3O36A

Crystal structure of trim24 phd-bromo complexed with h4(14-19)k16ac peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
184
structure length
184
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
molecule keywords Transcription intermediary factor 1-alpha
total genus 55
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o36A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o36A01
4MEQA 4ZQLA 2C2VS 4GNDA 4NN2A 2CT2A 5E3DA 4ZC9A 2D9EA 5DINA 4XYAA 5IGMA 1IYMA 2VPGA 4LZRA 5L99A 4N3WA 4YH4A 5KU3A 2L5UA 2YHNA 3UVWA 4QC3A 2YURA 2M6MA 4XUAA 3ASLA 4R8PK 1BORA 4Z93A 5KO4A 1F62A 5EM3A 1F68A 4LRGA 5FBXA 5DBMA 4A9FA 3QZTA 1WEVA 4IR6A 5E7DA 5D3SA 4O7FA 5JI8A 4IC2A 2G43A 4UIUA 5B78A 4IC3A 4R7EA 3Q2FA 3GG3A 3LQHA 2RSDA 5D3JA 3ZVYA 4MENA 2LSPB 5CRZA 1LDKC 4UIYA 4YYKA 3U5KA 5DKHA 4TTEA 2XB1A 3IU5A 3ZTGA 4NR6A 5LKZA 4XI1A 1WILA 4TU4A 5FG4A 4MR3A 4PS5A 2MIQA 4HXNA 4YABA 4J0RA 4YYJA 2LXPC 4GPJA 4YYNA 3GV4A 4NR9A 5CUCA 5F61A 1N72A 2QJ0A 3PHDA 5AIUA 1ZS5A 2VJEA 5KH9A 2RNWA 1K2FA 2BAYA 4UYFA 4P5OB 4NR8A 2NAAA 1X0JA 5E9LA 4TZ8A 4A0CD 5IG6A 4WZ0A 5B75A 5CPEA 3FKMX 3V43A 4WHUA 2YYRA 3VK6A 5ENEA 5D3NA 5JWMA 3D7CA 5DW1A 4A9JA 2I50A 2KREA 4YC9A 5TCMA 5KTWA 2JMIA 2LGVA 4LADB 5EWDA 2IDAA 4CA1A 2VNFA 4UIXA 4MR4A 5C85A 4S3OB 4UI9B 3JVJA 5C13A 4FK5A 1VD4A 5FE9A 4TZ2A 3L1XA 3O34A 4CUSA 3NXBA 5DKCA 2L5EA 4HXSA 4F3IA 2OSSA 4UYFB 2RI7A 2FSAA 1XWHA 3SOWA 3ONIA 2L85A 5E9VA 4TKPB 4UYGA 5A83A 3HCUA 4WZ2A 5HJCA 1JSPB 1Z2QA 4GNGA 3UVXA 3I2DA 5A5NA 2YDWA 3U5LA 1WGMA 4A9HA 5F2PA 2R0YA 4CUTA 2CSZA 5CQ7A 4X3GA 5B8DA 4L7XA 4OUFA 4MVTA 3MHSA 2DKWA 4O7EA 4QSWA 4PTBA 5A5PA 5KHMA 4HBXA 5LKTA 4J1PA 4NUDA 5LVQA 1JM4B 2Y1MA 5G04B 3UW9A 4I7BA 4QEUA 5D26A 5D7XA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4QR4A 1WUGA 3DAIA 5EQ1A 4B7YC 4BW1A 3SVFA 5FB0A 2G6QA 5B77A 2RNYA 4TT6A 5II1A 4F52B 4MR6A 5TDRA 2WP1A 5BT3A 1WFKA 3P1CA 2RNXA 3NG2A 5I88A 3SOXA 2DWWA 3HMHA 2KE1A 4IR3A 5D3LA 5EGUA 1G25A 5CQ6A 2VP7A 3IHPA 4QB3A 1EQFA 2KWJA 5L96A 2EGPA 4UYEA 5BT5A 4LKAA 4QYDA 3IU6A 5F60A 1WENA 4TT4A 1MM3A 1WEUA 2PNXA 2QICA 5II2A 3O7AA 5D24A 2L84A 4ALGA 2C2LA 4B86C 5FE2A 4QF3A 3S91A 3SVHA 2YEKA 4AYCA 2DVRA 4Z1SA 3ZPVE 3JVMA 5DY7A 5I89A 4LC2A 4BW4A 1LDJB 2YU4A 5L8UA 2I8NA 2K16A 5KTXA 4QR3A 3U5JA 2KWKA 2M3HA 5EV9A 5EICA 5CS8A 5I40A 5LKUA 5EWWA 5C4QA 4HXOA 4O74A 2LQ6A 2MA5A 2UZGA 4UITA 4OGIA 5G05B 4X2IA 4ALHA 3JVKA 2F6JA 4QF2A 5I29A 4OGJA 5FERA 4A9NA 5FE0A 4Z6IA 2L0BA 3RTRB 4TS8A 2ZETC 5D1MB 4HBYA 5AD2A 2I7KA 4A49A 5HRWA 1VFYA 2MNZA 4FO9A 3U5NA 4LZ2A 3N9NA 3P1EA 5CY9A 4NQMA 5F1HA 1HYIA 1WUMA 5ENJA 3MB3A 5HFQA 4N4GA 5HENA 5I80A 5DFBA 4QSXA 5A82A 4Z1QA 2EA6A 2LGKA 5KH3A 5D0CA 5F63A 3L11A 5FFWA 4BW3A 3QZVA 5ENHA 4HBWA 5HM0A 4YH3A 3HMFA 5EK9A 2DVSA 3MUKA 2YW5A 2RO1A 1WEMA 4UIWA 1WEQA 3M99A 4YYHA 4N4IA 4PCIA 5IGKA 3N9MA 4O64A 4ZDTA 4LLBA 4UYDA 5D3TA 2D8SA 4FLPA 5CFWA 3KQIA 4YK0A 2ECVA 4WZ3B 1X4UA 4O7AA 2DATA 4YBTA 4YYDA 4PKLA 5CUDA 2OO1A 5TDWA 4UIVA 3UV2A 5FH8A 4KV4A 2N9GA 1WE9A 5I7XA 5DYAA 4O72A 5F36A 3LXJA 2ECIA 4LDFA 4I7CA 4QYLA 2EODA 4XY8A 5F3AA 5CQ4A 2F42A 4NQNA 5ETBA 4N4HA 4UP5A 3LRQA 4CUUA 1WEOA 3MULA 5D3RA 4AVXA 2YYNA 5EA1A 1VYXA 4FJCA 5CZGA 5I7YA 5L97A 2YW8A 2H0DB 4AUQB 4YY4A 4TQNA 4NYWA 3N9LA 2LXHC 5D25A 5FB1A 1WESA 5FFVA 5KTUA 4A9EA 3EB5A 4YAXA 1MM2A 2YELA 4A9IA 4GNEA 5E74A 4NXJA 5DYUA 5EPRA 2RFJA 4O78A 5CQ8A 3DQVR 3T6RA 5CQTA 2MD7B 4O70A 4CURA 5LCWB 3Q2EA 2CKLA 3SHBA 2LGLA 5FE5A 2YT5A 5C7NA 3O70A 1ZBDB 2YSJA 5CU8A 4QSVA 5FFYA 3SOUA 5IGNA 4J0SA 5A5SA 5CUGA 5LKXA 4V3KC 5E0RA 4IOOA 5BT4A 2VJEB 5HRXA 4LK9A 5KH7A 5DYXA 5TB6A 4S3OC 4QSUA 3UVDA 5HQ6A 2MJVB 5F62A 2PUYA 4C9ZA 4NYVA 4CL9A 5ENGA 5A5QA 1Z6UA 3U5OA 2FUUA 2L43A 2L80A 4WA6A 3QZSA 2K4DA 4LYWA 2E6SA 3L1ZB 2L75A 4UIZA 2M85A 2WP2A 2HYED 4IR5A 3MXFA 5ENFA 3HTKC 4YATA 3SVGA 5ACYA 3U5MA 4IORA 4XY9A 4QSQA 2JMJA 4NR5A 2KU3A 3DPLR 3ZVZB 3LJWA 5DX4A 4WIVA 2VJFB 5C87A 5DFCA 4QSPA 4MEPA 3ZPV1 2OXQC 3KV6A 2JRJA 5IGLA 3LQJA 4NRBA 2E3KA 4YADA 4ZW1A 2K1JA 5L98A 4A9OA 5K29A 3KNVA 5CRMA 4LR6A 5FE6A 5C11A 1E4UA 2Y1NA 4TU6A 5HLSA 4ZUXU 5I86A 3PUQA 2MT5A 5EYAF 2H0DA 5FE7A 5FH7A 4C67A 2E7NA 5CUEA 5ENCA 5EISA 5DKDA 4LZSA 3RPGC 5B76A 3AQAA 5EWCA 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 3ZYUA 4KCXA 4PCEA 5F25A 4QZSA 1FBVA 3U5PA 5HELA 5A81A 2AN6A 2ECJA 5I3LA 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 4YBMA 3DWYA 4V3LC 4QBMA 3M63A 5E9IA 4MR5A 4CLBA 4LYIA 5CQ5A 4YY6A 4BHWA 4QUTA 5C8GA 2LV9A 5EI4A 5J0DA 5LJ2A 4AYCB 3O33A 4CFKA 2K17A 3EB6A 4L58A 5H9MA 5EPBA 2CSYA 4A4BA 3I3JA 5FEYA 5A5OA 3P5OA 4LYSA 4QSTA 4A9MA 5CTLA 5D3HA 5A7CA 1WEWA 2ECWA 2NXBA 5DYCA 5DFDA 4QSSA 5CGPA 5I83A 3N9PA 2KWNA 4PY6A 2E7OA 5LJ1A 3UVYA 5J3XA 3GL6A 4NYXA 5EU1A 5IIDA 1V87A 2FUIA 5FE8A 2YEMA 5AMEA 1E6IA 4HXLA 2GRCA 5H85A 2YHOA 5D3PA 4O75A 3T7LA 3RCWA 3TLPA 5FDZA 1DVPA 4FIPA 3ZYQA 4AKNA 4A9LA 4A9KA 5IBNA 4O7CA 3HMEA 4QEWA 4Q0OA 3G0JA 4QC1A 3MB4A 2MA6A 4QR5A 5A85A 3HCTA 2LGGA 2HDPA 5H1VA 3M62A 3N9QA 4TYLA 3JVLA 5CUBA 5HCLA 5AITA 2OUOA 5FG5A 2XEUA 5HEMA 5H1UA 4YYMA 4MSXA 3RPGB 4CFLA 5FE4A 3O35A 5E3GA 2KR4A 4WHWA 5E9MA 4GB0A 2JMDA 2DVVA 5CQAA 5E9YA 3O37A 4QNSA 2R0VA 2Y43A 5ENIA 2DX8A 5LUUA 1HYJA 2KIZA 4QY4A 5DLXA 5AD3A 1N87A 2VPDA 4Q0NA 4UYHA 2LN0A 4E96A 5AMFA 4NRAA 5F1LA 2D82A 3G0LA 3MQMA 4I7DA 3LQIA 5TRBA 4Z6HA 1X4IA 2YQLA 5COIA 3O36A 4QUUA 5L8TA 2KYUA 3C5KA 5A5RA 4C66A 5FG6A 4Y03A 3ZNIA 4CUQA 1JM7A 5TBNA 3UV5A 4HXRA 4N4FA 2LDRA 3N9OA 5G4RA 4XUBA 2KFTA 3AADA 5EP7A 5EWHA 2CKLB 4LJNA 2MD8C 5G0FA 5CUAA 4YBSA 5CQ3A 4GNFA 3K2JA 4QSRA 5H1TA 5DLZA 5ENBA 4TT2A 5EWVA 2E6RA 4DONA 1CHCA 3C6WA 3MHHA 2R10A 4HBVA 4CUPA 2KTBB 4IOQA 4MEOA 5HQ5A 4HXKA 5FE3A 2KGIA 4J3IA 4HXMA 5F5ZA 2DVQA 2YQMA 1JM7B 5HFRA 4YYIA 2VJFA 3S92A 1U6GB 5G4SA 5HQ7A 2H60A 5EVAA 4BW2A 2ECTA 2VPEA 3UV4A 1X4JA 2YSMA 5FH6A 5I1QA 5E9KA 2ECNA 2YQDA 4NS5A 1Z60A 1WIMA 4AP4A 4NUCA 2G4AA 5LJ0A 4PPEA 5EPSA 4BBQA 5TABA 3FL2A 2KGGA 2RS9B 4NR4A 1WEEA 5DW2A 1T1HA 5D1KB 5DKAA 4KV1A 4NUEA 4HXPA 4IR4A 5ETDA 5JG6A 3P1FA 2R0SA 4O77A 5E73A 1RMDA 4R2YA 4UP0A 5CP5A 4NRCA 4BJXA 4QEVA 2QIZA 5HRVA 4NR7A 4O76A 3P1DA 2M1RA 4O7BA 4W4UA 4CCGX 4O71A 5FE1A 5LVRA 2KWOA 2F6NA 5B79A 5C89A 4RVRA 4YYGA
chains in the Genus database with same CATH superfamily
4MEQA 4ZQLA 2C2VS 4GNDA 2M13A 2CT2A 4NN2A 5E3DA 2KKYA 4ZC9A 2D9EA 5DINA 4XYAA 3O47A 4O62A 5IGMA 1IYMA 2VPGA 4LZRA 5L99A 4N3WA 4YH4A 5KU3A 2L5UA 3FJUB 2YHNA 3UVWA 4QC3A 3PLWA 2YURA 2KKXA 2M6MA 4XUAA 3ASLA 4R8PK 1BORA 4Z93A 5KO4A 1F62A 5EM3A 1F68A 4LRGA 3FANA 5FBXA 5DBMA 4A9FA 3QZTA 1WEVA 4IR6A 5E7DA 5D3SA 4O7FA 5JI8A 4IC2A 2G43A 4UIUA 5B78A 4IC3A 4R7EA 3Q2FA 3GG3A 3LQHA 2RSDA 5D3JA 3ZVYA 4MENA 2LSPB 5CRZA 1LDKC 2JM3A 4UIYA 4YYKA 3U5KA 5DKHA 4TTEA 2XB1A 3IU5A 3ZTGA 4NR6A 5LKZA 5K3QA 4XI1A 1WILA 4TU4A 3H7HA 5FG4A 4MR3A 4PS5A 3DWDA 2MIQA 4HXNA 4YABA 4J0RA 5SVYA 4YYJA 2LXPC 4GPJA 4YYNA 3GV4A 4NR9A 2EXUA 5CUCA 5F61A 1N72A 2QJ0A 3VKGA 3PHDA 5AIUA 1ZS5A 2VJEA 5KH9A 2RNWA 1K2FA 2BAYA 4UYFA 4P5OB 4NR8A 2NAAA 1X0JA 5E9LA 4TZ8A 4A0CD 5IG6A 4WZ0A 5B75A 5CPEA 3FKMX 3V43A 4WHUA 2YYRA 3VK6A 5ENEA 5D3NA 5JWMA 3D7CA 5DW1A 4A9JA 2I50A 2KREA 4YC9A 5TCMA 5KTWA 2JMIA 2LGVA 4LADB 5EWDA 2IDAA 4CA1A 2VNFA 4UIXA 4MR4A 5C85A 4S3OB 4UI9B 3JVJA 5C13A 4FK5A 1VD4A 5FE9A 4TZ2A 3L1XA 3O34A 4CUSA 3NXBA 5DKCA 2L5EA 4HXSA 4F3IA 2OSSA 4UYFB 2RI7A 2FSAA 1XWHA 3SOWA 3ONIA 2L85A 2L7PA 5E9VA 4TKPB 4UYGA 5A83A 3HCUA 4WZ2A 5HJCA 1JSPB 1Z2QA 4GNGA 3UVXA 3I2DA 5A5NA 2YDWA 3U5LA 1WGMA 4A9HA 5F2PA 2R0YA 4CUTA 2CSZA 5CQ7A 4X3GA 5B8DA 4L7XA 4OUFA 4MVTA 3MHSA 2DKWA 4O7EA 4QSWA 4PTBA 5A5PA 5KHMA 4HBXA 5LKTA 4J1PA 4NUDA 5LVQA 1JM4B 2P57A 2Y1MA 5G04B 3UW9A 4I7BA 4QEUA 5D26A 5D7XA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4QR4A 1WUGA 3D1BA 3DAIA 5EQ1A 4B7YC 4BW1A 3SVFA 5FB0A 2G6QA 5B77A 2RNYA 4TT6A 5II1A 4QQ4A 4F52B 4MR6A 5TDRA 2WP1A 5BT3A 2CRWA 1WFKA 3P1CA 2RNXA 3NG2A 5I88A 5SVXA 2DWWA 3HMHA 2KE1A 3SOXA 4IR3A 2XOYA 5D3LA 5EGUA 1G25A 5CQ6A 2VP7A 3IHPA 3Q1DA 4QB3A 1EQFA 2KWJA 5L96A 2EGPA 4UYEA 5BT5A 4LKAA 4QYDA 3IU6A 5F60A 1WENA 4TT4A 1MM3A 1WEUA 2PNXA 2QICA 5II2A 3O7AA 5D24A 2L84A 4ALGA 2C2LA 4B86C 5FE2A 4QF3A 3S91A 3SVHA 2YEKA 4AYCA 2DVRA 4Z1SA 3ZPVE 3JVMA 5DY7A 5I89A 4LC2A 4BW4A 1LDJB 5SVIA 2YU4A 5L8UA 2I8NA 2K16A 5KTXA 4QR3A 3U5JA 2KWKA 2M3HA 5EV9A 5EICA 5CS8A 1MBMA 5I40A 5LKUA 5EWWA 5C4QA 4HXOA 4O74A 2LQ6A 2MA5A 2UZGA 4UITA 4OGIA 5G05B 4X2IA 4ALHA 3JVKA 2F6JA 4QF2A 5I29A 4OGJA 5FERA 4A9NA 5FE0A 4Z6IA 2L0BA 3RTRB 4TS8A 2D8UA 2ZETC 5D1MB 4HBYA 5AD2A 3DDTA 4AKHA 2I7KA 4A49A 5HRWA 1VFYA 2MNZA 4FO9A 3U5NA 3LDYA 4LZ2A 3N9NA 3JUEA 3P1EA 5CY9A 4NQMA 5F1HA 1HYIA 1WUMA 5ENJA 3MB3A 5HFQA 4N4GA 5HENA 5I80A 5DFBA 4QSXA 5A82A 4Z1QA 2EA6A 2LGKA 5KH3A 5D0CA 5F63A 3L11A 5FFWA 4BW3A 3QZVA 5ENHA 4HBWA 5HM0A 4YH3A 3HMFA 5EK9A 2DVSA 3MUKA 3M7KA 2YW5A 2RO1A 1WEMA 4UIWA 1WEQA 3M99A 2LAUA 4YYHA 4N4IA 4PCIA 5IGKA 3N9MA 4O64A 1PUOA 4ZDTA 4LLBA 4UYDA 5D3TA 2D8SA 4FLPA 5CFWA 3KQIA 4YK0A 4Z0RA 2ECVA 4WZ3B 1X4UA 4O7AA 2DATA 4YBTA 4YYDA 4PKLA 5CUDA 2OO1A 5TDWA 4UIVA 3UV2A 5FH8A 3T9KA 4KV4A 2N9GA 1WE9A 5I7XA 5DYAA 4O72A 5F36A 3LXJA 2ECIA 4LDFA 4I7CA 4QYLA 2EODA 4XY8A 5F3AA 5CQ4A 2F42A 4NQNA 2EJNA 5ETBA 4AKIA 2XOZA 4N4HA 4UP5A 3LRQA 4CUUA 1WEOA 3MULA 5D3RA 4AVXA 2YYNA 5EA1A 1VYXA 4FJCA 5CZGA 5I7YA 5L97A 2YW8A 2H0DB 4AUQB 4YY4A 4TQNA 2B0OE 4NYWA 3N9LA 2LXHC 5D25A 5FB1A 1WESA 5FFVA 5KTUA 4OGCA 3LVRE 2OWAA 4A9EA 2IQJA 3EB5A 4YAXA 1MM2A 2YELA 4A9IA 4GNEA 5E74A 4NXJA 5DYUA 5EPRA 3FEHA 2RFJA 4O78A 5CQ8A 3FAOA 3DQVR 3T6RA 5CQTA 2MD7B 4O70A 3ERRA 4CURA 5LCWB 3Q2EA 2CKLA 3SHBA 2LGLA 3VKHA 5FE5A 2YT5A 5C7NA 3O70A 1ZBDB 2YSJA 5CU8A 4QSVA 5FFYA 3SOUA 5IGNA 4J0SA 5A5SA 5CUGA 5LKXA 4V3KC 5E0RA 4IOOA 5BT4A 2VJEB 4H9DA 5HRXA 4LK9A 5KH7A 5DYXA 5TB6A 4S3OC 4QSUA 3UVDA 5HQ6A 2MJVB 5F62A 2PUYA 4C9ZA 4NYVA 4CL9A 5ENGA 5A5QA 1Z6UA 3U5OA 2FUUA 2L43A 2L80A 4WA6A 3QZSA 2K4DA 4LYWA 2E6SA 3L1ZB 2L75A 4UIZA 2M85A 2WP2A 2HYED 4IR5A 3MXFA 5ENFA 3HTKC 4YATA 3SVGA 5ACYA 3U5MA 4IORA 4XY9A 4QSQA 2JMJA 4NR5A 2KU3A 3MDBC 3DPLR 3ZVZB 3LJWA 5DX4A 4WIVA 2VJFB 5C87A 5DFCA 4QSPA 4MEPA 3ZPV1 2OXQC 2EGMA 3KV6A 2JRJA 5IGLA 3LQJA 4NRBA 2VPEA 3LVQE 2E3KA 4YADA 4ZW1A 2K1JA 5L98A 4A9OA 5K29A 3KNVA 5CRMA 4LR6A 5FE6A 5C11A 1E4UA 2Y1NA 4TU6A 3FM8C 5HLSA 4OGEA 4ZUXU 5I86A 3PUQA 2MT5A 5EYAF 2H0DA 5FE7A 5FH7A 4C67A 3SUBA 2E7NA 5CUEA 5ENCA 5EISA 5DKDA 2FFWA 4LZSA 3RPGC 5B76A 3AQAA 5EWCA 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 3ZYUA 4KCXA 4PCEA 5F25A 4QZSA 1FBVA 3U5PA 5HELA 5A81A 2AN6A 2ECJA 5I3LA 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 4YBMA 2FD4A 3DWYA 4V3LC 4QBMA 3M63A 5E9IA 4MR5A 4CLBA 4LYIA 5CQ5A 4YY6A 4BHWA 4QUTA 5C8GA 2LV9A 5EI4A 5J0DA 5LJ2A 4AYCB 3O33A 4CFKA 2K17A 2CSVA 3EB6A 4L58A 5H9MA 4Z0OA 4AI6A 5EPBA 2CSYA 4A4BA 3I3JA 5FEYA 5A5OA 3P5OA 4LYSA 4QSTA 4A9MA 5CTLA 5D3HA 5A7CA 1WEWA 2ECWA 2YVRA 2NXBA 5DYCA 5DFDA 4QSSA 5CGPA 5I83A 3N9PA 2KWNA 4PY6A 2E7OA 5LJ1A 3UVYA 5J3XA 3GL6A 4NYXA 5EU1A 5IIDA 1V87A 2FUIA 5FE8A 2YEMA 5AMEA 1E6IA 4HXLA 2GRCA 5H85A 2YHOA 5D3PA 4O75A 3T7LA 3E2DA 3RCWA 3TLPA 5FDZA 1DVPA 4FIPA 3ZYQA 4AKNA 4A9LA 4A9KA 5IBNA 4O7CA 3HMEA 4QEWA 4Q0OA 3G0JA 2DSMA 4QC1A 3MB4A 2MA6A 4QR5A 5A85A 3HCTA 2LGGA 2HDPA 2RR4A 5H1VA 3M62A 3N9QA 4TYLA 3JVLA 5CUBA 5HCLA 5AITA 2OUOA 5FG5A 2XEUA 5HEMA 5H1UA 4YYMA 4MSXA 5SVIB 3RPGB 4CFLA 5FE4A 3O35A 5E3GA 2KR4A 3KDEC 4WHWA 5E9MA 4GB0A 2JMDA 2DVVA 5CQAA 5E9YA 1DCQA 3O37A 4QNSA 2R0VA 2Y43A 3LJUX 5ENIA 2DX8A 5LUUA 1HYJA 2KIZA 4QY4A 5DLXA 5AD3A 1N87A 2VPDA 4Q0NA 4UYHA 2LN0A 4E96A 5AMFA 4NRAA 5F1LA 2D82A 3G0LA 3MQMA 4I7DA 3LQIA 5TRBA 4Z6HA 1X4IA 2YQLA 5COIA 3O36A 4QUUA 5L8TA 2KYUA 3C5KA 3D1DA 5A5RA 4C66A 5FG6A 4Y03A 3ZNIA 4CUQA 1JM7A 5TBNA 3UV5A 4HXRA 4N4FA 2LDRA 3N9OA 5G4RA 4XUBA 2MKEA 2KFTA 3AADA 5EP7A 5EWHA 2CKLB 4LJNA 2MD8C 5G0FA 5CUAA 4YBSA 5CQ3A 4GNFA 3K2JA 4QSRA 5H1TA 5DLZA 5ENBA 4TT2A 5EWVA 2E6RA 4DONA 1CHCA 2CRRA 3C6WA 3MHHA 2R10A 4HBVA 4CUPA 2KTBB 4IOQA 4F1PA 2E61A 4MEOA 5HQ5A 4HXKA 5FE3A 2KGIA 4J3IA 4HXMA 5F5ZA 2DVQA 2YQMA 1JM7B 5HFRA 4YYIA 2VJFA 3S92A 1U6GB 5G4SA 5HQ7A 2H60A 5EVAA 4BW2A 2DJAA 2ECTA 3UV4A 1X4JA 2YSMA 5FH6A 5I1QA 5E9KA 2ECNA 2YQDA 4NS5A 1Z60A 1WIMA 4AP4A 4NUCA 2G4AA 5LJ0A 4PPEA 5EPSA 4BBQA 2JUNA 5TABA 3FL2A 2KGGA 2XP0A 2RS9B 4NR4A 1WEEA 5DW2A 1T1HA 5D1KB 2XOCA 5DKAA 1ZKRA 4KV1A 4NUEA 4HXPA 4IR4A 5ETDA 5JG6A 3P1FA 2R0SA 4O77A 5E73A 1RMDA 4R2YA 4UP0A 5CP5A 4NRCA 4BJXA 4QEVA 2QIZA 5HRVA 4AKGA 4NR7A 4O76A 3P1DA 2M1RA 4O7BA 2CONA 4W4UA 4CCGX 4O71A 5FE1A 5LVRA 2KWOA 2F6NA 5B79A 5C89A 4RVRA 4YYGA
chains in the Genus database with same CATH topology
4MEQA 4ZQLA 2C2VS 4GNDA 4NN2A 2CT2A 5E3DA 4ZC9A 2D9EA 5DINA 4XYAA 5IGMA 1IYMA 2VPGA 4LZRA 5L99A 4N3WA 4YH4A 5KU3A 2L5UA 2YHNA 3UVWA 4QC3A 2YURA 2M6MA 4XUAA 3ASLA 4R8PK 1BORA 4Z93A 5KO4A 1F62A 5EM3A 1F68A 4LRGA 5FBXA 5DBMA 4A9FA 3QZTA 1WEVA 4IR6A 5E7DA 5D3SA 4O7FA 5JI8A 4IC2A 2G43A 4UIUA 5B78A 4IC3A 4R7EA 3Q2FA 3GG3A 3LQHA 2RSDA 5D3JA 3ZVYA 4MENA 2LSPB 5CRZA 1LDKC 4UIYA 4YYKA 3U5KA 5DKHA 4TTEA 2XB1A 3IU5A 3ZTGA 4NR6A 5LKZA 4XI1A 1WILA 4TU4A 5FG4A 4MR3A 4PS5A 2MIQA 4HXNA 4YABA 4J0RA 4YYJA 2LXPC 4GPJA 4YYNA 3GV4A 4NR9A 5CUCA 5F61A 1N72A 2QJ0A 3PHDA 5AIUA 1ZS5A 2VJEA 5KH9A 2RNWA 1K2FA 2BAYA 4UYFA 4P5OB 4NR8A 2NAAA 1X0JA 5E9LA 4TZ8A 4A0CD 5IG6A 4WZ0A 5B75A 5CPEA 3FKMX 3V43A 4WHUA 2YYRA 3VK6A 5ENEA 5D3NA 5JWMA 3D7CA 5DW1A 4A9JA 2I50A 2KREA 4YC9A 5TCMA 5KTWA 2JMIA 2LGVA 4LADB 5EWDA 2IDAA 4CA1A 2VNFA 4UIXA 4MR4A 5C85A 4S3OB 4UI9B 3JVJA 5C13A 4FK5A 1VD4A 5FE9A 4TZ2A 3L1XA 3O34A 4CUSA 3NXBA 5DKCA 2L5EA 4HXSA 4F3IA 2OSSA 4UYFB 2RI7A 2FSAA 1XWHA 3SOWA 3ONIA 2L85A 5E9VA 4TKPB 4UYGA 5A83A 3HCUA 4WZ2A 5HJCA 1JSPB 1Z2QA 4GNGA 3UVXA 3I2DA 5A5NA 2YDWA 3U5LA 1WGMA 4A9HA 5F2PA 2R0YA 4CUTA 2CSZA 5CQ7A 4X3GA 5B8DA 4L7XA 4OUFA 4MVTA 3MHSA 2DKWA 4O7EA 4QSWA 4PTBA 5A5PA 5KHMA 4HBXA 5LKTA 4J1PA 4NUDA 5LVQA 1JM4B 2Y1MA 5G04B 3UW9A 4I7BA 4QEUA 5D26A 5D7XA 2YUCA 2G45A 3HCSA 2VPBA 4A4CA 1FP0A 4QR4A 1WUGA 3DAIA 5EQ1A 4B7YC 4BW1A 3SVFA 5FB0A 2G6QA 5B77A 2RNYA 4TT6A 5II1A 4F52B 4MR6A 5TDRA 2WP1A 5BT3A 1WFKA 3P1CA 2RNXA 3NG2A 5I88A 3SOXA 2DWWA 3HMHA 2KE1A 4IR3A 5D3LA 5EGUA 1G25A 5CQ6A 2VP7A 3IHPA 4QB3A 1EQFA 2KWJA 5L96A 2EGPA 4UYEA 5BT5A 4LKAA 4QYDA 3IU6A 5F60A 1WENA 4TT4A 1MM3A 1WEUA 2PNXA 2QICA 5II2A 3O7AA 5D24A 2L84A 4ALGA 2C2LA 4B86C 5FE2A 4QF3A 3S91A 3SVHA 2YEKA 4AYCA 2DVRA 4Z1SA 3ZPVE 3JVMA 5DY7A 5I89A 4LC2A 4BW4A 1LDJB 2YU4A 5L8UA 2I8NA 2K16A 5KTXA 4QR3A 3U5JA 2KWKA 2M3HA 5EV9A 5EICA 5CS8A 5I40A 5LKUA 5EWWA 5C4QA 4HXOA 4O74A 2LQ6A 2MA5A 2UZGA 4UITA 4OGIA 5G05B 4X2IA 4ALHA 3JVKA 2F6JA 4QF2A 5I29A 4OGJA 5FERA 4A9NA 5FE0A 4Z6IA 2L0BA 3RTRB 4TS8A 2ZETC 5D1MB 4HBYA 5AD2A 2I7KA 4A49A 5HRWA 1VFYA 2MNZA 4FO9A 3U5NA 4LZ2A 3N9NA 3P1EA 5CY9A 4NQMA 5F1HA 1HYIA 1WUMA 5ENJA 3MB3A 5HFQA 4N4GA 5HENA 5I80A 5DFBA 4QSXA 5A82A 4Z1QA 2EA6A 2LGKA 5KH3A 5D0CA 5F63A 3L11A 5FFWA 4BW3A 3QZVA 5ENHA 4HBWA 5HM0A 4YH3A 3HMFA 5EK9A 2DVSA 3MUKA 2YW5A 2RO1A 1WEMA 4UIWA 1WEQA 3M99A 4YYHA 4N4IA 4PCIA 5IGKA 3N9MA 4O64A 4ZDTA 4LLBA 4UYDA 5D3TA 2D8SA 4FLPA 5CFWA 3KQIA 4YK0A 2ECVA 4WZ3B 1X4UA 4O7AA 2DATA 4YBTA 4YYDA 4PKLA 5CUDA 2OO1A 5TDWA 4UIVA 3UV2A 5FH8A 4KV4A 2N9GA 1WE9A 5I7XA 5DYAA 4O72A 5F36A 3LXJA 2ECIA 4LDFA 4I7CA 4QYLA 2EODA 4XY8A 5F3AA 5CQ4A 2F42A 4NQNA 5ETBA 4N4HA 4UP5A 3LRQA 4CUUA 1WEOA 3MULA 5D3RA 4AVXA 2YYNA 5EA1A 1VYXA 4FJCA 5CZGA 5I7YA 5L97A 2YW8A 2H0DB 4AUQB 4YY4A 4TQNA 4NYWA 3N9LA 2LXHC 5D25A 5FB1A 1WESA 5FFVA 5KTUA 4A9EA 3EB5A 4YAXA 1MM2A 2YELA 4A9IA 4GNEA 5E74A 4NXJA 5DYUA 5EPRA 2RFJA 4O78A 5CQ8A 3DQVR 3T6RA 5CQTA 2MD7B 4O70A 4CURA 5LCWB 3Q2EA 2CKLA 3SHBA 2LGLA 5FE5A 2YT5A 5C7NA 3O70A 1ZBDB 2YSJA 5CU8A 4QSVA 5FFYA 3SOUA 5IGNA 4J0SA 5A5SA 5CUGA 5LKXA 4V3KC 5E0RA 4IOOA 5BT4A 2VJEB 5HRXA 4LK9A 5KH7A 5DYXA 5TB6A 4S3OC 4QSUA 3UVDA 5HQ6A 2MJVB 5F62A 2PUYA 4C9ZA 4NYVA 4CL9A 5ENGA 5A5QA 1Z6UA 3U5OA 2FUUA 2L43A 2L80A 4WA6A 3QZSA 2K4DA 4LYWA 2E6SA 3L1ZB 2L75A 4UIZA 2M85A 2WP2A 2HYED 4IR5A 3MXFA 5ENFA 3HTKC 4YATA 3SVGA 5ACYA 3U5MA 4IORA 4XY9A 4QSQA 2JMJA 4NR5A 2KU3A 3DPLR 3ZVZB 3LJWA 5DX4A 4WIVA 2VJFB 5C87A 5DFCA 4QSPA 4MEPA 3ZPV1 2OXQC 3KV6A 2JRJA 5IGLA 3LQJA 4NRBA 2E3KA 4YADA 4ZW1A 2K1JA 5L98A 4A9OA 5K29A 3KNVA 5CRMA 4LR6A 5FE6A 5C11A 1E4UA 2Y1NA 4TU6A 5HLSA 4ZUXU 5I86A 3PUQA 2MT5A 5EYAF 2H0DA 5FE7A 5FH7A 4C67A 2E7NA 5CUEA 5ENCA 5EISA 5DKDA 4LZSA 3RPGC 5B76A 3AQAA 5EWCA 4Q6FA 1JOCA 2LRIC 3PURA 2MNYA 3ZYUA 4KCXA 4PCEA 5F25A 4QZSA 1FBVA 3U5PA 5HELA 5A81A 2AN6A 2ECJA 5I3LA 2ECGA 5D1LB 2MUMA 2YREA 1WEPA 3KV5A 4YBMA 3DWYA 4V3LC 4QBMA 3M63A 5E9IA 4MR5A 4CLBA 4LYIA 5CQ5A 4YY6A 4BHWA 4QUTA 5C8GA 2LV9A 5EI4A 5J0DA 5LJ2A 4AYCB 3O33A 4CFKA 2K17A 3EB6A 4L58A 5H9MA 5EPBA 2CSYA 4A4BA 3I3JA 5FEYA 5A5OA 3P5OA 4LYSA 4QSTA 4A9MA 5CTLA 5D3HA 5A7CA 1WEWA 2ECWA 2NXBA 5DYCA 5DFDA 4QSSA 5CGPA 5I83A 3N9PA 2KWNA 4PY6A 2E7OA 5LJ1A 3UVYA 5J3XA 3GL6A 4NYXA 5EU1A 5IIDA 1V87A 2FUIA 5FE8A 2YEMA 5AMEA 1E6IA 4HXLA 2GRCA 5H85A 2YHOA 5D3PA 4O75A 3T7LA 3RCWA 3TLPA 5FDZA 1DVPA 4FIPA 3ZYQA 4AKNA 4A9LA 4A9KA 5IBNA 4O7CA 3HMEA 4QEWA 4Q0OA 3G0JA 4QC1A 3MB4A 2MA6A 4QR5A 5A85A 3HCTA 2LGGA 2HDPA 5H1VA 3M62A 3N9QA 4TYLA 3JVLA 5CUBA 5HCLA 5AITA 2OUOA 5FG5A 2XEUA 5HEMA 5H1UA 4YYMA 4MSXA 3RPGB 4CFLA 5FE4A 3O35A 5E3GA 2KR4A 4WHWA 5E9MA 4GB0A 2JMDA 2DVVA 5CQAA 5E9YA 3O37A 4QNSA 2R0VA 2Y43A 5ENIA 2DX8A 5LUUA 1HYJA 2KIZA 4QY4A 5DLXA 5AD3A 1N87A 2VPDA 4Q0NA 4UYHA 2LN0A 4E96A 5AMFA 4NRAA 5F1LA 2D82A 3G0LA 3MQMA 4I7DA 3LQIA 5TRBA 4Z6HA 1X4IA 2YQLA 5COIA 3O36A 4QUUA 5L8TA 2KYUA 3C5KA 5A5RA 4C66A 5FG6A 4Y03A 3ZNIA 4CUQA 1JM7A 5TBNA 3UV5A 4HXRA 4N4FA 2LDRA 3N9OA 5G4RA 4XUBA 2KFTA 3AADA 5EP7A 5EWHA 2CKLB 4LJNA 2MD8C 5G0FA 5CUAA 4YBSA 5CQ3A 4GNFA 3K2JA 4QSRA 5H1TA 5DLZA 5ENBA 4TT2A 5EWVA 2E6RA 4DONA 1CHCA 3C6WA 3MHHA 2R10A 4HBVA 4CUPA 2KTBB 4IOQA 4MEOA 5HQ5A 4HXKA 5FE3A 2KGIA 4J3IA 4HXMA 5F5ZA 2DVQA 2YQMA 1JM7B 5HFRA 4YYIA 2VJFA 3S92A 1U6GB 5G4SA 5HQ7A 2H60A 5EVAA 4BW2A 2ECTA 2VPEA 3UV4A 1X4JA 2YSMA 5FH6A 5I1QA 5E9KA 2ECNA 2YQDA 4NS5A 1Z60A 1WIMA 4AP4A 4NUCA 2G4AA 5LJ0A 4PPEA 5EPSA 4BBQA 5TABA 3FL2A 2KGGA 2RS9B 4NR4A 1WEEA 5DW2A 1T1HA 5D1KB 5DKAA 4KV1A 4NUEA 4HXPA 4IR4A 5ETDA 5JG6A 3P1FA 2R0SA 4O77A 5E73A 1RMDA 4R2YA 4UP0A 5CP5A 4NRCA 4BJXA 4QEVA 2QIZA 5HRVA 4NR7A 4O76A 3P1DA 2M1RA 4O7BA 4W4UA 4CCGX 4O71A 5FE1A 5LVRA 2KWOA 2F6NA 5B79A 5C89A 4RVRA 4YYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEQ A;  4ZQL A;  2C2V S;  4GND A;  4NN2 A;  2CT2 A;  5E3D A;  4ZC9 A;  2D9E A;  5DIN A;  4XYA A;  5IGM A;  1IYM A;  2VPG A;  4LZR A;  5L99 A;  4N3W A;  4YH4 A;  5KU3 A;  2L5U A;  2YHN A;  3UVW A;  4QC3 A;  2YUR A;  2M6M A;  4XUA A;  3ASL A;  4R8P K;  1BOR A;  4Z93 A;  5KO4 A;  1F62 A;  5EM3 A;  1F68 A;  4LRG A;  5FBX A;  5DBM A;  4A9F A;  3QZT A;  1WEV A;  4IR6 A;  5E7D A;  5D3S A;  4O7F A;  5JI8 A;  4IC2 A;  2G43 A;  4UIU A;  5B78 A;  4IC3 A;  4R7E A;  3Q2F A;  3GG3 A;  3LQH A;  2RSD A;  5D3J A;  3ZVY A;  4MEN A;  2LSP B;  5CRZ A;  1LDK C;  4UIY A;  4YYK A;  3U5K A;  5DKH A;  4TTE A;  2XB1 A;  3IU5 A;  3ZTG A;  4NR6 A;  5LKZ A;  4XI1 A;  1WIL A;  4TU4 A;  5FG4 A;  4MR3 A;  4PS5 A;  2MIQ A;  4HXN A;  4YAB A;  4J0R A;  4YYJ A;  2LXP C;  4GPJ A;  4YYN A;  3GV4 A;  4NR9 A;  5CUC A;  5F61 A;  1N72 A;  2QJ0 A;  3PHD A;  5AIU A;  1ZS5 A;  2VJE A;  5KH9 A;  2RNW A;  1K2F A;  2BAY A;  4UYF A;  4P5O B;  4NR8 A;  2NAA A;  1X0J A;  5E9L A;  4TZ8 A;  4A0C D;  5IG6 A;  4WZ0 A;  5B75 A;  5CPE A;  3FKM X;  3V43 A;  4WHU A;  2YYR A;  3VK6 A;  5ENE A;  5D3N A;  5JWM A;  3D7C A;  5DW1 A;  4A9J A;  2I50 A;  2KRE A;  4YC9 A;  5TCM A;  5KTW A;  2JMI A;  2LGV A;  4LAD B;  5EWD A;  2IDA A;  4CA1 A;  2VNF A;  4UIX A;  4MR4 A;  5C85 A;  4S3O B;  4UI9 B;  3JVJ A;  5C13 A;  4FK5 A;  1VD4 A;  5FE9 A;  4TZ2 A;  3L1X A;  3O34 A;  4CUS A;  3NXB A;  5DKC A;  2L5E A;  4HXS A;  4F3I A;  2OSS A;  4UYF B;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  3ONI A;  2L85 A;  5E9V A;  4TKP B;  4UYG A;  5A83 A;  3HCU A;  4WZ2 A;  5HJC A;  1JSP B;  1Z2Q A;  4GNG A;  3UVX A;  3I2D A;  5A5N A;  2YDW A;  3U5L A;  1WGM A;  4A9H A;  5F2P A;  2R0Y A;  4CUT A;  2CSZ A;  5CQ7 A;  4X3G A;  5B8D A;  4L7X A;  4OUF A;  4MVT A;  3MHS A;  2DKW A;  4O7E A;  4QSW A;  4PTB A;  5A5P A;  5KHM A;  4HBX A;  5LKT A;  4J1P A;  4NUD A;  5LVQ A;  1JM4 B;  2Y1M A;  5G04 B;  3UW9 A;  4I7B A;  4QEU A;  5D26 A;  5D7X A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4QR4 A;  1WUG A;  3DAI A;  5EQ1 A;  4B7Y C;  4BW1 A;  3SVF A;  5FB0 A;  2G6Q A;  5B77 A;  2RNY A;  4TT6 A;  5II1 A;  4F52 B;  4MR6 A;  5TDR A;  2WP1 A;  5BT3 A;  1WFK A;  3P1C A;  2RNX A;  3NG2 A;  5I88 A;  3SOX A;  2DWW A;  3HMH A;  2KE1 A;  4IR3 A;  5D3L A;  5EGU A;  1G25 A;  5CQ6 A;  2VP7 A;  3IHP A;  4QB3 A;  1EQF A;  2KWJ A;  5L96 A;  2EGP A;  4UYE A;  5BT5 A;  4LKA A;  4QYD A;  3IU6 A;  5F60 A;  1WEN A;  4TT4 A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  5II2 A;  3O7A A;  5D24 A;  2L84 A;  4ALG A;  2C2L A;  4B86 C;  5FE2 A;  4QF3 A;  3S91 A;  3SVH A;  2YEK A;  4AYC A;  2DVR A;  4Z1S A;  3ZPV E;  3JVM A;  5DY7 A;  5I89 A;  4LC2 A;  4BW4 A;  1LDJ B;  2YU4 A;  5L8U A;  2I8N A;  2K16 A;  5KTX A;  4QR3 A;  3U5J A;  2KWK A;  2M3H A;  5EV9 A;  5EIC A;  5CS8 A;  5I40 A;  5LKU A;  5EWW A;  5C4Q A;  4HXO A;  4O74 A;  2LQ6 A;  2MA5 A;  2UZG A;  4UIT A;  4OGI A;  5G05 B;  4X2I A;  4ALH A;  3JVK A;  2F6J A;  4QF2 A;  5I29 A;  4OGJ A;  5FER A;  4A9N A;  5FE0 A;  4Z6I A;  2L0B A;  3RTR B;  4TS8 A;  2ZET C;  5D1M B;  4HBY A;  5AD2 A;  2I7K A;  4A49 A;  5HRW A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  4LZ2 A;  3N9N A;  3P1E A;  5CY9 A;  4NQM A;  5F1H A;  1HYI A;  1WUM A;  5ENJ A;  3MB3 A;  5HFQ A;  4N4G A;  5HEN A;  5I80 A;  5DFB A;  4QSX A;  5A82 A;  4Z1Q A;  2EA6 A;  2LGK A;  5KH3 A;  5D0C A;  5F63 A;  3L11 A;  5FFW A;  4BW3 A;  3QZV A;  5ENH A;  4HBW A;  5HM0 A;  4YH3 A;  3HMF A;  5EK9 A;  2DVS A;  3MUK A;  2YW5 A;  2RO1 A;  1WEM A;  4UIW A;  1WEQ A;  3M99 A;  4YYH A;  4N4I A;  4PCI A;  5IGK A;  3N9M A;  4O64 A;  4ZDT A;  4LLB A;  4UYD A;  5D3T A;  2D8S A;  4FLP A;  5CFW A;  3KQI A;  4YK0 A;  2ECV A;  4WZ3 B;  1X4U A;  4O7A A;  2DAT A;  4YBT A;  4YYD A;  4PKL A;  5CUD A;  2OO1 A;  5TDW A;  4UIV A;  3UV2 A;  5FH8 A;  4KV4 A;  2N9G A;  1WE9 A;  5I7X A;  5DYA A;  4O72 A;  5F36 A;  3LXJ A;  2ECI A;  4LDF A;  4I7C A;  4QYL A;  2EOD A;  4XY8 A;  5F3A A;  5CQ4 A;  2F42 A;  4NQN A;  5ETB A;  4N4H A;  4UP5 A;  3LRQ A;  4CUU A;  1WEO A;  3MUL A;  5D3R A;  4AVX A;  2YYN A;  5EA1 A;  1VYX A;  4FJC A;  5CZG A;  5I7Y A;  5L97 A;  2YW8 A;  2H0D B;  4AUQ B;  4YY4 A;  4TQN A;  4NYW A;  3N9L A;  2LXH C;  5D25 A;  5FB1 A;  1WES A;  5FFV A;  5KTU A;  4A9E A;  3EB5 A;  4YAX A;  1MM2 A;  2YEL A;  4A9I A;  4GNE A;  5E74 A;  4NXJ A;  5DYU A;  5EPR A;  2RFJ A;  4O78 A;  5CQ8 A;  3DQV R;  3T6R A;  5CQT A;  2MD7 B;  4O70 A;  4CUR A;  5LCW B;  3Q2E A;  2CKL A;  3SHB A;  2LGL A;  5FE5 A;  2YT5 A;  5C7N A;  3O70 A;  1ZBD B;  2YSJ A;  5CU8 A;  4QSV A;  5FFY A;  3SOU A;  5IGN A;  4J0S A;  5A5S A;  5CUG A;  5LKX A;  4V3K C;  5E0R A;  4IOO A;  5BT4 A;  2VJE B;  5HRX A;  4LK9 A;  5KH7 A;  5DYX A;  5TB6 A;  4S3O C;  4QSU A;  3UVD A;  5HQ6 A;  2MJV B;  5F62 A;  2PUY A;  4C9Z A;  4NYV A;  4CL9 A;  5ENG A;  5A5Q A;  1Z6U A;  3U5O A;  2FUU A;  2L43 A;  2L80 A;  4WA6 A;  3QZS A;  2K4D A;  4LYW A;  2E6S A;  3L1Z B;  2L75 A;  4UIZ A;  2M85 A;  2WP2 A;  2HYE D;  4IR5 A;  3MXF A;  5ENF A;  3HTK C;  4YAT A;  3SVG A;  5ACY A;  3U5M A;  4IOR A;  4XY9 A;  4QSQ A;  2JMJ A;  4NR5 A;  2KU3 A;  3DPL R;  3ZVZ B;  3LJW A;  5DX4 A;  4WIV A;  2VJF B;  5C87 A;  5DFC A;  4QSP A;  4MEP A;  3ZPV 1;  2OXQ C;  3KV6 A;  2JRJ A;  5IGL A;  3LQJ A;  4NRB A;  2E3K A;  4YAD A;  4ZW1 A;  2K1J A;  5L98 A;  4A9O A;  5K29 A;  3KNV A;  5CRM A;  4LR6 A;  5FE6 A;  5C11 A;  1E4U A;  2Y1N A;  4TU6 A;  5HLS A;  4ZUX U;  5I86 A;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  5FE7 A;  5FH7 A;  4C67 A;  2E7N A;  5CUE A;  5ENC A;  5EIS A;  5DKD A;  4LZS A;  3RPG C;  5B76 A;  3AQA A;  5EWC A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  3ZYU A;  4KCX A;  4PCE A;  5F25 A;  4QZS A;  1FBV A;  3U5P A;  5HEL A;  5A81 A;  2AN6 A;  2ECJ A;  5I3L A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  4YBM A;  3DWY A;  4V3L C;  4QBM A;  3M63 A;  5E9I A;  4MR5 A;  4CLB A;  4LYI A;  5CQ5 A;  4YY6 A;  4BHW A;  4QUT A;  5C8G A;  2LV9 A;  5EI4 A;  5J0D A;  5LJ2 A;  4AYC B;  3O33 A;  4CFK A;  2K17 A;  3EB6 A;  4L58 A;  5H9M A;  5EPB A;  2CSY A;  4A4B A;  3I3J A;  5FEY A;  5A5O A;  3P5O A;  4LYS A;  4QST A;  4A9M A;  5CTL A;  5D3H A;  5A7C A;  1WEW A;  2ECW A;  2NXB A;  5DYC A;  5DFD A;  4QSS A;  5CGP A;  5I83 A;  3N9P A;  2KWN A;  4PY6 A;  2E7O A;  5LJ1 A;  3UVY A;  5J3X A;  3GL6 A;  4NYX A;  5EU1 A;  5IID A;  1V87 A;  2FUI A;  5FE8 A;  2YEM A;  5AME A;  1E6I A;  4HXL A;  2GRC A;  5H85 A;  2YHO A;  5D3P A;  4O75 A;  3T7L A;  3RCW A;  3TLP A;  5FDZ A;  1DVP A;  4FIP A;  3ZYQ A;  4AKN A;  4A9L A;  4A9K A;  5IBN A;  4O7C A;  3HME A;  4QEW A;  4Q0O A;  3G0J A;  4QC1 A;  3MB4 A;  2MA6 A;  4QR5 A;  5A85 A;  3HCT A;  2LGG A;  2HDP A;  5H1V A;  3M62 A;  3N9Q A;  4TYL A;  3JVL A;  5CUB A;  5HCL A;  5AIT A;  2OUO A;  5FG5 A;  2XEU A;  5HEM A;  5H1U A;  4YYM A;  4MSX A;  3RPG B;  4CFL A;  5FE4 A;  3O35 A;  5E3G A;  2KR4 A;  4WHW A;  5E9M A;  4GB0 A;  2JMD A;  2DVV A;  5CQA A;  5E9Y A;  3O37 A;  4QNS A;  2R0V A;  2Y43 A;  5ENI A;  2DX8 A;  5LUU A;  1HYJ A;  2KIZ A;  4QY4 A;  5DLX A;  5AD3 A;  1N87 A;  2VPD A;  4Q0N A;  4UYH A;  2LN0 A;  4E96 A;  5AMF A;  4NRA A;  5F1L A;  2D82 A;  3G0L A;  3MQM A;  4I7D A;  3LQI A;  5TRB A;  4Z6H A;  1X4I A;  2YQL A;  5COI A;  3O36 A;  4QUU A;  5L8T A;  2KYU A;  3C5K A;  5A5R A;  4C66 A;  5FG6 A;  4Y03 A;  3ZNI A;  4CUQ A;  1JM7 A;  5TBN A;  3UV5 A;  4HXR A;  4N4F A;  2LDR A;  3N9O A;  5G4R A;  4XUB A;  2KFT A;  3AAD A;  5EP7 A;  5EWH A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  5CUA A;  4YBS A;  5CQ3 A;  4GNF A;  3K2J A;  4QSR A;  5H1T A;  5DLZ A;  5ENB A;  4TT2 A;  5EWV A;  2E6R A;  4DON A;  1CHC A;  3C6W A;  3MHH A;  2R10 A;  4HBV A;  4CUP A;  2KTB B;  4IOQ A;  4MEO A;  5HQ5 A;  4HXK A;  5FE3 A;  2KGI A;  4J3I A;  4HXM A;  5F5Z A;  2DVQ A;  2YQM A;  1JM7 B;  5HFR A;  4YYI A;  2VJF A;  3S92 A;  1U6G B;  5G4S A;  5HQ7 A;  2H60 A;  5EVA A;  4BW2 A;  2ECT A;  2VPE A;  3UV4 A;  1X4J A;  2YSM A;  5FH6 A;  5I1Q A;  5E9K A;  2ECN A;  2YQD A;  4NS5 A;  1Z60 A;  1WIM A;  4AP4 A;  4NUC A;  2G4A A;  5LJ0 A;  4PPE A;  5EPS A;  4BBQ A;  5TAB A;  3FL2 A;  2KGG A;  2RS9 B;  4NR4 A;  1WEE A;  5DW2 A;  1T1H A;  5D1K B;  5DKA A;  4KV1 A;  4NUE A;  4HXP A;  4IR4 A;  5ETD A;  5JG6 A;  3P1F A;  2R0S A;  4O77 A;  5E73 A;  1RMD A;  4R2Y A;  4UP0 A;  5CP5 A;  4NRC A;  4BJX A;  4QEV A;  2QIZ A;  5HRV A;  4NR7 A;  4O76 A;  3P1D A;  2M1R A;  4O7B A;  4W4U A;  4CCG X;  4O71 A;  5FE1 A;  5LVR A;  2KWO A;  2F6N A;  5B79 A;  5C89 A;  4RVR A;  4YYG A; 
#chains in the Genus database with same CATH topology
 4MEQ A;  4ZQL A;  2C2V S;  4GND A;  2M13 A;  2CT2 A;  4NN2 A;  5E3D A;  2KKY A;  4ZC9 A;  2D9E A;  5DIN A;  4XYA A;  3O47 A;  4O62 A;  5IGM A;  1IYM A;  2VPG A;  4LZR A;  5L99 A;  4N3W A;  4YH4 A;  5KU3 A;  2L5U A;  3FJU B;  2YHN A;  3UVW A;  4QC3 A;  3PLW A;  2YUR A;  2KKX A;  2M6M A;  4XUA A;  3ASL A;  4R8P K;  1BOR A;  4Z93 A;  5KO4 A;  1F62 A;  5EM3 A;  1F68 A;  4LRG A;  3FAN A;  5FBX A;  5DBM A;  4A9F A;  3QZT A;  1WEV A;  4IR6 A;  5E7D A;  5D3S A;  4O7F A;  5JI8 A;  4IC2 A;  2G43 A;  4UIU A;  5B78 A;  4IC3 A;  4R7E A;  3Q2F A;  3GG3 A;  3LQH A;  2RSD A;  5D3J A;  3ZVY A;  4MEN A;  2LSP B;  5CRZ A;  1LDK C;  2JM3 A;  4UIY A;  4YYK A;  3U5K A;  5DKH A;  4TTE A;  2XB1 A;  3IU5 A;  3ZTG A;  4NR6 A;  5LKZ A;  5K3Q A;  4XI1 A;  1WIL A;  4TU4 A;  3H7H A;  5FG4 A;  4MR3 A;  4PS5 A;  3DWD A;  2MIQ A;  4HXN A;  4YAB A;  4J0R A;  5SVY A;  4YYJ A;  2LXP C;  4GPJ A;  4YYN A;  3GV4 A;  4NR9 A;  2EXU A;  5CUC A;  5F61 A;  1N72 A;  2QJ0 A;  3VKG A;  3PHD A;  5AIU A;  1ZS5 A;  2VJE A;  5KH9 A;  2RNW A;  1K2F A;  2BAY A;  4UYF A;  4P5O B;  4NR8 A;  2NAA A;  1X0J A;  5E9L A;  4TZ8 A;  4A0C D;  5IG6 A;  4WZ0 A;  5B75 A;  5CPE A;  3FKM X;  3V43 A;  4WHU A;  2YYR A;  3VK6 A;  5ENE A;  5D3N A;  5JWM A;  3D7C A;  5DW1 A;  4A9J A;  2I50 A;  2KRE A;  4YC9 A;  5TCM A;  5KTW A;  2JMI A;  2LGV A;  4LAD B;  5EWD A;  2IDA A;  4CA1 A;  2VNF A;  4UIX A;  4MR4 A;  5C85 A;  4S3O B;  4UI9 B;  3JVJ A;  5C13 A;  4FK5 A;  1VD4 A;  5FE9 A;  4TZ2 A;  3L1X A;  3O34 A;  4CUS A;  3NXB A;  5DKC A;  2L5E A;  4HXS A;  4F3I A;  2OSS A;  4UYF B;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  3ONI A;  2L85 A;  2L7P A;  5E9V A;  4TKP B;  4UYG A;  5A83 A;  3HCU A;  4WZ2 A;  5HJC A;  1JSP B;  1Z2Q A;  4GNG A;  3UVX A;  3I2D A;  5A5N A;  2YDW A;  3U5L A;  1WGM A;  4A9H A;  5F2P A;  2R0Y A;  4CUT A;  2CSZ A;  5CQ7 A;  4X3G A;  5B8D A;  4L7X A;  4OUF A;  4MVT A;  3MHS A;  2DKW A;  4O7E A;  4QSW A;  4PTB A;  5A5P A;  5KHM A;  4HBX A;  5LKT A;  4J1P A;  4NUD A;  5LVQ A;  1JM4 B;  2P57 A;  2Y1M A;  5G04 B;  3UW9 A;  4I7B A;  4QEU A;  5D26 A;  5D7X A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4QR4 A;  1WUG A;  3D1B A;  3DAI A;  5EQ1 A;  4B7Y C;  4BW1 A;  3SVF A;  5FB0 A;  2G6Q A;  5B77 A;  2RNY A;  4TT6 A;  5II1 A;  4QQ4 A;  4F52 B;  4MR6 A;  5TDR A;  2WP1 A;  5BT3 A;  2CRW A;  1WFK A;  3P1C A;  2RNX A;  3NG2 A;  5I88 A;  5SVX A;  2DWW A;  3HMH A;  2KE1 A;  3SOX A;  4IR3 A;  2XOY A;  5D3L A;  5EGU A;  1G25 A;  5CQ6 A;  2VP7 A;  3IHP A;  3Q1D A;  4QB3 A;  1EQF A;  2KWJ A;  5L96 A;  2EGP A;  4UYE A;  5BT5 A;  4LKA A;  4QYD A;  3IU6 A;  5F60 A;  1WEN A;  4TT4 A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  5II2 A;  3O7A A;  5D24 A;  2L84 A;  4ALG A;  2C2L A;  4B86 C;  5FE2 A;  4QF3 A;  3S91 A;  3SVH A;  2YEK A;  4AYC A;  2DVR A;  4Z1S A;  3ZPV E;  3JVM A;  5DY7 A;  5I89 A;  4LC2 A;  4BW4 A;  1LDJ B;  5SVI A;  2YU4 A;  5L8U A;  2I8N A;  2K16 A;  5KTX A;  4QR3 A;  3U5J A;  2KWK A;  2M3H A;  5EV9 A;  5EIC A;  5CS8 A;  1MBM A;  5I40 A;  5LKU A;  5EWW A;  5C4Q A;  4HXO A;  4O74 A;  2LQ6 A;  2MA5 A;  2UZG A;  4UIT A;  4OGI A;  5G05 B;  4X2I A;  4ALH A;  3JVK A;  2F6J A;  4QF2 A;  5I29 A;  4OGJ A;  5FER A;  4A9N A;  5FE0 A;  4Z6I A;  2L0B A;  3RTR B;  4TS8 A;  2D8U A;  2ZET C;  5D1M B;  4HBY A;  5AD2 A;  3DDT A;  4AKH A;  2I7K A;  4A49 A;  5HRW A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  3LDY A;  4LZ2 A;  3N9N A;  3JUE A;  3P1E A;  5CY9 A;  4NQM A;  5F1H A;  1HYI A;  1WUM A;  5ENJ A;  3MB3 A;  5HFQ A;  4N4G A;  5HEN A;  5I80 A;  5DFB A;  4QSX A;  5A82 A;  4Z1Q A;  2EA6 A;  2LGK A;  5KH3 A;  5D0C A;  5F63 A;  3L11 A;  5FFW A;  4BW3 A;  3QZV A;  5ENH A;  4HBW A;  5HM0 A;  4YH3 A;  3HMF A;  5EK9 A;  2DVS A;  3MUK A;  3M7K A;  2YW5 A;  2RO1 A;  1WEM A;  4UIW A;  1WEQ A;  3M99 A;  2LAU A;  4YYH A;  4N4I A;  4PCI A;  5IGK A;  3N9M A;  4O64 A;  1PUO A;  4ZDT A;  4LLB A;  4UYD A;  5D3T A;  2D8S A;  4FLP A;  5CFW A;  3KQI A;  4YK0 A;  4Z0R A;  2ECV A;  4WZ3 B;  1X4U A;  4O7A A;  2DAT A;  4YBT A;  4YYD A;  4PKL A;  5CUD A;  2OO1 A;  5TDW A;  4UIV A;  3UV2 A;  5FH8 A;  3T9K A;  4KV4 A;  2N9G A;  1WE9 A;  5I7X A;  5DYA A;  4O72 A;  5F36 A;  3LXJ A;  2ECI A;  4LDF A;  4I7C A;  4QYL A;  2EOD A;  4XY8 A;  5F3A A;  5CQ4 A;  2F42 A;  4NQN A;  2EJN A;  5ETB A;  4AKI A;  2XOZ A;  4N4H A;  4UP5 A;  3LRQ A;  4CUU A;  1WEO A;  3MUL A;  5D3R A;  4AVX A;  2YYN A;  5EA1 A;  1VYX A;  4FJC A;  5CZG A;  5I7Y A;  5L97 A;  2YW8 A;  2H0D B;  4AUQ B;  4YY4 A;  4TQN A;  2B0O E;  4NYW A;  3N9L A;  2LXH C;  5D25 A;  5FB1 A;  1WES A;  5FFV A;  5KTU A;  4OGC A;  3LVR E;  2OWA A;  4A9E A;  2IQJ A;  3EB5 A;  4YAX A;  1MM2 A;  2YEL A;  4A9I A;  4GNE A;  5E74 A;  4NXJ A;  5DYU A;  5EPR A;  3FEH A;  2RFJ A;  4O78 A;  5CQ8 A;  3FAO A;  3DQV R;  3T6R A;  5CQT A;  2MD7 B;  4O70 A;  3ERR A;  4CUR A;  5LCW B;  3Q2E A;  2CKL A;  3SHB A;  2LGL A;  3VKH A;  5FE5 A;  2YT5 A;  5C7N A;  3O70 A;  1ZBD B;  2YSJ A;  5CU8 A;  4QSV A;  5FFY A;  3SOU A;  5IGN A;  4J0S A;  5A5S A;  5CUG A;  5LKX A;  4V3K C;  5E0R A;  4IOO A;  5BT4 A;  2VJE B;  4H9D A;  5HRX A;  4LK9 A;  5KH7 A;  5DYX A;  5TB6 A;  4S3O C;  4QSU A;  3UVD A;  5HQ6 A;  2MJV B;  5F62 A;  2PUY A;  4C9Z A;  4NYV A;  4CL9 A;  5ENG A;  5A5Q A;  1Z6U A;  3U5O A;  2FUU A;  2L43 A;  2L80 A;  4WA6 A;  3QZS A;  2K4D A;  4LYW A;  2E6S A;  3L1Z B;  2L75 A;  4UIZ A;  2M85 A;  2WP2 A;  2HYE D;  4IR5 A;  3MXF A;  5ENF A;  3HTK C;  4YAT A;  3SVG A;  5ACY A;  3U5M A;  4IOR A;  4XY9 A;  4QSQ A;  2JMJ A;  4NR5 A;  2KU3 A;  3MDB C;  3DPL R;  3ZVZ B;  3LJW A;  5DX4 A;  4WIV A;  2VJF B;  5C87 A;  5DFC A;  4QSP A;  4MEP A;  3ZPV 1;  2OXQ C;  2EGM A;  3KV6 A;  2JRJ A;  5IGL A;  3LQJ A;  4NRB A;  2VPE A;  3LVQ E;  2E3K A;  4YAD A;  4ZW1 A;  2K1J A;  5L98 A;  4A9O A;  5K29 A;  3KNV A;  5CRM A;  4LR6 A;  5FE6 A;  5C11 A;  1E4U A;  2Y1N A;  4TU6 A;  3FM8 C;  5HLS A;  4OGE A;  4ZUX U;  5I86 A;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  5FE7 A;  5FH7 A;  4C67 A;  3SUB A;  2E7N A;  5CUE A;  5ENC A;  5EIS A;  5DKD A;  2FFW A;  4LZS A;  3RPG C;  5B76 A;  3AQA A;  5EWC A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  3ZYU A;  4KCX A;  4PCE A;  5F25 A;  4QZS A;  1FBV A;  3U5P A;  5HEL A;  5A81 A;  2AN6 A;  2ECJ A;  5I3L A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  4YBM A;  2FD4 A;  3DWY A;  4V3L C;  4QBM A;  3M63 A;  5E9I A;  4MR5 A;  4CLB A;  4LYI A;  5CQ5 A;  4YY6 A;  4BHW A;  4QUT A;  5C8G A;  2LV9 A;  5EI4 A;  5J0D A;  5LJ2 A;  4AYC B;  3O33 A;  4CFK A;  2K17 A;  2CSV A;  3EB6 A;  4L58 A;  5H9M A;  4Z0O A;  4AI6 A;  5EPB A;  2CSY A;  4A4B A;  3I3J A;  5FEY A;  5A5O A;  3P5O A;  4LYS A;  4QST A;  4A9M A;  5CTL A;  5D3H A;  5A7C A;  1WEW A;  2ECW A;  2YVR A;  2NXB A;  5DYC A;  5DFD A;  4QSS A;  5CGP A;  5I83 A;  3N9P A;  2KWN A;  4PY6 A;  2E7O A;  5LJ1 A;  3UVY A;  5J3X A;  3GL6 A;  4NYX A;  5EU1 A;  5IID A;  1V87 A;  2FUI A;  5FE8 A;  2YEM A;  5AME A;  1E6I A;  4HXL A;  2GRC A;  5H85 A;  2YHO A;  5D3P A;  4O75 A;  3T7L A;  3E2D A;  3RCW A;  3TLP A;  5FDZ A;  1DVP A;  4FIP A;  3ZYQ A;  4AKN A;  4A9L A;  4A9K A;  5IBN A;  4O7C A;  3HME A;  4QEW A;  4Q0O A;  3G0J A;  2DSM A;  4QC1 A;  3MB4 A;  2MA6 A;  4QR5 A;  5A85 A;  3HCT A;  2LGG A;  2HDP A;  2RR4 A;  5H1V A;  3M62 A;  3N9Q A;  4TYL A;  3JVL A;  5CUB A;  5HCL A;  5AIT A;  2OUO A;  5FG5 A;  2XEU A;  5HEM A;  5H1U A;  4YYM A;  4MSX A;  5SVI B;  3RPG B;  4CFL A;  5FE4 A;  3O35 A;  5E3G A;  2KR4 A;  3KDE C;  4WHW A;  5E9M A;  4GB0 A;  2JMD A;  2DVV A;  5CQA A;  5E9Y A;  1DCQ A;  3O37 A;  4QNS A;  2R0V A;  2Y43 A;  3LJU X;  5ENI A;  2DX8 A;  5LUU A;  1HYJ A;  2KIZ A;  4QY4 A;  5DLX A;  5AD3 A;  1N87 A;  2VPD A;  4Q0N A;  4UYH A;  2LN0 A;  4E96 A;  5AMF A;  4NRA A;  5F1L A;  2D82 A;  3G0L A;  3MQM A;  4I7D A;  3LQI A;  5TRB A;  4Z6H A;  1X4I A;  2YQL A;  5COI A;  3O36 A;  4QUU A;  5L8T A;  2KYU A;  3C5K A;  3D1D A;  5A5R A;  4C66 A;  5FG6 A;  4Y03 A;  3ZNI A;  4CUQ A;  1JM7 A;  5TBN A;  3UV5 A;  4HXR A;  4N4F A;  2LDR A;  3N9O A;  5G4R A;  4XUB A;  2MKE A;  2KFT A;  3AAD A;  5EP7 A;  5EWH A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  5CUA A;  4YBS A;  5CQ3 A;  4GNF A;  3K2J A;  4QSR A;  5H1T A;  5DLZ A;  5ENB A;  4TT2 A;  5EWV A;  2E6R A;  4DON A;  1CHC A;  2CRR A;  3C6W A;  3MHH A;  2R10 A;  4HBV A;  4CUP A;  2KTB B;  4IOQ A;  4F1P A;  2E61 A;  4MEO A;  5HQ5 A;  4HXK A;  5FE3 A;  2KGI A;  4J3I A;  4HXM A;  5F5Z A;  2DVQ A;  2YQM A;  1JM7 B;  5HFR A;  4YYI A;  2VJF A;  3S92 A;  1U6G B;  5G4S A;  5HQ7 A;  2H60 A;  5EVA A;  4BW2 A;  2DJA A;  2ECT A;  3UV4 A;  1X4J A;  2YSM A;  5FH6 A;  5I1Q A;  5E9K A;  2ECN A;  2YQD A;  4NS5 A;  1Z60 A;  1WIM A;  4AP4 A;  4NUC A;  2G4A A;  5LJ0 A;  4PPE A;  5EPS A;  4BBQ A;  2JUN A;  5TAB A;  3FL2 A;  2KGG A;  2XP0 A;  2RS9 B;  4NR4 A;  1WEE A;  5DW2 A;  1T1H A;  5D1K B;  2XOC A;  5DKA A;  1ZKR A;  4KV1 A;  4NUE A;  4HXP A;  4IR4 A;  5ETD A;  5JG6 A;  3P1F A;  2R0S A;  4O77 A;  5E73 A;  1RMD A;  4R2Y A;  4UP0 A;  5CP5 A;  4NRC A;  4BJX A;  4QEV A;  2QIZ A;  5HRV A;  4AKG A;  4NR7 A;  4O76 A;  3P1D A;  2M1R A;  4O7B A;  2CON A;  4W4U A;  4CCG X;  4O71 A;  5FE1 A;  5LVR A;  2KWO A;  2F6N A;  5B79 A;  5C89 A;  4RVR A;  4YYG A; 
#chains in the Genus database with same CATH homology
 4MEQ A;  4ZQL A;  2C2V S;  4GND A;  4NN2 A;  2CT2 A;  5E3D A;  4ZC9 A;  2D9E A;  5DIN A;  4XYA A;  5IGM A;  1IYM A;  2VPG A;  4LZR A;  5L99 A;  4N3W A;  4YH4 A;  5KU3 A;  2L5U A;  2YHN A;  3UVW A;  4QC3 A;  2YUR A;  2M6M A;  4XUA A;  3ASL A;  4R8P K;  1BOR A;  4Z93 A;  5KO4 A;  1F62 A;  5EM3 A;  1F68 A;  4LRG A;  5FBX A;  5DBM A;  4A9F A;  3QZT A;  1WEV A;  4IR6 A;  5E7D A;  5D3S A;  4O7F A;  5JI8 A;  4IC2 A;  2G43 A;  4UIU A;  5B78 A;  4IC3 A;  4R7E A;  3Q2F A;  3GG3 A;  3LQH A;  2RSD A;  5D3J A;  3ZVY A;  4MEN A;  2LSP B;  5CRZ A;  1LDK C;  4UIY A;  4YYK A;  3U5K A;  5DKH A;  4TTE A;  2XB1 A;  3IU5 A;  3ZTG A;  4NR6 A;  5LKZ A;  4XI1 A;  1WIL A;  4TU4 A;  5FG4 A;  4MR3 A;  4PS5 A;  2MIQ A;  4HXN A;  4YAB A;  4J0R A;  4YYJ A;  2LXP C;  4GPJ A;  4YYN A;  3GV4 A;  4NR9 A;  5CUC A;  5F61 A;  1N72 A;  2QJ0 A;  3PHD A;  5AIU A;  1ZS5 A;  2VJE A;  5KH9 A;  2RNW A;  1K2F A;  2BAY A;  4UYF A;  4P5O B;  4NR8 A;  2NAA A;  1X0J A;  5E9L A;  4TZ8 A;  4A0C D;  5IG6 A;  4WZ0 A;  5B75 A;  5CPE A;  3FKM X;  3V43 A;  4WHU A;  2YYR A;  3VK6 A;  5ENE A;  5D3N A;  5JWM A;  3D7C A;  5DW1 A;  4A9J A;  2I50 A;  2KRE A;  4YC9 A;  5TCM A;  5KTW A;  2JMI A;  2LGV A;  4LAD B;  5EWD A;  2IDA A;  4CA1 A;  2VNF A;  4UIX A;  4MR4 A;  5C85 A;  4S3O B;  4UI9 B;  3JVJ A;  5C13 A;  4FK5 A;  1VD4 A;  5FE9 A;  4TZ2 A;  3L1X A;  3O34 A;  4CUS A;  3NXB A;  5DKC A;  2L5E A;  4HXS A;  4F3I A;  2OSS A;  4UYF B;  2RI7 A;  2FSA A;  1XWH A;  3SOW A;  3ONI A;  2L85 A;  5E9V A;  4TKP B;  4UYG A;  5A83 A;  3HCU A;  4WZ2 A;  5HJC A;  1JSP B;  1Z2Q A;  4GNG A;  3UVX A;  3I2D A;  5A5N A;  2YDW A;  3U5L A;  1WGM A;  4A9H A;  5F2P A;  2R0Y A;  4CUT A;  2CSZ A;  5CQ7 A;  4X3G A;  5B8D A;  4L7X A;  4OUF A;  4MVT A;  3MHS A;  2DKW A;  4O7E A;  4QSW A;  4PTB A;  5A5P A;  5KHM A;  4HBX A;  5LKT A;  4J1P A;  4NUD A;  5LVQ A;  1JM4 B;  2Y1M A;  5G04 B;  3UW9 A;  4I7B A;  4QEU A;  5D26 A;  5D7X A;  2YUC A;  2G45 A;  3HCS A;  2VPB A;  4A4C A;  1FP0 A;  4QR4 A;  1WUG A;  3DAI A;  5EQ1 A;  4B7Y C;  4BW1 A;  3SVF A;  5FB0 A;  2G6Q A;  5B77 A;  2RNY A;  4TT6 A;  5II1 A;  4F52 B;  4MR6 A;  5TDR A;  2WP1 A;  5BT3 A;  1WFK A;  3P1C A;  2RNX A;  3NG2 A;  5I88 A;  3SOX A;  2DWW A;  3HMH A;  2KE1 A;  4IR3 A;  5D3L A;  5EGU A;  1G25 A;  5CQ6 A;  2VP7 A;  3IHP A;  4QB3 A;  1EQF A;  2KWJ A;  5L96 A;  2EGP A;  4UYE A;  5BT5 A;  4LKA A;  4QYD A;  3IU6 A;  5F60 A;  1WEN A;  4TT4 A;  1MM3 A;  1WEU A;  2PNX A;  2QIC A;  5II2 A;  3O7A A;  5D24 A;  2L84 A;  4ALG A;  2C2L A;  4B86 C;  5FE2 A;  4QF3 A;  3S91 A;  3SVH A;  2YEK A;  4AYC A;  2DVR A;  4Z1S A;  3ZPV E;  3JVM A;  5DY7 A;  5I89 A;  4LC2 A;  4BW4 A;  1LDJ B;  2YU4 A;  5L8U A;  2I8N A;  2K16 A;  5KTX A;  4QR3 A;  3U5J A;  2KWK A;  2M3H A;  5EV9 A;  5EIC A;  5CS8 A;  5I40 A;  5LKU A;  5EWW A;  5C4Q A;  4HXO A;  4O74 A;  2LQ6 A;  2MA5 A;  2UZG A;  4UIT A;  4OGI A;  5G05 B;  4X2I A;  4ALH A;  3JVK A;  2F6J A;  4QF2 A;  5I29 A;  4OGJ A;  5FER A;  4A9N A;  5FE0 A;  4Z6I A;  2L0B A;  3RTR B;  4TS8 A;  2ZET C;  5D1M B;  4HBY A;  5AD2 A;  2I7K A;  4A49 A;  5HRW A;  1VFY A;  2MNZ A;  4FO9 A;  3U5N A;  4LZ2 A;  3N9N A;  3P1E A;  5CY9 A;  4NQM A;  5F1H A;  1HYI A;  1WUM A;  5ENJ A;  3MB3 A;  5HFQ A;  4N4G A;  5HEN A;  5I80 A;  5DFB A;  4QSX A;  5A82 A;  4Z1Q A;  2EA6 A;  2LGK A;  5KH3 A;  5D0C A;  5F63 A;  3L11 A;  5FFW A;  4BW3 A;  3QZV A;  5ENH A;  4HBW A;  5HM0 A;  4YH3 A;  3HMF A;  5EK9 A;  2DVS A;  3MUK A;  2YW5 A;  2RO1 A;  1WEM A;  4UIW A;  1WEQ A;  3M99 A;  4YYH A;  4N4I A;  4PCI A;  5IGK A;  3N9M A;  4O64 A;  4ZDT A;  4LLB A;  4UYD A;  5D3T A;  2D8S A;  4FLP A;  5CFW A;  3KQI A;  4YK0 A;  2ECV A;  4WZ3 B;  1X4U A;  4O7A A;  2DAT A;  4YBT A;  4YYD A;  4PKL A;  5CUD A;  2OO1 A;  5TDW A;  4UIV A;  3UV2 A;  5FH8 A;  4KV4 A;  2N9G A;  1WE9 A;  5I7X A;  5DYA A;  4O72 A;  5F36 A;  3LXJ A;  2ECI A;  4LDF A;  4I7C A;  4QYL A;  2EOD A;  4XY8 A;  5F3A A;  5CQ4 A;  2F42 A;  4NQN A;  5ETB A;  4N4H A;  4UP5 A;  3LRQ A;  4CUU A;  1WEO A;  3MUL A;  5D3R A;  4AVX A;  2YYN A;  5EA1 A;  1VYX A;  4FJC A;  5CZG A;  5I7Y A;  5L97 A;  2YW8 A;  2H0D B;  4AUQ B;  4YY4 A;  4TQN A;  4NYW A;  3N9L A;  2LXH C;  5D25 A;  5FB1 A;  1WES A;  5FFV A;  5KTU A;  4A9E A;  3EB5 A;  4YAX A;  1MM2 A;  2YEL A;  4A9I A;  4GNE A;  5E74 A;  4NXJ A;  5DYU A;  5EPR A;  2RFJ A;  4O78 A;  5CQ8 A;  3DQV R;  3T6R A;  5CQT A;  2MD7 B;  4O70 A;  4CUR A;  5LCW B;  3Q2E A;  2CKL A;  3SHB A;  2LGL A;  5FE5 A;  2YT5 A;  5C7N A;  3O70 A;  1ZBD B;  2YSJ A;  5CU8 A;  4QSV A;  5FFY A;  3SOU A;  5IGN A;  4J0S A;  5A5S A;  5CUG A;  5LKX A;  4V3K C;  5E0R A;  4IOO A;  5BT4 A;  2VJE B;  5HRX A;  4LK9 A;  5KH7 A;  5DYX A;  5TB6 A;  4S3O C;  4QSU A;  3UVD A;  5HQ6 A;  2MJV B;  5F62 A;  2PUY A;  4C9Z A;  4NYV A;  4CL9 A;  5ENG A;  5A5Q A;  1Z6U A;  3U5O A;  2FUU A;  2L43 A;  2L80 A;  4WA6 A;  3QZS A;  2K4D A;  4LYW A;  2E6S A;  3L1Z B;  2L75 A;  4UIZ A;  2M85 A;  2WP2 A;  2HYE D;  4IR5 A;  3MXF A;  5ENF A;  3HTK C;  4YAT A;  3SVG A;  5ACY A;  3U5M A;  4IOR A;  4XY9 A;  4QSQ A;  2JMJ A;  4NR5 A;  2KU3 A;  3DPL R;  3ZVZ B;  3LJW A;  5DX4 A;  4WIV A;  2VJF B;  5C87 A;  5DFC A;  4QSP A;  4MEP A;  3ZPV 1;  2OXQ C;  3KV6 A;  2JRJ A;  5IGL A;  3LQJ A;  4NRB A;  2E3K A;  4YAD A;  4ZW1 A;  2K1J A;  5L98 A;  4A9O A;  5K29 A;  3KNV A;  5CRM A;  4LR6 A;  5FE6 A;  5C11 A;  1E4U A;  2Y1N A;  4TU6 A;  5HLS A;  4ZUX U;  5I86 A;  3PUQ A;  2MT5 A;  5EYA F;  2H0D A;  5FE7 A;  5FH7 A;  4C67 A;  2E7N A;  5CUE A;  5ENC A;  5EIS A;  5DKD A;  4LZS A;  3RPG C;  5B76 A;  3AQA A;  5EWC A;  4Q6F A;  1JOC A;  2LRI C;  3PUR A;  2MNY A;  3ZYU A;  4KCX A;  4PCE A;  5F25 A;  4QZS A;  1FBV A;  3U5P A;  5HEL A;  5A81 A;  2AN6 A;  2ECJ A;  5I3L A;  2ECG A;  5D1L B;  2MUM A;  2YRE A;  1WEP A;  3KV5 A;  4YBM A;  3DWY A;  4V3L C;  4QBM A;  3M63 A;  5E9I A;  4MR5 A;  4CLB A;  4LYI A;  5CQ5 A;  4YY6 A;  4BHW A;  4QUT A;  5C8G A;  2LV9 A;  5EI4 A;  5J0D A;  5LJ2 A;  4AYC B;  3O33 A;  4CFK A;  2K17 A;  3EB6 A;  4L58 A;  5H9M A;  5EPB A;  2CSY A;  4A4B A;  3I3J A;  5FEY A;  5A5O A;  3P5O A;  4LYS A;  4QST A;  4A9M A;  5CTL A;  5D3H A;  5A7C A;  1WEW A;  2ECW A;  2NXB A;  5DYC A;  5DFD A;  4QSS A;  5CGP A;  5I83 A;  3N9P A;  2KWN A;  4PY6 A;  2E7O A;  5LJ1 A;  3UVY A;  5J3X A;  3GL6 A;  4NYX A;  5EU1 A;  5IID A;  1V87 A;  2FUI A;  5FE8 A;  2YEM A;  5AME A;  1E6I A;  4HXL A;  2GRC A;  5H85 A;  2YHO A;  5D3P A;  4O75 A;  3T7L A;  3RCW A;  3TLP A;  5FDZ A;  1DVP A;  4FIP A;  3ZYQ A;  4AKN A;  4A9L A;  4A9K A;  5IBN A;  4O7C A;  3HME A;  4QEW A;  4Q0O A;  3G0J A;  4QC1 A;  3MB4 A;  2MA6 A;  4QR5 A;  5A85 A;  3HCT A;  2LGG A;  2HDP A;  5H1V A;  3M62 A;  3N9Q A;  4TYL A;  3JVL A;  5CUB A;  5HCL A;  5AIT A;  2OUO A;  5FG5 A;  2XEU A;  5HEM A;  5H1U A;  4YYM A;  4MSX A;  3RPG B;  4CFL A;  5FE4 A;  3O35 A;  5E3G A;  2KR4 A;  4WHW A;  5E9M A;  4GB0 A;  2JMD A;  2DVV A;  5CQA A;  5E9Y A;  3O37 A;  4QNS A;  2R0V A;  2Y43 A;  5ENI A;  2DX8 A;  5LUU A;  1HYJ A;  2KIZ A;  4QY4 A;  5DLX A;  5AD3 A;  1N87 A;  2VPD A;  4Q0N A;  4UYH A;  2LN0 A;  4E96 A;  5AMF A;  4NRA A;  5F1L A;  2D82 A;  3G0L A;  3MQM A;  4I7D A;  3LQI A;  5TRB A;  4Z6H A;  1X4I A;  2YQL A;  5COI A;  3O36 A;  4QUU A;  5L8T A;  2KYU A;  3C5K A;  5A5R A;  4C66 A;  5FG6 A;  4Y03 A;  3ZNI A;  4CUQ A;  1JM7 A;  5TBN A;  3UV5 A;  4HXR A;  4N4F A;  2LDR A;  3N9O A;  5G4R A;  4XUB A;  2KFT A;  3AAD A;  5EP7 A;  5EWH A;  2CKL B;  4LJN A;  2MD8 C;  5G0F A;  5CUA A;  4YBS A;  5CQ3 A;  4GNF A;  3K2J A;  4QSR A;  5H1T A;  5DLZ A;  5ENB A;  4TT2 A;  5EWV A;  2E6R A;  4DON A;  1CHC A;  3C6W A;  3MHH A;  2R10 A;  4HBV A;  4CUP A;  2KTB B;  4IOQ A;  4MEO A;  5HQ5 A;  4HXK A;  5FE3 A;  2KGI A;  4J3I A;  4HXM A;  5F5Z A;  2DVQ A;  2YQM A;  1JM7 B;  5HFR A;  4YYI A;  2VJF A;  3S92 A;  1U6G B;  5G4S A;  5HQ7 A;  2H60 A;  5EVA A;  4BW2 A;  2ECT A;  2VPE A;  3UV4 A;  1X4J A;  2YSM A;  5FH6 A;  5I1Q A;  5E9K A;  2ECN A;  2YQD A;  4NS5 A;  1Z60 A;  1WIM A;  4AP4 A;  4NUC A;  2G4A A;  5LJ0 A;  4PPE A;  5EPS A;  4BBQ A;  5TAB A;  3FL2 A;  2KGG A;  2RS9 B;  4NR4 A;  1WEE A;  5DW2 A;  1T1H A;  5D1K B;  5DKA A;  4KV1 A;  4NUE A;  4HXP A;  4IR4 A;  5ETD A;  5JG6 A;  3P1F A;  2R0S A;  4O77 A;  5E73 A;  1RMD A;  4R2Y A;  4UP0 A;  5CP5 A;  4NRC A;  4BJX A;  4QEV A;  2QIZ A;  5HRV A;  4NR7 A;  4O76 A;  3P1D A;  2M1R A;  4O7B A;  4W4U A;  4CCG X;  4O71 A;  5FE1 A;  5LVR A;  2KWO A;  2F6N A;  5B79 A;  5C89 A;  4RVR A;  4YYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...