3O36A

Crystal structure of trim24 phd-bromo complexed with h4(14-19)k16ac peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
184
structure length
184
Chain Sequence
b'SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 55
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o36A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o36A01
2HDPA 5EGUA 5LKTA 1LDJB 5HELA 2XEUA 1WEEA 3HMHA 5FG5A 4NRAA 5EU1A 2RNXA 4WZ3B 2Y43A 4J1PA 5ENBA 5F60A 3C5KA 4YATA 5EVAA 5KO4A 1X4JA 4QF2A 4MEPA 3ZVZB 4HXMA 1VD4A 2KIZA 2M1RA 2M3HA 3N9NA 3PUQA 2IDAA 5A7CA 1X4IA 4W4UA 2LGKA 4LZ2A 2LV9A 5DY7A 5TCMA 3SVHA 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 5IGNA 5F61A 2RI7A 5FFWA 2VPGA 4NR7A 4YYMA 4LR6A 5A5SA 4NRBA 3NG2A 3UW9A 4NQNA 5HQ7A 4HXKA 4QC1A 5FE0A 2JMDA 5D3JA 5EWDA 3LRQA 3LQJA 2MIQA 1RMDA 4V3KC 5E9VA 3DQVR 4WHUA 1ZS5A 4KV4A 4C67A 2LDRA 5E9LA 2D9EA 4Z93A 5A5NA 5EPBA 5KU3A 3AADA 2OXQC 5CRZA 4IR6A 2OO1A 5DKHA 4NYWA 5HLSA 4NQMA 5DKDA 3ZVYA 5ETDA 2YELA 2KWNA 3SHBA 4NR8A 1G25A 4QBMA 4LC2A 2XB1A 5C11A 2YW8A 4IR4A 3KNVA 5IGLA 3QZSA 5JWMA 4KCXA 2F6JA 5ENJA 3M99A 2VJFA 5K29A 3O35A 3I3JA 5E9MA 4Z1SA 4NN2A 5HEMA 2NXBA 4UYGA 5C85A 2YUCA 3HMEA 4FO9A 5FFVA 5LJ1A 1E4UA 3O36A 5EQ1A 2YYNA 4QEVA 5CPEA 4I7CA 5FEYA 2MD7B 4LZSA 5A5QA 5DYXA 4V3LC 5ETBA 2K16A 2LGGA 5CU8A 4NS5A 2LXPC 4CURA 4O7EA 5BT4A 4TU4A 5DKCA 4CUSA 2ECIA 2KWKA 4TT2A 3P1FA 3G0LA 1JOCA 5LVRA 5F1LA 2RNYA 5LKUA 5FE8A 4FJCA 5F62A 5I89A 1WEOA 1JSPB 4MENA 5EK9A 4J0RA 4A4BA 4OGJA 5G4RA 3ZTGA 4AP4A 4QB3A 4BHWA 5E9IA 3SOWA 4QC3A 4BW1A 2G43A 4Y03A 3M63A 3MQMA 4CA1A 4C66A 5LUUA 3HTKC 2KGGA 1X0JA 4MEOA 2E6SA 4HXPA 5DX4A 4BW4A 2BAYA 4IR3A 4NR6A 4IOQA 2E7NA 4LRGA 4ALHA 5G4SA 4BJXA 4UYDA 5I80A 5KTXA 5L99A 2E6RA 4YY6A 5D3PA 2KGIA 4ALGA 1CHCA 4A49A 1N72A 4XYAA 3MB3A 5CQ3A 1WEVA 4O71A 2MA5A 4QZSA 2MD8C 5I29A 4BBQA 3D7CA 4UIWA 5IGMA 2KWJA 5I1QA 1VFYA 5CP5A 4TKPB 5G05B 5L97A 5E3DA 3ZPVE 5E9YA 2LSPB 5EPSA 2YHNA 2YT5A 4PCIA 3V43A 5CQ7A 4LLBA 2LQ6A 1HYJA 4PY6A 5F63A 4YBMA 3ZYQA 2KWOA 4QR5A 5CQ8A 2ECNA 5D3HA 1Z2QA 5F5ZA 4UI9B 3O70A 4LJNA 3U5LA 2YREA 3RPGB 4ZQLA 1XWHA 2K17A 5IIDA 5KH9A 2H0DB 4QSTA 3UV2A 4TZ2A 5CUCA 5EWVA 3UVYA 5F3AA 4O7FA 4A9FA 2OSSA 4N3WA 5II1A 5LJ0A 5A82A 2MNZA 5EWWA 4TS8A 5E73A 3KV6A 4YYGA 5TDWA 5HFQA 5CS8A 3P5OA 4NRCA 3U5JA 5D0CA 4YYIA 1JM7B 4GNEA 2GRCA 3LJWA 4MR3A 4NR5A 4QSSA 5EI4A 4XUBA 3U5NA 3T6RA 5B76A 5DW2A 4BW2A 3O34A 4A9KA 5IG6A 4YABA 5FERA 3L11A 4GB0A 3SVFA 5TB6A 4MVTA 5E0RA 2VJEB 4HBXA 2RS9B 4A9OA 1FP0A 5D3SA 4AKNA 4LKAA 3T7LA 4F52B 2G6QA 5HRWA 4NUDA 4UIXA 5D3NA 5FE7A 3PURA 5DKAA 4CFKA 1WIMA 4TT4A 1WFKA 5FB0A 4Z1QA 5CQ6A 5B77A 2ECTA 4UIYA 2DKWA 2MT5A 4NR9A 4N4HA 4YC9A 2RO1A 4WHWA 2FSAA 4YADA 5CUBA 5EYAF 2YQMA 4NYXA 4QSVA 3PHDA 2H0DA 4IC2A 1WEUA 5D7XA 2DATA 5CQAA 5CFWA 2CSYA 3TLPA 3IU5A 2LGVA 4OGIA 3RTRB 4LYWA 2YDWA 2R0YA 5FBXA 4XY9A 5DW1A 4HBVA 3UVXA 1DVPA 5F36A 2YU4A 3U5MA 4A9NA 2G45A 2E3KA 3ZPV1 4QR4A 2L5UA 2RNWA 4LYSA 2CSZA 4TTEA 1IYMA 5FE3A 5HM0A 2H60A 2KFTA 5ENCA 4IOOA 5EISA 5H85A 5C8GA 2JMIA 5DFBA 2RSDA 4A0CD 5CUGA 3RCWA 3DAIA 4FLPA 5ENGA 3N9QA 5AD3A 4I7BA 2MA6A 5FG6A 3M62A 3MHHA 3P1CA 4YH3A 4YYKA 4O78A 1WUGA 4YYJA 5B78A 4O75A 2ECVA 4CFLA 3JVJA 4S3OB 5L96A 4XI1A 3L1XA 1V87A 4O76A 2UZGA 5FH8A 4MEQA 4NR4A 3JVMA 2CT2A 5A5RA 2EA6A 3GV4A 5FDZA 4AUQB 5L8UA 3S91A 4HXLA 3IU6A 4O70A 5EV9A 3U5OA 4BW3A 1JM4B 5IBNA 2YYRA 4GNDA 4Q0OA 2K1JA 4QEWA 4O7BA 2L80A 5TABA 2M6MA 5EA1A 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 5A81A 4GNGA 4NXJA 4MR6A 5FE6A 3O37A 5CQTA 5D1LB 5ENEA 5JG6A 2Y1MA 5D1KB 3P1EA 4N4GA 3U5KA 4O77A 2DVRA 1X4UA 4CUQA 4QR3A 5JI8A 3UV4A 5ACYA 4PCEA 1WENA 4YK0A 5DYUA 4A9JA 5DYCA 5BT5A 2LGLA 5TDRA 5CRMA 4Q6FA 4WZ0A 4HXOA 1VYXA 4QSQA 4UIZA 2KR4A 1F62A 4J3IA 1K2FA 2LXHC 5F25A 5J0DA 5CTLA 5C87A 3UVDA 5EWHA 4X2IA 4UP5A 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4N4IA 4A9EA 5I88A 4PTBA 5EPRA 4YYDA 2C2LA 2NAAA 2I8NA 3ASLA 3QZVA 1LDKC 5FB1A 2JRJA 4I7DA 5KTWA 5A5PA 1WUMA 4LADB 5CQ5A 5II2A 4UIUA 5D26A 4MR5A 4YAXA 5F2PA 5AIUA 4TYLA 5LCWB 1WEWA 2LN0A 3UVWA 5D25A 5HJCA 4L7XA 3N9PA 3AQAA 4MSXA 4A9LA 2L43A 3HCUA 5C13A 5DLZA 2MNYA 4WA6A 2F42A 5HQ6A 5LKZA 2PUYA 5FE9A 3O33A 5EP7A 1BORA 3S92A 5E3GA 5I83A 4Z6IA 3ZNIA 2ECWA 3MUKA 4PKLA 4QSXA 4QYLA 4IORA 5AMEA 5BT3A 4B86C 2D8SA 2KYUA 2DX8A 3Q2FA 2VPBA 4UP0A 5B75A 5I3LA 1Z60A 5LVQA 1WEQA 2KREA 4RVRA 4GNFA 2YW5A 5CUDA 5DYAA 5KH3A 2YURA 5A85A 5AMFA 4HXRA 5HQ5A 5E74A 3IHPA 4FIPA 4O74A 5D24A 5DBMA 1WILA 2D82A 3MXFA 3Q2EA 5F1HA 4QEUA 5HRVA 5FE1A 2YQLA 3SOXA 5FE4A 4QSUA 2WP1A 5CUEA 5FE2A 3MULA 1F68A 5ENIA 5IGKA 2VPEA 1E6IA 2N9GA 4O72A 2M85A 2DVSA 4NYVA 2ECGA 3DPLR 5KH7A 4ZC9A 1JM7A 4WIVA 5E7DA 1WE9A 4S3OC 2AN6A 4N4FA 4YYNA 1ZBDB 5I7XA 4WZ2A 4KV1A 4OUFA 4NUCA 1FBVA 4ZUXU 5DFDA 4LK9A 4AYCB 4XY8A 2VJEA 5L98A 3FKMX 4YYHA 5EICA 3QZTA 5D1MB 3GG3A 4LYIA 2KE1A 4TU6A 2YEMA 3LQIA 4CLBA 4HBWA 3HCSA 2R0VA 2YEKA 4MR4A 4O64A 2YQDA 3UV5A 3KV5A 5HFRA 4YBSA 5B79A 5A5OA 5HENA 3N9OA 1WEMA 2C2VS 2L84A 3JVLA 4YY4A 3K2JA 2EODA 2QJ0A 4DONA 4J0SA 2QIZA 5CZGA 4F3IA 4A9HA 4ZW1A 1N87A 2MJVB 1WEPA 1U6GB 5G04B 4GPJA 2Y1NA 4QF3A 3O7AA 4C9ZA 2RFJA 3NXBA 3EB5A 4UITA 2QICA 4FK5A 3MB4A 5I86A 3LXJA 2WP2A 2L85A 3HMFA 1MM3A 2L0BA 5EWCA 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 2I7KA 5I7YA 5CY9A 4X3GA 5ENFA 2PNXA 2DVQA 5AD2A 4AYCA 3N9LA 4UYEA 5CQ4A 2VPDA 3JVKA 4YBTA 4QNSA 2YSMA 4P5OB 5D3LA 3ONIA 5G0FA 1WESA 3EB6A 5FE5A 3ZYUA 4Q0NA 5FH7A 3GL6A 4PPEA 5COIA 4TT6A 4QY4A 2CKLB 4CUPA 2VP7A 4QUTA 5C89A 5D3TA 4QSWA 2KU3A 5CUAA 2ZETC 2E7OA 5H1TA 4QYDA 4UYFB 4CUTA 3RPGC 4UYHA 5FH6A 4A9IA 5HRXA 2R10A 3C6WA 4YH4A 5A83A 5AITA 1T1HA 5H1UA 5FFYA 3P1DA 5D3RA 3DWYA 2L5EA 2EGPA 5TRBA 4NUEA 4O7CA 4B7YC 4HBYA 3U5PA 4QSPA 2OUOA 5KHMA 4PS5A 2F6NA 5C7NA 2HYED 4IR5A 2DWWA 5EM3A 4CL9A 5CGPA 2FUUA 3L1ZB 3SVGA 4QUUA 2R0SA 4XUAA 2DVVA 4HXNA 4HXSA 5DFCA 4UIVA 4TZ8A 4IC3A 4CUUA 2L75A 2G4AA 5H1VA 5HCLA 5TBNA 4O7AA 4QSRA 2YSJA 5B8DA 5FG4A 4LDFA 3MHSA 3G0JA 1Z6UA 2KTBB 4R8PK 5LKXA 2ECJA 3I2DA 2CKLA 4TQNA 5DINA 5L8TA 5C4QA 1EQFA 5H9MA 5E9KA 4Z6HA 4UYFA 5I40A 4E96A 4R7EA 4AVXA 4LZRA 4A9MA 5ENHA 5DLXA 5LJ2A 5KTUA
chains in the Genus database with same CATH superfamily
2DJAA 2HDPA 5EGUA 4Z0OA 5LKTA 3MDBC 1LDJB 5HELA 2XEUA 1WEEA 3HMHA 5FG5A 4NRAA 5EU1A 2RNXA 4WZ3B 2Y43A 4J1PA 5ENBA 5F60A 3C5KA 4YATA 5EVAA 5KO4A 1X4JA 4QF2A 4MEPA 3T9KA 3ZVZB 4HXMA 4OGCA 1VD4A 2KIZA 2M1RA 2M3HA 2OWAA 3N9NA 2IDAA 5A7CA 1X4IA 3PUQA 4W4UA 2LGKA 4LZ2A 2LV9A 5DY7A 5TCMA 3SVHA 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 5IGNA 5F61A 2RI7A 5FFWA 2VPGA 4NR7A 4YYMA 4LR6A 5A5SA 4NRBA 3NG2A 4AKIA 3UW9A 4NQNA 5HQ7A 4HXKA 4QC1A 5FE0A 2JMDA 5D3JA 5EWDA 3LRQA 3LQJA 2MIQA 1RMDA 4V3KC 5E9VA 3DQVR 4WHUA 1ZS5A 4KV4A 4C67A 2LDRA 5E9LA 2D9EA 4Z93A 5A5NA 5EPBA 5KU3A 3AADA 2OXQC 3LJUX 5CRZA 4IR6A 2OO1A 5DKHA 4NYWA 5HLSA 4NQMA 5DKDA 4AKHA 3ZVYA 5ETDA 2YELA 5K3QA 2KWNA 3SHBA 4NR8A 1G25A 4QBMA 4LC2A 2XB1A 5C11A 2YW8A 4IR4A 3KNVA 5IGLA 3QZSA 5JWMA 4KCXA 2F6JA 5ENJA 3M99A 2EJNA 2VJFA 5K29A 3O35A 3E2DA 3I3JA 5E9MA 4Z1SA 4NN2A 5HEMA 2NXBA 4UYGA 5C85A 2FD4A 2YUCA 3HMEA 4FO9A 5FFVA 5LJ1A 1E4UA 3O36A 5EQ1A 2YYNA 4QEVA 5CPEA 4I7CA 3FAOA 5FEYA 2MD7B 4LZSA 5A5QA 5DYXA 4V3LC 5ETBA 2XP0A 2K16A 2LGGA 4Z0RA 5CU8A 4NS5A 2LXPC 4CURA 4O7EA 5BT4A 4TU4A 5DKCA 4CUSA 2ECIA 2KWKA 2P57A 4TT2A 3P1FA 3G0LA 1JOCA 5LVRA 5F1LA 2RNYA 5LKUA 5FE8A 4FJCA 5F62A 5I89A 1WEOA 1JSPB 4MENA 5EK9A 2CSVA 5SVIB 4J0RA 4A4BA 4OGJA 5G4RA 2CRRA 3ZTGA 4AP4A 4QB3A 4BHWA 3PLWA 5E9IA 2B0OE 3SOWA 4QC3A 4BW1A 2G43A 2EXUA 4Y03A 3M63A 3MQMA 4CA1A 4C66A 5LUUA 3HTKC 3LVQE 2KGGA 1X0JA 2DSMA 4MEOA 2E6SA 4HXPA 5DX4A 4BW4A 2BAYA 3O47A 4IR3A 4NR6A 4IOQA 3D1DA 2E7NA 4LRGA 4ALHA 5G4SA 4BJXA 4UYDA 5I80A 5KTXA 5L99A 2E6RA 4YY6A 5D3PA 2KGIA 4ALGA 1CHCA 4OGEA 4A49A 1N72A 4XYAA 3MB3A 5CQ3A 1WEVA 4O71A 2MA5A 4QZSA 3SUBA 2MD8C 5I29A 4BBQA 3M7KA 4O62A 3D7CA 4UIWA 5IGMA 2KWJA 3Q1DA 5I1QA 1VFYA 5CP5A 4TKPB 5G05B 5L97A 5E3DA 3ZPVE 3FEHA 5E9YA 5SVIA 2LSPB 5EPSA 2YHNA 2YT5A 4PCIA 3V43A 5CQ7A 4LLBA 2LQ6A 1HYJA 4PY6A 5F63A 4YBMA 3ZYQA 2KWOA 4QR5A 5CQ8A 2ECNA 5D3HA 1Z2QA 5F5ZA 4UI9B 3O70A 4LJNA 3U5LA 2YREA 3RPGB 4ZQLA 1XWHA 2K17A 5IIDA 5KH9A 2CONA 2H0DB 4QSTA 4AI6A 3UV2A 4TZ2A 5CUCA 5EWVA 3UVYA 5F3AA 4O7FA 4A9FA 2OSSA 2XOZA 4N3WA 5II1A 5LJ0A 5A82A 2MNZA 5EWWA 4TS8A 5E73A 3KV6A 4YYGA 5TDWA 5HFQA 1MBMA 5CS8A 3P5OA 4NRCA 3U5JA 5D0CA 4YYIA 1JM7B 4GNEA 2GRCA 3LJWA 4MR3A 4NR5A 4QSSA 5EI4A 4XUBA 3U5NA 3T6RA 5B76A 5DW2A 4BW2A 3O34A 4A9KA 5IG6A 4YABA 5FERA 3L11A 4GB0A 3SVFA 5TB6A 4MVTA 5E0RA 2VJEB 4HBXA 2RS9B 4A9OA 1FP0A 5D3SA 4AKNA 4LKAA 3T7LA 3DDTA 4F52B 2G6QA 5HRWA 4NUDA 4UIXA 5D3NA 5FE7A 3PURA 3ERRA 5DKAA 4CFKA 1WIMA 4TT4A 1WFKA 5FB0A 4Z1QA 5CQ6A 5B77A 2ECTA 4UIYA 2DKWA 2MT5A 4NR9A 4N4HA 4YC9A 2RO1A 4WHWA 2FSAA 4YADA 5CUBA 5EYAF 2YQMA 4NYXA 4QSVA 3PHDA 2H0DA 4IC2A 1WEUA 5D7XA 2DATA 5CQAA 5CFWA 2CSYA 3TLPA 3IU5A 2LGVA 4OGIA 3RTRB 4LYWA 2YDWA 2R0YA 5FBXA 4XY9A 5DW1A 4HBVA 3UVXA 1DVPA 5F36A 2YU4A 3U5MA 4F1PA 4A9NA 2G45A 2E3KA 3ZPV1 4QR4A 2L5UA 2RNWA 4LYSA 2CSZA 4TTEA 1IYMA 5FE3A 5HM0A 2H60A 2KFTA 5ENCA 4IOOA 5EISA 5H85A 5C8GA 2JMIA 5DFBA 2RSDA 4A0CD 5CUGA 3RCWA 3DAIA 4FLPA 5ENGA 1DCQA 3N9QA 5AD3A 4I7BA 2MA6A 5FG6A 3M62A 3MHHA 3P1CA 4YH3A 4YYKA 4O78A 1WUGA 4YYJA 5B78A 4O75A 2ECVA 4CFLA 3JVJA 4S3OB 5L96A 4XI1A 3L1XA 2XOYA 1V87A 4O76A 2UZGA 5FH8A 4MEQA 4NR4A 3JVMA 2CT2A 5A5RA 2EA6A 3GV4A 5FDZA 4AUQB 5L8UA 3S91A 4HXLA 3IU6A 4O70A 5EV9A 3U5OA 4BW3A 1JM4B 5IBNA 2YYRA 4GNDA 4Q0OA 2K1JA 4QEWA 4O7BA 2L80A 5TABA 2M6MA 5EA1A 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 5A81A 4GNGA 4NXJA 4MR6A 5FE6A 3O37A 5CQTA 5D1LB 3D1BA 3JUEA 5ENEA 5JG6A 2Y1MA 5D1KB 3P1EA 4N4GA 3U5KA 4O77A 3DWDA 2DVRA 1X4UA 4CUQA 4QR3A 5JI8A 3UV4A 5ACYA 4PCEA 3VKGA 1WENA 2LAUA 4YK0A 5DYUA 4A9JA 5DYCA 5BT5A 2LGLA 5TDRA 5CRMA 4Q6FA 4WZ0A 4HXOA 1VYXA 4QSQA 4UIZA 2KR4A 1F62A 4J3IA 1K2FA 2LXHC 5F25A 5J0DA 5CTLA 5C87A 2JM3A 3UVDA 5EWHA 4X2IA 4UP5A 3FJUB 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4N4IA 4A9EA 5I88A 4PTBA 5EPRA 4YYDA 2C2LA 2NAAA 2I8NA 3ASLA 3QZVA 1LDKC 5FB1A 2JRJA 4I7DA 5KTWA 5A5PA 1WUMA 4LADB 5CQ5A 5II2A 4UIUA 5D26A 4MR5A 4YAXA 5F2PA 5AIUA 4TYLA 5LCWB 1WEWA 2LN0A 2D8UA 3UVWA 5D25A 5HJCA 4L7XA 3N9PA 3AQAA 4MSXA 4A9LA 2L43A 3HCUA 5C13A 5DLZA 2MNYA 4WA6A 2F42A 2CRWA 5HQ6A 5LKZA 2PUYA 5FE9A 3O33A 5EP7A 1BORA 3S92A 5E3GA 5I83A 4Z6IA 2M13A 3ZNIA 2ECWA 3MUKA 4PKLA 4QSXA 4QYLA 4IORA 5AMEA 5BT3A 4B86C 2D8SA 2KYUA 2DX8A 3Q2FA 2VPBA 4UP0A 4AKGA 5B75A 5I3LA 1Z60A 5LVQA 1WEQA 2KREA 4RVRA 4GNFA 2YW5A 2FFWA 5CUDA 5DYAA 5KH3A 2YURA 5A85A 5AMFA 4HXRA 5HQ5A 5E74A 3IHPA 4FIPA 2L7PA 4O74A 5D24A 5DBMA 1WILA 2D82A 3MXFA 3Q2EA 5F1HA 4QEUA 5HRVA 5FE1A 2YQLA 3SOXA 5FE4A 4QSUA 2RR4A 2WP1A 5CUEA 5FE2A 3MULA 1F68A 2IQJA 5ENIA 5IGKA 2VPEA 1E6IA 2N9GA 4O72A 2M85A 2DVSA 4NYVA 2ECGA 3DPLR 5KH7A 4ZC9A 1JM7A 4WIVA 5E7DA 1WE9A 4S3OC 2AN6A 4N4FA 4YYNA 1ZBDB 5I7XA 4WZ2A 4KV1A 4OUFA 3FANA 4NUCA 1FBVA 2KKXA 4ZUXU 5DFDA 4LK9A 4AYCB 4XY8A 3LDYA 2VJEA 5L98A 3FKMX 4YYHA 5EICA 3QZTA 5D1MB 3GG3A 4LYIA 2KE1A 4TU6A 2YEMA 3LQIA 4CLBA 4HBWA 3HCSA 2R0VA 2YEKA 4MR4A 4O64A 2YQDA 3UV5A 3KV5A 5HFRA 4YBSA 5B79A 5A5OA 5HENA 3N9OA 1WEMA 2C2VS 2L84A 3JVLA 4YY4A 3K2JA 2EODA 2QJ0A 5SVXA 4DONA 4J0SA 2QIZA 5CZGA 4F3IA 4A9HA 2YVRA 4ZW1A 1N87A 1ZKRA 2MJVB 1WEPA 1U6GB 4QQ4A 5G04B 4GPJA 2Y1NA 4QF3A 2XOCA 3VKHA 3O7AA 4C9ZA 2RFJA 3NXBA 3EB5A 4UITA 2QICA 4FK5A 3MB4A 5I86A 3LXJA 2WP2A 2L85A 3HMFA 1MM3A 2L0BA 5EWCA 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 2I7KA 5I7YA 5CY9A 4X3GA 5ENFA 2PNXA 2DVQA 5AD2A 4AYCA 3N9LA 4UYEA 5CQ4A 2VPDA 3JVKA 4YBTA 4QNSA 2YSMA 4P5OB 5D3LA 3ONIA 5G0FA 1WESA 3EB6A 5FE5A 3ZYUA 4Q0NA 5FH7A 3GL6A 4PPEA 5COIA 4TT6A 3H7HA 4QY4A 2CKLB 1PUOA 4CUPA 2VP7A 4QUTA 5C89A 5D3TA 4QSWA 2KU3A 5CUAA 2ZETC 4H9DA 2E7OA 5H1TA 4QYDA 4UYFB 4CUTA 3RPGC 4UYHA 5FH6A 4A9IA 5HRXA 2R10A 3C6WA 4YH4A 5A83A 5AITA 2KKYA 1T1HA 5H1UA 5FFYA 3P1DA 2EGMA 5D3RA 3DWYA 2L5EA 2EGPA 5TRBA 4NUEA 4O7CA 4B7YC 4HBYA 3U5PA 4QSPA 2OUOA 5KHMA 4PS5A 2F6NA 5C7NA 2HYED 4IR5A 2DWWA 5EM3A 4CL9A 5CGPA 2FUUA 3L1ZB 2E61A 3SVGA 2MKEA 4QUUA 2R0SA 3KDEC 4XUAA 2DVVA 5SVYA 4HXNA 4HXSA 5DFCA 4UIVA 4TZ8A 4IC3A 4CUUA 2L75A 2G4AA 5H1VA 5HCLA 5TBNA 4O7AA 4QSRA 2YSJA 5B8DA 5FG4A 4LDFA 3MHSA 3G0JA 1Z6UA 2KTBB 4R8PK 5LKXA 2ECJA 3I2DA 2CKLA 4TQNA 5DINA 5L8TA 5C4QA 2JUNA 3LVRE 1EQFA 3FM8C 5H9MA 5E9KA 4Z6HA 4UYFA 5I40A 4E96A 4R7EA 4AVXA 4LZRA 4A9MA 5ENHA 5DLXA 5LJ2A 5KTUA
chains in the Genus database with same CATH topology
2HDPA 5EGUA 5LKTA 1LDJB 5HELA 2XEUA 1WEEA 3HMHA 5FG5A 4NRAA 5EU1A 2RNXA 4WZ3B 2Y43A 4J1PA 5ENBA 5F60A 3C5KA 4YATA 5EVAA 5KO4A 1X4JA 4QF2A 4MEPA 3ZVZB 4HXMA 1VD4A 2KIZA 2M1RA 2M3HA 3N9NA 3PUQA 2IDAA 5A7CA 1X4IA 4W4UA 2LGKA 4LZ2A 2LV9A 5DY7A 5TCMA 3SVHA 2K4DA 2LRIC 2VJFB 4ZDTA 4A4CA 5IGNA 5F61A 2RI7A 5FFWA 2VPGA 4NR7A 4YYMA 4LR6A 5A5SA 4NRBA 3NG2A 3UW9A 4NQNA 5HQ7A 4HXKA 4QC1A 5FE0A 2JMDA 5D3JA 5EWDA 3LRQA 3LQJA 2MIQA 1RMDA 4V3KC 5E9VA 3DQVR 4WHUA 1ZS5A 4KV4A 4C67A 2LDRA 5E9LA 2D9EA 4Z93A 5A5NA 5EPBA 5KU3A 3AADA 2OXQC 5CRZA 4IR6A 2OO1A 5DKHA 4NYWA 5HLSA 4NQMA 5DKDA 3ZVYA 5ETDA 2YELA 2KWNA 3SHBA 4NR8A 1G25A 4QBMA 4LC2A 2XB1A 5C11A 2YW8A 4IR4A 3KNVA 5IGLA 3QZSA 5JWMA 4KCXA 2F6JA 5ENJA 3M99A 2VJFA 5K29A 3O35A 3I3JA 5E9MA 4Z1SA 4NN2A 5HEMA 2NXBA 4UYGA 5C85A 2YUCA 3HMEA 4FO9A 5FFVA 5LJ1A 1E4UA 3O36A 5EQ1A 2YYNA 4QEVA 5CPEA 4I7CA 5FEYA 2MD7B 4LZSA 5A5QA 5DYXA 4V3LC 5ETBA 2K16A 2LGGA 5CU8A 4NS5A 2LXPC 4CURA 4O7EA 5BT4A 4TU4A 5DKCA 4CUSA 2ECIA 2KWKA 4TT2A 3P1FA 3G0LA 1JOCA 5LVRA 5F1LA 2RNYA 5LKUA 5FE8A 4FJCA 5F62A 5I89A 1WEOA 1JSPB 4MENA 5EK9A 4J0RA 4A4BA 4OGJA 5G4RA 3ZTGA 4AP4A 4QB3A 4BHWA 5E9IA 3SOWA 4QC3A 4BW1A 2G43A 4Y03A 3M63A 3MQMA 4CA1A 4C66A 5LUUA 3HTKC 2KGGA 1X0JA 4MEOA 2E6SA 4HXPA 5DX4A 4BW4A 2BAYA 4IR3A 4NR6A 4IOQA 2E7NA 4LRGA 4ALHA 5G4SA 4BJXA 4UYDA 5I80A 5KTXA 5L99A 2E6RA 4YY6A 5D3PA 2KGIA 4ALGA 1CHCA 4A49A 1N72A 4XYAA 3MB3A 5CQ3A 1WEVA 4O71A 2MA5A 4QZSA 2MD8C 5I29A 4BBQA 3D7CA 4UIWA 5IGMA 2KWJA 5I1QA 1VFYA 5CP5A 4TKPB 5G05B 5L97A 5E3DA 3ZPVE 5E9YA 2LSPB 5EPSA 2YHNA 2YT5A 4PCIA 3V43A 5CQ7A 4LLBA 2LQ6A 1HYJA 4PY6A 5F63A 4YBMA 3ZYQA 2KWOA 4QR5A 5CQ8A 2ECNA 5D3HA 1Z2QA 5F5ZA 4UI9B 3O70A 4LJNA 3U5LA 2YREA 3RPGB 4ZQLA 1XWHA 2K17A 5IIDA 5KH9A 2H0DB 4QSTA 3UV2A 4TZ2A 5CUCA 5EWVA 3UVYA 5F3AA 4O7FA 4A9FA 2OSSA 4N3WA 5II1A 5LJ0A 5A82A 2MNZA 5EWWA 4TS8A 5E73A 3KV6A 4YYGA 5TDWA 5HFQA 5CS8A 3P5OA 4NRCA 3U5JA 5D0CA 4YYIA 1JM7B 4GNEA 2GRCA 3LJWA 4MR3A 4NR5A 4QSSA 5EI4A 4XUBA 3U5NA 3T6RA 5B76A 5DW2A 4BW2A 3O34A 4A9KA 5IG6A 4YABA 5FERA 3L11A 4GB0A 3SVFA 5TB6A 4MVTA 5E0RA 2VJEB 4HBXA 2RS9B 4A9OA 1FP0A 5D3SA 4AKNA 4LKAA 3T7LA 4F52B 2G6QA 5HRWA 4NUDA 4UIXA 5D3NA 5FE7A 3PURA 5DKAA 4CFKA 1WIMA 4TT4A 1WFKA 5FB0A 4Z1QA 5CQ6A 5B77A 2ECTA 4UIYA 2DKWA 2MT5A 4NR9A 4N4HA 4YC9A 2RO1A 4WHWA 2FSAA 4YADA 5CUBA 5EYAF 2YQMA 4NYXA 4QSVA 3PHDA 2H0DA 4IC2A 1WEUA 5D7XA 2DATA 5CQAA 5CFWA 2CSYA 3TLPA 3IU5A 2LGVA 4OGIA 3RTRB 4LYWA 2YDWA 2R0YA 5FBXA 4XY9A 5DW1A 4HBVA 3UVXA 1DVPA 5F36A 2YU4A 3U5MA 4A9NA 2G45A 2E3KA 3ZPV1 4QR4A 2L5UA 2RNWA 4LYSA 2CSZA 4TTEA 1IYMA 5FE3A 5HM0A 2H60A 2KFTA 5ENCA 4IOOA 5EISA 5H85A 5C8GA 2JMIA 5DFBA 2RSDA 4A0CD 5CUGA 3RCWA 3DAIA 4FLPA 5ENGA 3N9QA 5AD3A 4I7BA 2MA6A 5FG6A 3M62A 3MHHA 3P1CA 4YH3A 4YYKA 4O78A 1WUGA 4YYJA 5B78A 4O75A 2ECVA 4CFLA 3JVJA 4S3OB 5L96A 4XI1A 3L1XA 1V87A 4O76A 2UZGA 5FH8A 4MEQA 4NR4A 3JVMA 2CT2A 5A5RA 2EA6A 3GV4A 5FDZA 4AUQB 5L8UA 3S91A 4HXLA 3IU6A 4O70A 5EV9A 3U5OA 4BW3A 1JM4B 5IBNA 2YYRA 4GNDA 4Q0OA 2K1JA 4QEWA 4O7BA 2L80A 5TABA 2M6MA 5EA1A 1HYIA 2YHOA 4R2YA 3LQHA 2VNFA 5A81A 4GNGA 4NXJA 4MR6A 5FE6A 3O37A 5CQTA 5D1LB 5ENEA 5JG6A 2Y1MA 5D1KB 3P1EA 4N4GA 3U5KA 4O77A 2DVRA 1X4UA 4CUQA 4QR3A 5JI8A 3UV4A 5ACYA 4PCEA 1WENA 4YK0A 5DYUA 4A9JA 5DYCA 5BT5A 2LGLA 5TDRA 5CRMA 4Q6FA 4WZ0A 4HXOA 1VYXA 4QSQA 4UIZA 2KR4A 1F62A 4J3IA 1K2FA 2LXHC 5F25A 5J0DA 5CTLA 5C87A 3UVDA 5EWHA 4X2IA 4UP5A 2I50A 2FUIA 2JMJA 4L58A 1WGMA 3FL2A 4N4IA 4A9EA 5I88A 4PTBA 5EPRA 4YYDA 2C2LA 2NAAA 2I8NA 3ASLA 3QZVA 1LDKC 5FB1A 2JRJA 4I7DA 5KTWA 5A5PA 1WUMA 4LADB 5CQ5A 5II2A 4UIUA 5D26A 4MR5A 4YAXA 5F2PA 5AIUA 4TYLA 5LCWB 1WEWA 2LN0A 3UVWA 5D25A 5HJCA 4L7XA 3N9PA 3AQAA 4MSXA 4A9LA 2L43A 3HCUA 5C13A 5DLZA 2MNYA 4WA6A 2F42A 5HQ6A 5LKZA 2PUYA 5FE9A 3O33A 5EP7A 1BORA 3S92A 5E3GA 5I83A 4Z6IA 3ZNIA 2ECWA 3MUKA 4PKLA 4QSXA 4QYLA 4IORA 5AMEA 5BT3A 4B86C 2D8SA 2KYUA 2DX8A 3Q2FA 2VPBA 4UP0A 5B75A 5I3LA 1Z60A 5LVQA 1WEQA 2KREA 4RVRA 4GNFA 2YW5A 5CUDA 5DYAA 5KH3A 2YURA 5A85A 5AMFA 4HXRA 5HQ5A 5E74A 3IHPA 4FIPA 4O74A 5D24A 5DBMA 1WILA 2D82A 3MXFA 3Q2EA 5F1HA 4QEUA 5HRVA 5FE1A 2YQLA 3SOXA 5FE4A 4QSUA 2WP1A 5CUEA 5FE2A 3MULA 1F68A 5ENIA 5IGKA 2VPEA 1E6IA 2N9GA 4O72A 2M85A 2DVSA 4NYVA 2ECGA 3DPLR 5KH7A 4ZC9A 1JM7A 4WIVA 5E7DA 1WE9A 4S3OC 2AN6A 4N4FA 4YYNA 1ZBDB 5I7XA 4WZ2A 4KV1A 4OUFA 4NUCA 1FBVA 4ZUXU 5DFDA 4LK9A 4AYCB 4XY8A 2VJEA 5L98A 3FKMX 4YYHA 5EICA 3QZTA 5D1MB 3GG3A 4LYIA 2KE1A 4TU6A 2YEMA 3LQIA 4CLBA 4HBWA 3HCSA 2R0VA 2YEKA 4MR4A 4O64A 2YQDA 3UV5A 3KV5A 5HFRA 4YBSA 5B79A 5A5OA 5HENA 3N9OA 1WEMA 2C2VS 2L84A 3JVLA 4YY4A 3K2JA 2EODA 2QJ0A 4DONA 4J0SA 2QIZA 5CZGA 4F3IA 4A9HA 4ZW1A 1N87A 2MJVB 1WEPA 1U6GB 5G04B 4GPJA 2Y1NA 4QF3A 3O7AA 4C9ZA 2RFJA 3NXBA 3EB5A 4UITA 2QICA 4FK5A 3MB4A 5I86A 3LXJA 2WP2A 2L85A 3HMFA 1MM3A 2L0BA 5EWCA 2MUMA 3SOUA 3HCTA 3N9MA 5J3XA 3VK6A 1MM2A 4CCGX 3KQIA 2I7KA 5I7YA 5CY9A 4X3GA 5ENFA 2PNXA 2DVQA 5AD2A 4AYCA 3N9LA 4UYEA 5CQ4A 2VPDA 3JVKA 4YBTA 4QNSA 2YSMA 4P5OB 5D3LA 3ONIA 5G0FA 1WESA 3EB6A 5FE5A 3ZYUA 4Q0NA 5FH7A 3GL6A 4PPEA 5COIA 4TT6A 4QY4A 2CKLB 4CUPA 2VP7A 4QUTA 5C89A 5D3TA 4QSWA 2KU3A 5CUAA 2ZETC 2E7OA 5H1TA 4QYDA 4UYFB 4CUTA 3RPGC 4UYHA 5FH6A 4A9IA 5HRXA 2R10A 3C6WA 4YH4A 5A83A 5AITA 1T1HA 5H1UA 5FFYA 3P1DA 5D3RA 3DWYA 2L5EA 2EGPA 5TRBA 4NUEA 4O7CA 4B7YC 4HBYA 3U5PA 4QSPA 2OUOA 5KHMA 4PS5A 2F6NA 5C7NA 2HYED 4IR5A 2DWWA 5EM3A 4CL9A 5CGPA 2FUUA 3L1ZB 3SVGA 4QUUA 2R0SA 4XUAA 2DVVA 4HXNA 4HXSA 5DFCA 4UIVA 4TZ8A 4IC3A 4CUUA 2L75A 2G4AA 5H1VA 5HCLA 5TBNA 4O7AA 4QSRA 2YSJA 5B8DA 5FG4A 4LDFA 3MHSA 3G0JA 1Z6UA 2KTBB 4R8PK 5LKXA 2ECJA 3I2DA 2CKLA 4TQNA 5DINA 5L8TA 5C4QA 1EQFA 5H9MA 5E9KA 4Z6HA 4UYFA 5I40A 4E96A 4R7EA 4AVXA 4LZRA 4A9MA 5ENHA 5DLXA 5LJ2A 5KTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDP A;  5EGU A;  5LKT A;  1LDJ B;  5HEL A;  2XEU A;  1WEE A;  3HMH A;  5FG5 A;  4NRA A;  5EU1 A;  2RNX A;  4WZ3 B;  2Y43 A;  4J1P A;  5ENB A;  5F60 A;  3C5K A;  4YAT A;  5EVA A;  5KO4 A;  1X4J A;  4QF2 A;  4MEP A;  3ZVZ B;  4HXM A;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  3N9N A;  3PUQ A;  2IDA A;  5A7C A;  1X4I A;  4W4U A;  2LGK A;  4LZ2 A;  2LV9 A;  5DY7 A;  5TCM A;  3SVH A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  5IGN A;  5F61 A;  2RI7 A;  5FFW A;  2VPG A;  4NR7 A;  4YYM A;  4LR6 A;  5A5S A;  4NRB A;  3NG2 A;  3UW9 A;  4NQN A;  5HQ7 A;  4HXK A;  4QC1 A;  5FE0 A;  2JMD A;  5D3J A;  5EWD A;  3LRQ A;  3LQJ A;  2MIQ A;  1RMD A;  4V3K C;  5E9V A;  3DQV R;  4WHU A;  1ZS5 A;  4KV4 A;  4C67 A;  2LDR A;  5E9L A;  2D9E A;  4Z93 A;  5A5N A;  5EPB A;  5KU3 A;  3AAD A;  2OXQ C;  5CRZ A;  4IR6 A;  2OO1 A;  5DKH A;  4NYW A;  5HLS A;  4NQM A;  5DKD A;  3ZVY A;  5ETD A;  2YEL A;  2KWN A;  3SHB A;  4NR8 A;  1G25 A;  4QBM A;  4LC2 A;  2XB1 A;  5C11 A;  2YW8 A;  4IR4 A;  3KNV A;  5IGL A;  3QZS A;  5JWM A;  4KCX A;  2F6J A;  5ENJ A;  3M99 A;  2VJF A;  5K29 A;  3O35 A;  3I3J A;  5E9M A;  4Z1S A;  4NN2 A;  5HEM A;  2NXB A;  4UYG A;  5C85 A;  2YUC A;  3HME A;  4FO9 A;  5FFV A;  5LJ1 A;  1E4U A;  3O36 A;  5EQ1 A;  2YYN A;  4QEV A;  5CPE A;  4I7C A;  5FEY A;  2MD7 B;  4LZS A;  5A5Q A;  5DYX A;  4V3L C;  5ETB A;  2K16 A;  2LGG A;  5CU8 A;  4NS5 A;  2LXP C;  4CUR A;  4O7E A;  5BT4 A;  4TU4 A;  5DKC A;  4CUS A;  2ECI A;  2KWK A;  4TT2 A;  3P1F A;  3G0L A;  1JOC A;  5LVR A;  5F1L A;  2RNY A;  5LKU A;  5FE8 A;  4FJC A;  5F62 A;  5I89 A;  1WEO A;  1JSP B;  4MEN A;  5EK9 A;  4J0R A;  4A4B A;  4OGJ A;  5G4R A;  3ZTG A;  4AP4 A;  4QB3 A;  4BHW A;  5E9I A;  3SOW A;  4QC3 A;  4BW1 A;  2G43 A;  4Y03 A;  3M63 A;  3MQM A;  4CA1 A;  4C66 A;  5LUU A;  3HTK C;  2KGG A;  1X0J A;  4MEO A;  2E6S A;  4HXP A;  5DX4 A;  4BW4 A;  2BAY A;  4IR3 A;  4NR6 A;  4IOQ A;  2E7N A;  4LRG A;  4ALH A;  5G4S A;  4BJX A;  4UYD A;  5I80 A;  5KTX A;  5L99 A;  2E6R A;  4YY6 A;  5D3P A;  2KGI A;  4ALG A;  1CHC A;  4A49 A;  1N72 A;  4XYA A;  3MB3 A;  5CQ3 A;  1WEV A;  4O71 A;  2MA5 A;  4QZS A;  2MD8 C;  5I29 A;  4BBQ A;  3D7C A;  4UIW A;  5IGM A;  2KWJ A;  5I1Q A;  1VFY A;  5CP5 A;  4TKP B;  5G05 B;  5L97 A;  5E3D A;  3ZPV E;  5E9Y A;  2LSP B;  5EPS A;  2YHN A;  2YT5 A;  4PCI A;  3V43 A;  5CQ7 A;  4LLB A;  2LQ6 A;  1HYJ A;  4PY6 A;  5F63 A;  4YBM A;  3ZYQ A;  2KWO A;  4QR5 A;  5CQ8 A;  2ECN A;  5D3H A;  1Z2Q A;  5F5Z A;  4UI9 B;  3O70 A;  4LJN A;  3U5L A;  2YRE A;  3RPG B;  4ZQL A;  1XWH A;  2K17 A;  5IID A;  5KH9 A;  2H0D B;  4QST A;  3UV2 A;  4TZ2 A;  5CUC A;  5EWV A;  3UVY A;  5F3A A;  4O7F A;  4A9F A;  2OSS A;  4N3W A;  5II1 A;  5LJ0 A;  5A82 A;  2MNZ A;  5EWW A;  4TS8 A;  5E73 A;  3KV6 A;  4YYG A;  5TDW A;  5HFQ A;  5CS8 A;  3P5O A;  4NRC A;  3U5J A;  5D0C A;  4YYI A;  1JM7 B;  4GNE A;  2GRC A;  3LJW A;  4MR3 A;  4NR5 A;  4QSS A;  5EI4 A;  4XUB A;  3U5N A;  3T6R A;  5B76 A;  5DW2 A;  4BW2 A;  3O34 A;  4A9K A;  5IG6 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  3SVF A;  5TB6 A;  4MVT A;  5E0R A;  2VJE B;  4HBX A;  2RS9 B;  4A9O A;  1FP0 A;  5D3S A;  4AKN A;  4LKA A;  3T7L A;  4F52 B;  2G6Q A;  5HRW A;  4NUD A;  4UIX A;  5D3N A;  5FE7 A;  3PUR A;  5DKA A;  4CFK A;  1WIM A;  4TT4 A;  1WFK A;  5FB0 A;  4Z1Q A;  5CQ6 A;  5B77 A;  2ECT A;  4UIY A;  2DKW A;  2MT5 A;  4NR9 A;  4N4H A;  4YC9 A;  2RO1 A;  4WHW A;  2FSA A;  4YAD A;  5CUB A;  5EYA F;  2YQM A;  4NYX A;  4QSV A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  5D7X A;  2DAT A;  5CQA A;  5CFW A;  2CSY A;  3TLP A;  3IU5 A;  2LGV A;  4OGI A;  3RTR B;  4LYW A;  2YDW A;  2R0Y A;  5FBX A;  4XY9 A;  5DW1 A;  4HBV A;  3UVX A;  1DVP A;  5F36 A;  2YU4 A;  3U5M A;  4A9N A;  2G45 A;  2E3K A;  3ZPV 1;  4QR4 A;  2L5U A;  2RNW A;  4LYS A;  2CSZ A;  4TTE A;  1IYM A;  5FE3 A;  5HM0 A;  2H60 A;  2KFT A;  5ENC A;  4IOO A;  5EIS A;  5H85 A;  5C8G A;  2JMI A;  5DFB A;  2RSD A;  4A0C D;  5CUG A;  3RCW A;  3DAI A;  4FLP A;  5ENG A;  3N9Q A;  5AD3 A;  4I7B A;  2MA6 A;  5FG6 A;  3M62 A;  3MHH A;  3P1C A;  4YH3 A;  4YYK A;  4O78 A;  1WUG A;  4YYJ A;  5B78 A;  4O75 A;  2ECV A;  4CFL A;  3JVJ A;  4S3O B;  5L96 A;  4XI1 A;  3L1X A;  1V87 A;  4O76 A;  2UZG A;  5FH8 A;  4MEQ A;  4NR4 A;  3JVM A;  2CT2 A;  5A5R A;  2EA6 A;  3GV4 A;  5FDZ A;  4AUQ B;  5L8U A;  3S91 A;  4HXL A;  3IU6 A;  4O70 A;  5EV9 A;  3U5O A;  4BW3 A;  1JM4 B;  5IBN A;  2YYR A;  4GND A;  4Q0O A;  2K1J A;  4QEW A;  4O7B A;  2L80 A;  5TAB A;  2M6M A;  5EA1 A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  5A81 A;  4GNG A;  4NXJ A;  4MR6 A;  5FE6 A;  3O37 A;  5CQT A;  5D1L B;  5ENE A;  5JG6 A;  2Y1M A;  5D1K B;  3P1E A;  4N4G A;  3U5K A;  4O77 A;  2DVR A;  1X4U A;  4CUQ A;  4QR3 A;  5JI8 A;  3UV4 A;  5ACY A;  4PCE A;  1WEN A;  4YK0 A;  5DYU A;  4A9J A;  5DYC A;  5BT5 A;  2LGL A;  5TDR A;  5CRM A;  4Q6F A;  4WZ0 A;  4HXO A;  1VYX A;  4QSQ A;  4UIZ A;  2KR4 A;  1F62 A;  4J3I A;  1K2F A;  2LXH C;  5F25 A;  5J0D A;  5CTL A;  5C87 A;  3UVD A;  5EWH A;  4X2I A;  4UP5 A;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4N4I A;  4A9E A;  5I88 A;  4PTB A;  5EPR A;  4YYD A;  2C2L A;  2NAA A;  2I8N A;  3ASL A;  3QZV A;  1LDK C;  5FB1 A;  2JRJ A;  4I7D A;  5KTW A;  5A5P A;  1WUM A;  4LAD B;  5CQ5 A;  5II2 A;  4UIU A;  5D26 A;  4MR5 A;  4YAX A;  5F2P A;  5AIU A;  4TYL A;  5LCW B;  1WEW A;  2LN0 A;  3UVW A;  5D25 A;  5HJC A;  4L7X A;  3N9P A;  3AQA A;  4MSX A;  4A9L A;  2L43 A;  3HCU A;  5C13 A;  5DLZ A;  2MNY A;  4WA6 A;  2F42 A;  5HQ6 A;  5LKZ A;  2PUY A;  5FE9 A;  3O33 A;  5EP7 A;  1BOR A;  3S92 A;  5E3G A;  5I83 A;  4Z6I A;  3ZNI A;  2ECW A;  3MUK A;  4PKL A;  4QSX A;  4QYL A;  4IOR A;  5AME A;  5BT3 A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  3Q2F A;  2VPB A;  4UP0 A;  5B75 A;  5I3L A;  1Z60 A;  5LVQ A;  1WEQ A;  2KRE A;  4RVR A;  4GNF A;  2YW5 A;  5CUD A;  5DYA A;  5KH3 A;  2YUR A;  5A85 A;  5AMF A;  4HXR A;  5HQ5 A;  5E74 A;  3IHP A;  4FIP A;  4O74 A;  5D24 A;  5DBM A;  1WIL A;  2D82 A;  3MXF A;  3Q2E A;  5F1H A;  4QEU A;  5HRV A;  5FE1 A;  2YQL A;  3SOX A;  5FE4 A;  4QSU A;  2WP1 A;  5CUE A;  5FE2 A;  3MUL A;  1F68 A;  5ENI A;  5IGK A;  2VPE A;  1E6I A;  2N9G A;  4O72 A;  2M85 A;  2DVS A;  4NYV A;  2ECG A;  3DPL R;  5KH7 A;  4ZC9 A;  1JM7 A;  4WIV A;  5E7D A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  4YYN A;  1ZBD B;  5I7X A;  4WZ2 A;  4KV1 A;  4OUF A;  4NUC A;  1FBV A;  4ZUX U;  5DFD A;  4LK9 A;  4AYC B;  4XY8 A;  2VJE A;  5L98 A;  3FKM X;  4YYH A;  5EIC A;  3QZT A;  5D1M B;  3GG3 A;  4LYI A;  2KE1 A;  4TU6 A;  2YEM A;  3LQI A;  4CLB A;  4HBW A;  3HCS A;  2R0V A;  2YEK A;  4MR4 A;  4O64 A;  2YQD A;  3UV5 A;  3KV5 A;  5HFR A;  4YBS A;  5B79 A;  5A5O A;  5HEN A;  3N9O A;  1WEM A;  2C2V S;  2L84 A;  3JVL A;  4YY4 A;  3K2J A;  2EOD A;  2QJ0 A;  4DON A;  4J0S A;  2QIZ A;  5CZG A;  4F3I A;  4A9H A;  4ZW1 A;  1N87 A;  2MJV B;  1WEP A;  1U6G B;  5G04 B;  4GPJ A;  2Y1N A;  4QF3 A;  3O7A A;  4C9Z A;  2RFJ A;  3NXB A;  3EB5 A;  4UIT A;  2QIC A;  4FK5 A;  3MB4 A;  5I86 A;  3LXJ A;  2WP2 A;  2L85 A;  3HMF A;  1MM3 A;  2L0B A;  5EWC A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  2I7K A;  5I7Y A;  5CY9 A;  4X3G A;  5ENF A;  2PNX A;  2DVQ A;  5AD2 A;  4AYC A;  3N9L A;  4UYE A;  5CQ4 A;  2VPD A;  3JVK A;  4YBT A;  4QNS A;  2YSM A;  4P5O B;  5D3L A;  3ONI A;  5G0F A;  1WES A;  3EB6 A;  5FE5 A;  3ZYU A;  4Q0N A;  5FH7 A;  3GL6 A;  4PPE A;  5COI A;  4TT6 A;  4QY4 A;  2CKL B;  4CUP A;  2VP7 A;  4QUT A;  5C89 A;  5D3T A;  4QSW A;  2KU3 A;  5CUA A;  2ZET C;  2E7O A;  5H1T A;  4QYD A;  4UYF B;  4CUT A;  3RPG C;  4UYH A;  5FH6 A;  4A9I A;  5HRX A;  2R10 A;  3C6W A;  4YH4 A;  5A83 A;  5AIT A;  1T1H A;  5H1U A;  5FFY A;  3P1D A;  5D3R A;  3DWY A;  2L5E A;  2EGP A;  5TRB A;  4NUE A;  4O7C A;  4B7Y C;  4HBY A;  3U5P A;  4QSP A;  2OUO A;  5KHM A;  4PS5 A;  2F6N A;  5C7N A;  2HYE D;  4IR5 A;  2DWW A;  5EM3 A;  4CL9 A;  5CGP A;  2FUU A;  3L1Z B;  3SVG A;  4QUU A;  2R0S A;  4XUA A;  2DVV A;  4HXN A;  4HXS A;  5DFC A;  4UIV A;  4TZ8 A;  4IC3 A;  4CUU A;  2L75 A;  2G4A A;  5H1V A;  5HCL A;  5TBN A;  4O7A A;  4QSR A;  2YSJ A;  5B8D A;  5FG4 A;  4LDF A;  3MHS A;  3G0J A;  1Z6U A;  2KTB B;  4R8P K;  5LKX A;  2ECJ A;  3I2D A;  2CKL A;  4TQN A;  5DIN A;  5L8T A;  5C4Q A;  1EQF A;  5H9M A;  5E9K A;  4Z6H A;  4UYF A;  5I40 A;  4E96 A;  4R7E A;  4AVX A;  4LZR A;  4A9M A;  5ENH A;  5DLX A;  5LJ2 A;  5KTU A; 
#chains in the Genus database with same CATH topology
 2DJA A;  2HDP A;  5EGU A;  4Z0O A;  5LKT A;  3MDB C;  1LDJ B;  5HEL A;  2XEU A;  1WEE A;  3HMH A;  5FG5 A;  4NRA A;  5EU1 A;  2RNX A;  4WZ3 B;  2Y43 A;  4J1P A;  5ENB A;  5F60 A;  3C5K A;  4YAT A;  5EVA A;  5KO4 A;  1X4J A;  4QF2 A;  4MEP A;  3T9K A;  3ZVZ B;  4HXM A;  4OGC A;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  2OWA A;  3N9N A;  2IDA A;  5A7C A;  1X4I A;  3PUQ A;  4W4U A;  2LGK A;  4LZ2 A;  2LV9 A;  5DY7 A;  5TCM A;  3SVH A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  5IGN A;  5F61 A;  2RI7 A;  5FFW A;  2VPG A;  4NR7 A;  4YYM A;  4LR6 A;  5A5S A;  4NRB A;  3NG2 A;  4AKI A;  3UW9 A;  4NQN A;  5HQ7 A;  4HXK A;  4QC1 A;  5FE0 A;  2JMD A;  5D3J A;  5EWD A;  3LRQ A;  3LQJ A;  2MIQ A;  1RMD A;  4V3K C;  5E9V A;  3DQV R;  4WHU A;  1ZS5 A;  4KV4 A;  4C67 A;  2LDR A;  5E9L A;  2D9E A;  4Z93 A;  5A5N A;  5EPB A;  5KU3 A;  3AAD A;  2OXQ C;  3LJU X;  5CRZ A;  4IR6 A;  2OO1 A;  5DKH A;  4NYW A;  5HLS A;  4NQM A;  5DKD A;  4AKH A;  3ZVY A;  5ETD A;  2YEL A;  5K3Q A;  2KWN A;  3SHB A;  4NR8 A;  1G25 A;  4QBM A;  4LC2 A;  2XB1 A;  5C11 A;  2YW8 A;  4IR4 A;  3KNV A;  5IGL A;  3QZS A;  5JWM A;  4KCX A;  2F6J A;  5ENJ A;  3M99 A;  2EJN A;  2VJF A;  5K29 A;  3O35 A;  3E2D A;  3I3J A;  5E9M A;  4Z1S A;  4NN2 A;  5HEM A;  2NXB A;  4UYG A;  5C85 A;  2FD4 A;  2YUC A;  3HME A;  4FO9 A;  5FFV A;  5LJ1 A;  1E4U A;  3O36 A;  5EQ1 A;  2YYN A;  4QEV A;  5CPE A;  4I7C A;  3FAO A;  5FEY A;  2MD7 B;  4LZS A;  5A5Q A;  5DYX A;  4V3L C;  5ETB A;  2XP0 A;  2K16 A;  2LGG A;  4Z0R A;  5CU8 A;  4NS5 A;  2LXP C;  4CUR A;  4O7E A;  5BT4 A;  4TU4 A;  5DKC A;  4CUS A;  2ECI A;  2KWK A;  2P57 A;  4TT2 A;  3P1F A;  3G0L A;  1JOC A;  5LVR A;  5F1L A;  2RNY A;  5LKU A;  5FE8 A;  4FJC A;  5F62 A;  5I89 A;  1WEO A;  1JSP B;  4MEN A;  5EK9 A;  2CSV A;  5SVI B;  4J0R A;  4A4B A;  4OGJ A;  5G4R A;  2CRR A;  3ZTG A;  4AP4 A;  4QB3 A;  4BHW A;  3PLW A;  5E9I A;  2B0O E;  3SOW A;  4QC3 A;  4BW1 A;  2G43 A;  2EXU A;  4Y03 A;  3M63 A;  3MQM A;  4CA1 A;  4C66 A;  5LUU A;  3HTK C;  3LVQ E;  2KGG A;  1X0J A;  2DSM A;  4MEO A;  2E6S A;  4HXP A;  5DX4 A;  4BW4 A;  2BAY A;  3O47 A;  4IR3 A;  4NR6 A;  4IOQ A;  3D1D A;  2E7N A;  4LRG A;  4ALH A;  5G4S A;  4BJX A;  4UYD A;  5I80 A;  5KTX A;  5L99 A;  2E6R A;  4YY6 A;  5D3P A;  2KGI A;  4ALG A;  1CHC A;  4OGE A;  4A49 A;  1N72 A;  4XYA A;  3MB3 A;  5CQ3 A;  1WEV A;  4O71 A;  2MA5 A;  4QZS A;  3SUB A;  2MD8 C;  5I29 A;  4BBQ A;  3M7K A;  4O62 A;  3D7C A;  4UIW A;  5IGM A;  2KWJ A;  3Q1D A;  5I1Q A;  1VFY A;  5CP5 A;  4TKP B;  5G05 B;  5L97 A;  5E3D A;  3ZPV E;  3FEH A;  5E9Y A;  5SVI A;  2LSP B;  5EPS A;  2YHN A;  2YT5 A;  4PCI A;  3V43 A;  5CQ7 A;  4LLB A;  2LQ6 A;  1HYJ A;  4PY6 A;  5F63 A;  4YBM A;  3ZYQ A;  2KWO A;  4QR5 A;  5CQ8 A;  2ECN A;  5D3H A;  1Z2Q A;  5F5Z A;  4UI9 B;  3O70 A;  4LJN A;  3U5L A;  2YRE A;  3RPG B;  4ZQL A;  1XWH A;  2K17 A;  5IID A;  5KH9 A;  2CON A;  2H0D B;  4QST A;  4AI6 A;  3UV2 A;  4TZ2 A;  5CUC A;  5EWV A;  3UVY A;  5F3A A;  4O7F A;  4A9F A;  2OSS A;  2XOZ A;  4N3W A;  5II1 A;  5LJ0 A;  5A82 A;  2MNZ A;  5EWW A;  4TS8 A;  5E73 A;  3KV6 A;  4YYG A;  5TDW A;  5HFQ A;  1MBM A;  5CS8 A;  3P5O A;  4NRC A;  3U5J A;  5D0C A;  4YYI A;  1JM7 B;  4GNE A;  2GRC A;  3LJW A;  4MR3 A;  4NR5 A;  4QSS A;  5EI4 A;  4XUB A;  3U5N A;  3T6R A;  5B76 A;  5DW2 A;  4BW2 A;  3O34 A;  4A9K A;  5IG6 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  3SVF A;  5TB6 A;  4MVT A;  5E0R A;  2VJE B;  4HBX A;  2RS9 B;  4A9O A;  1FP0 A;  5D3S A;  4AKN A;  4LKA A;  3T7L A;  3DDT A;  4F52 B;  2G6Q A;  5HRW A;  4NUD A;  4UIX A;  5D3N A;  5FE7 A;  3PUR A;  3ERR A;  5DKA A;  4CFK A;  1WIM A;  4TT4 A;  1WFK A;  5FB0 A;  4Z1Q A;  5CQ6 A;  5B77 A;  2ECT A;  4UIY A;  2DKW A;  2MT5 A;  4NR9 A;  4N4H A;  4YC9 A;  2RO1 A;  4WHW A;  2FSA A;  4YAD A;  5CUB A;  5EYA F;  2YQM A;  4NYX A;  4QSV A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  5D7X A;  2DAT A;  5CQA A;  5CFW A;  2CSY A;  3TLP A;  3IU5 A;  2LGV A;  4OGI A;  3RTR B;  4LYW A;  2YDW A;  2R0Y A;  5FBX A;  4XY9 A;  5DW1 A;  4HBV A;  3UVX A;  1DVP A;  5F36 A;  2YU4 A;  3U5M A;  4F1P A;  4A9N A;  2G45 A;  2E3K A;  3ZPV 1;  4QR4 A;  2L5U A;  2RNW A;  4LYS A;  2CSZ A;  4TTE A;  1IYM A;  5FE3 A;  5HM0 A;  2H60 A;  2KFT A;  5ENC A;  4IOO A;  5EIS A;  5H85 A;  5C8G A;  2JMI A;  5DFB A;  2RSD A;  4A0C D;  5CUG A;  3RCW A;  3DAI A;  4FLP A;  5ENG A;  1DCQ A;  3N9Q A;  5AD3 A;  4I7B A;  2MA6 A;  5FG6 A;  3M62 A;  3MHH A;  3P1C A;  4YH3 A;  4YYK A;  4O78 A;  1WUG A;  4YYJ A;  5B78 A;  4O75 A;  2ECV A;  4CFL A;  3JVJ A;  4S3O B;  5L96 A;  4XI1 A;  3L1X A;  2XOY A;  1V87 A;  4O76 A;  2UZG A;  5FH8 A;  4MEQ A;  4NR4 A;  3JVM A;  2CT2 A;  5A5R A;  2EA6 A;  3GV4 A;  5FDZ A;  4AUQ B;  5L8U A;  3S91 A;  4HXL A;  3IU6 A;  4O70 A;  5EV9 A;  3U5O A;  4BW3 A;  1JM4 B;  5IBN A;  2YYR A;  4GND A;  4Q0O A;  2K1J A;  4QEW A;  4O7B A;  2L80 A;  5TAB A;  2M6M A;  5EA1 A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  5A81 A;  4GNG A;  4NXJ A;  4MR6 A;  5FE6 A;  3O37 A;  5CQT A;  5D1L B;  3D1B A;  3JUE A;  5ENE A;  5JG6 A;  2Y1M A;  5D1K B;  3P1E A;  4N4G A;  3U5K A;  4O77 A;  3DWD A;  2DVR A;  1X4U A;  4CUQ A;  4QR3 A;  5JI8 A;  3UV4 A;  5ACY A;  4PCE A;  3VKG A;  1WEN A;  2LAU A;  4YK0 A;  5DYU A;  4A9J A;  5DYC A;  5BT5 A;  2LGL A;  5TDR A;  5CRM A;  4Q6F A;  4WZ0 A;  4HXO A;  1VYX A;  4QSQ A;  4UIZ A;  2KR4 A;  1F62 A;  4J3I A;  1K2F A;  2LXH C;  5F25 A;  5J0D A;  5CTL A;  5C87 A;  2JM3 A;  3UVD A;  5EWH A;  4X2I A;  4UP5 A;  3FJU B;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4N4I A;  4A9E A;  5I88 A;  4PTB A;  5EPR A;  4YYD A;  2C2L A;  2NAA A;  2I8N A;  3ASL A;  3QZV A;  1LDK C;  5FB1 A;  2JRJ A;  4I7D A;  5KTW A;  5A5P A;  1WUM A;  4LAD B;  5CQ5 A;  5II2 A;  4UIU A;  5D26 A;  4MR5 A;  4YAX A;  5F2P A;  5AIU A;  4TYL A;  5LCW B;  1WEW A;  2LN0 A;  2D8U A;  3UVW A;  5D25 A;  5HJC A;  4L7X A;  3N9P A;  3AQA A;  4MSX A;  4A9L A;  2L43 A;  3HCU A;  5C13 A;  5DLZ A;  2MNY A;  4WA6 A;  2F42 A;  2CRW A;  5HQ6 A;  5LKZ A;  2PUY A;  5FE9 A;  3O33 A;  5EP7 A;  1BOR A;  3S92 A;  5E3G A;  5I83 A;  4Z6I A;  2M13 A;  3ZNI A;  2ECW A;  3MUK A;  4PKL A;  4QSX A;  4QYL A;  4IOR A;  5AME A;  5BT3 A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  3Q2F A;  2VPB A;  4UP0 A;  4AKG A;  5B75 A;  5I3L A;  1Z60 A;  5LVQ A;  1WEQ A;  2KRE A;  4RVR A;  4GNF A;  2YW5 A;  2FFW A;  5CUD A;  5DYA A;  5KH3 A;  2YUR A;  5A85 A;  5AMF A;  4HXR A;  5HQ5 A;  5E74 A;  3IHP A;  4FIP A;  2L7P A;  4O74 A;  5D24 A;  5DBM A;  1WIL A;  2D82 A;  3MXF A;  3Q2E A;  5F1H A;  4QEU A;  5HRV A;  5FE1 A;  2YQL A;  3SOX A;  5FE4 A;  4QSU A;  2RR4 A;  2WP1 A;  5CUE A;  5FE2 A;  3MUL A;  1F68 A;  2IQJ A;  5ENI A;  5IGK A;  2VPE A;  1E6I A;  2N9G A;  4O72 A;  2M85 A;  2DVS A;  4NYV A;  2ECG A;  3DPL R;  5KH7 A;  4ZC9 A;  1JM7 A;  4WIV A;  5E7D A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  4YYN A;  1ZBD B;  5I7X A;  4WZ2 A;  4KV1 A;  4OUF A;  3FAN A;  4NUC A;  1FBV A;  2KKX A;  4ZUX U;  5DFD A;  4LK9 A;  4AYC B;  4XY8 A;  3LDY A;  2VJE A;  5L98 A;  3FKM X;  4YYH A;  5EIC A;  3QZT A;  5D1M B;  3GG3 A;  4LYI A;  2KE1 A;  4TU6 A;  2YEM A;  3LQI A;  4CLB A;  4HBW A;  3HCS A;  2R0V A;  2YEK A;  4MR4 A;  4O64 A;  2YQD A;  3UV5 A;  3KV5 A;  5HFR A;  4YBS A;  5B79 A;  5A5O A;  5HEN A;  3N9O A;  1WEM A;  2C2V S;  2L84 A;  3JVL A;  4YY4 A;  3K2J A;  2EOD A;  2QJ0 A;  5SVX A;  4DON A;  4J0S A;  2QIZ A;  5CZG A;  4F3I A;  4A9H A;  2YVR A;  4ZW1 A;  1N87 A;  1ZKR A;  2MJV B;  1WEP A;  1U6G B;  4QQ4 A;  5G04 B;  4GPJ A;  2Y1N A;  4QF3 A;  2XOC A;  3VKH A;  3O7A A;  4C9Z A;  2RFJ A;  3NXB A;  3EB5 A;  4UIT A;  2QIC A;  4FK5 A;  3MB4 A;  5I86 A;  3LXJ A;  2WP2 A;  2L85 A;  3HMF A;  1MM3 A;  2L0B A;  5EWC A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  2I7K A;  5I7Y A;  5CY9 A;  4X3G A;  5ENF A;  2PNX A;  2DVQ A;  5AD2 A;  4AYC A;  3N9L A;  4UYE A;  5CQ4 A;  2VPD A;  3JVK A;  4YBT A;  4QNS A;  2YSM A;  4P5O B;  5D3L A;  3ONI A;  5G0F A;  1WES A;  3EB6 A;  5FE5 A;  3ZYU A;  4Q0N A;  5FH7 A;  3GL6 A;  4PPE A;  5COI A;  4TT6 A;  3H7H A;  4QY4 A;  2CKL B;  1PUO A;  4CUP A;  2VP7 A;  4QUT A;  5C89 A;  5D3T A;  4QSW A;  2KU3 A;  5CUA A;  2ZET C;  4H9D A;  2E7O A;  5H1T A;  4QYD A;  4UYF B;  4CUT A;  3RPG C;  4UYH A;  5FH6 A;  4A9I A;  5HRX A;  2R10 A;  3C6W A;  4YH4 A;  5A83 A;  5AIT A;  2KKY A;  1T1H A;  5H1U A;  5FFY A;  3P1D A;  2EGM A;  5D3R A;  3DWY A;  2L5E A;  2EGP A;  5TRB A;  4NUE A;  4O7C A;  4B7Y C;  4HBY A;  3U5P A;  4QSP A;  2OUO A;  5KHM A;  4PS5 A;  2F6N A;  5C7N A;  2HYE D;  4IR5 A;  2DWW A;  5EM3 A;  4CL9 A;  5CGP A;  2FUU A;  3L1Z B;  2E61 A;  3SVG A;  2MKE A;  4QUU A;  2R0S A;  3KDE C;  4XUA A;  2DVV A;  5SVY A;  4HXN A;  4HXS A;  5DFC A;  4UIV A;  4TZ8 A;  4IC3 A;  4CUU A;  2L75 A;  2G4A A;  5H1V A;  5HCL A;  5TBN A;  4O7A A;  4QSR A;  2YSJ A;  5B8D A;  5FG4 A;  4LDF A;  3MHS A;  3G0J A;  1Z6U A;  2KTB B;  4R8P K;  5LKX A;  2ECJ A;  3I2D A;  2CKL A;  4TQN A;  5DIN A;  5L8T A;  5C4Q A;  2JUN A;  3LVR E;  1EQF A;  3FM8 C;  5H9M A;  5E9K A;  4Z6H A;  4UYF A;  5I40 A;  4E96 A;  4R7E A;  4AVX A;  4LZR A;  4A9M A;  5ENH A;  5DLX A;  5LJ2 A;  5KTU A; 
#chains in the Genus database with same CATH homology
 2HDP A;  5EGU A;  5LKT A;  1LDJ B;  5HEL A;  2XEU A;  1WEE A;  3HMH A;  5FG5 A;  4NRA A;  5EU1 A;  2RNX A;  4WZ3 B;  2Y43 A;  4J1P A;  5ENB A;  5F60 A;  3C5K A;  4YAT A;  5EVA A;  5KO4 A;  1X4J A;  4QF2 A;  4MEP A;  3ZVZ B;  4HXM A;  1VD4 A;  2KIZ A;  2M1R A;  2M3H A;  3N9N A;  3PUQ A;  2IDA A;  5A7C A;  1X4I A;  4W4U A;  2LGK A;  4LZ2 A;  2LV9 A;  5DY7 A;  5TCM A;  3SVH A;  2K4D A;  2LRI C;  2VJF B;  4ZDT A;  4A4C A;  5IGN A;  5F61 A;  2RI7 A;  5FFW A;  2VPG A;  4NR7 A;  4YYM A;  4LR6 A;  5A5S A;  4NRB A;  3NG2 A;  3UW9 A;  4NQN A;  5HQ7 A;  4HXK A;  4QC1 A;  5FE0 A;  2JMD A;  5D3J A;  5EWD A;  3LRQ A;  3LQJ A;  2MIQ A;  1RMD A;  4V3K C;  5E9V A;  3DQV R;  4WHU A;  1ZS5 A;  4KV4 A;  4C67 A;  2LDR A;  5E9L A;  2D9E A;  4Z93 A;  5A5N A;  5EPB A;  5KU3 A;  3AAD A;  2OXQ C;  5CRZ A;  4IR6 A;  2OO1 A;  5DKH A;  4NYW A;  5HLS A;  4NQM A;  5DKD A;  3ZVY A;  5ETD A;  2YEL A;  2KWN A;  3SHB A;  4NR8 A;  1G25 A;  4QBM A;  4LC2 A;  2XB1 A;  5C11 A;  2YW8 A;  4IR4 A;  3KNV A;  5IGL A;  3QZS A;  5JWM A;  4KCX A;  2F6J A;  5ENJ A;  3M99 A;  2VJF A;  5K29 A;  3O35 A;  3I3J A;  5E9M A;  4Z1S A;  4NN2 A;  5HEM A;  2NXB A;  4UYG A;  5C85 A;  2YUC A;  3HME A;  4FO9 A;  5FFV A;  5LJ1 A;  1E4U A;  3O36 A;  5EQ1 A;  2YYN A;  4QEV A;  5CPE A;  4I7C A;  5FEY A;  2MD7 B;  4LZS A;  5A5Q A;  5DYX A;  4V3L C;  5ETB A;  2K16 A;  2LGG A;  5CU8 A;  4NS5 A;  2LXP C;  4CUR A;  4O7E A;  5BT4 A;  4TU4 A;  5DKC A;  4CUS A;  2ECI A;  2KWK A;  4TT2 A;  3P1F A;  3G0L A;  1JOC A;  5LVR A;  5F1L A;  2RNY A;  5LKU A;  5FE8 A;  4FJC A;  5F62 A;  5I89 A;  1WEO A;  1JSP B;  4MEN A;  5EK9 A;  4J0R A;  4A4B A;  4OGJ A;  5G4R A;  3ZTG A;  4AP4 A;  4QB3 A;  4BHW A;  5E9I A;  3SOW A;  4QC3 A;  4BW1 A;  2G43 A;  4Y03 A;  3M63 A;  3MQM A;  4CA1 A;  4C66 A;  5LUU A;  3HTK C;  2KGG A;  1X0J A;  4MEO A;  2E6S A;  4HXP A;  5DX4 A;  4BW4 A;  2BAY A;  4IR3 A;  4NR6 A;  4IOQ A;  2E7N A;  4LRG A;  4ALH A;  5G4S A;  4BJX A;  4UYD A;  5I80 A;  5KTX A;  5L99 A;  2E6R A;  4YY6 A;  5D3P A;  2KGI A;  4ALG A;  1CHC A;  4A49 A;  1N72 A;  4XYA A;  3MB3 A;  5CQ3 A;  1WEV A;  4O71 A;  2MA5 A;  4QZS A;  2MD8 C;  5I29 A;  4BBQ A;  3D7C A;  4UIW A;  5IGM A;  2KWJ A;  5I1Q A;  1VFY A;  5CP5 A;  4TKP B;  5G05 B;  5L97 A;  5E3D A;  3ZPV E;  5E9Y A;  2LSP B;  5EPS A;  2YHN A;  2YT5 A;  4PCI A;  3V43 A;  5CQ7 A;  4LLB A;  2LQ6 A;  1HYJ A;  4PY6 A;  5F63 A;  4YBM A;  3ZYQ A;  2KWO A;  4QR5 A;  5CQ8 A;  2ECN A;  5D3H A;  1Z2Q A;  5F5Z A;  4UI9 B;  3O70 A;  4LJN A;  3U5L A;  2YRE A;  3RPG B;  4ZQL A;  1XWH A;  2K17 A;  5IID A;  5KH9 A;  2H0D B;  4QST A;  3UV2 A;  4TZ2 A;  5CUC A;  5EWV A;  3UVY A;  5F3A A;  4O7F A;  4A9F A;  2OSS A;  4N3W A;  5II1 A;  5LJ0 A;  5A82 A;  2MNZ A;  5EWW A;  4TS8 A;  5E73 A;  3KV6 A;  4YYG A;  5TDW A;  5HFQ A;  5CS8 A;  3P5O A;  4NRC A;  3U5J A;  5D0C A;  4YYI A;  1JM7 B;  4GNE A;  2GRC A;  3LJW A;  4MR3 A;  4NR5 A;  4QSS A;  5EI4 A;  4XUB A;  3U5N A;  3T6R A;  5B76 A;  5DW2 A;  4BW2 A;  3O34 A;  4A9K A;  5IG6 A;  4YAB A;  5FER A;  3L11 A;  4GB0 A;  3SVF A;  5TB6 A;  4MVT A;  5E0R A;  2VJE B;  4HBX A;  2RS9 B;  4A9O A;  1FP0 A;  5D3S A;  4AKN A;  4LKA A;  3T7L A;  4F52 B;  2G6Q A;  5HRW A;  4NUD A;  4UIX A;  5D3N A;  5FE7 A;  3PUR A;  5DKA A;  4CFK A;  1WIM A;  4TT4 A;  1WFK A;  5FB0 A;  4Z1Q A;  5CQ6 A;  5B77 A;  2ECT A;  4UIY A;  2DKW A;  2MT5 A;  4NR9 A;  4N4H A;  4YC9 A;  2RO1 A;  4WHW A;  2FSA A;  4YAD A;  5CUB A;  5EYA F;  2YQM A;  4NYX A;  4QSV A;  3PHD A;  2H0D A;  4IC2 A;  1WEU A;  5D7X A;  2DAT A;  5CQA A;  5CFW A;  2CSY A;  3TLP A;  3IU5 A;  2LGV A;  4OGI A;  3RTR B;  4LYW A;  2YDW A;  2R0Y A;  5FBX A;  4XY9 A;  5DW1 A;  4HBV A;  3UVX A;  1DVP A;  5F36 A;  2YU4 A;  3U5M A;  4A9N A;  2G45 A;  2E3K A;  3ZPV 1;  4QR4 A;  2L5U A;  2RNW A;  4LYS A;  2CSZ A;  4TTE A;  1IYM A;  5FE3 A;  5HM0 A;  2H60 A;  2KFT A;  5ENC A;  4IOO A;  5EIS A;  5H85 A;  5C8G A;  2JMI A;  5DFB A;  2RSD A;  4A0C D;  5CUG A;  3RCW A;  3DAI A;  4FLP A;  5ENG A;  3N9Q A;  5AD3 A;  4I7B A;  2MA6 A;  5FG6 A;  3M62 A;  3MHH A;  3P1C A;  4YH3 A;  4YYK A;  4O78 A;  1WUG A;  4YYJ A;  5B78 A;  4O75 A;  2ECV A;  4CFL A;  3JVJ A;  4S3O B;  5L96 A;  4XI1 A;  3L1X A;  1V87 A;  4O76 A;  2UZG A;  5FH8 A;  4MEQ A;  4NR4 A;  3JVM A;  2CT2 A;  5A5R A;  2EA6 A;  3GV4 A;  5FDZ A;  4AUQ B;  5L8U A;  3S91 A;  4HXL A;  3IU6 A;  4O70 A;  5EV9 A;  3U5O A;  4BW3 A;  1JM4 B;  5IBN A;  2YYR A;  4GND A;  4Q0O A;  2K1J A;  4QEW A;  4O7B A;  2L80 A;  5TAB A;  2M6M A;  5EA1 A;  1HYI A;  2YHO A;  4R2Y A;  3LQH A;  2VNF A;  5A81 A;  4GNG A;  4NXJ A;  4MR6 A;  5FE6 A;  3O37 A;  5CQT A;  5D1L B;  5ENE A;  5JG6 A;  2Y1M A;  5D1K B;  3P1E A;  4N4G A;  3U5K A;  4O77 A;  2DVR A;  1X4U A;  4CUQ A;  4QR3 A;  5JI8 A;  3UV4 A;  5ACY A;  4PCE A;  1WEN A;  4YK0 A;  5DYU A;  4A9J A;  5DYC A;  5BT5 A;  2LGL A;  5TDR A;  5CRM A;  4Q6F A;  4WZ0 A;  4HXO A;  1VYX A;  4QSQ A;  4UIZ A;  2KR4 A;  1F62 A;  4J3I A;  1K2F A;  2LXH C;  5F25 A;  5J0D A;  5CTL A;  5C87 A;  3UVD A;  5EWH A;  4X2I A;  4UP5 A;  2I50 A;  2FUI A;  2JMJ A;  4L58 A;  1WGM A;  3FL2 A;  4N4I A;  4A9E A;  5I88 A;  4PTB A;  5EPR A;  4YYD A;  2C2L A;  2NAA A;  2I8N A;  3ASL A;  3QZV A;  1LDK C;  5FB1 A;  2JRJ A;  4I7D A;  5KTW A;  5A5P A;  1WUM A;  4LAD B;  5CQ5 A;  5II2 A;  4UIU A;  5D26 A;  4MR5 A;  4YAX A;  5F2P A;  5AIU A;  4TYL A;  5LCW B;  1WEW A;  2LN0 A;  3UVW A;  5D25 A;  5HJC A;  4L7X A;  3N9P A;  3AQA A;  4MSX A;  4A9L A;  2L43 A;  3HCU A;  5C13 A;  5DLZ A;  2MNY A;  4WA6 A;  2F42 A;  5HQ6 A;  5LKZ A;  2PUY A;  5FE9 A;  3O33 A;  5EP7 A;  1BOR A;  3S92 A;  5E3G A;  5I83 A;  4Z6I A;  3ZNI A;  2ECW A;  3MUK A;  4PKL A;  4QSX A;  4QYL A;  4IOR A;  5AME A;  5BT3 A;  4B86 C;  2D8S A;  2KYU A;  2DX8 A;  3Q2F A;  2VPB A;  4UP0 A;  5B75 A;  5I3L A;  1Z60 A;  5LVQ A;  1WEQ A;  2KRE A;  4RVR A;  4GNF A;  2YW5 A;  5CUD A;  5DYA A;  5KH3 A;  2YUR A;  5A85 A;  5AMF A;  4HXR A;  5HQ5 A;  5E74 A;  3IHP A;  4FIP A;  4O74 A;  5D24 A;  5DBM A;  1WIL A;  2D82 A;  3MXF A;  3Q2E A;  5F1H A;  4QEU A;  5HRV A;  5FE1 A;  2YQL A;  3SOX A;  5FE4 A;  4QSU A;  2WP1 A;  5CUE A;  5FE2 A;  3MUL A;  1F68 A;  5ENI A;  5IGK A;  2VPE A;  1E6I A;  2N9G A;  4O72 A;  2M85 A;  2DVS A;  4NYV A;  2ECG A;  3DPL R;  5KH7 A;  4ZC9 A;  1JM7 A;  4WIV A;  5E7D A;  1WE9 A;  4S3O C;  2AN6 A;  4N4F A;  4YYN A;  1ZBD B;  5I7X A;  4WZ2 A;  4KV1 A;  4OUF A;  4NUC A;  1FBV A;  4ZUX U;  5DFD A;  4LK9 A;  4AYC B;  4XY8 A;  2VJE A;  5L98 A;  3FKM X;  4YYH A;  5EIC A;  3QZT A;  5D1M B;  3GG3 A;  4LYI A;  2KE1 A;  4TU6 A;  2YEM A;  3LQI A;  4CLB A;  4HBW A;  3HCS A;  2R0V A;  2YEK A;  4MR4 A;  4O64 A;  2YQD A;  3UV5 A;  3KV5 A;  5HFR A;  4YBS A;  5B79 A;  5A5O A;  5HEN A;  3N9O A;  1WEM A;  2C2V S;  2L84 A;  3JVL A;  4YY4 A;  3K2J A;  2EOD A;  2QJ0 A;  4DON A;  4J0S A;  2QIZ A;  5CZG A;  4F3I A;  4A9H A;  4ZW1 A;  1N87 A;  2MJV B;  1WEP A;  1U6G B;  5G04 B;  4GPJ A;  2Y1N A;  4QF3 A;  3O7A A;  4C9Z A;  2RFJ A;  3NXB A;  3EB5 A;  4UIT A;  2QIC A;  4FK5 A;  3MB4 A;  5I86 A;  3LXJ A;  2WP2 A;  2L85 A;  3HMF A;  1MM3 A;  2L0B A;  5EWC A;  2MUM A;  3SOU A;  3HCT A;  3N9M A;  5J3X A;  3VK6 A;  1MM2 A;  4CCG X;  3KQI A;  2I7K A;  5I7Y A;  5CY9 A;  4X3G A;  5ENF A;  2PNX A;  2DVQ A;  5AD2 A;  4AYC A;  3N9L A;  4UYE A;  5CQ4 A;  2VPD A;  3JVK A;  4YBT A;  4QNS A;  2YSM A;  4P5O B;  5D3L A;  3ONI A;  5G0F A;  1WES A;  3EB6 A;  5FE5 A;  3ZYU A;  4Q0N A;  5FH7 A;  3GL6 A;  4PPE A;  5COI A;  4TT6 A;  4QY4 A;  2CKL B;  4CUP A;  2VP7 A;  4QUT A;  5C89 A;  5D3T A;  4QSW A;  2KU3 A;  5CUA A;  2ZET C;  2E7O A;  5H1T A;  4QYD A;  4UYF B;  4CUT A;  3RPG C;  4UYH A;  5FH6 A;  4A9I A;  5HRX A;  2R10 A;  3C6W A;  4YH4 A;  5A83 A;  5AIT A;  1T1H A;  5H1U A;  5FFY A;  3P1D A;  5D3R A;  3DWY A;  2L5E A;  2EGP A;  5TRB A;  4NUE A;  4O7C A;  4B7Y C;  4HBY A;  3U5P A;  4QSP A;  2OUO A;  5KHM A;  4PS5 A;  2F6N A;  5C7N A;  2HYE D;  4IR5 A;  2DWW A;  5EM3 A;  4CL9 A;  5CGP A;  2FUU A;  3L1Z B;  3SVG A;  4QUU A;  2R0S A;  4XUA A;  2DVV A;  4HXN A;  4HXS A;  5DFC A;  4UIV A;  4TZ8 A;  4IC3 A;  4CUU A;  2L75 A;  2G4A A;  5H1V A;  5HCL A;  5TBN A;  4O7A A;  4QSR A;  2YSJ A;  5B8D A;  5FG4 A;  4LDF A;  3MHS A;  3G0J A;  1Z6U A;  2KTB B;  4R8P K;  5LKX A;  2ECJ A;  3I2D A;  2CKL A;  4TQN A;  5DIN A;  5L8T A;  5C4Q A;  1EQF A;  5H9M A;  5E9K A;  4Z6H A;  4UYF A;  5I40 A;  4E96 A;  4R7E A;  4AVX A;  4LZR A;  4A9M A;  5ENH A;  5DLX A;  5LJ2 A;  5KTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...