3O34A

Crystal structure of trim24 phd-bromo complexed with h3(13-32)k23ac peptide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
181
structure length
177
Chain Sequence
EDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
total genus 50
structure length 177
sequence length 181
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o34A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o34A01
3C5KA 2YQDA 4AP4A 2K16A 3HCTA 4UIUA 5EVAA 1JSPB 4HBVA 5ENJA 4UIYA 5FFVA 2YYRA 4CLBA 1N72A 2M3HA 2N9GA 5LKUA 3LRQA 4HXRA 5CY9A 4QYLA 5D1MB 5EWHA 1JOCA 4L7XA 4QSRA 2MA6A 5HELA 4HBYA 5E74A 4PPEA 4WZ3B 5L8TA 3O70A 5FE3A 1WEUA 4O72A 5LVQA 2KGIA 4O7CA 3LQIA 5DYXA 4XY8A 5F62A 3UW9A 5FE7A 2ECTA 2KE1A 4BHWA 4ALGA 4R7EA 3Q2FA 2ECIA 4O76A 5HM0A 2YU4A 4Z1SA 5CP5A 2JMDA 4BBQA 3NXBA 4QSXA 4NQMA 3HCUA 5D3HA 5EV9A 4AVXA 3G0LA 4J1PA 4YABA 3DWYA 1X4IA 5F63A 1JM4B 5E3DA 5II1A 3Q2EA 1K2FA 4IOQA 5HRXA 5CQ4A 1WESA 5D3LA 2YEKA 3MQMA 3O7AA 2MJVB 4QY4A 4Z6HA 3N9NA 3UVDA 2L5EA 4QC3A 2MT5A 2ECNA 4WHWA 1VYXA 4A9IA 1WUMA 4HXKA 5CUCA 5F2PA 4N4IA 1X4UA 4NUEA 5FFWA 1X4JA 2CSZA 5EISA 5BT4A 2QICA 4YYNA 3C6WA 2RO1A 4LZSA 3ZYUA 5F25A 1DVPA 5E9MA 3O36A 4S3OB 4R8PK 2YT5A 4O7FA 2F6JA 2KYUA 5A83A 2K1JA 2LV9A 5EWDA 3U5OA 2E6RA 2LRIC 4QR4A 4TZ2A 2EA6A 4TZ8A 5EWWA 2OUOA 4J3IA 4UP5A 2MNZA 4F3IA 4WIVA 5EM3A 5TCMA 5FG4A 2NAAA 5IIDA 2YQLA 4XUBA 2LGKA 4BW1A 4MR5A 4J0RA 2MNYA 4HXOA 5EU1A 4LLBA 5G04B 5E9YA 5A81A 1WEVA 2R0SA 4OGIA 5D0CA 5E7DA 5D3NA 2R10A 3IU5A 5B77A 4LK9A 2JMIA 1T1HA 4GB0A 3JVLA 5CUGA 3QZSA 2XB1A 4NQNA 5HFRA 4Z93A 5LKTA 5CTLA 5LCWB 2DKWA 5CZGA 4NYXA 1HYIA 5AMFA 5HQ6A 5LKZA 4CUQA 4NN2A 4LYSA 3UV4A 3DQVR 4YC9A 3SOUA 4YBTA 2E7NA 4HXPA 4LDFA 1WFKA 4J0SA 3HCSA 4OGJA 4C66A 5D3SA 5FH8A 5DW1A 5C85A 5DX4A 4TS8A 4MR6A 4FK5A 4Q0NA 4QC1A 3T7LA 3N9OA 5EI4A 3KV5A 2RFJA 3AADA 1BORA 3M63A 3ZPV1 4YYJA 4LR6A 4LZRA 2OXQC 4TT4A 2Y1MA 4ZW1A 5CFWA 2K4DA 5CQ8A 1FP0A 5D26A 1WEEA 2H0DA 2I8NA 2XEUA 3P1EA 5CUAA 4LRGA 4YYKA 4A9HA 4YK0A 5DFBA 5II2A 5EWVA 4GNEA 4A49A 2DVRA 1X0JA 5L8UA 4V3LC 2I7KA 2R0YA 3PUQA 3RPGB 3VK6A 1EQFA 3QZVA 3TLPA 4E96A 5A5QA 3SVHA 5EQ1A 5HENA 4I7DA 3S92A 3SVGA 3GG3A 5FBXA 1WE9A 3FKMX 5FE4A 4O7EA 2VJFB 4ZC9A 4CUSA 5DKDA 5E3GA 4MSXA 5DFCA 3I2DA 2DWWA 5CQ6A 3K2JA 4TKPB 3SOXA 4CA1A 2RNYA 4NRBA 2YYNA 5HQ5A 3ZVYA 4PCEA 5FE6A 1E6IA 5C11A 3NG2A 2PUYA 4O78A 5LVRA 4LJNA 4AYCA 5EK9A 2FUUA 1FBVA 4UITA 4XUAA 2YHOA 4QB3A 4A9NA 5HCLA 3HMEA 4A9MA 2KIZA 2RNWA 4IOOA 4YY4A 5G4RA 4TT6A 5B75A 5IG6A 5K29A 5B78A 3L1ZB 5LJ0A 5FE9A 4IC2A 2VJFA 3ASLA 5D7XA 5E9IA 4QNSA 4QF2A 3HMHA 3RTRB 2I50A 2ECVA 4MVTA 3JVMA 2L84A 5EICA 5FB0A 5ENBA 1Z6UA 4HXLA 5KH7A 5JG6A 3MXFA 5DINA 3LQHA 3U5KA 4HBWA 5LJ2A 5CQ5A 2OSSA 4QSSA 2JRJA 2L85A 5TBNA 5LJ1A 5LUUA 1N87A 4WZ2A 4O77A 4PTBA 4IR4A 4NS5A 2CKLB 5C87A 3P1DA 5I29A 5E9VA 3P1CA 2FUIA 4TTEA 4BW2A 3AQAA 2YUCA 5TDWA 2D8SA 4GNDA 5CS8A 5A5NA 3SHBA 2EODA 4F52B 4LYWA 5EPBA 1U6GB 2MD8C 2OO1A 4O75A 4UIZA 4UYHA 2L75A 5A7CA 4QUTA 4A0CD 3IU6A 4RVRA 4WA6A 2KWOA 5DFDA 5FG6A 4XYAA 5FE1A 4HXNA 5I89A 4IR6A 5EGUA 4A9JA 5ETBA 4CUTA 1F68A 4NRCA 2CKLA 2G6QA 2YSJA 5A82A 3N9PA 1HYJA 3MB3A 2DVQA 5AD2A 4HBXA 1XWHA 4QR3A 2MA5A 5AIUA 4GPJA 4YBMA 3ZPVE 3U5MA 5CQ3A 2DVVA 3G0JA 1MM2A 5KH3A 4NYWA 5TRBA 4Y03A 4GNFA 2YEMA 5ACYA 3U5LA 5E9LA 5C7NA 4UI9B 5B76A 2YW8A 5KTUA 4UIVA 5E73A 4NUCA 1LDJB 2DX8A 2WP1A 4CUUA 5CGPA 1WEWA 4QUUA 5ENEA 3ZTGA 4YYMA 2H60A 5TB6A 4IORA 5F3AA 4YBSA 4TT2A 2KFTA 4MR3A 4N4HA 5JWMA 2KWNA 2MIQA 4IR5A 5FH7A 5KO4A 5D25A 5ETDA 2M85A 2VPEA 2BAYA 1WEOA 5D1KB 2KGGA 4KCXA 2ECWA 5HEMA 4UYGA 5H1UA 5HJCA 5EPSA 2EGPA 2YQMA 2GRCA 5CQ7A 3LQJA 5CU8A 2D9EA 3PURA 4A9OA 4XI1A 3UVYA 5FE0A 3O34A 4N4GA 2LGVA 2ZETC 3O37A 5I80A 3HTKC 2KWJA 4UYEA 3MHHA 4IC3A 4W4UA 3UVWA 1WENA 3MHSA 2YSMA 5DLXA 4BJXA 5TABA 3JVKA 4O7BA 5COIA 2E6SA 2KU3A 5I40A 1WEPA 4PCIA 2RSDA 5KU3A 2MD7B 5ENCA 3JVJA 5I7XA 4ZQLA 2Y1NA 4L58A 5EPRA 4NR9A 3L1XA 5I86A 5KTWA 5H1TA 5D24A 5AD3A 1WEQA 5I7YA 3I3JA 4Z1QA 2VPGA 4UYFB 2G4AA 5E9KA 5HFQA 3UV5A 3D7CA 4DONA 3ZYQA 5FFYA 2IDAA 4YYHA 2G43A 5TDRA 1JM7A 3UVXA 4O70A 4QZSA 3DAIA 4FO9A 3SVFA 5I88A 1Z2QA 5HRWA 5D1LB 5H9MA 4P5OB 5F60A 3ONIA 5I3LA 5FG5A 4MEPA 4MR4A 3EB6A 3M99A 4S3OC 5AITA 5FE8A 4NUDA 5DKCA 4MEOA 5L98A 3MULA 4PY6A 2ECJA 4FLPA 4B86C 1E4UA 5E0RA 2KREA 4UIWA 5A5PA 2CT2A 2DATA 4HXMA 5ENGA 2HDPA 2LGLA 5FE2A 2WP2A 4TU4A 2KTBB 4LKAA 4MEQA 5EWCA 5A5SA 4BW3A 4QYDA 5AMEA 5CPEA 5J3XA 4UYDA 3S91A 5A85A 2C2VS 3N9QA 2R0VA 2LSPB 4TU6A 2QIZA 5C13A 4N3WA 5B79A 4Q0OA 5B8DA 5BT3A 5FDZA 2VNFA 4WZ0A 5FH6A 4QEWA 4YYDA 4Z6IA 4YADA 4O74A 5CUBA 5L97A 5D3TA 4A9LA 2HYED 4QSVA 4QSWA 4R2YA 2KWKA 4NYVA 4UYFA 5H1VA 2VJEB 3L11A 2H0DB 4CUPA 4TYLA 2FSAA 5BT5A 2VP7A 3IHPA 3QZTA 5DLZA 5D3RA 3EB5A 5F61A 1V87A 5L96A 2RS9B 5FB1A 3UV2A 4HXSA 5HQ7A 1LDKC 4CFLA 4YY6A 4LC2A 5IGMA 4C9ZA 4YYIA 3O33A 2LDRA 2LXHC 2YDWA 5H85A 4X3GA 4NR5A 5F1HA 3KV6A 4KV4A 5G4SA 5C89A 3V43A 5ENHA 3SOWA 4QR5A 4NR7A 2F6NA 5CQAA 4YAXA 4GNGA 5DYAA 4C67A 4QBMA 4QSQA 5C8GA 1WILA 4YATA 4WHUA 3RPGC 3PHDA 5HLSA 4IR3A 3MB4A 2L5UA 2G45A 5CUEA 2PNXA 4KV1A 5ENIA 1VD4A 4B7YC 4CL9A 4QSUA 2C2LA 2AN6A 4LADB 3P5OA 2D82A 5I83A 5CRZA 5EYAF 1IYMA 2JMJA 4LYIA 1RMDA 1Z60A 5EP7A 4TQNA 5HRVA 2YHNA 2YELA 4YH4A 5JI8A 3MUKA 3GV4A 1ZS5A 4QF3A 4A4BA 4ZUXU 2VJEA 4O7AA 3P1FA 1WUGA 3GL6A 4LZ2A 4QEVA 2F42A 4PKLA 5KTXA 4PS5A 5DW2A 3N9MA 4XY9A 4I7BA 3LJWA 4A9FA 2QJ0A 5A5RA 5ENFA 5IGKA 1ZBDB 4O71A 3ZVZB 2MUMA 1WGMA 2YURA 4FIPA 5DBMA 3KNVA 5FERA 5DYCA 2M6MA 3DPLR 5I1QA 4CFKA 4NXJA 2M1RA 4YH3A 1CHCA 5CUDA 4MENA 4AUQB 4X2IA 1G25A 5IGLA 5DY7A 5C4QA 4QSTA 2DVSA 5KHMA 4UIXA 1WIMA 2L80A 3ZNIA 4A4CA 2RI7A 5J0DA 2LN0A 2VPDA 4AKNA 4AYCB 5F5ZA 4QSPA 3FL2A 4ZDTA 3KQIA 4CURA 4ALHA 1VFYA 5D3PA 2ECGA 4CCGX 5F36A 2LQ6A 4NRAA 2LGGA 1JM7B 3N9LA 2L43A 3LXJA 3O35A 5EA1A 4QEUA 4BW4A 2L0BA 4N4FA 4NR6A 3U5PA 5IGNA 4NR4A 5DKAA 2YREA 4A9KA 5KH9A 1MM3A 4YYGA 5L99A 2YW5A 2UZGA 2Y43A 5A5OA 4Q6FA 5LKXA 1WEMA 4V3KC 5CRMA 4I7CA 5CQTA 2LXPC 2KR4A 4UP0A 5G05B 5DKHA 4OUFA 3U5JA 2E7OA 5D3JA 5F1LA 5IBNA 3U5NA 4A9EA 4FJCA 3RCWA 4NR8A 4O64A 2K17A 2E3KA 5DYUA 2CSYA 2VPBA 2NXBA 2RNXA 3T6RA 5G0FA 5FE5A 1F62A 5FEYA 3M62A 3HMFA
chains in the Genus database with same CATH superfamily
3C5KA 2YQDA 4AP4A 2K16A 3HCTA 4UIUA 5EVAA 1JSPB 4HBVA 5ENJA 4UIYA 5FFVA 2YYRA 4CLBA 1N72A 2M3HA 2N9GA 5LKUA 3LRQA 4HXRA 5CY9A 4QYLA 5D1MB 5EWHA 1JOCA 4L7XA 4QSRA 3Q1DA 2MA6A 5HELA 4HBYA 5E74A 4PPEA 4WZ3B 5L8TA 3O70A 5FE3A 1WEUA 4O72A 5LVQA 2KGIA 4O7CA 3LQIA 5DYXA 4XY8A 5F62A 3UW9A 5FE7A 2ECTA 2KE1A 4BHWA 4ALGA 4R7EA 3Q2FA 2KKXA 2ECIA 4O76A 5HM0A 2YU4A 4Z1SA 5CP5A 2JMDA 4BBQA 3NXBA 4QSXA 4NQMA 3HCUA 5D3HA 2MKEA 5EV9A 3O47A 3LVRE 4AVXA 3G0LA 4J1PA 4YABA 3DWYA 1X4IA 5F63A 1JM4B 5E3DA 5II1A 1ZKRA 3Q2EA 1K2FA 4IOQA 5HRXA 5CQ4A 1WESA 5D3LA 2YEKA 3MQMA 3O7AA 2MJVB 4QY4A 2DJAA 2EGMA 4Z6HA 3N9NA 3UVDA 2L5EA 4QC3A 2MT5A 2ECNA 4WHWA 1VYXA 4A9IA 1WUMA 4HXKA 5CUCA 5F2PA 4N4IA 1X4UA 4NUEA 5FFWA 1X4JA 2CSZA 5EISA 5BT4A 2QICA 4YYNA 3LVQE 3C6WA 2RO1A 4LZSA 3ZYUA 5F25A 1DVPA 5E9MA 3O36A 4S3OB 4R8PK 2YT5A 4O7FA 2F6JA 2KYUA 4OGEA 5A83A 2K1JA 2LV9A 5EWDA 3U5OA 2E6RA 2LRIC 3SUBA 4QR4A 4TZ2A 2EA6A 4TZ8A 5EWWA 2OUOA 4J3IA 4UP5A 2MNZA 2XP0A 4F3IA 4WIVA 5EM3A 5TCMA 5FG4A 2NAAA 5IIDA 2YQLA 4XUBA 2LGKA 4BW1A 4MR5A 4J0RA 2MNYA 4HXOA 5EU1A 4LLBA 5G04B 5E9YA 5A81A 1WEVA 2R0SA 4OGIA 5D0CA 5E7DA 5D3NA 2R10A 3IU5A 5B77A 3FAOA 4LK9A 2JMIA 1T1HA 4AI6A 4GB0A 3JVLA 5CUGA 3QZSA 2XB1A 4NQNA 5HFRA 4Z93A 5LKTA 5CTLA 5LCWB 2DKWA 2D8UA 5CZGA 4NYXA 1HYIA 5AMFA 5HQ6A 5LKZA 4CUQA 4NN2A 4LYSA 3UV4A 3DQVR 4YC9A 3SOUA 4YBTA 2E7NA 4HXPA 4LDFA 1WFKA 4J0SA 3HCSA 4OGJA 4C66A 5D3SA 5FH8A 5DW1A 4QQ4A 5C85A 3VKHA 5DX4A 4TS8A 4MR6A 4FK5A 4Q0NA 4QC1A 3T7LA 3N9OA 5EI4A 3KV5A 2RFJA 3AADA 1BORA 3M63A 3ZPV1 4YYJA 4O62A 4LR6A 4LZRA 2OXQC 4TT4A 2Y1MA 4ZW1A 5CFWA 2K4DA 5CQ8A 1FP0A 5D26A 1WEEA 2H0DA 2I8NA 2XEUA 3P1EA 5CUAA 4LRGA 4YYKA 4A9HA 4YK0A 5DFBA 5II2A 5EWVA 4GNEA 4A49A 2DVRA 5SVYA 1X0JA 5L8UA 4V3LC 2I7KA 2R0YA 3PUQA 3RPGB 3VK6A 1EQFA 3QZVA 3TLPA 4E96A 5A5QA 3SVHA 4F1PA 4AKGA 5EQ1A 5HENA 4I7DA 3S92A 3SVGA 3GG3A 5FBXA 5SVXA 1WE9A 3FKMX 5FE4A 4O7EA 2VJFB 4ZC9A 4CUSA 5DKDA 5E3GA 4MSXA 5DFCA 3I2DA 2DWWA 5CQ6A 3K2JA 4TKPB 3SOXA 4CA1A 2RNYA 4NRBA 2YYNA 5HQ5A 3ZVYA 4PCEA 5FE6A 1E6IA 5C11A 3NG2A 2PUYA 4O78A 5LVRA 4LJNA 4AYCA 5EK9A 2FUUA 1FBVA 3H7HA 4UITA 4XUAA 2YHOA 4QB3A 2L7PA 4A9NA 5HCLA 3HMEA 4A9MA 2KIZA 2RNWA 4IOOA 4YY4A 3KDEC 5G4RA 4TT6A 5B75A 5IG6A 5K29A 5B78A 3L1ZB 5LJ0A 5FE9A 4IC2A 2VJFA 3ASLA 5D7XA 5E9IA 4QNSA 4QF2A 3HMHA 3RTRB 2I50A 2ECVA 4MVTA 3JVMA 2L84A 5EICA 5FB0A 5ENBA 1Z6UA 4HXLA 5KH7A 2CRRA 5JG6A 3MXFA 2CSVA 5DINA 3LQHA 3U5KA 4HBWA 5LJ2A 5CQ5A 2OSSA 4QSSA 2JRJA 2L85A 5TBNA 5LJ1A 5LUUA 1N87A 4WZ2A 4O77A 4PTBA 2YVRA 4AKIA 4IR4A 4NS5A 2CKLB 5C87A 3P1DA 5I29A 5E9VA 3P1CA 2FUIA 4TTEA 4BW2A 3AQAA 2YUCA 5TDWA 2D8SA 4GNDA 5CS8A 5A5NA 3SHBA 2EODA 4F52B 4LYWA 5EPBA 1U6GB 2MD8C 2XOYA 2OO1A 3D1BA 4O75A 4UIZA 4UYHA 2L75A 3FJUB 5A7CA 4QUTA 4A0CD 3IU6A 4RVRA 4WA6A 2KWOA 5DFDA 5FG6A 4XYAA 5FE1A 4HXNA 5I89A 4IR6A 5EGUA 4A9JA 5ETBA 4CUTA 1F68A 4NRCA 2CKLA 2G6QA 2LAUA 5A82A 2YSJA 3N9PA 1HYJA 3MB3A 2DVQA 5AD2A 4HBXA 1XWHA 4QR3A 2MA5A 5AIUA 4GPJA 4YBMA 3ZPVE 3U5MA 5CQ3A 2DVVA 3G0JA 1MM2A 5KH3A 4NYWA 5TRBA 4Y03A 4GNFA 2YEMA 5ACYA 3U5LA 5E9LA 5C7NA 4UI9B 5B76A 2YW8A 5KTUA 4UIVA 1DCQA 5E73A 4NUCA 1LDJB 2DX8A 2WP1A 4CUUA 5CGPA 1WEWA 4QUUA 5ENEA 2CRWA 3ZTGA 4YYMA 2FD4A 2H60A 5TB6A 4IORA 5F3AA 4YBSA 4Z0RA 4TT2A 2KFTA 4MR3A 4N4HA 5JWMA 2KWNA 2MIQA 3DWDA 4IR5A 5FH7A 5KO4A 5D25A 5ETDA 2M85A 2VPEA 2BAYA 1WEOA 5D1KB 2KGGA 4KCXA 2ECWA 5HEMA 4UYGA 4Z0OA 5H1UA 5HJCA 5EPSA 2EGPA 2YQMA 2GRCA 5CQ7A 3LQJA 2JUNA 5CU8A 3FEHA 2D9EA 3PURA 4A9OA 3DDTA 1MBMA 4XI1A 3UVYA 5FE0A 3O34A 4N4GA 2LGVA 2ZETC 3O37A 5I80A 3HTKC 2KWJA 4UYEA 3MHHA 4IC3A 4W4UA 3UVWA 1WENA 3MHSA 2YSMA 5DLXA 4BJXA 4H9DA 5TABA 3JVKA 4O7BA 5COIA 2E6SA 2KU3A 5I40A 1WEPA 4PCIA 2RSDA 5KU3A 2MD7B 5ENCA 3JVJA 5I7XA 4ZQLA 2XOZA 2Y1NA 4L58A 5EPRA 4NR9A 3L1XA 5I86A 5KTWA 5H1TA 5D24A 5AD3A 1WEQA 5I7YA 3I3JA 4Z1QA 2VPGA 4UYFB 3M7KA 2G4AA 5E9KA 5HFQA 3UV5A 3D7CA 4DONA 3ZYQA 5FFYA 2IDAA 4YYHA 2G43A 5TDRA 2M13A 1JM7A 3UVXA 4O70A 4QZSA 2CONA 3DAIA 4FO9A 3SVFA 5I88A 1Z2QA 5HRWA 5D1LB 2KKYA 5H9MA 4P5OB 5F60A 3ONIA 5I3LA 5FG5A 4MEPA 4MR4A 2XOCA 3EB6A 3M99A 4S3OC 5AITA 5SVIA 5FE8A 4NUDA 5DKCA 4MEOA 5L98A 3MULA 4PY6A 2ECJA 4FLPA 4B86C 3JUEA 1E4UA 5E0RA 2KREA 4UIWA 5A5PA 2CT2A 2DATA 4HXMA 5ENGA 2HDPA 2LGLA 2IQJA 5FE2A 2WP2A 4TU4A 2KTBB 4LKAA 4MEQA 5EWCA 5A5SA 4BW3A 3FANA 4QYDA 5AMEA 5CPEA 5J3XA 4UYDA 3S91A 5A85A 2C2VS 3N9QA 2R0VA 2LSPB 4TU6A 2QIZA 5C13A 4N3WA 5B79A 4Q0OA 5B8DA 5BT3A 5FDZA 2VNFA 4WZ0A 5FH6A 4QEWA 4YYDA 4Z6IA 4YADA 4O74A 5CUBA 5L97A 5D3TA 4A9LA 3PLWA 2HYED 4QSVA 4QSWA 4R2YA 2KWKA 4NYVA 4UYFA 5H1VA 2VJEB 3L11A 2H0DB 4CUPA 4TYLA 2FSAA 3D1DA 5BT5A 2VP7A 3IHPA 3QZTA 5DLZA 5D3RA 3EB5A 5F61A 1V87A 5L96A 2RS9B 5FB1A 3UV2A 4HXSA 5HQ7A 1LDKC 2EJNA 4CFLA 4YY6A 4LC2A 5IGMA 4C9ZA 4YYIA 3O33A 2LDRA 2LXHC 2JM3A 2YDWA 2B0OE 5H85A 4X3GA 4NR5A 4AKHA 5F1HA 3KV6A 4KV4A 5G4SA 5C89A 3V43A 5ENHA 3SOWA 4QR5A 4NR7A 2F6NA 5CQAA 4YAXA 3MDBC 4GNGA 5DYAA 4C67A 4QBMA 4QSQA 5C8GA 1WILA 4YATA 4WHUA 3RPGC 3PHDA 5HLSA 4IR3A 3MB4A 2L5UA 2G45A 5CUEA 2PNXA 3E2DA 4KV1A 5ENIA 1VD4A 4B7YC 4CL9A 4QSUA 2C2LA 2AN6A 4LADB 3P5OA 2D82A 5I83A 5CRZA 5EYAF 1IYMA 2JMJA 4LYIA 1RMDA 2EXUA 1Z60A 5EP7A 4TQNA 5HRVA 2OWAA 2YHNA 2YELA 4YH4A 5JI8A 3MUKA 3GV4A 1ZS5A 4QF3A 4A4BA 4ZUXU 2VJEA 4O7AA 3P1FA 1WUGA 3T9KA 3GL6A 4LZ2A 4QEVA 2F42A 4PKLA 5KTXA 2DSMA 4PS5A 5DW2A 3N9MA 4XY9A 4I7BA 4OGCA 3LJWA 4A9FA 2QJ0A 5A5RA 5ENFA 5IGKA 1ZBDB 4O71A 3ZVZB 2MUMA 1WGMA 2E61A 2YURA 4FIPA 2P57A 5DBMA 3KNVA 5FERA 5DYCA 2M6MA 3DPLR 5I1QA 4CFKA 4NXJA 2M1RA 4YH3A 3LJUX 1CHCA 5CUDA 4MENA 4AUQB 4X2IA 1G25A 5IGLA 5DY7A 5C4QA 4QSTA 2DVSA 5KHMA 4UIXA 1WIMA 2L80A 3ZNIA 4A4CA 2RI7A 5J0DA 2LN0A 2VPDA 4AKNA 4AYCB 1PUOA 5F5ZA 4QSPA 3FL2A 4ZDTA 3KQIA 4CURA 4ALHA 1VFYA 5D3PA 2ECGA 4CCGX 5F36A 2LQ6A 4NRAA 2LGGA 1JM7B 3N9LA 2L43A 5K3QA 3LXJA 3O35A 5EA1A 4QEUA 4BW4A 2L0BA 4N4FA 4NR6A 3U5PA 5IGNA 4NR4A 5DKAA 2YREA 4A9KA 5KH9A 5SVIB 3LDYA 1MM3A 4YYGA 3VKGA 3FM8C 5L99A 2YW5A 2UZGA 2Y43A 5A5OA 4Q6FA 5LKXA 1WEMA 4V3KC 5CRMA 2FFWA 4I7CA 5CQTA 2LXPC 2KR4A 4UP0A 5G05B 5DKHA 4OUFA 3U5JA 2E7OA 5D3JA 5F1LA 5IBNA 3U5NA 4A9EA 4FJCA 3RCWA 4NR8A 4O64A 2K17A 2E3KA 5DYUA 2CSYA 2RR4A 2VPBA 2NXBA 2RNXA 3T6RA 5G0FA 5FE5A 3ERRA 5FEYA 3M62A 1F62A 3HMFA
chains in the Genus database with same CATH topology
3C5KA 2YQDA 4AP4A 2K16A 3HCTA 4UIUA 5EVAA 1JSPB 4HBVA 5ENJA 4UIYA 5FFVA 2YYRA 4CLBA 1N72A 2M3HA 2N9GA 5LKUA 3LRQA 4HXRA 5CY9A 4QYLA 5D1MB 5EWHA 1JOCA 4L7XA 4QSRA 2MA6A 5HELA 4HBYA 5E74A 4PPEA 4WZ3B 5L8TA 3O70A 5FE3A 1WEUA 4O72A 5LVQA 2KGIA 4O7CA 3LQIA 5DYXA 4XY8A 5F62A 3UW9A 5FE7A 2ECTA 2KE1A 4BHWA 4ALGA 4R7EA 3Q2FA 2ECIA 4O76A 5HM0A 2YU4A 4Z1SA 5CP5A 2JMDA 4BBQA 3NXBA 4QSXA 4NQMA 3HCUA 5D3HA 5EV9A 4AVXA 3G0LA 4J1PA 4YABA 3DWYA 1X4IA 5F63A 1JM4B 5E3DA 5II1A 3Q2EA 1K2FA 4IOQA 5HRXA 5CQ4A 1WESA 5D3LA 2YEKA 3MQMA 3O7AA 2MJVB 4QY4A 4Z6HA 3N9NA 3UVDA 2L5EA 4QC3A 2MT5A 2ECNA 4WHWA 1VYXA 4A9IA 1WUMA 4HXKA 5CUCA 5F2PA 4N4IA 1X4UA 4NUEA 5FFWA 1X4JA 2CSZA 5EISA 5BT4A 2QICA 4YYNA 3C6WA 2RO1A 4LZSA 3ZYUA 5F25A 1DVPA 5E9MA 3O36A 4S3OB 4R8PK 2YT5A 4O7FA 2F6JA 2KYUA 5A83A 2K1JA 2LV9A 5EWDA 3U5OA 2E6RA 2LRIC 4QR4A 4TZ2A 2EA6A 4TZ8A 5EWWA 2OUOA 4J3IA 4UP5A 2MNZA 4F3IA 4WIVA 5EM3A 5TCMA 5FG4A 2NAAA 5IIDA 2YQLA 4XUBA 2LGKA 4BW1A 4MR5A 4J0RA 2MNYA 4HXOA 5EU1A 4LLBA 5G04B 5E9YA 5A81A 1WEVA 2R0SA 4OGIA 5D0CA 5E7DA 5D3NA 2R10A 3IU5A 5B77A 4LK9A 2JMIA 1T1HA 4GB0A 3JVLA 5CUGA 3QZSA 2XB1A 4NQNA 5HFRA 4Z93A 5LKTA 5CTLA 5LCWB 2DKWA 5CZGA 4NYXA 1HYIA 5AMFA 5HQ6A 5LKZA 4CUQA 4NN2A 4LYSA 3UV4A 3DQVR 4YC9A 3SOUA 4YBTA 2E7NA 4HXPA 4LDFA 1WFKA 4J0SA 3HCSA 4OGJA 4C66A 5D3SA 5FH8A 5DW1A 5C85A 5DX4A 4TS8A 4MR6A 4FK5A 4Q0NA 4QC1A 3T7LA 3N9OA 5EI4A 3KV5A 2RFJA 3AADA 1BORA 3M63A 3ZPV1 4YYJA 4LR6A 4LZRA 2OXQC 4TT4A 2Y1MA 4ZW1A 5CFWA 2K4DA 5CQ8A 1FP0A 5D26A 1WEEA 2H0DA 2I8NA 2XEUA 3P1EA 5CUAA 4LRGA 4YYKA 4A9HA 4YK0A 5DFBA 5II2A 5EWVA 4GNEA 4A49A 2DVRA 1X0JA 5L8UA 4V3LC 2I7KA 2R0YA 3PUQA 3RPGB 3VK6A 1EQFA 3QZVA 3TLPA 4E96A 5A5QA 3SVHA 5EQ1A 5HENA 4I7DA 3S92A 3SVGA 3GG3A 5FBXA 1WE9A 3FKMX 5FE4A 4O7EA 2VJFB 4ZC9A 4CUSA 5DKDA 5E3GA 4MSXA 5DFCA 3I2DA 2DWWA 5CQ6A 3K2JA 4TKPB 3SOXA 4CA1A 2RNYA 4NRBA 2YYNA 5HQ5A 3ZVYA 4PCEA 5FE6A 1E6IA 5C11A 3NG2A 2PUYA 4O78A 5LVRA 4LJNA 4AYCA 5EK9A 2FUUA 1FBVA 4UITA 4XUAA 2YHOA 4QB3A 4A9NA 5HCLA 3HMEA 4A9MA 2KIZA 2RNWA 4IOOA 4YY4A 5G4RA 4TT6A 5B75A 5IG6A 5K29A 5B78A 3L1ZB 5LJ0A 5FE9A 4IC2A 2VJFA 3ASLA 5D7XA 5E9IA 4QNSA 4QF2A 3HMHA 3RTRB 2I50A 2ECVA 4MVTA 3JVMA 2L84A 5EICA 5FB0A 5ENBA 1Z6UA 4HXLA 5KH7A 5JG6A 3MXFA 5DINA 3LQHA 3U5KA 4HBWA 5LJ2A 5CQ5A 2OSSA 4QSSA 2JRJA 2L85A 5TBNA 5LJ1A 5LUUA 1N87A 4WZ2A 4O77A 4PTBA 4IR4A 4NS5A 2CKLB 5C87A 3P1DA 5I29A 5E9VA 3P1CA 2FUIA 4TTEA 4BW2A 3AQAA 2YUCA 5TDWA 2D8SA 4GNDA 5CS8A 5A5NA 3SHBA 2EODA 4F52B 4LYWA 5EPBA 1U6GB 2MD8C 2OO1A 4O75A 4UIZA 4UYHA 2L75A 5A7CA 4QUTA 4A0CD 3IU6A 4RVRA 4WA6A 2KWOA 5DFDA 5FG6A 4XYAA 5FE1A 4HXNA 5I89A 4IR6A 5EGUA 4A9JA 5ETBA 4CUTA 1F68A 4NRCA 2CKLA 2G6QA 2YSJA 5A82A 3N9PA 1HYJA 3MB3A 2DVQA 5AD2A 4HBXA 1XWHA 4QR3A 2MA5A 5AIUA 4GPJA 4YBMA 3ZPVE 3U5MA 5CQ3A 2DVVA 3G0JA 1MM2A 5KH3A 4NYWA 5TRBA 4Y03A 4GNFA 2YEMA 5ACYA 3U5LA 5E9LA 5C7NA 4UI9B 5B76A 2YW8A 5KTUA 4UIVA 5E73A 4NUCA 1LDJB 2DX8A 2WP1A 4CUUA 5CGPA 1WEWA 4QUUA 5ENEA 3ZTGA 4YYMA 2H60A 5TB6A 4IORA 5F3AA 4YBSA 4TT2A 2KFTA 4MR3A 4N4HA 5JWMA 2KWNA 2MIQA 4IR5A 5FH7A 5KO4A 5D25A 5ETDA 2M85A 2VPEA 2BAYA 1WEOA 5D1KB 2KGGA 4KCXA 2ECWA 5HEMA 4UYGA 5H1UA 5HJCA 5EPSA 2EGPA 2YQMA 2GRCA 5CQ7A 3LQJA 5CU8A 2D9EA 3PURA 4A9OA 4XI1A 3UVYA 5FE0A 3O34A 4N4GA 2LGVA 2ZETC 3O37A 5I80A 3HTKC 2KWJA 4UYEA 3MHHA 4IC3A 4W4UA 3UVWA 1WENA 3MHSA 2YSMA 5DLXA 4BJXA 5TABA 3JVKA 4O7BA 5COIA 2E6SA 2KU3A 5I40A 1WEPA 4PCIA 2RSDA 5KU3A 2MD7B 5ENCA 3JVJA 5I7XA 4ZQLA 2Y1NA 4L58A 5EPRA 4NR9A 3L1XA 5I86A 5KTWA 5H1TA 5D24A 5AD3A 1WEQA 5I7YA 3I3JA 4Z1QA 2VPGA 4UYFB 2G4AA 5E9KA 5HFQA 3UV5A 3D7CA 4DONA 3ZYQA 5FFYA 2IDAA 4YYHA 2G43A 5TDRA 1JM7A 3UVXA 4O70A 4QZSA 3DAIA 4FO9A 3SVFA 5I88A 1Z2QA 5HRWA 5D1LB 5H9MA 4P5OB 5F60A 3ONIA 5I3LA 5FG5A 4MEPA 4MR4A 3EB6A 3M99A 4S3OC 5AITA 5FE8A 4NUDA 5DKCA 4MEOA 5L98A 3MULA 4PY6A 2ECJA 4FLPA 4B86C 1E4UA 5E0RA 2KREA 4UIWA 5A5PA 2CT2A 2DATA 4HXMA 5ENGA 2HDPA 2LGLA 5FE2A 2WP2A 4TU4A 2KTBB 4LKAA 4MEQA 5EWCA 5A5SA 4BW3A 4QYDA 5AMEA 5CPEA 5J3XA 4UYDA 3S91A 5A85A 2C2VS 3N9QA 2R0VA 2LSPB 4TU6A 2QIZA 5C13A 4N3WA 5B79A 4Q0OA 5B8DA 5BT3A 5FDZA 2VNFA 4WZ0A 5FH6A 4QEWA 4YYDA 4Z6IA 4YADA 4O74A 5CUBA 5L97A 5D3TA 4A9LA 2HYED 4QSVA 4QSWA 4R2YA 2KWKA 4NYVA 4UYFA 5H1VA 2VJEB 3L11A 2H0DB 4CUPA 4TYLA 2FSAA 5BT5A 2VP7A 3IHPA 3QZTA 5DLZA 5D3RA 3EB5A 5F61A 1V87A 5L96A 2RS9B 5FB1A 3UV2A 4HXSA 5HQ7A 1LDKC 4CFLA 4YY6A 4LC2A 5IGMA 4C9ZA 4YYIA 3O33A 2LDRA 2LXHC 2YDWA 5H85A 4X3GA 4NR5A 5F1HA 3KV6A 4KV4A 5G4SA 5C89A 3V43A 5ENHA 3SOWA 4QR5A 4NR7A 2F6NA 5CQAA 4YAXA 4GNGA 5DYAA 4C67A 4QBMA 4QSQA 5C8GA 1WILA 4YATA 4WHUA 3RPGC 3PHDA 5HLSA 4IR3A 3MB4A 2L5UA 2G45A 5CUEA 2PNXA 4KV1A 5ENIA 1VD4A 4B7YC 4CL9A 4QSUA 2C2LA 2AN6A 4LADB 3P5OA 2D82A 5I83A 5CRZA 5EYAF 1IYMA 2JMJA 4LYIA 1RMDA 1Z60A 5EP7A 4TQNA 5HRVA 2YHNA 2YELA 4YH4A 5JI8A 3MUKA 3GV4A 1ZS5A 4QF3A 4A4BA 4ZUXU 2VJEA 4O7AA 3P1FA 1WUGA 3GL6A 4LZ2A 4QEVA 2F42A 4PKLA 5KTXA 4PS5A 5DW2A 3N9MA 4XY9A 4I7BA 3LJWA 4A9FA 2QJ0A 5A5RA 5ENFA 5IGKA 1ZBDB 4O71A 3ZVZB 2MUMA 1WGMA 2YURA 4FIPA 5DBMA 3KNVA 5FERA 5DYCA 2M6MA 3DPLR 5I1QA 4CFKA 4NXJA 2M1RA 4YH3A 1CHCA 5CUDA 4MENA 4AUQB 4X2IA 1G25A 5IGLA 5DY7A 5C4QA 4QSTA 2DVSA 5KHMA 4UIXA 1WIMA 2L80A 3ZNIA 4A4CA 2RI7A 5J0DA 2LN0A 2VPDA 4AKNA 4AYCB 5F5ZA 4QSPA 3FL2A 4ZDTA 3KQIA 4CURA 4ALHA 1VFYA 5D3PA 2ECGA 4CCGX 5F36A 2LQ6A 4NRAA 2LGGA 1JM7B 3N9LA 2L43A 3LXJA 3O35A 5EA1A 4QEUA 4BW4A 2L0BA 4N4FA 4NR6A 3U5PA 5IGNA 4NR4A 5DKAA 2YREA 4A9KA 5KH9A 1MM3A 4YYGA 5L99A 2YW5A 2UZGA 2Y43A 5A5OA 4Q6FA 5LKXA 1WEMA 4V3KC 5CRMA 4I7CA 5CQTA 2LXPC 2KR4A 4UP0A 5G05B 5DKHA 4OUFA 3U5JA 2E7OA 5D3JA 5F1LA 5IBNA 3U5NA 4A9EA 4FJCA 3RCWA 4NR8A 4O64A 2K17A 2E3KA 5DYUA 2CSYA 2VPBA 2NXBA 2RNXA 3T6RA 5G0FA 5FE5A 1F62A 5FEYA 3M62A 3HMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5K A;  2YQD A;  4AP4 A;  2K16 A;  3HCT A;  4UIU A;  5EVA A;  1JSP B;  4HBV A;  5ENJ A;  4UIY A;  5FFV A;  2YYR A;  4CLB A;  1N72 A;  2M3H A;  2N9G A;  5LKU A;  3LRQ A;  4HXR A;  5CY9 A;  4QYL A;  5D1M B;  5EWH A;  1JOC A;  4L7X A;  4QSR A;  2MA6 A;  5HEL A;  4HBY A;  5E74 A;  4PPE A;  4WZ3 B;  5L8T A;  3O70 A;  5FE3 A;  1WEU A;  4O72 A;  5LVQ A;  2KGI A;  4O7C A;  3LQI A;  5DYX A;  4XY8 A;  5F62 A;  3UW9 A;  5FE7 A;  2ECT A;  2KE1 A;  4BHW A;  4ALG A;  4R7E A;  3Q2F A;  2ECI A;  4O76 A;  5HM0 A;  2YU4 A;  4Z1S A;  5CP5 A;  2JMD A;  4BBQ A;  3NXB A;  4QSX A;  4NQM A;  3HCU A;  5D3H A;  5EV9 A;  4AVX A;  3G0L A;  4J1P A;  4YAB A;  3DWY A;  1X4I A;  5F63 A;  1JM4 B;  5E3D A;  5II1 A;  3Q2E A;  1K2F A;  4IOQ A;  5HRX A;  5CQ4 A;  1WES A;  5D3L A;  2YEK A;  3MQM A;  3O7A A;  2MJV B;  4QY4 A;  4Z6H A;  3N9N A;  3UVD A;  2L5E A;  4QC3 A;  2MT5 A;  2ECN A;  4WHW A;  1VYX A;  4A9I A;  1WUM A;  4HXK A;  5CUC A;  5F2P A;  4N4I A;  1X4U A;  4NUE A;  5FFW A;  1X4J A;  2CSZ A;  5EIS A;  5BT4 A;  2QIC A;  4YYN A;  3C6W A;  2RO1 A;  4LZS A;  3ZYU A;  5F25 A;  1DVP A;  5E9M A;  3O36 A;  4S3O B;  4R8P K;  2YT5 A;  4O7F A;  2F6J A;  2KYU A;  5A83 A;  2K1J A;  2LV9 A;  5EWD A;  3U5O A;  2E6R A;  2LRI C;  4QR4 A;  4TZ2 A;  2EA6 A;  4TZ8 A;  5EWW A;  2OUO A;  4J3I A;  4UP5 A;  2MNZ A;  4F3I A;  4WIV A;  5EM3 A;  5TCM A;  5FG4 A;  2NAA A;  5IID A;  2YQL A;  4XUB A;  2LGK A;  4BW1 A;  4MR5 A;  4J0R A;  2MNY A;  4HXO A;  5EU1 A;  4LLB A;  5G04 B;  5E9Y A;  5A81 A;  1WEV A;  2R0S A;  4OGI A;  5D0C A;  5E7D A;  5D3N A;  2R10 A;  3IU5 A;  5B77 A;  4LK9 A;  2JMI A;  1T1H A;  4GB0 A;  3JVL A;  5CUG A;  3QZS A;  2XB1 A;  4NQN A;  5HFR A;  4Z93 A;  5LKT A;  5CTL A;  5LCW B;  2DKW A;  5CZG A;  4NYX A;  1HYI A;  5AMF A;  5HQ6 A;  5LKZ A;  4CUQ A;  4NN2 A;  4LYS A;  3UV4 A;  3DQV R;  4YC9 A;  3SOU A;  4YBT A;  2E7N A;  4HXP A;  4LDF A;  1WFK A;  4J0S A;  3HCS A;  4OGJ A;  4C66 A;  5D3S A;  5FH8 A;  5DW1 A;  5C85 A;  5DX4 A;  4TS8 A;  4MR6 A;  4FK5 A;  4Q0N A;  4QC1 A;  3T7L A;  3N9O A;  5EI4 A;  3KV5 A;  2RFJ A;  3AAD A;  1BOR A;  3M63 A;  3ZPV 1;  4YYJ A;  4LR6 A;  4LZR A;  2OXQ C;  4TT4 A;  2Y1M A;  4ZW1 A;  5CFW A;  2K4D A;  5CQ8 A;  1FP0 A;  5D26 A;  1WEE A;  2H0D A;  2I8N A;  2XEU A;  3P1E A;  5CUA A;  4LRG A;  4YYK A;  4A9H A;  4YK0 A;  5DFB A;  5II2 A;  5EWV A;  4GNE A;  4A49 A;  2DVR A;  1X0J A;  5L8U A;  4V3L C;  2I7K A;  2R0Y A;  3PUQ A;  3RPG B;  3VK6 A;  1EQF A;  3QZV A;  3TLP A;  4E96 A;  5A5Q A;  3SVH A;  5EQ1 A;  5HEN A;  4I7D A;  3S92 A;  3SVG A;  3GG3 A;  5FBX A;  1WE9 A;  3FKM X;  5FE4 A;  4O7E A;  2VJF B;  4ZC9 A;  4CUS A;  5DKD A;  5E3G A;  4MSX A;  5DFC A;  3I2D A;  2DWW A;  5CQ6 A;  3K2J A;  4TKP B;  3SOX A;  4CA1 A;  2RNY A;  4NRB A;  2YYN A;  5HQ5 A;  3ZVY A;  4PCE A;  5FE6 A;  1E6I A;  5C11 A;  3NG2 A;  2PUY A;  4O78 A;  5LVR A;  4LJN A;  4AYC A;  5EK9 A;  2FUU A;  1FBV A;  4UIT A;  4XUA A;  2YHO A;  4QB3 A;  4A9N A;  5HCL A;  3HME A;  4A9M A;  2KIZ A;  2RNW A;  4IOO A;  4YY4 A;  5G4R A;  4TT6 A;  5B75 A;  5IG6 A;  5K29 A;  5B78 A;  3L1Z B;  5LJ0 A;  5FE9 A;  4IC2 A;  2VJF A;  3ASL A;  5D7X A;  5E9I A;  4QNS A;  4QF2 A;  3HMH A;  3RTR B;  2I50 A;  2ECV A;  4MVT A;  3JVM A;  2L84 A;  5EIC A;  5FB0 A;  5ENB A;  1Z6U A;  4HXL A;  5KH7 A;  5JG6 A;  3MXF A;  5DIN A;  3LQH A;  3U5K A;  4HBW A;  5LJ2 A;  5CQ5 A;  2OSS A;  4QSS A;  2JRJ A;  2L85 A;  5TBN A;  5LJ1 A;  5LUU A;  1N87 A;  4WZ2 A;  4O77 A;  4PTB A;  4IR4 A;  4NS5 A;  2CKL B;  5C87 A;  3P1D A;  5I29 A;  5E9V A;  3P1C A;  2FUI A;  4TTE A;  4BW2 A;  3AQA A;  2YUC A;  5TDW A;  2D8S A;  4GND A;  5CS8 A;  5A5N A;  3SHB A;  2EOD A;  4F52 B;  4LYW A;  5EPB A;  1U6G B;  2MD8 C;  2OO1 A;  4O75 A;  4UIZ A;  4UYH A;  2L75 A;  5A7C A;  4QUT A;  4A0C D;  3IU6 A;  4RVR A;  4WA6 A;  2KWO A;  5DFD A;  5FG6 A;  4XYA A;  5FE1 A;  4HXN A;  5I89 A;  4IR6 A;  5EGU A;  4A9J A;  5ETB A;  4CUT A;  1F68 A;  4NRC A;  2CKL A;  2G6Q A;  2YSJ A;  5A82 A;  3N9P A;  1HYJ A;  3MB3 A;  2DVQ A;  5AD2 A;  4HBX A;  1XWH A;  4QR3 A;  2MA5 A;  5AIU A;  4GPJ A;  4YBM A;  3ZPV E;  3U5M A;  5CQ3 A;  2DVV A;  3G0J A;  1MM2 A;  5KH3 A;  4NYW A;  5TRB A;  4Y03 A;  4GNF A;  2YEM A;  5ACY A;  3U5L A;  5E9L A;  5C7N A;  4UI9 B;  5B76 A;  2YW8 A;  5KTU A;  4UIV A;  5E73 A;  4NUC A;  1LDJ B;  2DX8 A;  2WP1 A;  4CUU A;  5CGP A;  1WEW A;  4QUU A;  5ENE A;  3ZTG A;  4YYM A;  2H60 A;  5TB6 A;  4IOR A;  5F3A A;  4YBS A;  4TT2 A;  2KFT A;  4MR3 A;  4N4H A;  5JWM A;  2KWN A;  2MIQ A;  4IR5 A;  5FH7 A;  5KO4 A;  5D25 A;  5ETD A;  2M85 A;  2VPE A;  2BAY A;  1WEO A;  5D1K B;  2KGG A;  4KCX A;  2ECW A;  5HEM A;  4UYG A;  5H1U A;  5HJC A;  5EPS A;  2EGP A;  2YQM A;  2GRC A;  5CQ7 A;  3LQJ A;  5CU8 A;  2D9E A;  3PUR A;  4A9O A;  4XI1 A;  3UVY A;  5FE0 A;  3O34 A;  4N4G A;  2LGV A;  2ZET C;  3O37 A;  5I80 A;  3HTK C;  2KWJ A;  4UYE A;  3MHH A;  4IC3 A;  4W4U A;  3UVW A;  1WEN A;  3MHS A;  2YSM A;  5DLX A;  4BJX A;  5TAB A;  3JVK A;  4O7B A;  5COI A;  2E6S A;  2KU3 A;  5I40 A;  1WEP A;  4PCI A;  2RSD A;  5KU3 A;  2MD7 B;  5ENC A;  3JVJ A;  5I7X A;  4ZQL A;  2Y1N A;  4L58 A;  5EPR A;  4NR9 A;  3L1X A;  5I86 A;  5KTW A;  5H1T A;  5D24 A;  5AD3 A;  1WEQ A;  5I7Y A;  3I3J A;  4Z1Q A;  2VPG A;  4UYF B;  2G4A A;  5E9K A;  5HFQ A;  3UV5 A;  3D7C A;  4DON A;  3ZYQ A;  5FFY A;  2IDA A;  4YYH A;  2G43 A;  5TDR A;  1JM7 A;  3UVX A;  4O70 A;  4QZS A;  3DAI A;  4FO9 A;  3SVF A;  5I88 A;  1Z2Q A;  5HRW A;  5D1L B;  5H9M A;  4P5O B;  5F60 A;  3ONI A;  5I3L A;  5FG5 A;  4MEP A;  4MR4 A;  3EB6 A;  3M99 A;  4S3O C;  5AIT A;  5FE8 A;  4NUD A;  5DKC A;  4MEO A;  5L98 A;  3MUL A;  4PY6 A;  2ECJ A;  4FLP A;  4B86 C;  1E4U A;  5E0R A;  2KRE A;  4UIW A;  5A5P A;  2CT2 A;  2DAT A;  4HXM A;  5ENG A;  2HDP A;  2LGL A;  5FE2 A;  2WP2 A;  4TU4 A;  2KTB B;  4LKA A;  4MEQ A;  5EWC A;  5A5S A;  4BW3 A;  4QYD A;  5AME A;  5CPE A;  5J3X A;  4UYD A;  3S91 A;  5A85 A;  2C2V S;  3N9Q A;  2R0V A;  2LSP B;  4TU6 A;  2QIZ A;  5C13 A;  4N3W A;  5B79 A;  4Q0O A;  5B8D A;  5BT3 A;  5FDZ A;  2VNF A;  4WZ0 A;  5FH6 A;  4QEW A;  4YYD A;  4Z6I A;  4YAD A;  4O74 A;  5CUB A;  5L97 A;  5D3T A;  4A9L A;  2HYE D;  4QSV A;  4QSW A;  4R2Y A;  2KWK A;  4NYV A;  4UYF A;  5H1V A;  2VJE B;  3L11 A;  2H0D B;  4CUP A;  4TYL A;  2FSA A;  5BT5 A;  2VP7 A;  3IHP A;  3QZT A;  5DLZ A;  5D3R A;  3EB5 A;  5F61 A;  1V87 A;  5L96 A;  2RS9 B;  5FB1 A;  3UV2 A;  4HXS A;  5HQ7 A;  1LDK C;  4CFL A;  4YY6 A;  4LC2 A;  5IGM A;  4C9Z A;  4YYI A;  3O33 A;  2LDR A;  2LXH C;  2YDW A;  5H85 A;  4X3G A;  4NR5 A;  5F1H A;  3KV6 A;  4KV4 A;  5G4S A;  5C89 A;  3V43 A;  5ENH A;  3SOW A;  4QR5 A;  4NR7 A;  2F6N A;  5CQA A;  4YAX A;  4GNG A;  5DYA A;  4C67 A;  4QBM A;  4QSQ A;  5C8G A;  1WIL A;  4YAT A;  4WHU A;  3RPG C;  3PHD A;  5HLS A;  4IR3 A;  3MB4 A;  2L5U A;  2G45 A;  5CUE A;  2PNX A;  4KV1 A;  5ENI A;  1VD4 A;  4B7Y C;  4CL9 A;  4QSU A;  2C2L A;  2AN6 A;  4LAD B;  3P5O A;  2D82 A;  5I83 A;  5CRZ A;  5EYA F;  1IYM A;  2JMJ A;  4LYI A;  1RMD A;  1Z60 A;  5EP7 A;  4TQN A;  5HRV A;  2YHN A;  2YEL A;  4YH4 A;  5JI8 A;  3MUK A;  3GV4 A;  1ZS5 A;  4QF3 A;  4A4B A;  4ZUX U;  2VJE A;  4O7A A;  3P1F A;  1WUG A;  3GL6 A;  4LZ2 A;  4QEV A;  2F42 A;  4PKL A;  5KTX A;  4PS5 A;  5DW2 A;  3N9M A;  4XY9 A;  4I7B A;  3LJW A;  4A9F A;  2QJ0 A;  5A5R A;  5ENF A;  5IGK A;  1ZBD B;  4O71 A;  3ZVZ B;  2MUM A;  1WGM A;  2YUR A;  4FIP A;  5DBM A;  3KNV A;  5FER A;  5DYC A;  2M6M A;  3DPL R;  5I1Q A;  4CFK A;  4NXJ A;  2M1R A;  4YH3 A;  1CHC A;  5CUD A;  4MEN A;  4AUQ B;  4X2I A;  1G25 A;  5IGL A;  5DY7 A;  5C4Q A;  4QST A;  2DVS A;  5KHM A;  4UIX A;  1WIM A;  2L80 A;  3ZNI A;  4A4C A;  2RI7 A;  5J0D A;  2LN0 A;  2VPD A;  4AKN A;  4AYC B;  5F5Z A;  4QSP A;  3FL2 A;  4ZDT A;  3KQI A;  4CUR A;  4ALH A;  1VFY A;  5D3P A;  2ECG A;  4CCG X;  5F36 A;  2LQ6 A;  4NRA A;  2LGG A;  1JM7 B;  3N9L A;  2L43 A;  3LXJ A;  3O35 A;  5EA1 A;  4QEU A;  4BW4 A;  2L0B A;  4N4F A;  4NR6 A;  3U5P A;  5IGN A;  4NR4 A;  5DKA A;  2YRE A;  4A9K A;  5KH9 A;  1MM3 A;  4YYG A;  5L99 A;  2YW5 A;  2UZG A;  2Y43 A;  5A5O A;  4Q6F A;  5LKX A;  1WEM A;  4V3K C;  5CRM A;  4I7C A;  5CQT A;  2LXP C;  2KR4 A;  4UP0 A;  5G05 B;  5DKH A;  4OUF A;  3U5J A;  2E7O A;  5D3J A;  5F1L A;  5IBN A;  3U5N A;  4A9E A;  4FJC A;  3RCW A;  4NR8 A;  4O64 A;  2K17 A;  2E3K A;  5DYU A;  2CSY A;  2VPB A;  2NXB A;  2RNX A;  3T6R A;  5G0F A;  5FE5 A;  1F62 A;  5FEY A;  3M62 A;  3HMF A; 
#chains in the Genus database with same CATH topology
 3C5K A;  2YQD A;  4AP4 A;  2K16 A;  3HCT A;  4UIU A;  5EVA A;  1JSP B;  4HBV A;  5ENJ A;  4UIY A;  5FFV A;  2YYR A;  4CLB A;  1N72 A;  2M3H A;  2N9G A;  5LKU A;  3LRQ A;  4HXR A;  5CY9 A;  4QYL A;  5D1M B;  5EWH A;  1JOC A;  4L7X A;  4QSR A;  3Q1D A;  2MA6 A;  5HEL A;  4HBY A;  5E74 A;  4PPE A;  4WZ3 B;  5L8T A;  3O70 A;  5FE3 A;  1WEU A;  4O72 A;  5LVQ A;  2KGI A;  4O7C A;  3LQI A;  5DYX A;  4XY8 A;  5F62 A;  3UW9 A;  5FE7 A;  2ECT A;  2KE1 A;  4BHW A;  4ALG A;  4R7E A;  3Q2F A;  2KKX A;  2ECI A;  4O76 A;  5HM0 A;  2YU4 A;  4Z1S A;  5CP5 A;  2JMD A;  4BBQ A;  3NXB A;  4QSX A;  4NQM A;  3HCU A;  5D3H A;  2MKE A;  5EV9 A;  3O47 A;  3LVR E;  4AVX A;  3G0L A;  4J1P A;  4YAB A;  3DWY A;  1X4I A;  5F63 A;  1JM4 B;  5E3D A;  5II1 A;  1ZKR A;  3Q2E A;  1K2F A;  4IOQ A;  5HRX A;  5CQ4 A;  1WES A;  5D3L A;  2YEK A;  3MQM A;  3O7A A;  2MJV B;  4QY4 A;  2DJA A;  2EGM A;  4Z6H A;  3N9N A;  3UVD A;  2L5E A;  4QC3 A;  2MT5 A;  2ECN A;  4WHW A;  1VYX A;  4A9I A;  1WUM A;  4HXK A;  5CUC A;  5F2P A;  4N4I A;  1X4U A;  4NUE A;  5FFW A;  1X4J A;  2CSZ A;  5EIS A;  5BT4 A;  2QIC A;  4YYN A;  3LVQ E;  3C6W A;  2RO1 A;  4LZS A;  3ZYU A;  5F25 A;  1DVP A;  5E9M A;  3O36 A;  4S3O B;  4R8P K;  2YT5 A;  4O7F A;  2F6J A;  2KYU A;  4OGE A;  5A83 A;  2K1J A;  2LV9 A;  5EWD A;  3U5O A;  2E6R A;  2LRI C;  3SUB A;  4QR4 A;  4TZ2 A;  2EA6 A;  4TZ8 A;  5EWW A;  2OUO A;  4J3I A;  4UP5 A;  2MNZ A;  2XP0 A;  4F3I A;  4WIV A;  5EM3 A;  5TCM A;  5FG4 A;  2NAA A;  5IID A;  2YQL A;  4XUB A;  2LGK A;  4BW1 A;  4MR5 A;  4J0R A;  2MNY A;  4HXO A;  5EU1 A;  4LLB A;  5G04 B;  5E9Y A;  5A81 A;  1WEV A;  2R0S A;  4OGI A;  5D0C A;  5E7D A;  5D3N A;  2R10 A;  3IU5 A;  5B77 A;  3FAO A;  4LK9 A;  2JMI A;  1T1H A;  4AI6 A;  4GB0 A;  3JVL A;  5CUG A;  3QZS A;  2XB1 A;  4NQN A;  5HFR A;  4Z93 A;  5LKT A;  5CTL A;  5LCW B;  2DKW A;  2D8U A;  5CZG A;  4NYX A;  1HYI A;  5AMF A;  5HQ6 A;  5LKZ A;  4CUQ A;  4NN2 A;  4LYS A;  3UV4 A;  3DQV R;  4YC9 A;  3SOU A;  4YBT A;  2E7N A;  4HXP A;  4LDF A;  1WFK A;  4J0S A;  3HCS A;  4OGJ A;  4C66 A;  5D3S A;  5FH8 A;  5DW1 A;  4QQ4 A;  5C85 A;  3VKH A;  5DX4 A;  4TS8 A;  4MR6 A;  4FK5 A;  4Q0N A;  4QC1 A;  3T7L A;  3N9O A;  5EI4 A;  3KV5 A;  2RFJ A;  3AAD A;  1BOR A;  3M63 A;  3ZPV 1;  4YYJ A;  4O62 A;  4LR6 A;  4LZR A;  2OXQ C;  4TT4 A;  2Y1M A;  4ZW1 A;  5CFW A;  2K4D A;  5CQ8 A;  1FP0 A;  5D26 A;  1WEE A;  2H0D A;  2I8N A;  2XEU A;  3P1E A;  5CUA A;  4LRG A;  4YYK A;  4A9H A;  4YK0 A;  5DFB A;  5II2 A;  5EWV A;  4GNE A;  4A49 A;  2DVR A;  5SVY A;  1X0J A;  5L8U A;  4V3L C;  2I7K A;  2R0Y A;  3PUQ A;  3RPG B;  3VK6 A;  1EQF A;  3QZV A;  3TLP A;  4E96 A;  5A5Q A;  3SVH A;  4F1P A;  4AKG A;  5EQ1 A;  5HEN A;  4I7D A;  3S92 A;  3SVG A;  3GG3 A;  5FBX A;  5SVX A;  1WE9 A;  3FKM X;  5FE4 A;  4O7E A;  2VJF B;  4ZC9 A;  4CUS A;  5DKD A;  5E3G A;  4MSX A;  5DFC A;  3I2D A;  2DWW A;  5CQ6 A;  3K2J A;  4TKP B;  3SOX A;  4CA1 A;  2RNY A;  4NRB A;  2YYN A;  5HQ5 A;  3ZVY A;  4PCE A;  5FE6 A;  1E6I A;  5C11 A;  3NG2 A;  2PUY A;  4O78 A;  5LVR A;  4LJN A;  4AYC A;  5EK9 A;  2FUU A;  1FBV A;  3H7H A;  4UIT A;  4XUA A;  2YHO A;  4QB3 A;  2L7P A;  4A9N A;  5HCL A;  3HME A;  4A9M A;  2KIZ A;  2RNW A;  4IOO A;  4YY4 A;  3KDE C;  5G4R A;  4TT6 A;  5B75 A;  5IG6 A;  5K29 A;  5B78 A;  3L1Z B;  5LJ0 A;  5FE9 A;  4IC2 A;  2VJF A;  3ASL A;  5D7X A;  5E9I A;  4QNS A;  4QF2 A;  3HMH A;  3RTR B;  2I50 A;  2ECV A;  4MVT A;  3JVM A;  2L84 A;  5EIC A;  5FB0 A;  5ENB A;  1Z6U A;  4HXL A;  5KH7 A;  2CRR A;  5JG6 A;  3MXF A;  2CSV A;  5DIN A;  3LQH A;  3U5K A;  4HBW A;  5LJ2 A;  5CQ5 A;  2OSS A;  4QSS A;  2JRJ A;  2L85 A;  5TBN A;  5LJ1 A;  5LUU A;  1N87 A;  4WZ2 A;  4O77 A;  4PTB A;  2YVR A;  4AKI A;  4IR4 A;  4NS5 A;  2CKL B;  5C87 A;  3P1D A;  5I29 A;  5E9V A;  3P1C A;  2FUI A;  4TTE A;  4BW2 A;  3AQA A;  2YUC A;  5TDW A;  2D8S A;  4GND A;  5CS8 A;  5A5N A;  3SHB A;  2EOD A;  4F52 B;  4LYW A;  5EPB A;  1U6G B;  2MD8 C;  2XOY A;  2OO1 A;  3D1B A;  4O75 A;  4UIZ A;  4UYH A;  2L75 A;  3FJU B;  5A7C A;  4QUT A;  4A0C D;  3IU6 A;  4RVR A;  4WA6 A;  2KWO A;  5DFD A;  5FG6 A;  4XYA A;  5FE1 A;  4HXN A;  5I89 A;  4IR6 A;  5EGU A;  4A9J A;  5ETB A;  4CUT A;  1F68 A;  4NRC A;  2CKL A;  2G6Q A;  2LAU A;  5A82 A;  2YSJ A;  3N9P A;  1HYJ A;  3MB3 A;  2DVQ A;  5AD2 A;  4HBX A;  1XWH A;  4QR3 A;  2MA5 A;  5AIU A;  4GPJ A;  4YBM A;  3ZPV E;  3U5M A;  5CQ3 A;  2DVV A;  3G0J A;  1MM2 A;  5KH3 A;  4NYW A;  5TRB A;  4Y03 A;  4GNF A;  2YEM A;  5ACY A;  3U5L A;  5E9L A;  5C7N A;  4UI9 B;  5B76 A;  2YW8 A;  5KTU A;  4UIV A;  1DCQ A;  5E73 A;  4NUC A;  1LDJ B;  2DX8 A;  2WP1 A;  4CUU A;  5CGP A;  1WEW A;  4QUU A;  5ENE A;  2CRW A;  3ZTG A;  4YYM A;  2FD4 A;  2H60 A;  5TB6 A;  4IOR A;  5F3A A;  4YBS A;  4Z0R A;  4TT2 A;  2KFT A;  4MR3 A;  4N4H A;  5JWM A;  2KWN A;  2MIQ A;  3DWD A;  4IR5 A;  5FH7 A;  5KO4 A;  5D25 A;  5ETD A;  2M85 A;  2VPE A;  2BAY A;  1WEO A;  5D1K B;  2KGG A;  4KCX A;  2ECW A;  5HEM A;  4UYG A;  4Z0O A;  5H1U A;  5HJC A;  5EPS A;  2EGP A;  2YQM A;  2GRC A;  5CQ7 A;  3LQJ A;  2JUN A;  5CU8 A;  3FEH A;  2D9E A;  3PUR A;  4A9O A;  3DDT A;  1MBM A;  4XI1 A;  3UVY A;  5FE0 A;  3O34 A;  4N4G A;  2LGV A;  2ZET C;  3O37 A;  5I80 A;  3HTK C;  2KWJ A;  4UYE A;  3MHH A;  4IC3 A;  4W4U A;  3UVW A;  1WEN A;  3MHS A;  2YSM A;  5DLX A;  4BJX A;  4H9D A;  5TAB A;  3JVK A;  4O7B A;  5COI A;  2E6S A;  2KU3 A;  5I40 A;  1WEP A;  4PCI A;  2RSD A;  5KU3 A;  2MD7 B;  5ENC A;  3JVJ A;  5I7X A;  4ZQL A;  2XOZ A;  2Y1N A;  4L58 A;  5EPR A;  4NR9 A;  3L1X A;  5I86 A;  5KTW A;  5H1T A;  5D24 A;  5AD3 A;  1WEQ A;  5I7Y A;  3I3J A;  4Z1Q A;  2VPG A;  4UYF B;  3M7K A;  2G4A A;  5E9K A;  5HFQ A;  3UV5 A;  3D7C A;  4DON A;  3ZYQ A;  5FFY A;  2IDA A;  4YYH A;  2G43 A;  5TDR A;  2M13 A;  1JM7 A;  3UVX A;  4O70 A;  4QZS A;  2CON A;  3DAI A;  4FO9 A;  3SVF A;  5I88 A;  1Z2Q A;  5HRW A;  5D1L B;  2KKY A;  5H9M A;  4P5O B;  5F60 A;  3ONI A;  5I3L A;  5FG5 A;  4MEP A;  4MR4 A;  2XOC A;  3EB6 A;  3M99 A;  4S3O C;  5AIT A;  5SVI A;  5FE8 A;  4NUD A;  5DKC A;  4MEO A;  5L98 A;  3MUL A;  4PY6 A;  2ECJ A;  4FLP A;  4B86 C;  3JUE A;  1E4U A;  5E0R A;  2KRE A;  4UIW A;  5A5P A;  2CT2 A;  2DAT A;  4HXM A;  5ENG A;  2HDP A;  2LGL A;  2IQJ A;  5FE2 A;  2WP2 A;  4TU4 A;  2KTB B;  4LKA A;  4MEQ A;  5EWC A;  5A5S A;  4BW3 A;  3FAN A;  4QYD A;  5AME A;  5CPE A;  5J3X A;  4UYD A;  3S91 A;  5A85 A;  2C2V S;  3N9Q A;  2R0V A;  2LSP B;  4TU6 A;  2QIZ A;  5C13 A;  4N3W A;  5B79 A;  4Q0O A;  5B8D A;  5BT3 A;  5FDZ A;  2VNF A;  4WZ0 A;  5FH6 A;  4QEW A;  4YYD A;  4Z6I A;  4YAD A;  4O74 A;  5CUB A;  5L97 A;  5D3T A;  4A9L A;  3PLW A;  2HYE D;  4QSV A;  4QSW A;  4R2Y A;  2KWK A;  4NYV A;  4UYF A;  5H1V A;  2VJE B;  3L11 A;  2H0D B;  4CUP A;  4TYL A;  2FSA A;  3D1D A;  5BT5 A;  2VP7 A;  3IHP A;  3QZT A;  5DLZ A;  5D3R A;  3EB5 A;  5F61 A;  1V87 A;  5L96 A;  2RS9 B;  5FB1 A;  3UV2 A;  4HXS A;  5HQ7 A;  1LDK C;  2EJN A;  4CFL A;  4YY6 A;  4LC2 A;  5IGM A;  4C9Z A;  4YYI A;  3O33 A;  2LDR A;  2LXH C;  2JM3 A;  2YDW A;  2B0O E;  5H85 A;  4X3G A;  4NR5 A;  4AKH A;  5F1H A;  3KV6 A;  4KV4 A;  5G4S A;  5C89 A;  3V43 A;  5ENH A;  3SOW A;  4QR5 A;  4NR7 A;  2F6N A;  5CQA A;  4YAX A;  3MDB C;  4GNG A;  5DYA A;  4C67 A;  4QBM A;  4QSQ A;  5C8G A;  1WIL A;  4YAT A;  4WHU A;  3RPG C;  3PHD A;  5HLS A;  4IR3 A;  3MB4 A;  2L5U A;  2G45 A;  5CUE A;  2PNX A;  3E2D A;  4KV1 A;  5ENI A;  1VD4 A;  4B7Y C;  4CL9 A;  4QSU A;  2C2L A;  2AN6 A;  4LAD B;  3P5O A;  2D82 A;  5I83 A;  5CRZ A;  5EYA F;  1IYM A;  2JMJ A;  4LYI A;  1RMD A;  2EXU A;  1Z60 A;  5EP7 A;  4TQN A;  5HRV A;  2OWA A;  2YHN A;  2YEL A;  4YH4 A;  5JI8 A;  3MUK A;  3GV4 A;  1ZS5 A;  4QF3 A;  4A4B A;  4ZUX U;  2VJE A;  4O7A A;  3P1F A;  1WUG A;  3T9K A;  3GL6 A;  4LZ2 A;  4QEV A;  2F42 A;  4PKL A;  5KTX A;  2DSM A;  4PS5 A;  5DW2 A;  3N9M A;  4XY9 A;  4I7B A;  4OGC A;  3LJW A;  4A9F A;  2QJ0 A;  5A5R A;  5ENF A;  5IGK A;  1ZBD B;  4O71 A;  3ZVZ B;  2MUM A;  1WGM A;  2E61 A;  2YUR A;  4FIP A;  2P57 A;  5DBM A;  3KNV A;  5FER A;  5DYC A;  2M6M A;  3DPL R;  5I1Q A;  4CFK A;  4NXJ A;  2M1R A;  4YH3 A;  3LJU X;  1CHC A;  5CUD A;  4MEN A;  4AUQ B;  4X2I A;  1G25 A;  5IGL A;  5DY7 A;  5C4Q A;  4QST A;  2DVS A;  5KHM A;  4UIX A;  1WIM A;  2L80 A;  3ZNI A;  4A4C A;  2RI7 A;  5J0D A;  2LN0 A;  2VPD A;  4AKN A;  4AYC B;  1PUO A;  5F5Z A;  4QSP A;  3FL2 A;  4ZDT A;  3KQI A;  4CUR A;  4ALH A;  1VFY A;  5D3P A;  2ECG A;  4CCG X;  5F36 A;  2LQ6 A;  4NRA A;  2LGG A;  1JM7 B;  3N9L A;  2L43 A;  5K3Q A;  3LXJ A;  3O35 A;  5EA1 A;  4QEU A;  4BW4 A;  2L0B A;  4N4F A;  4NR6 A;  3U5P A;  5IGN A;  4NR4 A;  5DKA A;  2YRE A;  4A9K A;  5KH9 A;  5SVI B;  3LDY A;  1MM3 A;  4YYG A;  3VKG A;  3FM8 C;  5L99 A;  2YW5 A;  2UZG A;  2Y43 A;  5A5O A;  4Q6F A;  5LKX A;  1WEM A;  4V3K C;  5CRM A;  2FFW A;  4I7C A;  5CQT A;  2LXP C;  2KR4 A;  4UP0 A;  5G05 B;  5DKH A;  4OUF A;  3U5J A;  2E7O A;  5D3J A;  5F1L A;  5IBN A;  3U5N A;  4A9E A;  4FJC A;  3RCW A;  4NR8 A;  4O64 A;  2K17 A;  2E3K A;  5DYU A;  2CSY A;  2RR4 A;  2VPB A;  2NXB A;  2RNX A;  3T6R A;  5G0F A;  5FE5 A;  3ERR A;  5FEY A;  3M62 A;  1F62 A;  3HMF A; 
#chains in the Genus database with same CATH homology
 3C5K A;  2YQD A;  4AP4 A;  2K16 A;  3HCT A;  4UIU A;  5EVA A;  1JSP B;  4HBV A;  5ENJ A;  4UIY A;  5FFV A;  2YYR A;  4CLB A;  1N72 A;  2M3H A;  2N9G A;  5LKU A;  3LRQ A;  4HXR A;  5CY9 A;  4QYL A;  5D1M B;  5EWH A;  1JOC A;  4L7X A;  4QSR A;  2MA6 A;  5HEL A;  4HBY A;  5E74 A;  4PPE A;  4WZ3 B;  5L8T A;  3O70 A;  5FE3 A;  1WEU A;  4O72 A;  5LVQ A;  2KGI A;  4O7C A;  3LQI A;  5DYX A;  4XY8 A;  5F62 A;  3UW9 A;  5FE7 A;  2ECT A;  2KE1 A;  4BHW A;  4ALG A;  4R7E A;  3Q2F A;  2ECI A;  4O76 A;  5HM0 A;  2YU4 A;  4Z1S A;  5CP5 A;  2JMD A;  4BBQ A;  3NXB A;  4QSX A;  4NQM A;  3HCU A;  5D3H A;  5EV9 A;  4AVX A;  3G0L A;  4J1P A;  4YAB A;  3DWY A;  1X4I A;  5F63 A;  1JM4 B;  5E3D A;  5II1 A;  3Q2E A;  1K2F A;  4IOQ A;  5HRX A;  5CQ4 A;  1WES A;  5D3L A;  2YEK A;  3MQM A;  3O7A A;  2MJV B;  4QY4 A;  4Z6H A;  3N9N A;  3UVD A;  2L5E A;  4QC3 A;  2MT5 A;  2ECN A;  4WHW A;  1VYX A;  4A9I A;  1WUM A;  4HXK A;  5CUC A;  5F2P A;  4N4I A;  1X4U A;  4NUE A;  5FFW A;  1X4J A;  2CSZ A;  5EIS A;  5BT4 A;  2QIC A;  4YYN A;  3C6W A;  2RO1 A;  4LZS A;  3ZYU A;  5F25 A;  1DVP A;  5E9M A;  3O36 A;  4S3O B;  4R8P K;  2YT5 A;  4O7F A;  2F6J A;  2KYU A;  5A83 A;  2K1J A;  2LV9 A;  5EWD A;  3U5O A;  2E6R A;  2LRI C;  4QR4 A;  4TZ2 A;  2EA6 A;  4TZ8 A;  5EWW A;  2OUO A;  4J3I A;  4UP5 A;  2MNZ A;  4F3I A;  4WIV A;  5EM3 A;  5TCM A;  5FG4 A;  2NAA A;  5IID A;  2YQL A;  4XUB A;  2LGK A;  4BW1 A;  4MR5 A;  4J0R A;  2MNY A;  4HXO A;  5EU1 A;  4LLB A;  5G04 B;  5E9Y A;  5A81 A;  1WEV A;  2R0S A;  4OGI A;  5D0C A;  5E7D A;  5D3N A;  2R10 A;  3IU5 A;  5B77 A;  4LK9 A;  2JMI A;  1T1H A;  4GB0 A;  3JVL A;  5CUG A;  3QZS A;  2XB1 A;  4NQN A;  5HFR A;  4Z93 A;  5LKT A;  5CTL A;  5LCW B;  2DKW A;  5CZG A;  4NYX A;  1HYI A;  5AMF A;  5HQ6 A;  5LKZ A;  4CUQ A;  4NN2 A;  4LYS A;  3UV4 A;  3DQV R;  4YC9 A;  3SOU A;  4YBT A;  2E7N A;  4HXP A;  4LDF A;  1WFK A;  4J0S A;  3HCS A;  4OGJ A;  4C66 A;  5D3S A;  5FH8 A;  5DW1 A;  5C85 A;  5DX4 A;  4TS8 A;  4MR6 A;  4FK5 A;  4Q0N A;  4QC1 A;  3T7L A;  3N9O A;  5EI4 A;  3KV5 A;  2RFJ A;  3AAD A;  1BOR A;  3M63 A;  3ZPV 1;  4YYJ A;  4LR6 A;  4LZR A;  2OXQ C;  4TT4 A;  2Y1M A;  4ZW1 A;  5CFW A;  2K4D A;  5CQ8 A;  1FP0 A;  5D26 A;  1WEE A;  2H0D A;  2I8N A;  2XEU A;  3P1E A;  5CUA A;  4LRG A;  4YYK A;  4A9H A;  4YK0 A;  5DFB A;  5II2 A;  5EWV A;  4GNE A;  4A49 A;  2DVR A;  1X0J A;  5L8U A;  4V3L C;  2I7K A;  2R0Y A;  3PUQ A;  3RPG B;  3VK6 A;  1EQF A;  3QZV A;  3TLP A;  4E96 A;  5A5Q A;  3SVH A;  5EQ1 A;  5HEN A;  4I7D A;  3S92 A;  3SVG A;  3GG3 A;  5FBX A;  1WE9 A;  3FKM X;  5FE4 A;  4O7E A;  2VJF B;  4ZC9 A;  4CUS A;  5DKD A;  5E3G A;  4MSX A;  5DFC A;  3I2D A;  2DWW A;  5CQ6 A;  3K2J A;  4TKP B;  3SOX A;  4CA1 A;  2RNY A;  4NRB A;  2YYN A;  5HQ5 A;  3ZVY A;  4PCE A;  5FE6 A;  1E6I A;  5C11 A;  3NG2 A;  2PUY A;  4O78 A;  5LVR A;  4LJN A;  4AYC A;  5EK9 A;  2FUU A;  1FBV A;  4UIT A;  4XUA A;  2YHO A;  4QB3 A;  4A9N A;  5HCL A;  3HME A;  4A9M A;  2KIZ A;  2RNW A;  4IOO A;  4YY4 A;  5G4R A;  4TT6 A;  5B75 A;  5IG6 A;  5K29 A;  5B78 A;  3L1Z B;  5LJ0 A;  5FE9 A;  4IC2 A;  2VJF A;  3ASL A;  5D7X A;  5E9I A;  4QNS A;  4QF2 A;  3HMH A;  3RTR B;  2I50 A;  2ECV A;  4MVT A;  3JVM A;  2L84 A;  5EIC A;  5FB0 A;  5ENB A;  1Z6U A;  4HXL A;  5KH7 A;  5JG6 A;  3MXF A;  5DIN A;  3LQH A;  3U5K A;  4HBW A;  5LJ2 A;  5CQ5 A;  2OSS A;  4QSS A;  2JRJ A;  2L85 A;  5TBN A;  5LJ1 A;  5LUU A;  1N87 A;  4WZ2 A;  4O77 A;  4PTB A;  4IR4 A;  4NS5 A;  2CKL B;  5C87 A;  3P1D A;  5I29 A;  5E9V A;  3P1C A;  2FUI A;  4TTE A;  4BW2 A;  3AQA A;  2YUC A;  5TDW A;  2D8S A;  4GND A;  5CS8 A;  5A5N A;  3SHB A;  2EOD A;  4F52 B;  4LYW A;  5EPB A;  1U6G B;  2MD8 C;  2OO1 A;  4O75 A;  4UIZ A;  4UYH A;  2L75 A;  5A7C A;  4QUT A;  4A0C D;  3IU6 A;  4RVR A;  4WA6 A;  2KWO A;  5DFD A;  5FG6 A;  4XYA A;  5FE1 A;  4HXN A;  5I89 A;  4IR6 A;  5EGU A;  4A9J A;  5ETB A;  4CUT A;  1F68 A;  4NRC A;  2CKL A;  2G6Q A;  2YSJ A;  5A82 A;  3N9P A;  1HYJ A;  3MB3 A;  2DVQ A;  5AD2 A;  4HBX A;  1XWH A;  4QR3 A;  2MA5 A;  5AIU A;  4GPJ A;  4YBM A;  3ZPV E;  3U5M A;  5CQ3 A;  2DVV A;  3G0J A;  1MM2 A;  5KH3 A;  4NYW A;  5TRB A;  4Y03 A;  4GNF A;  2YEM A;  5ACY A;  3U5L A;  5E9L A;  5C7N A;  4UI9 B;  5B76 A;  2YW8 A;  5KTU A;  4UIV A;  5E73 A;  4NUC A;  1LDJ B;  2DX8 A;  2WP1 A;  4CUU A;  5CGP A;  1WEW A;  4QUU A;  5ENE A;  3ZTG A;  4YYM A;  2H60 A;  5TB6 A;  4IOR A;  5F3A A;  4YBS A;  4TT2 A;  2KFT A;  4MR3 A;  4N4H A;  5JWM A;  2KWN A;  2MIQ A;  4IR5 A;  5FH7 A;  5KO4 A;  5D25 A;  5ETD A;  2M85 A;  2VPE A;  2BAY A;  1WEO A;  5D1K B;  2KGG A;  4KCX A;  2ECW A;  5HEM A;  4UYG A;  5H1U A;  5HJC A;  5EPS A;  2EGP A;  2YQM A;  2GRC A;  5CQ7 A;  3LQJ A;  5CU8 A;  2D9E A;  3PUR A;  4A9O A;  4XI1 A;  3UVY A;  5FE0 A;  3O34 A;  4N4G A;  2LGV A;  2ZET C;  3O37 A;  5I80 A;  3HTK C;  2KWJ A;  4UYE A;  3MHH A;  4IC3 A;  4W4U A;  3UVW A;  1WEN A;  3MHS A;  2YSM A;  5DLX A;  4BJX A;  5TAB A;  3JVK A;  4O7B A;  5COI A;  2E6S A;  2KU3 A;  5I40 A;  1WEP A;  4PCI A;  2RSD A;  5KU3 A;  2MD7 B;  5ENC A;  3JVJ A;  5I7X A;  4ZQL A;  2Y1N A;  4L58 A;  5EPR A;  4NR9 A;  3L1X A;  5I86 A;  5KTW A;  5H1T A;  5D24 A;  5AD3 A;  1WEQ A;  5I7Y A;  3I3J A;  4Z1Q A;  2VPG A;  4UYF B;  2G4A A;  5E9K A;  5HFQ A;  3UV5 A;  3D7C A;  4DON A;  3ZYQ A;  5FFY A;  2IDA A;  4YYH A;  2G43 A;  5TDR A;  1JM7 A;  3UVX A;  4O70 A;  4QZS A;  3DAI A;  4FO9 A;  3SVF A;  5I88 A;  1Z2Q A;  5HRW A;  5D1L B;  5H9M A;  4P5O B;  5F60 A;  3ONI A;  5I3L A;  5FG5 A;  4MEP A;  4MR4 A;  3EB6 A;  3M99 A;  4S3O C;  5AIT A;  5FE8 A;  4NUD A;  5DKC A;  4MEO A;  5L98 A;  3MUL A;  4PY6 A;  2ECJ A;  4FLP A;  4B86 C;  1E4U A;  5E0R A;  2KRE A;  4UIW A;  5A5P A;  2CT2 A;  2DAT A;  4HXM A;  5ENG A;  2HDP A;  2LGL A;  5FE2 A;  2WP2 A;  4TU4 A;  2KTB B;  4LKA A;  4MEQ A;  5EWC A;  5A5S A;  4BW3 A;  4QYD A;  5AME A;  5CPE A;  5J3X A;  4UYD A;  3S91 A;  5A85 A;  2C2V S;  3N9Q A;  2R0V A;  2LSP B;  4TU6 A;  2QIZ A;  5C13 A;  4N3W A;  5B79 A;  4Q0O A;  5B8D A;  5BT3 A;  5FDZ A;  2VNF A;  4WZ0 A;  5FH6 A;  4QEW A;  4YYD A;  4Z6I A;  4YAD A;  4O74 A;  5CUB A;  5L97 A;  5D3T A;  4A9L A;  2HYE D;  4QSV A;  4QSW A;  4R2Y A;  2KWK A;  4NYV A;  4UYF A;  5H1V A;  2VJE B;  3L11 A;  2H0D B;  4CUP A;  4TYL A;  2FSA A;  5BT5 A;  2VP7 A;  3IHP A;  3QZT A;  5DLZ A;  5D3R A;  3EB5 A;  5F61 A;  1V87 A;  5L96 A;  2RS9 B;  5FB1 A;  3UV2 A;  4HXS A;  5HQ7 A;  1LDK C;  4CFL A;  4YY6 A;  4LC2 A;  5IGM A;  4C9Z A;  4YYI A;  3O33 A;  2LDR A;  2LXH C;  2YDW A;  5H85 A;  4X3G A;  4NR5 A;  5F1H A;  3KV6 A;  4KV4 A;  5G4S A;  5C89 A;  3V43 A;  5ENH A;  3SOW A;  4QR5 A;  4NR7 A;  2F6N A;  5CQA A;  4YAX A;  4GNG A;  5DYA A;  4C67 A;  4QBM A;  4QSQ A;  5C8G A;  1WIL A;  4YAT A;  4WHU A;  3RPG C;  3PHD A;  5HLS A;  4IR3 A;  3MB4 A;  2L5U A;  2G45 A;  5CUE A;  2PNX A;  4KV1 A;  5ENI A;  1VD4 A;  4B7Y C;  4CL9 A;  4QSU A;  2C2L A;  2AN6 A;  4LAD B;  3P5O A;  2D82 A;  5I83 A;  5CRZ A;  5EYA F;  1IYM A;  2JMJ A;  4LYI A;  1RMD A;  1Z60 A;  5EP7 A;  4TQN A;  5HRV A;  2YHN A;  2YEL A;  4YH4 A;  5JI8 A;  3MUK A;  3GV4 A;  1ZS5 A;  4QF3 A;  4A4B A;  4ZUX U;  2VJE A;  4O7A A;  3P1F A;  1WUG A;  3GL6 A;  4LZ2 A;  4QEV A;  2F42 A;  4PKL A;  5KTX A;  4PS5 A;  5DW2 A;  3N9M A;  4XY9 A;  4I7B A;  3LJW A;  4A9F A;  2QJ0 A;  5A5R A;  5ENF A;  5IGK A;  1ZBD B;  4O71 A;  3ZVZ B;  2MUM A;  1WGM A;  2YUR A;  4FIP A;  5DBM A;  3KNV A;  5FER A;  5DYC A;  2M6M A;  3DPL R;  5I1Q A;  4CFK A;  4NXJ A;  2M1R A;  4YH3 A;  1CHC A;  5CUD A;  4MEN A;  4AUQ B;  4X2I A;  1G25 A;  5IGL A;  5DY7 A;  5C4Q A;  4QST A;  2DVS A;  5KHM A;  4UIX A;  1WIM A;  2L80 A;  3ZNI A;  4A4C A;  2RI7 A;  5J0D A;  2LN0 A;  2VPD A;  4AKN A;  4AYC B;  5F5Z A;  4QSP A;  3FL2 A;  4ZDT A;  3KQI A;  4CUR A;  4ALH A;  1VFY A;  5D3P A;  2ECG A;  4CCG X;  5F36 A;  2LQ6 A;  4NRA A;  2LGG A;  1JM7 B;  3N9L A;  2L43 A;  3LXJ A;  3O35 A;  5EA1 A;  4QEU A;  4BW4 A;  2L0B A;  4N4F A;  4NR6 A;  3U5P A;  5IGN A;  4NR4 A;  5DKA A;  2YRE A;  4A9K A;  5KH9 A;  1MM3 A;  4YYG A;  5L99 A;  2YW5 A;  2UZG A;  2Y43 A;  5A5O A;  4Q6F A;  5LKX A;  1WEM A;  4V3K C;  5CRM A;  4I7C A;  5CQT A;  2LXP C;  2KR4 A;  4UP0 A;  5G05 B;  5DKH A;  4OUF A;  3U5J A;  2E7O A;  5D3J A;  5F1L A;  5IBN A;  3U5N A;  4A9E A;  4FJC A;  3RCW A;  4NR8 A;  4O64 A;  2K17 A;  2E3K A;  5DYU A;  2CSY A;  2VPB A;  2NXB A;  2RNX A;  3T6R A;  5G0F A;  5FE5 A;  1F62 A;  5FEY A;  3M62 A;  3HMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...