DA 3G0JA 3LRQA 3LDYA 5ETDA 2YYRA 4LK9A 1X4JA 2JMDA 5AIUA 4IOQA 2EGMA 2QICA 3ZVYA 4C67A 5I86A 4HXNA 4KV1A 5D3LA 3N9MA 1JM7B 5FE8A 3M62A 5CQ7A 4TYLA 5E74A 4TQNA 2MKEA 4HXKA 2FUIA 2YVRA 5CU8A 2FUUA 5L97A 5D3HA 1V87A 4QYLA 5CQ8A 4AUQB 4YY6A 2XOYA 2MT5A 1HYJA 4J0SA 5G0FA 2JMIA 1Z2QA 3JVMA 4MEOA 2EXUA 4YK0A 4V3KC 2VJFB 1ZBDB 3SVFA 3FKMX 3SOWA 5D3JA 1X0JA 2YDWA 2Y1NA 4Z0RA 3D1BA 5CUAA 5L99A 5ENBA 4GPJA 5B78A 3GG3A 5K29A 3KNVA 4NRAA 5IGMA 3FAOA 4ZW1A 4CUQA 2OWAA 4HBXA 4IC2A 4QSTA 2PNXA 3KDEC 5HLSA 4UIYA 5EWCA 4O72A 5EA1A 1WEQA 2ECIA 5DYXA 5HELA 4O7AA 4S3OC 5EWHA 3SVGA 5IGNA 4YBMA 2EODA 2VPEA 2RFJA 1DCQA 5I83A 4QSSA 4X3GA 2FFWA 2YW8A 4N4HA 1WEVA 3E2DA 2ECNA 2CKLA 4A4BA 4LZ2A 4AYCA 2CRRA 3HCTA 2E7OA 4S3OB 2VJEB 5DKHA 5E9YA 4PTBA 4UIVA 5ENGA 1WEEA 4NN2A 4V3LC 2M1RA 5D1LB 3ZYUA 5E7DA 5FG6A 3QZTA 5DFCA 5C87A 5KTXA 1JSPB 2ECGA 3MB3A 2QJ0A 3H7HA 4O74A 5EYAF 5E9KA 2RNYA 5C85A 5EU1A 1BORA 4CCGX 5TABA 2N9GA 3TLPA 4QC3A 3SHBA 3MB4A 5IGLA 4QSRA 2L0BA 4HXSA 2R0VA 1MM3A 4H9DA 4MSXA 2C2LA 4HXMA 3UW9A 4CFLA 2VP7A 4QQ4A 4A0CD 3S91A 3IHPA 4CL9A 4FIPA 2KWJA 4PY6A 5CZGA 1VFYA 2I7KA 5H1UA 2E6RA 2DJAA 3N9OA 1F62A 5EQ1A 4RVRA 2M85A 2YSMA 4QNSA 4QSQA 2D8SA 4N3WA 2Y43A 4HBVA 4TKPB 5EK9A 5EGUA 5SVYA 4PKLA 3JVLA 1WENA 4NQNA 4R7EA 5HRWA 4QSXA 5A82A 5B8DA 3HMHA 3RPGC 4A9HA 5B76A 5I3LA 3P1EA 4GNFA 4LYWA 4Q0OA 5I29A 5LKXA 5DKDA 4O62A 2YSJA 4CFKA 2LQ6A 5F36A 5LJ0A 2CSZA 2EJNA 2H0DB 4WA6A 5I7YA 2DWWA 4XY9A 4ZC9A 4KV4A 4LZRA 5LKUA 4F52B 4ZUXU 1WESA 1WEWA 4QBMA 4P5OB 4AKHA 4LR6A 3SUBA 5LJ1A
chains in the Genus database with same CATH topology
4BW4A 5FH7A 2EGPA 4A9KA 3P5OA 5DFDA 3P1DA 4Z6IA 2UZGA 2OSSA 5CQ6A 5TRBA 4CURA 5B79A 4HXPA 5KTUA 4HXLA 2DVRA 2R0YA 4UIXA 2KYUA 5COIA 3P1FA 5E73A 4FLPA 3MHHA 5DYAA 3DPLR 2R0SA 3GL6A 4QF3A 5DKAA 3ZNIA 2I8NA 5A5SA 3ZPV1 5FE7A 5HRXA 5DLZA 5CRMA 3M99A 5E9MA 1DVPA 4TZ2A 4UYDA 5LCWB 5IGKA 4XUBA 5DBMA 5CQTA 2R10A 5CQ5A 5F1HA 3HMFA 4UITA 4KCXA 2YQDA 4LKAA 3N9LA 2HDPA 4NQMA 5I89A 4XI1A 3DAIA 3FL2A 3M63A 3Q2EA 4QEWA 2FSAA 5C4QA 4Z1QA 1WUMA 5E9VA 2LGLA 4YYGA 3Q2FA 4IORA 5F25A 2L5UA 3O35A 1FP0A 4PS5A 2DATA 2YT5A 2KWOA 1WEMA 2YURA 3KQIA 4MVTA 5F3AA 4WIVA 1Z6UA 3LJWA 2F6JA 5IBNA 5HQ7A 3I3JA 3RCWA 5CQAA 4LADB 4F3IA 3UVXA 5E9IA 2CT2A 3JVKA 5D7XA 5CTLA 4UYGA 4QR4A 4YYIA 2RSDA 5EPRA 4LC2A 2AN6A 5E3DA 4HBWA 2G6QA 4O64A 5G4RA 1JOCA 5AD3A 4O75A 5CPEA 4Q6FA 5EISA 4TT6A 4NYWA 5FH6A 1LDJB 2F42A 3SOXA 3HCUA 5ENFA 4HXRA 5CUDA 3T6RA 5HENA 3PHDA 5EWVA 3U5LA 4QYDA 4QB3A 4WHWA 3O7AA 5D1KB 5C8GA 5FE4A 2EA6A 4NUEA 1Z60A 4UIUA 5H9MA 4MR6A 2Y1MA 4YBTA 3LQIA 4YBSA 1N87A 3KV5A 5TBNA 2LRIC 2H0DA 5A7CA 1WEPA 3G0LA 3UVWA 2LN0A 3U5MA 2KWNA 3DQVR 3C5KA 4IR6A 5KH9A 2DVVA 4PCEA 4Q0NA 5HFRA 4BHWA 2D82A 2K17A 2LDRA 2L5EA 4NR6A 4O7BA 1CHCA 4QSVA 1T1HA 5H85A 3U5KA 1IYMA 2JMJA 2M3HA 2BAYA 5F61A 3U5PA 2MA5A 2LXHC 5CUCA 4NUDA 4QSPA 5KTWA 2KREA 4LYIA 4YATA 2GRCA 5HEMA 4YYHA 2YQLA 1X4IA 2C2VS 4A9NA 5I1QA 5ENEA 2G4AA 5FG4A 2E6SA 4YABA 5G05B 4QSWA 5D3TA 4WZ2A 4UYFA 5TB6A 3RTRB 3L1ZB 2LXPC 5LVRA 4NR4A 2KE1A 2L43A 5FEYA 5F62A 5EV9A 3MQMA 5CY9A 5FFWA 2K16A 5F63A 5L8TA 3GV4A 4LLBA 2XB1A 2LSPB 3O37A 3K2JA 4YYMA 4MR4A 2KGGA 3MUKA 1JM4B 5E0RA 4GNDA 5A5QA 5G4SA 4YYDA 2RNWA 2MUMA 5KU3A 4TU4A 2VPDA 4QEUA 3RPGB 5FFYA 3AQAA 2YHOA 1JM7A 4A9JA 4YH3A 3SOUA 5D3NA 4QC1A 4LJNA 3U5NA 5JWMA 4TU6A 4NRCA 3U5OA 4LDFA 4GNGA 4E96A 4YH4A 3L1XA 2F6NA 4HXOA 5II2A 4OGJA 4BW3A 3I2DA 2VJFA 2MJVB 2NAAA 5B75A 4YAXA 5TCMA 5D1MB 5TDRA 3ZTGA 4IR5A 4AYCB 5II1A 4CUTA 4CUUA 4NUCA 3L11A 5A83A 5F5ZA 5LJ2A 5EICA 4ALGA 5LVQA 4C66A 2ECWA 2YELA 4O76A 5AMFA 1XWHA 2YHNA 3S92A 5J0DA 4I7DA 4NYXA 5FE6A 4YC9A 3N9QA 5FE3A 4YYJA 4O70A 4QSUA 3N9NA 4YYKA 4UYEA 4C9ZA 2NXBA 3UVDA 5FE5A 5LKZA 5F2PA 3HCSA 2KU3A 5EI4A 2DVSA 2CSYA 4LRGA 5AITA 2WP1A 5EVAA 3NXBA 4PCIA 4BBQA 3UV2A 3PURA 4A9EA 4I7BA 5D26A 2VJEA 4O71A 2VPGA 5F1LA 3LXJA 4UI9B 4QUUA 1N72A 5BT5A 4XYAA 4NS5A 2QIZA 4WHUA 2MIQA 5D25A 5HCLA 5IIDA 1MM2A 2OXQC 4QR3A 5L96A 5DW1A 5LUUA 5CQ3A 4NR8A 2YREA 4DONA 1LDKC 4GB0A 4TT2A 5DYCA 4A9IA 3IU5A 3O33A 5KHMA 2VPBA 4CA1A 5JG6A 3C6WA 1HYIA 5KH3A 5ENCA 3V43A 3SVHA 4L7XA 2MNZA 4YADA 1WEUA 5A81A 4J0RA 4O7EA 4QY4A 5DLXA 5L8UA 4MEPA 5CUGA 3UV5A 5D3RA 5DW2A 4Z93A 5LKTA 2E7NA 2YQMA 5A5OA 4AKNA 5I40A 3DWYA 3UV4A 2JRJA 5J3XA 5ETBA 2RS9B 5AMEA 5D0CA 5ENHA 5HFQA 5HQ6A 3T7LA 5FH8A 2DKWA 5KH7A 2ECVA 5G04B 4N4FA 5A85A 5E9LA 4OUFA 4QF2A 2L75A 4TT4A 5L98A 5B77A 3U5JA 4UYHA 4CUSA 2KFTA 2LGGA 5FB0A 4A9FA 5ENJA 5CQ4A 2RO1A 2YYNA 4IR4A 4BJXA 4UP5A 1WFKA 5TDWA 1FBVA 2I50A 4HBYA 2KWKA 3O70A 1E4UA 2YUCA 4A49A 4FK5A 3ZPVE 3UVYA 3MHSA 2KR4A 5BT3A 3D7CA 4Z1SA 5FE1A 4TTEA 1VD4A 5CP5A 4GNEA 5KO4A 3ASLA 2G45A 3HMEA 1WIMA 2IDAA 4O77A 2L80A 4R2YA 5EM3A 1K2FA 1WILA 5H1VA 2ZETC 4NRBA 4TS8A 5FDZA 5CGPA 5C7NA 2YEMA 4A9OA 4L58A 4QZSA 2KIZA 2L85A 1EQFA 3P1CA 5CS8A 5FG5A 4YYNA 3QZVA 2OUOA 4LZSA 1WGMA 4I7CA 5C89A 2MD8C 4QR5A 1G25A 2YW5A 4MEQA 4ALHA 5FE9A 4A9LA 4BW1A 5ACYA 3PUQA 5HRVA 4B86C 4WZ0A 5EWWA 4B7YC 3ONIA 5HQ5A 2ECTA 2DVQA 1E6IA 4OGIA 5I80A 1VYXA 5ENIA 3ZVZB 2MD7B 5EPSA 4NR9A 2DX8A 4FO9A 1U6GB 5FERA 4ZQLA 3IU6A 5D3SA 2D9EA 5HM0A 5IG6A 4NR5A 3HTKC 2KTBB 4UIZA 1ZS5A 5FE2A 5AD2A 2LV9A 3AADA 5I88A 4IR3A 4J1PA 4WZ3B 4X2IA 1X4UA 4XUAA 2CKLB 4UIWA 2MA6A 3LQJA 3MULA 3O34A 4IC3A 3KV6A 5DX4A 4O78A 5F60A 4MENA 5JI8A 3VK6A 5C13A 4IOOA 4BW2A 5EPBA 2OO1A 4AP4A 4QUTA 2LGKA 2XEUA 4J3IA 2G43A 4N4GA 5DFBA 5BT4A 2L84A 2ECJA 5DINA 4O7FA 3EB5A 5D24A 5HJCA 4FJCA 2PUYA 5DKCA 2M6MA 4UP0A 4LYSA 5EP7A 5FE0A 5A5RA 5CUBA 4CLBA 4XY8A 4O7CA 5D3PA 5A5PA 4W4UA 5FBXA 5H1TA 4QEVA 5CFWA 1F68A 4R8PK 4MR3A 2WP2A 3N9PA 2H60A 3JVJA 3QZSA 5EWDA 3LQHA 4NR7A 5E3GA 4Y03A 5FB1A 5FFVA 4A4CA 2K1JA 4AVXA 4NXJA 4UYFB 2HYED 3EB6A 2E3KA 2YEKA 4A9MA 4YY4A 2KGIA 3MXFA 3ZYQA 4NYVA 4CUPA 5DYUA 2LGVA 4TZ8A 5I7XA 3NG2A 4MR5A 5A5NA 2MNYA 4PPEA 5DY7A 4N4IA 5CRZA 2RNXA 3O36A 1RMDA 1WE9A 2VNFA 2RI7A 1WEOA 2K4DA 4ZDTA 2YU4A 1WUGA 5C11A 5CUEA 4Z6HA 3G0JA 3LRQA 5ETDA 2YYRA 4LK9A 1X4JA 2JMDA 5AIUA 4IOQA 2QICA 3ZVYA 4C67A 5I86A 4HXNA 4KV1A 5D3LA 3N9MA 1JM7B 5FE8A 3M62A 5CQ7A 4TYLA 5E74A 4TQNA 4HXKA 2FUIA 5CU8A 2FUUA 5L97A 5D3HA 1V87A 4QYLA 5CQ8A 4AUQB 4YY6A 1HYJA 2MT5A 4J0SA 5G0FA 2JMIA 1Z2QA 3JVMA 4MEOA 4YK0A 4V3KC 2VJFB 1ZBDB 3SVFA 3FKMX 3SOWA 5D3JA 1X0JA 2YDWA 2Y1NA 5CUAA 5L99A 5ENBA 4GPJA 5B78A 3GG3A 5K29A 3KNVA 4NRAA 5IGMA 4ZW1A 4CUQA 4HBXA 4IC2A 4QSTA 2PNXA 5HLSA 4UIYA 5EWCA 4O72A 5EA1A 1WEQA 2ECIA 5DYXA 5HELA 4O7AA 4S3OC 5EWHA 3SVGA 5IGNA 4YBMA 2EODA 2VPEA 2RFJA 5I83A 4QSSA 4X3GA 2YW8A 4N4HA 1WEVA 2ECNA 2CKLA 4A4BA 4LZ2A 4AYCA 3HCTA 2E7OA 4S3OB 2VJEB 5DKHA 5E9YA 4PTBA 4UIVA 5ENGA 1WEEA 4NN2A 4V3LC 2M1RA 5D1LB 3ZYUA 5E7DA 5FG6A 3QZTA 5DFCA 5C87A 5KTXA 1JSPB 2ECGA 3MB3A 2QJ0A 4O74A 5EYAF 5E9KA 2RNYA 5C85A 5EU1A 1BORA 4CCGX 5TABA 2N9GA 3TLPA 4QC3A 3SHBA 3MB4A 5IGLA 4QSRA 2L0BA 4HXSA 2R0VA 1MM3A 4MSXA 2C2LA 4HXMA 3UW9A 4CFLA 2VP7A 4A0CD 3S91A 3IHPA 4CL9A 4FIPA 2KWJA 4PY6A 5CZGA 1VFYA 2I7KA 5H1UA 2E6RA 3N9OA 1F62A 5EQ1A 4RVRA 2M85A 2YSMA 4QNSA 4QSQA 2D8SA 4N3WA 2Y43A 4HBVA 4TKPB 5EK9A 5EGUA 4PKLA 3JVLA 1WENA 4NQNA 4R7EA 5HRWA 4QSXA 5A82A 5B8DA 3HMHA 3RPGC 4A9HA 5B76A 5I3LA 3P1EA 4GNFA 4LYWA 4Q0OA 5I29A 5LKXA 5DKDA 2YSJA 4CFKA 2LQ6A 5F36A 5LJ0A 2CSZA 2H0DB 4WA6A 5I7YA 2DWWA 4XY9A 4ZC9A 4KV4A 4LZRA 5LKUA 4F52B 4ZUXU 1WESA 1WEWA 4QBMA 4P5OB 4LR6A 5LJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW4 A;  5FH7 A;  2EGP A;  4A9K A;  3P5O A;  5DFD A;  3P1D A;  4Z6I A;  2UZG A;  2OSS A;  5CQ6 A;  5TRB A;  4CUR A;  5B79 A;  4HXP A;  5KTU A;  4HXL A;  2DVR A;  2R0Y A;  4UIX A;  2KYU A;  5COI A;  3P1F A;  5E73 A;  4FLP A;  3MHH A;  5DYA A;  3DPL R;  2R0S A;  3GL6 A;  4QF3 A;  5DKA A;  3ZNI A;  2I8N A;  5A5S A;  3ZPV 1;  5FE7 A;  5HRX A;  5DLZ A;  5CRM A;  3M99 A;  5E9M A;  1DVP A;  4TZ2 A;  4UYD A;  5LCW B;  5IGK A;  4XUB A;  5DBM A;  5CQT A;  2R10 A;  5CQ5 A;  5F1H A;  3HMF A;  4UIT A;  4KCX A;  2YQD A;  4LKA A;  3N9L A;  2HDP A;  4NQM A;  5I89 A;  4XI1 A;  3DAI A;  3FL2 A;  3M63 A;  3Q2E A;  4QEW A;  2FSA A;  5C4Q A;  4Z1Q A;  1WUM A;  5E9V A;  2LGL A;  4YYG A;  3Q2F A;  4IOR A;  5F25 A;  2L5U A;  3O35 A;  1FP0 A;  4PS5 A;  2DAT A;  2YT5 A;  2KWO A;  1WEM A;  2YUR A;  3KQI A;  4MVT A;  5F3A A;  4WIV A;  1Z6U A;  3LJW A;  2F6J A;  5IBN A;  5HQ7 A;  3I3J A;  3RCW A;  5CQA A;  4LAD B;  4F3I A;  3UVX A;  5E9I A;  2CT2 A;  3JVK A;  5D7X A;  5CTL A;  4UYG A;  4QR4 A;  4YYI A;  2RSD A;  5EPR A;  4LC2 A;  2AN6 A;  5E3D A;  4HBW A;  2G6Q A;  4O64 A;  5G4R A;  1JOC A;  5AD3 A;  4O75 A;  5CPE A;  4Q6F A;  5EIS A;  4TT6 A;  4NYW A;  5FH6 A;  1LDJ B;  2F42 A;  3SOX A;  3HCU A;  5ENF A;  4HXR A;  5CUD A;  3T6R A;  5HEN A;  3PHD A;  5EWV A;  3U5L A;  4QYD A;  4QB3 A;  4WHW A;  3O7A A;  5D1K B;  5C8G A;  5FE4 A;  2EA6 A;  4NUE A;  1Z60 A;  4UIU A;  5H9M A;  4MR6 A;  2Y1M A;  4YBT A;  3LQI A;  4YBS A;  1N87 A;  3KV5 A;  5TBN A;  2LRI C;  2H0D A;  5A7C A;  1WEP A;  3G0L A;  3UVW A;  2LN0 A;  3U5M A;  2KWN A;  3DQV R;  3C5K A;  4IR6 A;  5KH9 A;  2DVV A;  4PCE A;  4Q0N A;  5HFR A;  4BHW A;  2D82 A;  2K17 A;  2LDR A;  2L5E A;  4NR6 A;  4O7B A;  1CHC A;  4QSV A;  1T1H A;  5H85 A;  3U5K A;  1IYM A;  2JMJ A;  2M3H A;  2BAY A;  5F61 A;  3U5P A;  2MA5 A;  2LXH C;  5CUC A;  4NUD A;  4QSP A;  5KTW A;  2KRE A;  4LYI A;  4YAT A;  2GRC A;  5HEM A;  4YYH A;  2YQL A;  1X4I A;  2C2V S;  4A9N A;  5I1Q A;  5ENE A;  2G4A A;  5FG4 A;  2E6S A;  4YAB A;  5G05 B;  4QSW A;  5D3T A;  4WZ2 A;  4UYF A;  5TB6 A;  3RTR B;  3L1Z B;  2LXP C;  5LVR A;  4NR4 A;  2KE1 A;  2L43 A;  5FEY A;  5F62 A;  5EV9 A;  3MQM A;  5CY9 A;  5FFW A;  2K16 A;  5F63 A;  5L8T A;  3GV4 A;  4LLB A;  2XB1 A;  2LSP B;  3O37 A;  3K2J A;  4YYM A;  4MR4 A;  2KGG A;  3MUK A;  1JM4 B;  5E0R A;  4GND A;  5A5Q A;  5G4S A;  4YYD A;  2RNW A;  2MUM A;  5KU3 A;  4TU4 A;  2VPD A;  4QEU A;  3RPG B;  5FFY A;  3AQA A;  2YHO A;  1JM7 A;  4A9J A;  4YH3 A;  3SOU A;  5D3N A;  4QC1 A;  4LJN A;  3U5N A;  5JWM A;  4TU6 A;  4NRC A;  3U5O A;  4LDF A;  4GNG A;  4E96 A;  4YH4 A;  3L1X A;  2F6N A;  4HXO A;  5II2 A;  4OGJ A;  4BW3 A;  3I2D A;  2VJF A;  2MJV B;  2NAA A;  5B75 A;  4YAX A;  5TCM A;  5D1M B;  5TDR A;  3ZTG A;  4IR5 A;  4AYC B;  5II1 A;  4CUT A;  4CUU A;  4NUC A;  3L11 A;  5A83 A;  5F5Z A;  5LJ2 A;  5EIC A;  4ALG A;  5LVQ A;  4C66 A;  2ECW A;  2YEL A;  4O76 A;  5AMF A;  1XWH A;  2YHN A;  3S92 A;  5J0D A;  4I7D A;  4NYX A;  5FE6 A;  4YC9 A;  3N9Q A;  5FE3 A;  4YYJ A;  4O70 A;  4QSU A;  3N9N A;  4YYK A;  4UYE A;  4C9Z A;  2NXB A;  3UVD A;  5FE5 A;  5LKZ A;  5F2P A;  3HCS A;  2KU3 A;  5EI4 A;  2DVS A;  2CSY A;  4LRG A;  5AIT A;  2WP1 A;  5EVA A;  3NXB A;  4PCI A;  4BBQ A;  3UV2 A;  3PUR A;  4A9E A;  4I7B A;  5D26 A;  2VJE A;  4O71 A;  2VPG A;  5F1L A;  3LXJ A;  4UI9 B;  4QUU A;  1N72 A;  5BT5 A;  4XYA A;  4NS5 A;  2QIZ A;  4WHU A;  2MIQ A;  5D25 A;  5HCL A;  5IID A;  1MM2 A;  2OXQ C;  4QR3 A;  5L96 A;  5DW1 A;  5LUU A;  5CQ3 A;  4NR8 A;  2YRE A;  4DON A;  1LDK C;  4GB0 A;  4TT2 A;  5DYC A;  4A9I A;  3IU5 A;  3O33 A;  5KHM A;  2VPB A;  4CA1 A;  5JG6 A;  3C6W A;  1HYI A;  5KH3 A;  5ENC A;  3V43 A;  3SVH A;  4L7X A;  2MNZ A;  4YAD A;  1WEU A;  5A81 A;  4J0R A;  4O7E A;  4QY4 A;  5DLX A;  5L8U A;  4MEP A;  5CUG A;  3UV5 A;  5D3R A;  5DW2 A;  4Z93 A;  5LKT A;  2E7N A;  2YQM A;  5A5O A;  4AKN A;  5I40 A;  3DWY A;  3UV4 A;  2JRJ A;  5J3X A;  5ETB A;  2RS9 B;  5AME A;  5D0C A;  5ENH A;  5HFQ A;  5HQ6 A;  3T7L A;  5FH8 A;  2DKW A;  5KH7 A;  2ECV A;  5G04 B;  4N4F A;  5A85 A;  5E9L A;  4OUF A;  4QF2 A;  2L75 A;  4TT4 A;  5L98 A;  5B77 A;  3U5J A;  4UYH A;  4CUS A;  2KFT A;  2LGG A;  5FB0 A;  4A9F A;  5ENJ A;  5CQ4 A;  2RO1 A;  2YYN A;  4IR4 A;  4BJX A;  4UP5 A;  1WFK A;  5TDW A;  1FBV A;  2I50 A;  4HBY A;  2KWK A;  3O70 A;  1E4U A;  2YUC A;  4A49 A;  4FK5 A;  3ZPV E;  3UVY A;  3MHS A;  2KR4 A;  5BT3 A;  3D7C A;  4Z1S A;  5FE1 A;  4TTE A;  1VD4 A;  5CP5 A;  4GNE A;  5KO4 A;  3ASL A;  2G45 A;  3HME A;  1WIM A;  2IDA A;  4O77 A;  2L80 A;  4R2Y A;  5EM3 A;  1K2F A;  1WIL A;  5H1V A;  2ZET C;  4NRB A;  4TS8 A;  5FDZ A;  5CGP A;  5C7N A;  2YEM A;  4A9O A;  4L58 A;  4QZS A;  2KIZ A;  2L85 A;  1EQF A;  3P1C A;  5CS8 A;  5FG5 A;  4YYN A;  3QZV A;  2OUO A;  4LZS A;  1WGM A;  4I7C A;  5C89 A;  2MD8 C;  4QR5 A;  1G25 A;  2YW5 A;  4MEQ A;  4ALH A;  5FE9 A;  4A9L A;  4BW1 A;  5ACY A;  3PUQ A;  5HRV A;  4B86 C;  4WZ0 A;  5EWW A;  4B7Y C;  3ONI A;  5HQ5 A;  2ECT A;  2DVQ A;  1E6I A;  4OGI A;  5I80 A;  1VYX A;  5ENI A;  3ZVZ B;  2MD7 B;  5EPS A;  4NR9 A;  2DX8 A;  4FO9 A;  1U6G B;  5FER A;  4ZQL A;  3IU6 A;  5D3S A;  2D9E A;  5HM0 A;  5IG6 A;  4NR5 A;  3HTK C;  2KTB B;  4UIZ A;  1ZS5 A;  5FE2 A;  5AD2 A;  2LV9 A;  3AAD A;  5I88 A;  4IR3 A;  4J1P A;  4WZ3 B;  4X2I A;  1X4U A;  4XUA A;  2CKL B;  4UIW A;  2MA6 A;  3LQJ A;  3MUL A;  3O34 A;  4IC3 A;  3KV6 A;  5DX4 A;  4O78 A;  5F60 A;  4MEN A;  5JI8 A;  3VK6 A;  5C13 A;  4IOO A;  4BW2 A;  5EPB A;  2OO1 A;  4AP4 A;  4QUT A;  2LGK A;  2XEU A;  4J3I A;  2G43 A;  4N4G A;  5DFB A;  5BT4 A;  2L84 A;  2ECJ A;  5DIN A;  4O7F A;  3EB5 A;  5D24 A;  5HJC A;  4FJC A;  2PUY A;  5DKC A;  2M6M A;  4UP0 A;  4LYS A;  5EP7 A;  5FE0 A;  5A5R A;  5CUB A;  4CLB A;  4XY8 A;  4O7C A;  5D3P A;  5A5P A;  4W4U A;  5FBX A;  5H1T A;  4QEV A;  5CFW A;  1F68 A;  4R8P K;  4MR3 A;  2WP2 A;  3N9P A;  2H60 A;  3JVJ A;  3QZS A;  5EWD A;  3LQH A;  4NR7 A;  5E3G A;  4Y03 A;  5FB1 A;  5FFV A;  4A4C A;  2K1J A;  4AVX A;  4NXJ A;  4UYF B;  2HYE D;  3EB6 A;  2E3K A;  2YEK A;  4A9M A;  4YY4 A;  2KGI A;  3MXF A;  3ZYQ A;  4NYV A;  4CUP A;  5DYU A;  2LGV A;  4TZ8 A;  5I7X A;  3NG2 A;  4MR5 A;  5A5N A;  2MNY A;  4PPE A;  5DY7 A;  4N4I A;  5CRZ A;  2RNX A;  3O36 A;  1RMD A;  1WE9 A;  2VNF A;  2RI7 A;  1WEO A;  2K4D A;  4ZDT A;  2YU4 A;  1WUG A;  5C11 A;  5CUE A;  4Z6H A;  3G0J A;  3LRQ A;  5ETD A;  2YYR A;  4LK9 A;  1X4J A;  2JMD A;  5AIU A;  4IOQ A;  2QIC A;  3ZVY A;  4C67 A;  5I86 A;  4HXN A;  4KV1 A;  5D3L A;  3N9M A;  1JM7 B;  5FE8 A;  3M62 A;  5CQ7 A;  4TYL A;  5E74 A;  4TQN A;  4HXK A;  2FUI A;  5CU8 A;  2FUU A;  5L97 A;  5D3H A;  1V87 A;  4QYL A;  5CQ8 A;  4AUQ B;  4YY6 A;  1HYJ A;  2MT5 A;  4J0S A;  5G0F A;  2JMI A;  1Z2Q A;  3JVM A;  4MEO A;  4YK0 A;  4V3K C;  2VJF B;  1ZBD B;  3SVF A;  3FKM X;  3SOW A;  5D3J A;  1X0J A;  2YDW A;  2Y1N A;  5CUA A;  5L99 A;  5ENB A;  4GPJ A;  5B78 A;  3GG3 A;  5K29 A;  3KNV A;  4NRA A;  5IGM A;  4ZW1 A;  4CUQ A;  4HBX A;  4IC2 A;  4QST A;  2PNX A;  5HLS A;  4UIY A;  5EWC A;  4O72 A;  5EA1 A;  1WEQ A;  2ECI A;  5DYX A;  5HEL A;  4O7A A;  4S3O C;  5EWH A;  3SVG A;  5IGN A;  4YBM A;  2EOD A;  2VPE A;  2RFJ A;  5I83 A;  4QSS A;  4X3G A;  2YW8 A;  4N4H A;  1WEV A;  2ECN A;  2CKL A;  4A4B A;  4LZ2 A;  4AYC A;  3HCT A;  2E7O A;  4S3O B;  2VJE B;  5DKH A;  5E9Y A;  4PTB A;  4UIV A;  5ENG A;  1WEE A;  4NN2 A;  4V3L C;  2M1R A;  5D1L B;  3ZYU A;  5E7D A;  5FG6 A;  3QZT A;  5DFC A;  5C87 A;  5KTX A;  1JSP B;  2ECG A;  3MB3 A;  2QJ0 A;  4O74 A;  5EYA F;  5E9K A;  2RNY A;  5C85 A;  5EU1 A;  1BOR A;  4CCG X;  5TAB A;  2N9G A;  3TLP A;  4QC3 A;  3SHB A;  3MB4 A;  5IGL A;  4QSR A;  2L0B A;  4HXS A;  2R0V A;  1MM3 A;  4MSX A;  2C2L A;  4HXM A;  3UW9 A;  4CFL A;  2VP7 A;  4A0C D;  3S91 A;  3IHP A;  4CL9 A;  4FIP A;  2KWJ A;  4PY6 A;  5CZG A;  1VFY A;  2I7K A;  5H1U A;  2E6R A;  3N9O A;  1F62 A;  5EQ1 A;  4RVR A;  2M85 A;  2YSM A;  4QNS A;  4QSQ A;  2D8S A;  4N3W A;  2Y43 A;  4HBV A;  4TKP B;  5EK9 A;  5EGU A;  4PKL A;  3JVL A;  1WEN A;  4NQN A;  4R7E A;  5HRW A;  4QSX A;  5A82 A;  5B8D A;  3HMH A;  3RPG C;  4A9H A;  5B76 A;  5I3L A;  3P1E A;  4GNF A;  4LYW A;  4Q0O A;  5I29 A;  5LKX A;  5DKD A;  2YSJ A;  4CFK A;  2LQ6 A;  5F36 A;  5LJ0 A;  2CSZ A;  2H0D B;  4WA6 A;  5I7Y A;  2DWW A;  4XY9 A;  4ZC9 A;  4KV4 A;  4LZR A;  5LKU A;  4F52 B;  4ZUX U;  1WES A;  1WEW A;  4QBM A;  4P5O B;  4LR6 A;  5LJ1 A; 
#chains in the Genus database with same CATH topology
 4BW4 A;  5FH7 A;  2EGP A;  4A9K A;  3P5O A;  5DFD A;  3P1D A;  4Z6I A;  2UZG A;  2OSS A;  5CQ6 A;  5TRB A;  4CUR A;  5B79 A;  4HXP A;  5KTU A;  4HXL A;  2DVR A;  2R0Y A;  4UIX A;  2KYU A;  5COI A;  3P1F A;  5E73 A;  4FLP A;  3MHH A;  5DYA A;  3DPL R;  2R0S A;  3GL6 A;  4QF3 A;  5DKA A;  3ZNI A;  2I8N A;  5A5S A;  3ZPV 1;  5FE7 A;  5HRX A;  5DLZ A;  5CRM A;  3M99 A;  5E9M A;  1DVP A;  4TZ2 A;  4UYD A;  5LCW B;  5IGK A;  4XUB A;  5DBM A;  5CQT A;  2R10 A;  5CQ5 A;  5F1H A;  3HMF A;  4UIT A;  4KCX A;  2YQD A;  4LKA A;  3N9L A;  2HDP A;  4NQM A;  2RR4 A;  5I89 A;  4XI1 A;  3LJU X;  3DAI A;  3FL2 A;  3M63 A;  3Q2E A;  4QEW A;  2FSA A;  5C4Q A;  4Z1Q A;  1WUM A;  5E9V A;  2LGL A;  4YYG A;  3Q2F A;  4IOR A;  5F25 A;  2L5U A;  3O35 A;  1FP0 A;  4PS5 A;  2DAT A;  2YT5 A;  2KWO A;  1WEM A;  2YUR A;  3KQI A;  4MVT A;  5F3A A;  4WIV A;  1Z6U A;  3LJW A;  4AKG A;  2F6J A;  5IBN A;  1PUO A;  5HQ7 A;  3I3J A;  3RCW A;  5CQA A;  4LAD B;  4F3I A;  3UVX A;  5E9I A;  2CT2 A;  3JVK A;  5D7X A;  5SVI B;  5CTL A;  4UYG A;  4QR4 A;  4YYI A;  2RSD A;  5EPR A;  4LC2 A;  2AN6 A;  5E3D A;  4HBW A;  2G6Q A;  4O64 A;  5G4R A;  1JOC A;  5AD3 A;  4O75 A;  5CPE A;  4Q6F A;  5EIS A;  1G25 A;  4TT6 A;  4NYW A;  5FH6 A;  1LDJ B;  2F42 A;  3SOX A;  5SVX A;  3HCU A;  5ENF A;  4HXR A;  5CUD A;  3T6R A;  5HEN A;  3PHD A;  5EWV A;  3U5L A;  4QYD A;  4QB3 A;  4WHW A;  3O7A A;  5D1K B;  5C8G A;  5FE4 A;  2EA6 A;  4NUE A;  1Z60 A;  4UIU A;  5H9M A;  4MR6 A;  2Y1M A;  4YBT A;  3LQI A;  3FM8 C;  4YBS A;  1N87 A;  3KV5 A;  5TBN A;  2LRI C;  2H0D A;  5A7C A;  1WEP A;  3FJU B;  1MBM A;  3G0L A;  3UVW A;  2LN0 A;  3U5M A;  2KWN A;  3DQV R;  3C5K A;  4IR6 A;  5KH9 A;  2DVV A;  4PCE A;  4Q0N A;  5HFR A;  4BHW A;  2D82 A;  2K17 A;  2LDR A;  2P57 A;  2L5E A;  2KKX A;  4NR6 A;  3LVQ E;  4O7B A;  1CHC A;  4QSV A;  1T1H A;  5H85 A;  2DSM A;  3U5K A;  1IYM A;  2JMJ A;  2M3H A;  2BAY A;  5F61 A;  3U5P A;  2MA5 A;  2LXH C;  5CUC A;  4NUD A;  4QSP A;  5KTW A;  2KRE A;  4LYI A;  4YAT A;  2GRC A;  5HEM A;  4YYH A;  2YQL A;  1X4I A;  2C2V S;  4A9N A;  5I1Q A;  5ENE A;  2G4A A;  1ZKR A;  5FG4 A;  2E6S A;  4YAB A;  5G05 B;  4QSW A;  5D3T A;  4WZ2 A;  4UYF A;  5TB6 A;  3RTR B;  3L1Z B;  2LXP C;  5LVR A;  4NR4 A;  2KE1 A;  2L43 A;  5FEY A;  5F62 A;  5EV9 A;  3MQM A;  5CY9 A;  5FFW A;  2K16 A;  5F63 A;  5L8T A;  3GV4 A;  4LLB A;  2XB1 A;  2LSP B;  3O37 A;  2KKY A;  3K2J A;  4YYM A;  4MR4 A;  2KGG A;  3MUK A;  1JM4 B;  5E0R A;  4GND A;  5A5Q A;  5G4S A;  4YYD A;  2JUN A;  2RNW A;  2MUM A;  5KU3 A;  4TU4 A;  2VPD A;  4QEU A;  3RPG B;  5FFY A;  3O47 A;  3AQA A;  2YHO A;  1JM7 A;  4A9J A;  4YH3 A;  3SOU A;  5D3N A;  4QC1 A;  4LJN A;  3U5N A;  5JWM A;  2FD4 A;  4TU6 A;  4NRC A;  3U5O A;  4LDF A;  4GNG A;  4E96 A;  4YH4 A;  3L1X A;  5K3Q A;  2B0O E;  5SVI A;  2F6N A;  4HXO A;  5II2 A;  4OGJ A;  4BW3 A;  3I2D A;  2VJF A;  2MJV B;  2NAA A;  5B75 A;  4YAX A;  5TCM A;  5D1M B;  5TDR A;  3ZTG A;  4IR5 A;  4AYC B;  5II1 A;  4CUT A;  4CUU A;  4NUC A;  3L11 A;  5A83 A;  5F5Z A;  5LJ2 A;  5EIC A;  4ALG A;  5LVQ A;  4C66 A;  2ECW A;  2YEL A;  4O76 A;  5AMF A;  1XWH A;  2YHN A;  3S92 A;  5J0D A;  4I7D A;  4NYX A;  5FE6 A;  4YC9 A;  3N9Q A;  5FE3 A;  4YYJ A;  4O70 A;  4QSU A;  3N9N A;  4YYK A;  4UYE A;  4C9Z A;  2NXB A;  3UVD A;  5FE5 A;  5LKZ A;  2M13 A;  5F2P A;  3MDB C;  3HCS A;  2KU3 A;  5EI4 A;  2DVS A;  2CSY A;  4LRG A;  5AIT A;  2WP1 A;  5EVA A;  3NXB A;  4PCI A;  4BBQ A;  3UV2 A;  3PUR A;  4A9E A;  2E61 A;  4I7B A;  5D26 A;  2VJE A;  4O71 A;  2VPG A;  5F1L A;  3LXJ A;  4UI9 B;  4QUU A;  1N72 A;  5BT5 A;  4XYA A;  4NS5 A;  2QIZ A;  4WHU A;  2MIQ A;  2D8U A;  5D25 A;  5HCL A;  5IID A;  1MM2 A;  2OXQ C;  4QR3 A;  2XP0 A;  5L96 A;  5DW1 A;  5LUU A;  4Z0O A;  5CQ3 A;  4NR8 A;  2YRE A;  4DON A;  1LDK C;  4GB0 A;  2JM3 A;  4TT2 A;  5DYC A;  4A9I A;  3IU5 A;  3O33 A;  5KHM A;  3LVR E;  2VPB A;  4CA1 A;  5JG6 A;  3C6W A;  1HYI A;  5KH3 A;  5ENC A;  3V43 A;  3JUE A;  3SVH A;  4AI6 A;  2CRW A;  4L7X A;  2MNZ A;  4YAD A;  2CON A;  1WEU A;  5A81 A;  4J0R A;  4O7E A;  4QY4 A;  5DLX A;  5L8U A;  4MEP A;  5CUG A;  3UV5 A;  5D3R A;  5DW2 A;  4Z93 A;  5LKT A;  3VKH A;  2E7N A;  2LAU A;  2YQM A;  5A5O A;  4AKN A;  5I40 A;  3DWY A;  3UV4 A;  2JRJ A;  5J3X A;  5ETB A;  2RS9 B;  5AME A;  5D0C A;  5ENH A;  5HFQ A;  5HQ6 A;  3T7L A;  5FH8 A;  2DKW A;  5KH7 A;  2ECV A;  5G04 B;  4N4F A;  5A85 A;  5E9L A;  4OUF A;  2IQJ A;  4QF2 A;  2L75 A;  4TT4 A;  5L98 A;  5B77 A;  3U5J A;  4UYH A;  4CUS A;  4OGC A;  2KFT A;  2LGG A;  5FB0 A;  4A9F A;  5ENJ A;  5CQ4 A;  2RO1 A;  2YYN A;  4IR4 A;  4BJX A;  4UP5 A;  1WFK A;  5TDW A;  1FBV A;  2I50 A;  4HBY A;  2KWK A;  3O70 A;  1E4U A;  2YUC A;  4A49 A;  4FK5 A;  3ZPV E;  3UVY A;  3MHS A;  2KR4 A;  5BT3 A;  3D7C A;  4Z1S A;  5FE1 A;  4TTE A;  1VD4 A;  5CP5 A;  4GNE A;  5KO4 A;  3ASL A;  2G45 A;  3HME A;  1WIM A;  2IDA A;  4O77 A;  2L80 A;  4R2Y A;  5EM3 A;  1K2F A;  1WIL A;  5H1V A;  2ZET C;  4NRB A;  4TS8 A;  5FDZ A;  5CGP A;  5C7N A;  2YEM A;  4A9O A;  4L58 A;  4QZS A;  2KIZ A;  2L85 A;  1EQF A;  3DDT A;  3P1C A;  5CS8 A;  5FG5 A;  4YYN A;  4F1P A;  3VKG A;  3QZV A;  2OUO A;  4LZS A;  1WGM A;  4I7C A;  5C89 A;  2CSV A;  4QR5 A;  2MD8 C;  2YW5 A;  4MEQ A;  4ALH A;  5FE9 A;  4A9L A;  4BW1 A;  5ACY A;  3PUQ A;  5HRV A;  4B86 C;  4WZ0 A;  5EWW A;  4B7Y C;  3ONI A;  5HQ5 A;  2ECT A;  2DVQ A;  1E6I A;  4OGI A;  5I80 A;  1VYX A;  5ENI A;  3ZVZ B;  2MD7 B;  5EPS A;  4NR9 A;  2DX8 A;  3M7K A;  4FO9 A;  1U6G B;  5FER A;  4ZQL A;  3IU6 A;  5D3S A;  2D9E A;  5HM0 A;  5IG6 A;  4NR5 A;  3HTK C;  2KTB B;  4UIZ A;  1ZS5 A;  5FE2 A;  5AD2 A;  2LV9 A;  3Q1D A;  3AAD A;  5I88 A;  4IR3 A;  4OGE A;  4J1P A;  4WZ3 B;  4X2I A;  1X4U A;  4XUA A;  2CKL B;  4UIW A;  2L7P A;  2MA6 A;  3LQJ A;  3FEH A;  3MUL A;  3O34 A;  4IC3 A;  3KV6 A;  5DX4 A;  4O78 A;  5F60 A;  4MEN A;  5JI8 A;  3VK6 A;  3ERR A;  3PLW A;  5C13 A;  4IOO A;  4BW2 A;  5EPB A;  2OO1 A;  4AP4 A;  4QUT A;  2LGK A;  2XEU A;  3T9K A;  4J3I A;  2G43 A;  4N4G A;  5DFB A;  5BT4 A;  2L84 A;  2ECJ A;  5DIN A;  4O7F A;  3EB5 A;  5D24 A;  5HJC A;  4FJC A;  2PUY A;  5DKC A;  3DWD A;  2M6M A;  4UP0 A;  4LYS A;  5EP7 A;  5FE0 A;  5A5R A;  5CUB A;  4CLB A;  4XY8 A;  4O7C A;  5D3P A;  5A5P A;  2XOC A;  4W4U A;  5FBX A;  5H1T A;  4QEV A;  5CFW A;  1F68 A;  4R8P K;  4MR3 A;  2WP2 A;  3N9P A;  2H60 A;  3JVJ A;  3QZS A;  5EWD A;  3LQH A;  4NR7 A;  5E3G A;  4Y03 A;  5FB1 A;  5FFV A;  4A4C A;  2K1J A;  4AVX A;  4NXJ A;  4UYF B;  2HYE D;  3EB6 A;  2E3K A;  2YEK A;  4A9M A;  4YY4 A;  2XOZ A;  2KGI A;  3MXF A;  3ZYQ A;  4AKI A;  4NYV A;  4CUP A;  5DYU A;  2LGV A;  4TZ8 A;  5I7X A;  3NG2 A;  4MR5 A;  5A5N A;  2MNY A;  4PPE A;  5DY7 A;  4N4I A;  5CRZ A;  2RNX A;  3O36 A;  1RMD A;  1WE9 A;  2VNF A;  2RI7 A;  1WEO A;  2K4D A;  4ZDT A;  2YU4 A;  1WUG A;  5C11 A;  5CUE A;  4Z6H A;  3FAN A;  3D1D A;  3G0J A;  3LRQ A;  3LDY A;  5ETD A;  2YYR A;  4LK9 A;  1X4J A;  2JMD A;  5AIU A;  4IOQ A;  2EGM A;  2QIC A;  3ZVY A;  4C67 A;  5I86 A;  4HXN A;  4KV1 A;  5D3L A;  3N9M A;  1JM7 B;  5FE8 A;  3M62 A;  5CQ7 A;  4TYL A;  5E74 A;  4TQN A;  2MKE A;  4HXK A;  2FUI A;  2YVR A;  5CU8 A;  2FUU A;  5L97 A;  5D3H A;  1V87 A;  4QYL A;  5CQ8 A;  4AUQ B;  4YY6 A;  2XOY A;  2MT5 A;  1HYJ A;  4J0S A;  5G0F A;  2JMI A;  1Z2Q A;  3JVM A;  4MEO A;  2EXU A;  4YK0 A;  4V3K C;  2VJF B;  1ZBD B;  3SVF A;  3FKM X;  3SOW A;  5D3J A;  1X0J A;  2YDW A;  2Y1N A;  4Z0R A;  3D1B A;  5CUA A;  5L99 A;  5ENB A;  4GPJ A;  5B78 A;  3GG3 A;  5K29 A;  3KNV A;  4NRA A;  5IGM A;  3FAO A;  4ZW1 A;  4CUQ A;  2OWA A;  4HBX A;  4IC2 A;  4QST A;  2PNX A;  3KDE C;  5HLS A;  4UIY A;  5EWC A;  4O72 A;  5EA1 A;  1WEQ A;  2ECI A;  5DYX A;  5HEL A;  4O7A A;  4S3O C;  5EWH A;  3SVG A;  5IGN A;  4YBM A;  2EOD A;  2VPE A;  2RFJ A;  1DCQ A;  5I83 A;  4QSS A;  4X3G A;  2FFW A;  2YW8 A;  4N4H A;  1WEV A;  3E2D A;  2ECN A;  2CKL A;  4A4B A;  4LZ2 A;  4AYC A;  2CRR A;  3HCT A;  2E7O A;  4S3O B;  2VJE B;  5DKH A;  5E9Y A;  4PTB A;  4UIV A;  5ENG A;  1WEE A;  4NN2 A;  4V3L C;  2M1R A;  5D1L B;  3ZYU A;  5E7D A;  5FG6 A;  3QZT A;  5DFC A;  5C87 A;  5KTX A;  1JSP B;  2ECG A;  3MB3 A;  2QJ0 A;  3H7H A;  4O74 A;  5EYA F;  5E9K A;  2RNY A;  5C85 A;  5EU1 A;  1BOR A;  4CCG X;  5TAB A;  2N9G A;  3TLP A;  4QC3 A;  3SHB A;  3MB4 A;  5IGL A;  4QSR A;  2L0B A;  4HXS A;  2R0V A;  1MM3 A;  4H9D A;  4MSX A;  2C2L A;  4HXM A;  3UW9 A;  4CFL A;  2VP7 A;  4QQ4 A;  4A0C D;  3S91 A;  3IHP A;  4CL9 A;  4FIP A;  2KWJ A;  4PY6 A;  5CZG A;  1VFY A;  2I7K A;  5H1U A;  2E6R A;  2DJA A;  3N9O A;  1F62 A;  5EQ1 A;  4RVR A;  2M85 A;  2YSM A;  4QNS A;  4QSQ A;  2D8S A;  4N3W A;  2Y43 A;  4HBV A;  4TKP B;  5EK9 A;  5EGU A;  5SVY A;  4PKL A;  3JVL A;  1WEN A;  4NQN A;  4R7E A;  5HRW A;  4QSX A;  5A82 A;  5B8D A;  3HMH A;  3RPG C;  4A9H A;  5B76 A;  5I3L A;  3P1E A;  4GNF A;  4LYW A;  4Q0O A;  5I29 A;  5LKX A;  5DKD A;  4O62 A;  2YSJ A;  4CFK A;  2LQ6 A;  5F36 A;  5LJ0 A;  2CSZ A;  2EJN A;  2H0D B;  4WA6 A;  5I7Y A;  2DWW A;  4XY9 A;  4ZC9 A;  4KV4 A;  4LZR A;  5LKU A;  4F52 B;  4ZUX U;  1WES A;  1WEW A;  4QBM A;  4P5O B;  4AKH A;  4LR6 A;  3SUB A;  5LJ1 A; 
#chains in the Genus database with same CATH homology
 4BW4 A;  5FH7 A;  2EGP A;  4A9K A;  3P5O A;  5DFD A;  3P1D A;  4Z6I A;  2UZG A;  2OSS A;  5CQ6 A;  5TRB A;  4CUR A;  5B79 A;  4HXP A;  5KTU A;  4HXL A;  2DVR A;  2R0Y A;  4UIX A;  2KYU A;  5COI A;  3P1F A;  5E73 A;  4FLP A;  3MHH A;  5DYA A;  3DPL R;  2R0S A;  3GL6 A;  4QF3 A;  5DKA A;  3ZNI A;  2I8N A;  5A5S A;  3ZPV 1;  5FE7 A;  5HRX A;  5DLZ A;  5CRM A;  3M99 A;  5E9M A;  1DVP A;  4TZ2 A;  4UYD A;  5LCW B;  5IGK A;  4XUB A;  5DBM A;  5CQT A;  2R10 A;  5CQ5 A;  5F1H A;  3HMF A;  4UIT A;  4KCX A;  2YQD A;  4LKA A;  3N9L A;  2HDP A;  4NQM A;  5I89 A;  4XI1 A;  3DAI A;  3FL2 A;  3M63 A;  3Q2E A;  4QEW A;  2FSA A;  5C4Q A;  4Z1Q A;  1WUM A;  5E9V A;  2LGL A;  4YYG A;  3Q2F A;  4IOR A;  5F25 A;  2L5U A;  3O35 A;  1FP0 A;  4PS5 A;  2DAT A;  2YT5 A;  2KWO A;  1WEM A;  2YUR A;  3KQI A;  4MVT A;  5F3A A;  4WIV A;  1Z6U A;  3LJW A;  2F6J A;  5IBN A;  5HQ7 A;  3I3J A;  3RCW A;  5CQA A;  4LAD B;  4F3I A;  3UVX A;  5E9I A;  2CT2 A;  3JVK A;  5D7X A;  5CTL A;  4UYG A;  4QR4 A;  4YYI A;  2RSD A;  5EPR A;  4LC2 A;  2AN6 A;  5E3D A;  4HBW A;  2G6Q A;  4O64 A;  5G4R A;  1JOC A;  5AD3 A;  4O75 A;  5CPE A;  4Q6F A;  5EIS A;  4TT6 A;  4NYW A;  5FH6 A;  1LDJ B;  2F42 A;  3SOX A;  3HCU A;  5ENF A;  4HXR A;  5CUD A;  3T6R A;  5HEN A;  3PHD A;  5EWV A;  3U5L A;  4QYD A;  4QB3 A;  4WHW A;  3O7A A;  5D1K B;  5C8G A;  5FE4 A;  2EA6 A;  4NUE A;  1Z60 A;  4UIU A;  5H9M A;  4MR6 A;  2Y1M A;  4YBT A;  3LQI A;  4YBS A;  1N87 A;  3KV5 A;  5TBN A;  2LRI C;  2H0D A;  5A7C A;  1WEP A;  3G0L A;  3UVW A;  2LN0 A;  3U5M A;  2KWN A;  3DQV R;  3C5K A;  4IR6 A;  5KH9 A;  2DVV A;  4PCE A;  4Q0N A;  5HFR A;  4BHW A;  2D82 A;  2K17 A;  2LDR A;  2L5E A;  4NR6 A;  4O7B A;  1CHC A;  4QSV A;  1T1H A;  5H85 A;  3U5K A;  1IYM A;  2JMJ A;  2M3H A;  2BAY A;  5F61 A;  3U5P A;  2MA5 A;  2LXH C;  5CUC A;  4NUD A;  4QSP A;  5KTW A;  2KRE A;  4LYI A;  4YAT A;  2GRC A;  5HEM A;  4YYH A;  2YQL A;  1X4I A;  2C2V S;  4A9N A;  5I1Q A;  5ENE A;  2G4A A;  5FG4 A;  2E6S A;  4YAB A;  5G05 B;  4QSW A;  5D3T A;  4WZ2 A;  4UYF A;  5TB6 A;  3RTR B;  3L1Z B;  2LXP C;  5LVR A;  4NR4 A;  2KE1 A;  2L43 A;  5FEY A;  5F62 A;  5EV9 A;  3MQM A;  5CY9 A;  5FFW A;  2K16 A;  5F63 A;  5L8T A;  3GV4 A;  4LLB A;  2XB1 A;  2LSP B;  3O37 A;  3K2J A;  4YYM A;  4MR4 A;  2KGG A;  3MUK A;  1JM4 B;  5E0R A;  4GND A;  5A5Q A;  5G4S A;  4YYD A;  2RNW A;  2MUM A;  5KU3 A;  4TU4 A;  2VPD A;  4QEU A;  3RPG B;  5FFY A;  3AQA A;  2YHO A;  1JM7 A;  4A9J A;  4YH3 A;  3SOU A;  5D3N A;  4QC1 A;  4LJN A;  3U5N A;  5JWM A;  4TU6 A;  4NRC A;  3U5O A;  4LDF A;  4GNG A;  4E96 A;  4YH4 A;  3L1X A;  2F6N A;  4HXO A;  5II2 A;  4OGJ A;  4BW3 A;  3I2D A;  2VJF A;  2MJV B;  2NAA A;  5B75 A;  4YAX A;  5TCM A;  5D1M B;  5TDR A;  3ZTG A;  4IR5 A;  4AYC B;  5II1 A;  4CUT A;  4CUU A;  4NUC A;  3L11 A;  5A83 A;  5F5Z A;  5LJ2 A;  5EIC A;  4ALG A;  5LVQ A;  4C66 A;  2ECW A;  2YEL A;  4O76 A;  5AMF A;  1XWH A;  2YHN A;  3S92 A;  5J0D A;  4I7D A;  4NYX A;  5FE6 A;  4YC9 A;  3N9Q A;  5FE3 A;  4YYJ A;  4O70 A;  4QSU A;  3N9N A;  4YYK A;  4UYE A;  4C9Z A;  2NXB A;  3UVD A;  5FE5 A;  5LKZ A;  5F2P A;  3HCS A;  2KU3 A;  5EI4 A;  2DVS A;  2CSY A;  4LRG A;  5AIT A;  2WP1 A;  5EVA A;  3NXB A;  4PCI A;  4BBQ A;  3UV2 A;  3PUR A;  4A9E A;  4I7B A;  5D26 A;  2VJE A;  4O71 A;  2VPG A;  5F1L A;  3LXJ A;  4UI9 B;  4QUU A;  1N72 A;  5BT5 A;  4XYA A;  4NS5 A;  2QIZ A;  4WHU A;  2MIQ A;  5D25 A;  5HCL A;  5IID A;  1MM2 A;  2OXQ C;  4QR3 A;  5L96 A;  5DW1 A;  5LUU A;  5CQ3 A;  4NR8 A;  2YRE A;  4DON A;  1LDK C;  4GB0 A;  4TT2 A;  5DYC A;  4A9I A;  3IU5 A;  3O33 A;  5KHM A;  2VPB A;  4CA1 A;  5JG6 A;  3C6W A;  1HYI A;  5KH3 A;  5ENC A;  3V43 A;  3SVH A;  4L7X A;  2MNZ A;  4YAD A;  1WEU A;  5A81 A;  4J0R A;  4O7E A;  4QY4 A;  5DLX A;  5L8U A;  4MEP A;  5CUG A;  3UV5 A;  5D3R A;  5DW2 A;  4Z93 A;  5LKT A;  2E7N A;  2YQM A;  5A5O A;  4AKN A;  5I40 A;  3DWY A;  3UV4 A;  2JRJ A;  5J3X A;  5ETB A;  2RS9 B;  5AME A;  5D0C A;  5ENH A;  5HFQ A;  5HQ6 A;  3T7L A;  5FH8 A;  2DKW A;  5KH7 A;  2ECV A;  5G04 B;  4N4F A;  5A85 A;  5E9L A;  4OUF A;  4QF2 A;  2L75 A;  4TT4 A;  5L98 A;  5B77 A;  3U5J A;  4UYH A;  4CUS A;  2KFT A;  2LGG A;  5FB0 A;  4A9F A;  5ENJ A;  5CQ4 A;  2RO1 A;  2YYN A;  4IR4 A;  4BJX A;  4UP5 A;  1WFK A;  5TDW A;  1FBV A;  2I50 A;  4HBY A;  2KWK A;  3O70 A;  1E4U A;  2YUC A;  4A49 A;  4FK5 A;  3ZPV E;  3UVY A;  3MHS A;  2KR4 A;  5BT3 A;  3D7C A;  4Z1S A;  5FE1 A;  4TTE A;  1VD4 A;  5CP5 A;  4GNE A;  5KO4 A;  3ASL A;  2G45 A;  3HME A;  1WIM A;  2IDA A;  4O77 A;  2L80 A;  4R2Y A;  5EM3 A;  1K2F A;  1WIL A;  5H1V A;  2ZET C;  4NRB A;  4TS8 A;  5FDZ A;  5CGP A;  5C7N A;  2YEM A;  4A9O A;  4L58 A;  4QZS A;  2KIZ A;  2L85 A;  1EQF A;  3P1C A;  5CS8 A;  5FG5 A;  4YYN A;  3QZV A;  2OUO A;  4LZS A;  1WGM A;  4I7C A;  5C89 A;  2MD8 C;  4QR5 A;  1G25 A;  2YW5 A;  4MEQ A;  4ALH A;  5FE9 A;  4A9L A;  4BW1 A;  5ACY A;  3PUQ A;  5HRV A;  4B86 C;  4WZ0 A;  5EWW A;  4B7Y C;  3ONI A;  5HQ5 A;  2ECT A;  2DVQ A;  1E6I A;  4OGI A;  5I80 A;  1VYX A;  5ENI A;  3ZVZ B;  2MD7 B;  5EPS A;  4NR9 A;  2DX8 A;  4FO9 A;  1U6G B;  5FER A;  4ZQL A;  3IU6 A;  5D3S A;  2D9E A;  5HM0 A;  5IG6 A;  4NR5 A;  3HTK C;  2KTB B;  4UIZ A;  1ZS5 A;  5FE2 A;  5AD2 A;  2LV9 A;  3AAD A;  5I88 A;  4IR3 A;  4J1P A;  4WZ3 B;  4X2I A;  1X4U A;  4XUA A;  2CKL B;  4UIW A;  2MA6 A;  3LQJ A;  3MUL A;  3O34 A;  4IC3 A;  3KV6 A;  5DX4 A;  4O78 A;  5F60 A;  4MEN A;  5JI8 A;  3VK6 A;  5C13 A;  4IOO A;  4BW2 A;  5EPB A;  2OO1 A;  4AP4 A;  4QUT A;  2LGK A;  2XEU A;  4J3I A;  2G43 A;  4N4G A;  5DFB A;  5BT4 A;  2L84 A;  2ECJ A;  5DIN A;  4O7F A;  3EB5 A;  5D24 A;  5HJC A;  4FJC A;  2PUY A;  5DKC A;  2M6M A;  4UP0 A;  4LYS A;  5EP7 A;  5FE0 A;  5A5R A;  5CUB A;  4CLB A;  4XY8 A;  4O7C A;  5D3P A;  5A5P A;  4W4U A;  5FBX A;  5H1T A;  4QEV A;  5CFW A;  1F68 A;  4R8P K;  4MR3 A;  2WP2 A;  3N9P A;  2H60 A;  3JVJ A;  3QZS A;  5EWD A;  3LQH A;  4NR7 A;  5E3G A;  4Y03 A;  5FB1 A;  5FFV A;  4A4C A;  2K1J A;  4AVX A;  4NXJ A;  4UYF B;  2HYE D;  3EB6 A;  2E3K A;  2YEK A;  4A9M A;  4YY4 A;  2KGI A;  3MXF A;  3ZYQ A;  4NYV A;  4CUP A;  5DYU A;  2LGV A;  4TZ8 A;  5I7X A;  3NG2 A;  4MR5 A;  5A5N A;  2MNY A;  4PPE A;  5DY7 A;  4N4I A;  5CRZ A;  2RNX A;  3O36 A;  1RMD A;  1WE9 A;  2VNF A;  2RI7 A;  1WEO A;  2K4D A;  4ZDT A;  2YU4 A;  1WUG A;  5C11 A;  5CUE A;  4Z6H A;  3G0J A;  3LRQ A;  5ETD A;  2YYR A;  4LK9 A;  1X4J A;  2JMD A;  5AIU A;  4IOQ A;  2QIC A;  3ZVY A;  4C67 A;  5I86 A;  4HXN A;  4KV1 A;  5D3L A;  3N9M A;  1JM7 B;  5FE8 A;  3M62 A;  5CQ7 A;  4TYL A;  5E74 A;  4TQN A;  4HXK A;  2FUI A;  5CU8 A;  2FUU A;  5L97 A;  5D3H A;  1V87 A;  4QYL A;  5CQ8 A;  4AUQ B;  4YY6 A;  1HYJ A;  2MT5 A;  4J0S A;  5G0F A;  2JMI A;  1Z2Q A;  3JVM A;  4MEO A;  4YK0 A;  4V3K C;  2VJF B;  1ZBD B;  3SVF A;  3FKM X;  3SOW A;  5D3J A;  1X0J A;  2YDW A;  2Y1N A;  5CUA A;  5L99 A;  5ENB A;  4GPJ A;  5B78 A;  3GG3 A;  5K29 A;  3KNV A;  4NRA A;  5IGM A;  4ZW1 A;  4CUQ A;  4HBX A;  4IC2 A;  4QST A;  2PNX A;  5HLS A;  4UIY A;  5EWC A;  4O72 A;  5EA1 A;  1WEQ A;  2ECI A;  5DYX A;  5HEL A;  4O7A A;  4S3O C;  5EWH A;  3SVG A;  5IGN A;  4YBM A;  2EOD A;  2VPE A;  2RFJ A;  5I83 A;  4QSS A;  4X3G A;  2YW8 A;  4N4H A;  1WEV A;  2ECN A;  2CKL A;  4A4B A;  4LZ2 A;  4AYC A;  3HCT A;  2E7O A;  4S3O B;  2VJE B;  5DKH A;  5E9Y A;  4PTB A;  4UIV A;  5ENG A;  1WEE A;  4NN2 A;  4V3L C;  2M1R A;  5D1L B;  3ZYU A;  5E7D A;  5FG6 A;  3QZT A;  5DFC A;  5C87 A;  5KTX A;  1JSP B;  2ECG A;  3MB3 A;  2QJ0 A;  4O74 A;  5EYA F;  5E9K A;  2RNY A;  5C85 A;  5EU1 A;  1BOR A;  4CCG X;  5TAB A;  2N9G A;  3TLP A;  4QC3 A;  3SHB A;  3MB4 A;  5IGL A;  4QSR A;  2L0B A;  4HXS A;  2R0V A;  1MM3 A;  4MSX A;  2C2L A;  4HXM A;  3UW9 A;  4CFL A;  2VP7 A;  4A0C D;  3S91 A;  3IHP A;  4CL9 A;  4FIP A;  2KWJ A;  4PY6 A;  5CZG A;  1VFY A;  2I7K A;  5H1U A;  2E6R A;  3N9O A;  1F62 A;  5EQ1 A;  4RVR A;  2M85 A;  2YSM A;  4QNS A;  4QSQ A;  2D8S A;  4N3W A;  2Y43 A;  4HBV A;  4TKP B;  5EK9 A;  5EGU A;  4PKL A;  3JVL A;  1WEN A;  4NQN A;  4R7E A;  5HRW A;  4QSX A;  5A82 A;  5B8D A;  3HMH A;  3RPG C;  4A9H A;  5B76 A;  5I3L A;  3P1E A;  4GNF A;  4LYW A;  4Q0O A;  5I29 A;  5LKX A;  5DKD A;  2YSJ A;  4CFK A;  2LQ6 A;  5F36 A;  5LJ0 A;  2CSZ A;  2H0D B;  4WA6 A;  5I7Y A;  2DWW A;  4XY9 A;  4ZC9 A;  4KV4 A;  4LZR A;  5LKU A;  4F52 B;  4ZUX U;  1WES A;  1WEW A;  4QBM A;  4P5O B;  4LR6 A;  5LJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...