3O36A

Crystal structure of trim24 phd-bromo complexed with h4(14-19)k16ac peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
184
structure length
184
Chain Sequence
SPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription intermediary factor 1-alpha
publication title TRIM24 links a non-canonical histone signature to breast cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/protein binding
total genus 55
structure length 184
sequence length 184
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3o36A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3o36A01
4E96A 4WZ2A 4NQMA 4IR4A 5EQ1A 5A5SA 5EM3A 3KV6A 3T7LA 2FUIA 1U6GB 2MJVB 2KE1A 4P5OB 3G0LA 5DKDA 2AN6A 3EB6A 4NR6A 2WP1A 5E9YA 3PUQA 1MM3A 4NN2A 4QF2A 5C85A 5EP7A 1X4JA 3MULA 3DWYA 4IOQA 2KGGA 5TDWA 4LR6A 4KCXA 5HFQA 5B76A 5CQ4A 2L85A 4QUUA 5TRBA 5C4QA 2WP2A 2GRCA 4PCEA 5TCMA 4YYNA 5KO4A 1CHCA 5EWCA 4UIZA 5FE2A 3ZTGA 2QIZA 4A9HA 3IU6A 4UYFA 5FBXA 5E73A 4I7DA 4IC3A 3VK6A 4HBXA 5G4SA 4QC1A 4IR5A 5HQ5A 3GL6A 5CPEA 5TBNA 2CKLA 4O74A 1WILA 5H1UA 5ENIA 2K16A 2LN0A 5CUAA 2MA6A 3SVGA 4AYCB 2EA6A 4YAXA 4LC2A 2KTBB 3C5KA 5F5ZA 5HM0A 4XY9A 4X2IA 4GB0A 4AUQB 2M1RA 5HJCA 4MSXA 4LADB 4Y03A 5FE1A 4QZSA 5DW1A 5HRVA 5LUUA 4QNSA 3SVHA 2H0DA 4X3GA 3LQJA 5CQAA 2E6RA 4XI1A 2KWKA 3M62A 5EWWA 4A9MA 2L0BA 5F36A 4LLBA 4AKNA 4NS5A 4AP4A 4QSRA 3MB3A 4TU6A 5I89A 5AD3A 3U5MA 4UP5A 4YBMA 4MR4A 4CUSA 2LGGA 2RI7A 4R7EA 4ZUXU 4AVXA 4TT6A 5EICA 1IYMA 5D0CA 2D8SA 2Y43A 2E7NA 5I80A 5EWDA 4Q6FA 2F6JA 3UVXA 5CTLA 3U5KA 4PS5A 4V3LC 2OO1A 2LDRA 4FIPA 3U5JA 5A5PA 4LZ2A 2OUOA 2RS9B 4IOOA 3MHSA 2VJFA 4NR9A 4ZW1A 1RMDA 3UVYA 4I7CA 3O36A 3M99A 4NR4A 4F3IA 3QZSA 3LXJA 2RSDA 5A5RA 4HXNA 1BORA 4CUUA 4UIWA 1WEQA 4UYGA 4A9LA 2UZGA 4OGIA 4TU4A 1F68A 3D7CA 5I88A 1JOCA 5CZGA 2DWWA 5G05B 5DYXA 1WEPA 4KV1A 2R0YA 5EU1A 2MD8C 3P1CA 4J1PA 4Q0OA 4MENA 1N87A 5DKHA 4A4BA 3O35A 5E9LA 4A0CD 2YEKA 3JVLA 2YW5A 4XUAA 2JRJA 3UV5A 3RCWA 2ZETC 2LGLA 5FG5A 3MB4A 5J0DA 4O64A 5LCWB 3Q2FA 3ZVZB 5A83A 4CUPA 4TS8A 5F63A 5FH8A 5B79A 3DAIA 3PURA 4O71A 2LV9A 2NAAA 4N4IA 1K2FA 1VD4A 4QB3A 4UYFB 4YYGA 5D1MB 3RPGB 2FUUA 2LGVA 3O70A 4KV4A 5HCLA 4GNGA 1WUMA 2G4AA 3QZVA 5L8TA 1T1HA 5C87A 2RNXA 1WEUA 4PTBA 4LDFA 4LK9A 3LQIA 3HMFA 4A9KA 4YYKA 4TT4A 5DFBA 5F1HA 5IGKA 4QSPA 5CUBA 4YC9A 5D7XA 5KU3A 5IBNA 2YHNA 3N9QA 4LKAA 4Z6HA 5LJ1A 4UYEA 2LXPC 2XEUA 4BW3A 5DINA 2RFJA 5D24A 4QEUA 4CFLA 2H0DB 5DYAA 3KQIA 5FG6A 4J0SA 4HXRA 5COIA 2G43A 1WE9A 2MA5A 4N4FA 2OSSA 1WEVA 4NR5A 1FP0A 3PHDA 5D3SA 4NQNA 2YU4A 5EK9A 4WZ3B 4TZ2A 3C6WA 4ALHA 3U5PA 4MVTA 5CRZA 5IGNA 5D3RA 1X4IA 2DX8A 2YELA 2M85A 4V3KC 5F1LA 3O34A 5FE9A 1WIMA 4QEWA 5AMEA 4A9JA 4N4GA 3O7AA 2G6QA 5CQ5A 4XUBA 2OXQC 3LRQA 2YQLA 4LYWA 5FE7A 5FFYA 3I2DA 4YABA 2VPDA 4MR3A 4W4UA 5JG6A 3GG3A 4OUFA 3RPGC 2IDAA 5CQTA 4NR8A 5KTUA 4LYSA 5EWHA 1JSPB 5AITA 3ZYUA 4HXLA 2L5EA 2VJEA 5KH3A 4C67A 5TDRA 2KGIA 4QSWA 5D1LB 4QUTA 5CUGA 4NUEA 5ENJA 1ZS5A 5B77A 2LXHC 5ENEA 1N72A 4OGJA 5LJ2A 4UYDA 2K17A 5H85A 2RNYA 5DX4A 5FE5A 3DPLR 5I7YA 4NRBA 5HELA 5EISA 5EPSA 5DYCA 4TYLA 4YYJA 5A85A 4PKLA 3I3JA 4YY4A 2C2LA 5CQ8A 3UV2A 1WFKA 3L1ZB 4CA1A 3QZTA 2DVSA 3ASLA 5DLXA 5I7XA 4HBWA 5HQ7A 5F3AA 2YSJA 4O72A 1HYIA 4CL9A 5EPRA 4Z6IA 5EA1A 5CUEA 5CQ7A 5EI4A 2HDPA 3JVKA 4QSXA 5D25A 4IORA 4ZQLA 1WEWA 2R0VA 4BW1A 5FE0A 5LVQA 3SOWA 4CLBA 4YYDA 4BW2A 5A5OA 2VPGA 3G0JA 1Z6UA 5A5NA 2PNXA 4MEPA 4O78A 4YH4A 2DVQA 5FE6A 5TB6A 4YYMA 4BBQA 5HFRA 1HYJA 2KWOA 3ZNIA 4QSUA 5LKXA 2LQ6A 2KYUA 4IR3A 2KWJA 4QSVA 5KTXA 3NG2A 4Z1QA 3SVFA 4LRGA 1JM7A 4TKPB 1JM4B 4GNEA 5CQ6A 4O7EA 2M3HA 3P1FA 4N3WA 5II1A 2MNYA 4O70A 1Z2QA 5D3TA 5LJ0A 4QSTA 2ECGA 4F52B 4NYVA 3MQMA 4CUTA 4MEQA 4O7CA 4A49A 5FB0A 3O37A 5H9MA 4QR3A 2LRIC 4HXKA 2ECWA 3T6RA 3N9LA 5HENA 1WENA 1F62A 5I1QA 4NYXA 4C9ZA 2YUCA 2DKWA 5FE4A 2VPBA 5L97A 5D3LA 2R0SA 3FKMX 4PY6A 3HCSA 4S3OB 3NXBA 5E9VA 2CKLB 4FO9A 2KWNA 2YURA 3LJWA 5IGLA 2MIQA 4TZ8A 4C66A 3IHPA 2KIZA 2VNFA 2YYNA 4XY8A 2F6NA 1FBVA 5EYAF 4MEOA 1VFYA 4WA6A 5D3JA 4YYHA 3AADA 4A9FA 2ECVA 2I50A 2VP7A 3MXFA 5DKAA 4CURA 3UVDA 1WEMA 4YYIA 4B7YC 1E6IA 4LZRA 3ZVYA 5BT4A 4WIVA 4R2YA 5EPBA 2L84A 5CUCA 4YH3A 4FLPA 5LKTA 5E9MA 4WZ0A 2YHOA 2KU3A 4A9IA 2YQMA 5ENFA 4PCIA 3ZYQA 5CUDA 5B78A 4R8PK 5C8GA 4L7XA 1X0JA 3N9NA 4FK5A 4A4CA 1DVPA 4WHWA 1Z60A 2MD7B 4CCGX 5L98A 4YBSA 5LKZA 3ZPV1 5ENCA 3L1XA 3IU5A 3HMEA 4J3IA 4BJXA 2Y1NA 5CFWA 2ECIA 5I86A 4FJCA 5C7NA 5KH9A 2K1JA 2YYRA 5KH7A 5AIUA 5L96A 5FH7A 2F42A 2MUMA 3FL2A 5DBMA 3HTKC 4RVRA 3UW9A 3UVWA 1ZBDB 1EQFA 4QBMA 2VJFB 5EWVA 1G25A 2I8NA 4NUCA 5D3HA 5BT5A 4QSSA 1X4UA 4Z1SA 4UIUA 2QICA 4S3OC 1LDJB 4GNDA 4IC2A 2L43A 4YATA 4NR7A 2YREA 3EB5A 4LZSA 4UIXA 2G45A 4L58A 5FE3A 4XYAA 2CSZA 2YSMA 5FG4A 4UIVA 4B86C 5CQ3A 5CGPA 4GPJA 5DYUA 5HQ6A 5FERA 4NXJA 2D82A 5C11A 4DONA 4QF3A 2JMJA 1WGMA 3K2JA 5ENHA 1MM2A 2D9EA 2MNZA 2DVRA 4UI9B 5K29A 3P1EA 2FSAA 5DFCA 4ZC9A 4NRAA 5EV9A 4O76A 3U5NA 4ZDTA 4QR5A 1JM7B 4BW4A 5KTWA 2M6MA 4LJNA 4IR6A 5FE8A 5ENGA 3N9PA 5FB1A 3O33A 2Y1MA 3HCUA 2L75A 5IIDA 4J0RA 2H60A 3HMHA 3P1DA 5G0FA 4QR4A 2MT5A 4NUDA 5H1TA 4O77A 4N4HA 2L80A 3Q2EA 4I7BA 3MUKA 3KNVA 3SOUA 4NRCA 3AQAA 2YEMA 5E3GA 5E3DA 5LKUA 2HYED 2KFTA 4O7AA 2E7OA 2E6SA 4QC3A 4CFKA 4HBYA 3L11A 4UIYA 5A7CA 5D26A 5J3XA 5FEYA 4UYHA 5CP5A 4YADA 5JI8A 4QY4A 3V43A 5IGMA 5IG6A 5I29A 2ECJA 4YY6A 4O7BA 4MR6A 2JMDA 4GNFA 2YW8A 5F60A 5TABA 4AYCA 5F62A 2CSYA 5EGUA 4UP0A 2RO1A 4HXSA 4TQNA 4LYIA 5HEMA 5AMFA 5ENBA 5CU8A 4HXMA 3ZPVE 4QSQA 1V87A 2ECNA 5DW2A 5FDZA 4YK0A 4CUQA 4QYLA 3UV4A 5HRXA 5I83A 2JMIA 3SHBA 5B75A 5I3LA 4QEVA 5A5QA 2RNWA 5II2A 1LDKC 4HXPA 5E7DA 4UITA 3P5OA 5AD2A 4YBTA 4QYDA 5DY7A 4WHUA 5D3NA 3MHHA 5D1KB 5D3PA 2E3KA 5C89A 2KR4A 1E4UA 5A81A 2NXBA 3ONIA 5CRMA 5LVRA 2EODA 2QJ0A 3U5LA 2C2VS 3KV5A 2DVVA 5E74A 5L8UA 5EVAA 5BT3A 4O75A 4PPEA 4A9EA 2I7KA 3S91A 2DATA 5B8DA 4HXOA 1WESA 5KHMA 5F25A 4O7FA 2YQDA 5F2PA 2LSPB 1VYXA 1WEEA 5A82A 4NYWA 2L5UA 5HRWA 3DQVR 4Z93A 3M63A 3RTRB 5FFVA 3HCTA 2YT5A 4ALGA 2LGKA 3N9MA 4BHWA 2VPEA 5E9KA 5I40A 2XB1A 2PUYA 5CY9A 5L99A 5F61A 5FH6A 3TLPA 2R10A 2KREA 2VJEB 5ETBA 3N9OA 4HBVA 5G04B 3U5OA 3SOXA 1WEOA 5CS8A 2YDWA 3JVJA 4TTEA 5ACYA 4Q0NA 2ECTA 5C13A 2K4DA 3LQHA 4MR5A 4A9NA 4A9OA 5HLSA 2N9GA 1XWHA 5FFWA 3GV4A 3S92A 5DLZA 5ETDA 2EGPA 5E9IA 2BAYA 5DFDA 5JWMA 5G4RA 5H1VA 3JVMA 2CT2A 5DKCA 5E0RA 1WUGA 4TT2A
chains in the Genus database with same CATH superfamily
4E96A 4WZ2A 4NQMA 4IR4A 5EQ1A 5A5SA 5EM3A 3KV6A 3T7LA 2FUIA 1U6GB 2MJVB 2KE1A 4P5OB 3G0LA 5DKDA 2AN6A 3EB6A 4NR6A 2WP1A 5E9YA 3PUQA 1MM3A 4NN2A 4QF2A 5C85A 5EP7A 1X4JA 3MULA 3DWYA 4IOQA 2KGGA 5TDWA 4LR6A 4KCXA 4F1PA 5HFQA 2EJNA 5B76A 5CQ4A 2L85A 4QUUA 5TRBA 5C4QA 2WP2A 2GRCA 4PCEA 5TCMA 4YYNA 5KO4A 1CHCA 5EWCA 4UIZA 3FEHA 5FE2A 3ZTGA 2QIZA 4A9HA 3IU6A 4UYFA 5FBXA 5E73A 4I7DA 4IC3A 3VK6A 4HBXA 5G4SA 4QC1A 4IR5A 5HQ5A 3E2DA 5CPEA 3GL6A 5TBNA 2CKLA 4O74A 1WILA 5H1UA 5ENIA 4OGEA 2K16A 2LN0A 5CUAA 2MA6A 3SVGA 4AYCB 2EA6A 4YAXA 4LC2A 2KTBB 3C5KA 5F5ZA 5HM0A 4XY9A 4X2IA 4GB0A 4AUQB 2M1RA 5HJCA 4MSXA 4LADB 4Y03A 5FE1A 4QZSA 5DW1A 5HRVA 5LUUA 4QNSA 3SVHA 2H0DA 2OWAA 4X3GA 3LQJA 5CQAA 2E6RA 4OGCA 4XI1A 2KWKA 3M62A 5EWWA 4A9MA 2L0BA 5F36A 4LLBA 4AKNA 4NS5A 4AP4A 4QSRA 3MB3A 4TU6A 5I89A 5AD3A 3U5MA 2JM3A 4UP5A 2YVRA 4YBMA 4MR4A 4CUSA 2LGGA 2RI7A 4R7EA 4ZUXU 4AVXA 4TT6A 5EICA 1IYMA 5D0CA 2D8SA 2Y43A 2E7NA 5I80A 5EWDA 4Q6FA 1ZKRA 2F6JA 3UVXA 5CTLA 3FM8C 3U5KA 2DJAA 4PS5A 4V3LC 2OO1A 2LDRA 4FIPA 3U5JA 5A5PA 4LZ2A 2OUOA 2RS9B 4IOOA 2XP0A 3MHSA 2M13A 2VJFA 4NR9A 4ZW1A 1RMDA 3UVYA 4I7CA 3O36A 3M99A 4NR4A 4F3IA 3QZSA 3LXJA 2RSDA 5A5RA 4HXNA 1BORA 4CUUA 4UIWA 1WEQA 4UYGA 5SVYA 4A9LA 2UZGA 4OGIA 2D8UA 4TU4A 1F68A 3D7CA 2FD4A 3LVQE 5I88A 1JOCA 2IQJA 5CZGA 2DWWA 5G05B 5DYXA 1WEPA 4KV1A 2R0YA 5EU1A 2MD8C 3LDYA 3P1CA 4J1PA 4Q0OA 3SUBA 4MENA 1N87A 5DKHA 2XOYA 4A4BA 3O35A 5E9LA 4A0CD 2YEKA 3JVLA 2YW5A 4XUAA 2JRJA 3UV5A 3RCWA 2CRRA 2ZETC 2LGLA 5FG5A 3MB4A 5J0DA 4O64A 5LCWB 3Q2FA 3ZVZB 3O47A 5A83A 4CUPA 4TS8A 5F63A 5FH8A 5B79A 3DAIA 3PURA 4O71A 2LV9A 5SVIA 2NAAA 3LVRE 4N4IA 1K2FA 1VD4A 4QB3A 4UYFB 4YYGA 5D1MB 3RPGB 2FUUA 2LGVA 3O70A 4Z0RA 4KV4A 5HCLA 4GNGA 1WUMA 2G4AA 3QZVA 5L8TA 3VKHA 1T1HA 2CONA 5C87A 2RNXA 1WEUA 3FANA 4PTBA 4LDFA 4LK9A 3LQIA 3HMFA 4A9KA 4YYKA 2CSVA 4TT4A 5DFBA 5F1HA 5IGKA 4QSPA 5CUBA 4YC9A 5D7XA 5KU3A 5IBNA 2YHNA 3N9QA 4LKAA 4Z6HA 5LJ1A 4UYEA 2LXPC 2XEUA 4BW3A 4QQ4A 2RFJA 5D24A 5DINA 4QEUA 4CFLA 2H0DB 5DYAA 2L7PA 5FG6A 3KQIA 4J0SA 4HXRA 3FJUB 5COIA 2G43A 1WE9A 2MA5A 4N4FA 2OSSA 1WEVA 5SVXA 4NR5A 1FP0A 3PHDA 5D3SA 4NQNA 3VKGA 2YU4A 5EK9A 4WZ3B 4TZ2A 3C6WA 4ALHA 3U5PA 4MVTA 5CRZA 4H9DA 5IGNA 5D3RA 1X4IA 1DCQA 4AKHA 2DX8A 2YELA 2M85A 4V3KC 5F1LA 3O34A 5FE9A 1WIMA 4QEWA 5AMEA 3MDBC 4A9JA 4N4GA 3O7AA 2G6QA 5CQ5A 4XUBA 2OXQC 3LRQA 2B0OE 4LYWA 2LAUA 5FE7A 2YQLA 5FFYA 3I2DA 3PLWA 4YABA 2VPDA 4MR3A 4W4UA 2KKXA 5JG6A 3GG3A 4OUFA 3RPGC 2IDAA 5CQTA 4NR8A 5KTUA 4LYSA 5EWHA 1JSPB 5AITA 3ZYUA 4HXLA 2L5EA 2VJEA 5KH3A 4C67A 1MBMA 2KGIA 5TDRA 4QSWA 5D1LB 4QUTA 5CUGA 4NUEA 5ENJA 1ZS5A 5B77A 2LXHC 5ENEA 1N72A 4OGJA 5LJ2A 4UYDA 2K17A 5H85A 2RNYA 5DX4A 5FE5A 3DPLR 5I7YA 4NRBA 5HELA 5EISA 5EPSA 5DYCA 4TYLA 4YYJA 3M7KA 5A85A 4PKLA 3I3JA 4YY4A 2C2LA 5CQ8A 3UV2A 1WFKA 3L1ZB 4CA1A 3QZTA 2DVSA 3ASLA 5DLXA 5I7XA 4HBWA 5HQ7A 5F3AA 2YSJA 4O72A 1HYIA 4CL9A 5EPRA 4Z6IA 5EA1A 5CUEA 5CQ7A 5EI4A 2HDPA 3DDTA 3JVKA 4QSXA 5D25A 4IORA 4ZQLA 1WEWA 2R0VA 4BW1A 5FE0A 5LVQA 3SOWA 4CLBA 4YYDA 4BW2A 5A5OA 2VPGA 3G0JA 1Z6UA 5A5NA 2PNXA 2EGMA 4MEPA 4O78A 4YH4A 2DVQA 5FE6A 5TB6A 4YYMA 4BBQA 5HFRA 1HYJA 2KWOA 3ZNIA 4QSUA 5LKXA 2LQ6A 2KYUA 4IR3A 2KWJA 4QSVA 5KTXA 3NG2A 4O62A 4Z1QA 3SVFA 5K3QA 4LRGA 1JM7A 4TKPB 1JM4B 4GNEA 5CQ6A 4O7EA 2M3HA 3P1FA 4N3WA 5II1A 2MNYA 4O70A 1Z2QA 5D3TA 5LJ0A 4QSTA 2ECGA 4F52B 4NYVA 3MQMA 4CUTA 4MEQA 4O7CA 4A49A 5FB0A 3O37A 5H9MA 4QR3A 2LRIC 4HXKA 2ECWA 3T6RA 3N9LA 5HENA 1WENA 1F62A 5I1QA 4NYXA 4C9ZA 2YUCA 2DKWA 5FE4A 2VPBA 5L97A 5D3LA 2R0SA 3FKMX 4PY6A 3HCSA 4S3OB 3NXBA 5E9VA 2CKLB 4FO9A 2KWNA 2YURA 3D1DA 3LJWA 5IGLA 2MIQA 4TZ8A 4C66A 3IHPA 2KIZA 2VNFA 2YYNA 4XY8A 2F6NA 1FBVA 2MKEA 5EYAF 4MEOA 1VFYA 1PUOA 4WA6A 5D3JA 4YYHA 3AADA 4A9FA 2ECVA 2I50A 3T9KA 2VP7A 3MXFA 5DKAA 4CURA 3UVDA 1WEMA 4YYIA 2XOZA 1E6IA 4LZRA 3ZVYA 5BT4A 4WIVA 4B7YC 4R2YA 5EPBA 2L84A 5CUCA 4YH3A 4FLPA 5LKTA 5E9MA 4WZ0A 2YHOA 2KKYA 2KU3A 4A9IA 2YQMA 5ENFA 4PCIA 3ZYQA 5CUDA 5B78A 4R8PK 4Z0OA 5C8GA 4L7XA 1X0JA 3N9NA 4FK5A 4A4CA 1DVPA 4WHWA 1Z60A 2MD7B 4CCGX 5L98A 4YBSA 5LKZA 3ZPV1 5ENCA 3L1XA 3IU5A 3HMEA 4J3IA 4BJXA 2Y1NA 5CFWA 2ECIA 5I86A 4FJCA 5C7NA 5KH9A 2K1JA 2YYRA 5KH7A 5AIUA 5L96A 5FH7A 2F42A 2MUMA 3FL2A 5DBMA 3HTKC 4RVRA 3UW9A 3UVWA 1ZBDB 1EQFA 4QBMA 2VJFB 5EWVA 1G25A 2I8NA 4NUCA 5D3HA 5BT5A 4QSSA 1X4UA 4Z1SA 3ERRA 4UIUA 2QICA 4S3OC 1LDJB 4GNDA 4IC2A 2L43A 4YATA 4NR7A 2YREA 3EB5A 4LZSA 4UIXA 2G45A 4L58A 5FE3A 4XYAA 2CSZA 2YSMA 5FG4A 4UIVA 4B86C 5CQ3A 5CGPA 4GPJA 5DYUA 5HQ6A 5FERA 4NXJA 2D82A 5C11A 4DONA 4QF3A 2JMJA 1WGMA 3K2JA 5ENHA 1MM2A 2D9EA 2MNZA 2DVRA 4UI9B 5K29A 3P1EA 2FSAA 5DFCA 4ZC9A 4NRAA 5EV9A 4O76A 3U5NA 4ZDTA 4QR5A 1JM7B 4BW4A 5KTWA 2M6MA 4LJNA 4IR6A 5FE8A 5ENGA 3N9PA 5FB1A 2EXUA 3O33A 2Y1MA 3HCUA 4AKIA 2L75A 5IIDA 4J0RA 2H60A 3HMHA 3P1DA 5G0FA 4QR4A 2MT5A 4NUDA 5H1TA 4O77A 4N4HA 2L80A 3Q2EA 4I7BA 3MUKA 3KNVA 3SOUA 4NRCA 3AQAA 2YEMA 5E3GA 5E3DA 5LKUA 2HYED 2KFTA 4O7AA 2E7OA 2E6SA 4QC3A 4CFKA 3KDEC 4HBYA 3L11A 4UIYA 5SVIB 5A7CA 5D26A 3LJUX 5J3XA 5FEYA 4UYHA 5CP5A 4YADA 5JI8A 4QY4A 3V43A 5IGMA 5IG6A 4AKGA 5I29A 2ECJA 2P57A 2FFWA 4YY6A 4O7BA 2JUNA 4MR6A 3D1BA 2JMDA 4GNFA 2YW8A 5F60A 5TABA 4AYCA 5F62A 2CSYA 5EGUA 4UP0A 2RO1A 4HXSA 4TQNA 4LYIA 5HEMA 5AMFA 5ENBA 5CU8A 4HXMA 3ZPVE 4QSQA 1V87A 2ECNA 5DW2A 5FDZA 4YK0A 4CUQA 4QYLA 3UV4A 5HRXA 5I83A 2JMIA 3SHBA 5B75A 5I3LA 4QEVA 5A5QA 2RNWA 5II2A 1LDKC 4HXPA 5E7DA 4UITA 3P5OA 5AD2A 4YBTA 4QYDA 5DY7A 4WHUA 5D3NA 3MHHA 5D1KB 5D3PA 2E3KA 5C89A 2KR4A 1E4UA 5A81A 2NXBA 3ONIA 5CRMA 5LVRA 2EODA 2QJ0A 3U5LA 2C2VS 3H7HA 3KV5A 2DVVA 5E74A 5L8UA 2CRWA 5EVAA 5BT3A 4O75A 4PPEA 4A9EA 2I7KA 3S91A 2DATA 5B8DA 4HXOA 1WESA 5KHMA 5F25A 4O7FA 2YQDA 5F2PA 2LSPB 1VYXA 1WEEA 5A82A 4NYWA 2L5UA 5HRWA 3DQVR 3Q1DA 4Z93A 3M63A 3RTRB 5FFVA 3HCTA 2YT5A 4ALGA 2LGKA 3N9MA 4BHWA 2RR4A 2VPEA 2XOCA 5E9KA 5I40A 2XB1A 2PUYA 5CY9A 5L99A 5F61A 3DWDA 5FH6A 3TLPA 2R10A 2KREA 2VJEB 5ETBA 3N9OA 4HBVA 5G04B 3U5OA 3SOXA 1WEOA 5CS8A 2YDWA 3JVJA 4TTEA 5ACYA 4Q0NA 2ECTA 3FAOA 5C13A 2K4DA 3LQHA 4MR5A 4A9NA 4A9OA 5HLSA 2N9GA 4AI6A 1XWHA 5FFWA 3GV4A 3S92A 5DLZA 3JUEA 5ETDA 2EGPA 5E9IA 2BAYA 5DFDA 2DSMA 5JWMA 5G4RA 5H1VA 3JVMA 2CT2A 2E61A 5DKCA 5E0RA 1WUGA 4TT2A
chains in the Genus database with same CATH topology
4E96A 4WZ2A 4NQMA 4IR4A 5EQ1A 5A5SA 5EM3A 3KV6A 3T7LA 2FUIA 1U6GB 2MJVB 2KE1A 4P5OB 3G0LA 5DKDA 2AN6A 3EB6A 4NR6A 2WP1A 5E9YA 3PUQA 1MM3A 4NN2A 4QF2A 5C85A 5EP7A 1X4JA 3MULA 3DWYA 4IOQA 2KGGA 5TDWA 4LR6A 4KCXA 5HFQA 5B76A 5CQ4A 2L85A 4QUUA 5TRBA 5C4QA 2WP2A 2GRCA 4PCEA 5TCMA 4YYNA 5KO4A 1CHCA 5EWCA 4UIZA 5FE2A 3ZTGA 2QIZA 4A9HA 3IU6A 4UYFA 5FBXA 5E73A 4I7DA 4IC3A 3VK6A 4HBXA 5G4SA 4QC1A 4IR5A 5HQ5A 3GL6A 5CPEA 5TBNA 2CKLA 4O74A 1WILA 5H1UA 5ENIA 2K16A 2LN0A 5CUAA 2MA6A 3SVGA 4AYCB 2EA6A 4YAXA 4LC2A 2KTBB 3C5KA 5F5ZA 5HM0A 4XY9A 4X2IA 4GB0A 4AUQB 2M1RA 5HJCA 4MSXA 4LADB 4Y03A 5FE1A 4QZSA 5DW1A 5HRVA 5LUUA 4QNSA 3SVHA 2H0DA 4X3GA 3LQJA 5CQAA 2E6RA 4XI1A 2KWKA 3M62A 5EWWA 4A9MA 2L0BA 5F36A 4LLBA 4AKNA 4NS5A 4AP4A 4QSRA 3MB3A 4TU6A 5I89A 5AD3A 3U5MA 4UP5A 4YBMA 4MR4A 4CUSA 2LGGA 2RI7A 4R7EA 4ZUXU 4AVXA 4TT6A 5EICA 1IYMA 5D0CA 2D8SA 2Y43A 2E7NA 5I80A 5EWDA 4Q6FA 2F6JA 3UVXA 5CTLA 3U5KA 4PS5A 4V3LC 2OO1A 2LDRA 4FIPA 3U5JA 5A5PA 4LZ2A 2OUOA 2RS9B 4IOOA 3MHSA 2VJFA 4NR9A 4ZW1A 1RMDA 3UVYA 4I7CA 3O36A 3M99A 4NR4A 4F3IA 3QZSA 3LXJA 2RSDA 5A5RA 4HXNA 1BORA 4CUUA 4UIWA 1WEQA 4UYGA 4A9LA 2UZGA 4OGIA 4TU4A 1F68A 3D7CA 5I88A 1JOCA 5CZGA 2DWWA 5G05B 5DYXA 1WEPA 4KV1A 2R0YA 5EU1A 2MD8C 3P1CA 4J1PA 4Q0OA 4MENA 1N87A 5DKHA 4A4BA 3O35A 5E9LA 4A0CD 2YEKA 3JVLA 2YW5A 4XUAA 2JRJA 3UV5A 3RCWA 2ZETC 2LGLA 5FG5A 3MB4A 5J0DA 4O64A 5LCWB 3Q2FA 3ZVZB 5A83A 4CUPA 4TS8A 5F63A 5FH8A 5B79A 3DAIA 3PURA 4O71A 2LV9A 2NAAA 4N4IA 1K2FA 1VD4A 4QB3A 4UYFB 4YYGA 5D1MB 3RPGB 2FUUA 2LGVA 3O70A 4KV4A 5HCLA 4GNGA 1WUMA 2G4AA 3QZVA 5L8TA 1T1HA 5C87A 2RNXA 1WEUA 4PTBA 4LDFA 4LK9A 3LQIA 3HMFA 4A9KA 4YYKA 4TT4A 5DFBA 5F1HA 5IGKA 4QSPA 5CUBA 4YC9A 5D7XA 5KU3A 5IBNA 2YHNA 3N9QA 4LKAA 4Z6HA 5LJ1A 4UYEA 2LXPC 2XEUA 4BW3A 5DINA 2RFJA 5D24A 4QEUA 4CFLA 2H0DB 5DYAA 3KQIA 5FG6A 4J0SA 4HXRA 5COIA 2G43A 1WE9A 2MA5A 4N4FA 2OSSA 1WEVA 4NR5A 1FP0A 3PHDA 5D3SA 4NQNA 2YU4A 5EK9A 4WZ3B 4TZ2A 3C6WA 4ALHA 3U5PA 4MVTA 5CRZA 5IGNA 5D3RA 1X4IA 2DX8A 2YELA 2M85A 4V3KC 5F1LA 3O34A 5FE9A 1WIMA 4QEWA 5AMEA 4A9JA 4N4GA 3O7AA 2G6QA 5CQ5A 4XUBA 2OXQC 3LRQA 2YQLA 4LYWA 5FE7A 5FFYA 3I2DA 4YABA 2VPDA 4MR3A 4W4UA 5JG6A 3GG3A 4OUFA 3RPGC 2IDAA 5CQTA 4NR8A 5KTUA 4LYSA 5EWHA 1JSPB 5AITA 3ZYUA 4HXLA 2L5EA 2VJEA 5KH3A 4C67A 5TDRA 2KGIA 4QSWA 5D1LB 4QUTA 5CUGA 4NUEA 5ENJA 1ZS5A 5B77A 2LXHC 5ENEA 1N72A 4OGJA 5LJ2A 4UYDA 2K17A 5H85A 2RNYA 5DX4A 5FE5A 3DPLR 5I7YA 4NRBA 5HELA 5EISA 5EPSA 5DYCA 4TYLA 4YYJA 5A85A 4PKLA 3I3JA 4YY4A 2C2LA 5CQ8A 3UV2A 1WFKA 3L1ZB 4CA1A 3QZTA 2DVSA 3ASLA 5DLXA 5I7XA 4HBWA 5HQ7A 5F3AA 2YSJA 4O72A 1HYIA 4CL9A 5EPRA 4Z6IA 5EA1A 5CUEA 5CQ7A 5EI4A 2HDPA 3JVKA 4QSXA 5D25A 4IORA 4ZQLA 1WEWA 2R0VA 4BW1A 5FE0A 5LVQA 3SOWA 4CLBA 4YYDA 4BW2A 5A5OA 2VPGA 3G0JA 1Z6UA 5A5NA 2PNXA 4MEPA 4O78A 4YH4A 2DVQA 5FE6A 5TB6A 4YYMA 4BBQA 5HFRA 1HYJA 2KWOA 3ZNIA 4QSUA 5LKXA 2LQ6A 2KYUA 4IR3A 2KWJA 4QSVA 5KTXA 3NG2A 4Z1QA 3SVFA 4LRGA 1JM7A 4TKPB 1JM4B 4GNEA 5CQ6A 4O7EA 2M3HA 3P1FA 4N3WA 5II1A 2MNYA 4O70A 1Z2QA 5D3TA 5LJ0A 4QSTA 2ECGA 4F52B 4NYVA 3MQMA 4CUTA 4MEQA 4O7CA 4A49A 5FB0A 3O37A 5H9MA 4QR3A 2LRIC 4HXKA 2ECWA 3T6RA 3N9LA 5HENA 1WENA 1F62A 5I1QA 4NYXA 4C9ZA 2YUCA 2DKWA 5FE4A 2VPBA 5L97A 5D3LA 2R0SA 3FKMX 4PY6A 3HCSA 4S3OB 3NXBA 5E9VA 2CKLB 4FO9A 2KWNA 2YURA 3LJWA 5IGLA 2MIQA 4TZ8A 4C66A 3IHPA 2KIZA 2VNFA 2YYNA 4XY8A 2F6NA 1FBVA 5EYAF 4MEOA 1VFYA 4WA6A 5D3JA 4YYHA 3AADA 4A9FA 2ECVA 2I50A 2VP7A 3MXFA 5DKAA 4CURA 3UVDA 1WEMA 4YYIA 4B7YC 1E6IA 4LZRA 3ZVYA 5BT4A 4WIVA 4R2YA 5EPBA 2L84A 5CUCA 4YH3A 4FLPA 5LKTA 5E9MA 4WZ0A 2YHOA 2KU3A 4A9IA 2YQMA 5ENFA 4PCIA 3ZYQA 5CUDA 5B78A 4R8PK 5C8GA 4L7XA 1X0JA 3N9NA 4FK5A 4A4CA 1DVPA 4WHWA 1Z60A 2MD7B 4CCGX 5L98A 4YBSA 5LKZA 3ZPV1 5ENCA 3L1XA 3IU5A 3HMEA 4J3IA 4BJXA 2Y1NA 5CFWA 2ECIA 5I86A 4FJCA 5C7NA 5KH9A 2K1JA 2YYRA 5KH7A 5AIUA 5L96A 5FH7A 2F42A 2MUMA 3FL2A 5DBMA 3HTKC 4RVRA 3UW9A 3UVWA 1ZBDB 1EQFA 4QBMA 2VJFB 5EWVA 1G25A 2I8NA 4NUCA 5D3HA 5BT5A 4QSSA 1X4UA 4Z1SA 4UIUA 2QICA 4S3OC 1LDJB 4GNDA 4IC2A 2L43A 4YATA 4NR7A 2YREA 3EB5A 4LZSA 4UIXA 2G45A 4L58A 5FE3A 4XYAA 2CSZA 2YSMA 5FG4A 4UIVA 4B86C 5CQ3A 5CGPA 4GPJA 5DYUA 5HQ6A 5FERA 4NXJA 2D82A 5C11A 4DONA 4QF3A 2JMJA 1WGMA 3K2JA 5ENHA 1MM2A 2D9EA 2MNZA 2DVRA 4UI9B 5K29A 3P1EA 2FSAA 5DFCA 4ZC9A 4NRAA 5EV9A 4O76A 3U5NA 4ZDTA 4QR5A 1JM7B 4BW4A 5KTWA 2M6MA 4LJNA 4IR6A 5FE8A 5ENGA 3N9PA 5FB1A 3O33A 2Y1MA 3HCUA 2L75A 5IIDA 4J0RA 2H60A 3HMHA 3P1DA 5G0FA 4QR4A 2MT5A 4NUDA 5H1TA 4O77A 4N4HA 2L80A 3Q2EA 4I7BA 3MUKA 3KNVA 3SOUA 4NRCA 3AQAA 2YEMA 5E3GA 5E3DA 5LKUA 2HYED 2KFTA 4O7AA 2E7OA 2E6SA 4QC3A 4CFKA 4HBYA 3L11A 4UIYA 5A7CA 5D26A 5J3XA 5FEYA 4UYHA 5CP5A 4YADA 5JI8A 4QY4A 3V43A 5IGMA 5IG6A 5I29A 2ECJA 4YY6A 4O7BA 4MR6A 2JMDA 4GNFA 2YW8A 5F60A 5TABA 4AYCA 5F62A 2CSYA 5EGUA 4UP0A 2RO1A 4HXSA 4TQNA 4LYIA 5HEMA 5AMFA 5ENBA 5CU8A 4HXMA 3ZPVE 4QSQA 1V87A 2ECNA 5DW2A 5FDZA 4YK0A 4CUQA 4QYLA 3UV4A 5HRXA 5I83A 2JMIA 3SHBA 5B75A 5I3LA 4QEVA 5A5QA 2RNWA 5II2A 1LDKC 4HXPA 5E7DA 4UITA 3P5OA 5AD2A 4YBTA 4QYDA 5DY7A 4WHUA 5D3NA 3MHHA 5D1KB 5D3PA 2E3KA 5C89A 2KR4A 1E4UA 5A81A 2NXBA 3ONIA 5CRMA 5LVRA 2EODA 2QJ0A 3U5LA 2C2VS 3KV5A 2DVVA 5E74A 5L8UA 5EVAA 5BT3A 4O75A 4PPEA 4A9EA 2I7KA 3S91A 2DATA 5B8DA 4HXOA 1WESA 5KHMA 5F25A 4O7FA 2YQDA 5F2PA 2LSPB 1VYXA 1WEEA 5A82A 4NYWA 2L5UA 5HRWA 3DQVR 4Z93A 3M63A 3RTRB 5FFVA 3HCTA 2YT5A 4ALGA 2LGKA 3N9MA 4BHWA 2VPEA 5E9KA 5I40A 2XB1A 2PUYA 5CY9A 5L99A 5F61A 5FH6A 3TLPA 2R10A 2KREA 2VJEB 5ETBA 3N9OA 4HBVA 5G04B 3U5OA 3SOXA 1WEOA 5CS8A 2YDWA 3JVJA 4TTEA 5ACYA 4Q0NA 2ECTA 5C13A 2K4DA 3LQHA 4MR5A 4A9NA 4A9OA 5HLSA 2N9GA 1XWHA 5FFWA 3GV4A 3S92A 5DLZA 5ETDA 2EGPA 5E9IA 2BAYA 5DFDA 5JWMA 5G4RA 5H1VA 3JVMA 2CT2A 5DKCA 5E0RA 1WUGA 4TT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E96 A;  4WZ2 A;  4NQM A;  4IR4 A;  5EQ1 A;  5A5S A;  5EM3 A;  3KV6 A;  3T7L A;  2FUI A;  1U6G B;  2MJV B;  2KE1 A;  4P5O B;  3G0L A;  5DKD A;  2AN6 A;  3EB6 A;  4NR6 A;  2WP1 A;  5E9Y A;  3PUQ A;  1MM3 A;  4NN2 A;  4QF2 A;  5C85 A;  5EP7 A;  1X4J A;  3MUL A;  3DWY A;  4IOQ A;  2KGG A;  5TDW A;  4LR6 A;  4KCX A;  5HFQ A;  5B76 A;  5CQ4 A;  2L85 A;  4QUU A;  5TRB A;  5C4Q A;  2WP2 A;  2GRC A;  4PCE A;  5TCM A;  4YYN A;  5KO4 A;  1CHC A;  5EWC A;  4UIZ A;  5FE2 A;  3ZTG A;  2QIZ A;  4A9H A;  3IU6 A;  4UYF A;  5FBX A;  5E73 A;  4I7D A;  4IC3 A;  3VK6 A;  4HBX A;  5G4S A;  4QC1 A;  4IR5 A;  5HQ5 A;  3GL6 A;  5CPE A;  5TBN A;  2CKL A;  4O74 A;  1WIL A;  5H1U A;  5ENI A;  2K16 A;  2LN0 A;  5CUA A;  2MA6 A;  3SVG A;  4AYC B;  2EA6 A;  4YAX A;  4LC2 A;  2KTB B;  3C5K A;  5F5Z A;  5HM0 A;  4XY9 A;  4X2I A;  4GB0 A;  4AUQ B;  2M1R A;  5HJC A;  4MSX A;  4LAD B;  4Y03 A;  5FE1 A;  4QZS A;  5DW1 A;  5HRV A;  5LUU A;  4QNS A;  3SVH A;  2H0D A;  4X3G A;  3LQJ A;  5CQA A;  2E6R A;  4XI1 A;  2KWK A;  3M62 A;  5EWW A;  4A9M A;  2L0B A;  5F36 A;  4LLB A;  4AKN A;  4NS5 A;  4AP4 A;  4QSR A;  3MB3 A;  4TU6 A;  5I89 A;  5AD3 A;  3U5M A;  4UP5 A;  4YBM A;  4MR4 A;  4CUS A;  2LGG A;  2RI7 A;  4R7E A;  4ZUX U;  4AVX A;  4TT6 A;  5EIC A;  1IYM A;  5D0C A;  2D8S A;  2Y43 A;  2E7N A;  5I80 A;  5EWD A;  4Q6F A;  2F6J A;  3UVX A;  5CTL A;  3U5K A;  4PS5 A;  4V3L C;  2OO1 A;  2LDR A;  4FIP A;  3U5J A;  5A5P A;  4LZ2 A;  2OUO A;  2RS9 B;  4IOO A;  3MHS A;  2VJF A;  4NR9 A;  4ZW1 A;  1RMD A;  3UVY A;  4I7C A;  3O36 A;  3M99 A;  4NR4 A;  4F3I A;  3QZS A;  3LXJ A;  2RSD A;  5A5R A;  4HXN A;  1BOR A;  4CUU A;  4UIW A;  1WEQ A;  4UYG A;  4A9L A;  2UZG A;  4OGI A;  4TU4 A;  1F68 A;  3D7C A;  5I88 A;  1JOC A;  5CZG A;  2DWW A;  5G05 B;  5DYX A;  1WEP A;  4KV1 A;  2R0Y A;  5EU1 A;  2MD8 C;  3P1C A;  4J1P A;  4Q0O A;  4MEN A;  1N87 A;  5DKH A;  4A4B A;  3O35 A;  5E9L A;  4A0C D;  2YEK A;  3JVL A;  2YW5 A;  4XUA A;  2JRJ A;  3UV5 A;  3RCW A;  2ZET C;  2LGL A;  5FG5 A;  3MB4 A;  5J0D A;  4O64 A;  5LCW B;  3Q2F A;  3ZVZ B;  5A83 A;  4CUP A;  4TS8 A;  5F63 A;  5FH8 A;  5B79 A;  3DAI A;  3PUR A;  4O71 A;  2LV9 A;  2NAA A;  4N4I A;  1K2F A;  1VD4 A;  4QB3 A;  4UYF B;  4YYG A;  5D1M B;  3RPG B;  2FUU A;  2LGV A;  3O70 A;  4KV4 A;  5HCL A;  4GNG A;  1WUM A;  2G4A A;  3QZV A;  5L8T A;  1T1H A;  5C87 A;  2RNX A;  1WEU A;  4PTB A;  4LDF A;  4LK9 A;  3LQI A;  3HMF A;  4A9K A;  4YYK A;  4TT4 A;  5DFB A;  5F1H A;  5IGK A;  4QSP A;  5CUB A;  4YC9 A;  5D7X A;  5KU3 A;  5IBN A;  2YHN A;  3N9Q A;  4LKA A;  4Z6H A;  5LJ1 A;  4UYE A;  2LXP C;  2XEU A;  4BW3 A;  5DIN A;  2RFJ A;  5D24 A;  4QEU A;  4CFL A;  2H0D B;  5DYA A;  3KQI A;  5FG6 A;  4J0S A;  4HXR A;  5COI A;  2G43 A;  1WE9 A;  2MA5 A;  4N4F A;  2OSS A;  1WEV A;  4NR5 A;  1FP0 A;  3PHD A;  5D3S A;  4NQN A;  2YU4 A;  5EK9 A;  4WZ3 B;  4TZ2 A;  3C6W A;  4ALH A;  3U5P A;  4MVT A;  5CRZ A;  5IGN A;  5D3R A;  1X4I A;  2DX8 A;  2YEL A;  2M85 A;  4V3K C;  5F1L A;  3O34 A;  5FE9 A;  1WIM A;  4QEW A;  5AME A;  4A9J A;  4N4G A;  3O7A A;  2G6Q A;  5CQ5 A;  4XUB A;  2OXQ C;  3LRQ A;  2YQL A;  4LYW A;  5FE7 A;  5FFY A;  3I2D A;  4YAB A;  2VPD A;  4MR3 A;  4W4U A;  5JG6 A;  3GG3 A;  4OUF A;  3RPG C;  2IDA A;  5CQT A;  4NR8 A;  5KTU A;  4LYS A;  5EWH A;  1JSP B;  5AIT A;  3ZYU A;  4HXL A;  2L5E A;  2VJE A;  5KH3 A;  4C67 A;  5TDR A;  2KGI A;  4QSW A;  5D1L B;  4QUT A;  5CUG A;  4NUE A;  5ENJ A;  1ZS5 A;  5B77 A;  2LXH C;  5ENE A;  1N72 A;  4OGJ A;  5LJ2 A;  4UYD A;  2K17 A;  5H85 A;  2RNY A;  5DX4 A;  5FE5 A;  3DPL R;  5I7Y A;  4NRB A;  5HEL A;  5EIS A;  5EPS A;  5DYC A;  4TYL A;  4YYJ A;  5A85 A;  4PKL A;  3I3J A;  4YY4 A;  2C2L A;  5CQ8 A;  3UV2 A;  1WFK A;  3L1Z B;  4CA1 A;  3QZT A;  2DVS A;  3ASL A;  5DLX A;  5I7X A;  4HBW A;  5HQ7 A;  5F3A A;  2YSJ A;  4O72 A;  1HYI A;  4CL9 A;  5EPR A;  4Z6I A;  5EA1 A;  5CUE A;  5CQ7 A;  5EI4 A;  2HDP A;  3JVK A;  4QSX A;  5D25 A;  4IOR A;  4ZQL A;  1WEW A;  2R0V A;  4BW1 A;  5FE0 A;  5LVQ A;  3SOW A;  4CLB A;  4YYD A;  4BW2 A;  5A5O A;  2VPG A;  3G0J A;  1Z6U A;  5A5N A;  2PNX A;  4MEP A;  4O78 A;  4YH4 A;  2DVQ A;  5FE6 A;  5TB6 A;  4YYM A;  4BBQ A;  5HFR A;  1HYJ A;  2KWO A;  3ZNI A;  4QSU A;  5LKX A;  2LQ6 A;  2KYU A;  4IR3 A;  2KWJ A;  4QSV A;  5KTX A;  3NG2 A;  4Z1Q A;  3SVF A;  4LRG A;  1JM7 A;  4TKP B;  1JM4 B;  4GNE A;  5CQ6 A;  4O7E A;  2M3H A;  3P1F A;  4N3W A;  5II1 A;  2MNY A;  4O70 A;  1Z2Q A;  5D3T A;  5LJ0 A;  4QST A;  2ECG A;  4F52 B;  4NYV A;  3MQM A;  4CUT A;  4MEQ A;  4O7C A;  4A49 A;  5FB0 A;  3O37 A;  5H9M A;  4QR3 A;  2LRI C;  4HXK A;  2ECW A;  3T6R A;  3N9L A;  5HEN A;  1WEN A;  1F62 A;  5I1Q A;  4NYX A;  4C9Z A;  2YUC A;  2DKW A;  5FE4 A;  2VPB A;  5L97 A;  5D3L A;  2R0S A;  3FKM X;  4PY6 A;  3HCS A;  4S3O B;  3NXB A;  5E9V A;  2CKL B;  4FO9 A;  2KWN A;  2YUR A;  3LJW A;  5IGL A;  2MIQ A;  4TZ8 A;  4C66 A;  3IHP A;  2KIZ A;  2VNF A;  2YYN A;  4XY8 A;  2F6N A;  1FBV A;  5EYA F;  4MEO A;  1VFY A;  4WA6 A;  5D3J A;  4YYH A;  3AAD A;  4A9F A;  2ECV A;  2I50 A;  2VP7 A;  3MXF A;  5DKA A;  4CUR A;  3UVD A;  1WEM A;  4YYI A;  4B7Y C;  1E6I A;  4LZR A;  3ZVY A;  5BT4 A;  4WIV A;  4R2Y A;  5EPB A;  2L84 A;  5CUC A;  4YH3 A;  4FLP A;  5LKT A;  5E9M A;  4WZ0 A;  2YHO A;  2KU3 A;  4A9I A;  2YQM A;  5ENF A;  4PCI A;  3ZYQ A;  5CUD A;  5B78 A;  4R8P K;  5C8G A;  4L7X A;  1X0J A;  3N9N A;  4FK5 A;  4A4C A;  1DVP A;  4WHW A;  1Z60 A;  2MD7 B;  4CCG X;  5L98 A;  4YBS A;  5LKZ A;  3ZPV 1;  5ENC A;  3L1X A;  3IU5 A;  3HME A;  4J3I A;  4BJX A;  2Y1N A;  5CFW A;  2ECI A;  5I86 A;  4FJC A;  5C7N A;  5KH9 A;  2K1J A;  2YYR A;  5KH7 A;  5AIU A;  5L96 A;  5FH7 A;  2F42 A;  2MUM A;  3FL2 A;  5DBM A;  3HTK C;  4RVR A;  3UW9 A;  3UVW A;  1ZBD B;  1EQF A;  4QBM A;  2VJF B;  5EWV A;  1G25 A;  2I8N A;  4NUC A;  5D3H A;  5BT5 A;  4QSS A;  1X4U A;  4Z1S A;  4UIU A;  2QIC A;  4S3O C;  1LDJ B;  4GND A;  4IC2 A;  2L43 A;  4YAT A;  4NR7 A;  2YRE A;  3EB5 A;  4LZS A;  4UIX A;  2G45 A;  4L58 A;  5FE3 A;  4XYA A;  2CSZ A;  2YSM A;  5FG4 A;  4UIV A;  4B86 C;  5CQ3 A;  5CGP A;  4GPJ A;  5DYU A;  5HQ6 A;  5FER A;  4NXJ A;  2D82 A;  5C11 A;  4DON A;  4QF3 A;  2JMJ A;  1WGM A;  3K2J A;  5ENH A;  1MM2 A;  2D9E A;  2MNZ A;  2DVR A;  4UI9 B;  5K29 A;  3P1E A;  2FSA A;  5DFC A;  4ZC9 A;  4NRA A;  5EV9 A;  4O76 A;  3U5N A;  4ZDT A;  4QR5 A;  1JM7 B;  4BW4 A;  5KTW A;  2M6M A;  4LJN A;  4IR6 A;  5FE8 A;  5ENG A;  3N9P A;  5FB1 A;  3O33 A;  2Y1M A;  3HCU A;  2L75 A;  5IID A;  4J0R A;  2H60 A;  3HMH A;  3P1D A;  5G0F A;  4QR4 A;  2MT5 A;  4NUD A;  5H1T A;  4O77 A;  4N4H A;  2L80 A;  3Q2E A;  4I7B A;  3MUK A;  3KNV A;  3SOU A;  4NRC A;  3AQA A;  2YEM A;  5E3G A;  5E3D A;  5LKU A;  2HYE D;  2KFT A;  4O7A A;  2E7O A;  2E6S A;  4QC3 A;  4CFK A;  4HBY A;  3L11 A;  4UIY A;  5A7C A;  5D26 A;  5J3X A;  5FEY A;  4UYH A;  5CP5 A;  4YAD A;  5JI8 A;  4QY4 A;  3V43 A;  5IGM A;  5IG6 A;  5I29 A;  2ECJ A;  4YY6 A;  4O7B A;  4MR6 A;  2JMD A;  4GNF A;  2YW8 A;  5F60 A;  5TAB A;  4AYC A;  5F62 A;  2CSY A;  5EGU A;  4UP0 A;  2RO1 A;  4HXS A;  4TQN A;  4LYI A;  5HEM A;  5AMF A;  5ENB A;  5CU8 A;  4HXM A;  3ZPV E;  4QSQ A;  1V87 A;  2ECN A;  5DW2 A;  5FDZ A;  4YK0 A;  4CUQ A;  4QYL A;  3UV4 A;  5HRX A;  5I83 A;  2JMI A;  3SHB A;  5B75 A;  5I3L A;  4QEV A;  5A5Q A;  2RNW A;  5II2 A;  1LDK C;  4HXP A;  5E7D A;  4UIT A;  3P5O A;  5AD2 A;  4YBT A;  4QYD A;  5DY7 A;  4WHU A;  5D3N A;  3MHH A;  5D1K B;  5D3P A;  2E3K A;  5C89 A;  2KR4 A;  1E4U A;  5A81 A;  2NXB A;  3ONI A;  5CRM A;  5LVR A;  2EOD A;  2QJ0 A;  3U5L A;  2C2V S;  3KV5 A;  2DVV A;  5E74 A;  5L8U A;  5EVA A;  5BT3 A;  4O75 A;  4PPE A;  4A9E A;  2I7K A;  3S91 A;  2DAT A;  5B8D A;  4HXO A;  1WES A;  5KHM A;  5F25 A;  4O7F A;  2YQD A;  5F2P A;  2LSP B;  1VYX A;  1WEE A;  5A82 A;  4NYW A;  2L5U A;  5HRW A;  3DQV R;  4Z93 A;  3M63 A;  3RTR B;  5FFV A;  3HCT A;  2YT5 A;  4ALG A;  2LGK A;  3N9M A;  4BHW A;  2VPE A;  5E9K A;  5I40 A;  2XB1 A;  2PUY A;  5CY9 A;  5L99 A;  5F61 A;  5FH6 A;  3TLP A;  2R10 A;  2KRE A;  2VJE B;  5ETB A;  3N9O A;  4HBV A;  5G04 B;  3U5O A;  3SOX A;  1WEO A;  5CS8 A;  2YDW A;  3JVJ A;  4TTE A;  5ACY A;  4Q0N A;  2ECT A;  5C13 A;  2K4D A;  3LQH A;  4MR5 A;  4A9N A;  4A9O A;  5HLS A;  2N9G A;  1XWH A;  5FFW A;  3GV4 A;  3S92 A;  5DLZ A;  5ETD A;  2EGP A;  5E9I A;  2BAY A;  5DFD A;  5JWM A;  5G4R A;  5H1V A;  3JVM A;  2CT2 A;  5DKC A;  5E0R A;  1WUG A;  4TT2 A; 
#chains in the Genus database with same CATH topology
 4E96 A;  4WZ2 A;  4NQM A;  4IR4 A;  5EQ1 A;  5A5S A;  5EM3 A;  3KV6 A;  3T7L A;  2FUI A;  1U6G B;  2MJV B;  2KE1 A;  4P5O B;  3G0L A;  5DKD A;  2AN6 A;  3EB6 A;  4NR6 A;  2WP1 A;  5E9Y A;  3PUQ A;  1MM3 A;  4NN2 A;  4QF2 A;  5C85 A;  5EP7 A;  1X4J A;  3MUL A;  3DWY A;  4IOQ A;  2KGG A;  5TDW A;  4LR6 A;  4KCX A;  4F1P A;  5HFQ A;  2EJN A;  5B76 A;  5CQ4 A;  2L85 A;  4QUU A;  5TRB A;  5C4Q A;  2WP2 A;  2GRC A;  4PCE A;  5TCM A;  4YYN A;  5KO4 A;  1CHC A;  5EWC A;  4UIZ A;  3FEH A;  5FE2 A;  3ZTG A;  2QIZ A;  4A9H A;  3IU6 A;  4UYF A;  5FBX A;  5E73 A;  4I7D A;  4IC3 A;  3VK6 A;  4HBX A;  5G4S A;  4QC1 A;  4IR5 A;  5HQ5 A;  3E2D A;  5CPE A;  3GL6 A;  5TBN A;  2CKL A;  4O74 A;  1WIL A;  5H1U A;  5ENI A;  4OGE A;  2K16 A;  2LN0 A;  5CUA A;  2MA6 A;  3SVG A;  4AYC B;  2EA6 A;  4YAX A;  4LC2 A;  2KTB B;  3C5K A;  5F5Z A;  5HM0 A;  4XY9 A;  4X2I A;  4GB0 A;  4AUQ B;  2M1R A;  5HJC A;  4MSX A;  4LAD B;  4Y03 A;  5FE1 A;  4QZS A;  5DW1 A;  5HRV A;  5LUU A;  4QNS A;  3SVH A;  2H0D A;  2OWA A;  4X3G A;  3LQJ A;  5CQA A;  2E6R A;  4OGC A;  4XI1 A;  2KWK A;  3M62 A;  5EWW A;  4A9M A;  2L0B A;  5F36 A;  4LLB A;  4AKN A;  4NS5 A;  4AP4 A;  4QSR A;  3MB3 A;  4TU6 A;  5I89 A;  5AD3 A;  3U5M A;  2JM3 A;  4UP5 A;  2YVR A;  4YBM A;  4MR4 A;  4CUS A;  2LGG A;  2RI7 A;  4R7E A;  4ZUX U;  4AVX A;  4TT6 A;  5EIC A;  1IYM A;  5D0C A;  2D8S A;  2Y43 A;  2E7N A;  5I80 A;  5EWD A;  4Q6F A;  1ZKR A;  2F6J A;  3UVX A;  5CTL A;  3FM8 C;  3U5K A;  2DJA A;  4PS5 A;  4V3L C;  2OO1 A;  2LDR A;  4FIP A;  3U5J A;  5A5P A;  4LZ2 A;  2OUO A;  2RS9 B;  4IOO A;  2XP0 A;  3MHS A;  2M13 A;  2VJF A;  4NR9 A;  4ZW1 A;  1RMD A;  3UVY A;  4I7C A;  3O36 A;  3M99 A;  4NR4 A;  4F3I A;  3QZS A;  3LXJ A;  2RSD A;  5A5R A;  4HXN A;  1BOR A;  4CUU A;  4UIW A;  1WEQ A;  4UYG A;  5SVY A;  4A9L A;  2UZG A;  4OGI A;  2D8U A;  4TU4 A;  1F68 A;  3D7C A;  2FD4 A;  3LVQ E;  5I88 A;  1JOC A;  2IQJ A;  5CZG A;  2DWW A;  5G05 B;  5DYX A;  1WEP A;  4KV1 A;  2R0Y A;  5EU1 A;  2MD8 C;  3LDY A;  3P1C A;  4J1P A;  4Q0O A;  3SUB A;  4MEN A;  1N87 A;  5DKH A;  2XOY A;  4A4B A;  3O35 A;  5E9L A;  4A0C D;  2YEK A;  3JVL A;  2YW5 A;  4XUA A;  2JRJ A;  3UV5 A;  3RCW A;  2CRR A;  2ZET C;  2LGL A;  5FG5 A;  3MB4 A;  5J0D A;  4O64 A;  5LCW B;  3Q2F A;  3ZVZ B;  3O47 A;  5A83 A;  4CUP A;  4TS8 A;  5F63 A;  5FH8 A;  5B79 A;  3DAI A;  3PUR A;  4O71 A;  2LV9 A;  5SVI A;  2NAA A;  3LVR E;  4N4I A;  1K2F A;  1VD4 A;  4QB3 A;  4UYF B;  4YYG A;  5D1M B;  3RPG B;  2FUU A;  2LGV A;  3O70 A;  4Z0R A;  4KV4 A;  5HCL A;  4GNG A;  1WUM A;  2G4A A;  3QZV A;  5L8T A;  3VKH A;  1T1H A;  2CON A;  5C87 A;  2RNX A;  1WEU A;  3FAN A;  4PTB A;  4LDF A;  4LK9 A;  3LQI A;  3HMF A;  4A9K A;  4YYK A;  2CSV A;  4TT4 A;  5DFB A;  5F1H A;  5IGK A;  4QSP A;  5CUB A;  4YC9 A;  5D7X A;  5KU3 A;  5IBN A;  2YHN A;  3N9Q A;  4LKA A;  4Z6H A;  5LJ1 A;  4UYE A;  2LXP C;  2XEU A;  4BW3 A;  4QQ4 A;  2RFJ A;  5D24 A;  5DIN A;  4QEU A;  4CFL A;  2H0D B;  5DYA A;  2L7P A;  5FG6 A;  3KQI A;  4J0S A;  4HXR A;  3FJU B;  5COI A;  2G43 A;  1WE9 A;  2MA5 A;  4N4F A;  2OSS A;  1WEV A;  5SVX A;  4NR5 A;  1FP0 A;  3PHD A;  5D3S A;  4NQN A;  3VKG A;  2YU4 A;  5EK9 A;  4WZ3 B;  4TZ2 A;  3C6W A;  4ALH A;  3U5P A;  4MVT A;  5CRZ A;  4H9D A;  5IGN A;  5D3R A;  1X4I A;  1DCQ A;  4AKH A;  2DX8 A;  2YEL A;  2M85 A;  4V3K C;  5F1L A;  3O34 A;  5FE9 A;  1WIM A;  4QEW A;  5AME A;  3MDB C;  4A9J A;  4N4G A;  3O7A A;  2G6Q A;  5CQ5 A;  4XUB A;  2OXQ C;  3LRQ A;  2B0O E;  4LYW A;  2LAU A;  5FE7 A;  2YQL A;  5FFY A;  3I2D A;  3PLW A;  4YAB A;  2VPD A;  4MR3 A;  4W4U A;  2KKX A;  5JG6 A;  3GG3 A;  4OUF A;  3RPG C;  2IDA A;  5CQT A;  4NR8 A;  5KTU A;  4LYS A;  5EWH A;  1JSP B;  5AIT A;  3ZYU A;  4HXL A;  2L5E A;  2VJE A;  5KH3 A;  4C67 A;  1MBM A;  2KGI A;  5TDR A;  4QSW A;  5D1L B;  4QUT A;  5CUG A;  4NUE A;  5ENJ A;  1ZS5 A;  5B77 A;  2LXH C;  5ENE A;  1N72 A;  4OGJ A;  5LJ2 A;  4UYD A;  2K17 A;  5H85 A;  2RNY A;  5DX4 A;  5FE5 A;  3DPL R;  5I7Y A;  4NRB A;  5HEL A;  5EIS A;  5EPS A;  5DYC A;  4TYL A;  4YYJ A;  3M7K A;  5A85 A;  4PKL A;  3I3J A;  4YY4 A;  2C2L A;  5CQ8 A;  3UV2 A;  1WFK A;  3L1Z B;  4CA1 A;  3QZT A;  2DVS A;  3ASL A;  5DLX A;  5I7X A;  4HBW A;  5HQ7 A;  5F3A A;  2YSJ A;  4O72 A;  1HYI A;  4CL9 A;  5EPR A;  4Z6I A;  5EA1 A;  5CUE A;  5CQ7 A;  5EI4 A;  2HDP A;  3DDT A;  3JVK A;  4QSX A;  5D25 A;  4IOR A;  4ZQL A;  1WEW A;  2R0V A;  4BW1 A;  5FE0 A;  5LVQ A;  3SOW A;  4CLB A;  4YYD A;  4BW2 A;  5A5O A;  2VPG A;  3G0J A;  1Z6U A;  5A5N A;  2PNX A;  2EGM A;  4MEP A;  4O78 A;  4YH4 A;  2DVQ A;  5FE6 A;  5TB6 A;  4YYM A;  4BBQ A;  5HFR A;  1HYJ A;  2KWO A;  3ZNI A;  4QSU A;  5LKX A;  2LQ6 A;  2KYU A;  4IR3 A;  2KWJ A;  4QSV A;  5KTX A;  3NG2 A;  4O62 A;  4Z1Q A;  3SVF A;  5K3Q A;  4LRG A;  1JM7 A;  4TKP B;  1JM4 B;  4GNE A;  5CQ6 A;  4O7E A;  2M3H A;  3P1F A;  4N3W A;  5II1 A;  2MNY A;  4O70 A;  1Z2Q A;  5D3T A;  5LJ0 A;  4QST A;  2ECG A;  4F52 B;  4NYV A;  3MQM A;  4CUT A;  4MEQ A;  4O7C A;  4A49 A;  5FB0 A;  3O37 A;  5H9M A;  4QR3 A;  2LRI C;  4HXK A;  2ECW A;  3T6R A;  3N9L A;  5HEN A;  1WEN A;  1F62 A;  5I1Q A;  4NYX A;  4C9Z A;  2YUC A;  2DKW A;  5FE4 A;  2VPB A;  5L97 A;  5D3L A;  2R0S A;  3FKM X;  4PY6 A;  3HCS A;  4S3O B;  3NXB A;  5E9V A;  2CKL B;  4FO9 A;  2KWN A;  2YUR A;  3D1D A;  3LJW A;  5IGL A;  2MIQ A;  4TZ8 A;  4C66 A;  3IHP A;  2KIZ A;  2VNF A;  2YYN A;  4XY8 A;  2F6N A;  1FBV A;  2MKE A;  5EYA F;  4MEO A;  1VFY A;  1PUO A;  4WA6 A;  5D3J A;  4YYH A;  3AAD A;  4A9F A;  2ECV A;  2I50 A;  3T9K A;  2VP7 A;  3MXF A;  5DKA A;  4CUR A;  3UVD A;  1WEM A;  4YYI A;  2XOZ A;  1E6I A;  4LZR A;  3ZVY A;  5BT4 A;  4WIV A;  4B7Y C;  4R2Y A;  5EPB A;  2L84 A;  5CUC A;  4YH3 A;  4FLP A;  5LKT A;  5E9M A;  4WZ0 A;  2YHO A;  2KKY A;  2KU3 A;  4A9I A;  2YQM A;  5ENF A;  4PCI A;  3ZYQ A;  5CUD A;  5B78 A;  4R8P K;  4Z0O A;  5C8G A;  4L7X A;  1X0J A;  3N9N A;  4FK5 A;  4A4C A;  1DVP A;  4WHW A;  1Z60 A;  2MD7 B;  4CCG X;  5L98 A;  4YBS A;  5LKZ A;  3ZPV 1;  5ENC A;  3L1X A;  3IU5 A;  3HME A;  4J3I A;  4BJX A;  2Y1N A;  5CFW A;  2ECI A;  5I86 A;  4FJC A;  5C7N A;  5KH9 A;  2K1J A;  2YYR A;  5KH7 A;  5AIU A;  5L96 A;  5FH7 A;  2F42 A;  2MUM A;  3FL2 A;  5DBM A;  3HTK C;  4RVR A;  3UW9 A;  3UVW A;  1ZBD B;  1EQF A;  4QBM A;  2VJF B;  5EWV A;  1G25 A;  2I8N A;  4NUC A;  5D3H A;  5BT5 A;  4QSS A;  1X4U A;  4Z1S A;  3ERR A;  4UIU A;  2QIC A;  4S3O C;  1LDJ B;  4GND A;  4IC2 A;  2L43 A;  4YAT A;  4NR7 A;  2YRE A;  3EB5 A;  4LZS A;  4UIX A;  2G45 A;  4L58 A;  5FE3 A;  4XYA A;  2CSZ A;  2YSM A;  5FG4 A;  4UIV A;  4B86 C;  5CQ3 A;  5CGP A;  4GPJ A;  5DYU A;  5HQ6 A;  5FER A;  4NXJ A;  2D82 A;  5C11 A;  4DON A;  4QF3 A;  2JMJ A;  1WGM A;  3K2J A;  5ENH A;  1MM2 A;  2D9E A;  2MNZ A;  2DVR A;  4UI9 B;  5K29 A;  3P1E A;  2FSA A;  5DFC A;  4ZC9 A;  4NRA A;  5EV9 A;  4O76 A;  3U5N A;  4ZDT A;  4QR5 A;  1JM7 B;  4BW4 A;  5KTW A;  2M6M A;  4LJN A;  4IR6 A;  5FE8 A;  5ENG A;  3N9P A;  5FB1 A;  2EXU A;  3O33 A;  2Y1M A;  3HCU A;  4AKI A;  2L75 A;  5IID A;  4J0R A;  2H60 A;  3HMH A;  3P1D A;  5G0F A;  4QR4 A;  2MT5 A;  4NUD A;  5H1T A;  4O77 A;  4N4H A;  2L80 A;  3Q2E A;  4I7B A;  3MUK A;  3KNV A;  3SOU A;  4NRC A;  3AQA A;  2YEM A;  5E3G A;  5E3D A;  5LKU A;  2HYE D;  2KFT A;  4O7A A;  2E7O A;  2E6S A;  4QC3 A;  4CFK A;  3KDE C;  4HBY A;  3L11 A;  4UIY A;  5SVI B;  5A7C A;  5D26 A;  3LJU X;  5J3X A;  5FEY A;  4UYH A;  5CP5 A;  4YAD A;  5JI8 A;  4QY4 A;  3V43 A;  5IGM A;  5IG6 A;  4AKG A;  5I29 A;  2ECJ A;  2P57 A;  2FFW A;  4YY6 A;  4O7B A;  2JUN A;  4MR6 A;  3D1B A;  2JMD A;  4GNF A;  2YW8 A;  5F60 A;  5TAB A;  4AYC A;  5F62 A;  2CSY A;  5EGU A;  4UP0 A;  2RO1 A;  4HXS A;  4TQN A;  4LYI A;  5HEM A;  5AMF A;  5ENB A;  5CU8 A;  4HXM A;  3ZPV E;  4QSQ A;  1V87 A;  2ECN A;  5DW2 A;  5FDZ A;  4YK0 A;  4CUQ A;  4QYL A;  3UV4 A;  5HRX A;  5I83 A;  2JMI A;  3SHB A;  5B75 A;  5I3L A;  4QEV A;  5A5Q A;  2RNW A;  5II2 A;  1LDK C;  4HXP A;  5E7D A;  4UIT A;  3P5O A;  5AD2 A;  4YBT A;  4QYD A;  5DY7 A;  4WHU A;  5D3N A;  3MHH A;  5D1K B;  5D3P A;  2E3K A;  5C89 A;  2KR4 A;  1E4U A;  5A81 A;  2NXB A;  3ONI A;  5CRM A;  5LVR A;  2EOD A;  2QJ0 A;  3U5L A;  2C2V S;  3H7H A;  3KV5 A;  2DVV A;  5E74 A;  5L8U A;  2CRW A;  5EVA A;  5BT3 A;  4O75 A;  4PPE A;  4A9E A;  2I7K A;  3S91 A;  2DAT A;  5B8D A;  4HXO A;  1WES A;  5KHM A;  5F25 A;  4O7F A;  2YQD A;  5F2P A;  2LSP B;  1VYX A;  1WEE A;  5A82 A;  4NYW A;  2L5U A;  5HRW A;  3DQV R;  3Q1D A;  4Z93 A;  3M63 A;  3RTR B;  5FFV A;  3HCT A;  2YT5 A;  4ALG A;  2LGK A;  3N9M A;  4BHW A;  2RR4 A;  2VPE A;  2XOC A;  5E9K A;  5I40 A;  2XB1 A;  2PUY A;  5CY9 A;  5L99 A;  5F61 A;  3DWD A;  5FH6 A;  3TLP A;  2R10 A;  2KRE A;  2VJE B;  5ETB A;  3N9O A;  4HBV A;  5G04 B;  3U5O A;  3SOX A;  1WEO A;  5CS8 A;  2YDW A;  3JVJ A;  4TTE A;  5ACY A;  4Q0N A;  2ECT A;  3FAO A;  5C13 A;  2K4D A;  3LQH A;  4MR5 A;  4A9N A;  4A9O A;  5HLS A;  2N9G A;  4AI6 A;  1XWH A;  5FFW A;  3GV4 A;  3S92 A;  5DLZ A;  3JUE A;  5ETD A;  2EGP A;  5E9I A;  2BAY A;  5DFD A;  2DSM A;  5JWM A;  5G4R A;  5H1V A;  3JVM A;  2CT2 A;  2E61 A;  5DKC A;  5E0R A;  1WUG A;  4TT2 A; 
#chains in the Genus database with same CATH homology
 4E96 A;  4WZ2 A;  4NQM A;  4IR4 A;  5EQ1 A;  5A5S A;  5EM3 A;  3KV6 A;  3T7L A;  2FUI A;  1U6G B;  2MJV B;  2KE1 A;  4P5O B;  3G0L A;  5DKD A;  2AN6 A;  3EB6 A;  4NR6 A;  2WP1 A;  5E9Y A;  3PUQ A;  1MM3 A;  4NN2 A;  4QF2 A;  5C85 A;  5EP7 A;  1X4J A;  3MUL A;  3DWY A;  4IOQ A;  2KGG A;  5TDW A;  4LR6 A;  4KCX A;  5HFQ A;  5B76 A;  5CQ4 A;  2L85 A;  4QUU A;  5TRB A;  5C4Q A;  2WP2 A;  2GRC A;  4PCE A;  5TCM A;  4YYN A;  5KO4 A;  1CHC A;  5EWC A;  4UIZ A;  5FE2 A;  3ZTG A;  2QIZ A;  4A9H A;  3IU6 A;  4UYF A;  5FBX A;  5E73 A;  4I7D A;  4IC3 A;  3VK6 A;  4HBX A;  5G4S A;  4QC1 A;  4IR5 A;  5HQ5 A;  3GL6 A;  5CPE A;  5TBN A;  2CKL A;  4O74 A;  1WIL A;  5H1U A;  5ENI A;  2K16 A;  2LN0 A;  5CUA A;  2MA6 A;  3SVG A;  4AYC B;  2EA6 A;  4YAX A;  4LC2 A;  2KTB B;  3C5K A;  5F5Z A;  5HM0 A;  4XY9 A;  4X2I A;  4GB0 A;  4AUQ B;  2M1R A;  5HJC A;  4MSX A;  4LAD B;  4Y03 A;  5FE1 A;  4QZS A;  5DW1 A;  5HRV A;  5LUU A;  4QNS A;  3SVH A;  2H0D A;  4X3G A;  3LQJ A;  5CQA A;  2E6R A;  4XI1 A;  2KWK A;  3M62 A;  5EWW A;  4A9M A;  2L0B A;  5F36 A;  4LLB A;  4AKN A;  4NS5 A;  4AP4 A;  4QSR A;  3MB3 A;  4TU6 A;  5I89 A;  5AD3 A;  3U5M A;  4UP5 A;  4YBM A;  4MR4 A;  4CUS A;  2LGG A;  2RI7 A;  4R7E A;  4ZUX U;  4AVX A;  4TT6 A;  5EIC A;  1IYM A;  5D0C A;  2D8S A;  2Y43 A;  2E7N A;  5I80 A;  5EWD A;  4Q6F A;  2F6J A;  3UVX A;  5CTL A;  3U5K A;  4PS5 A;  4V3L C;  2OO1 A;  2LDR A;  4FIP A;  3U5J A;  5A5P A;  4LZ2 A;  2OUO A;  2RS9 B;  4IOO A;  3MHS A;  2VJF A;  4NR9 A;  4ZW1 A;  1RMD A;  3UVY A;  4I7C A;  3O36 A;  3M99 A;  4NR4 A;  4F3I A;  3QZS A;  3LXJ A;  2RSD A;  5A5R A;  4HXN A;  1BOR A;  4CUU A;  4UIW A;  1WEQ A;  4UYG A;  4A9L A;  2UZG A;  4OGI A;  4TU4 A;  1F68 A;  3D7C A;  5I88 A;  1JOC A;  5CZG A;  2DWW A;  5G05 B;  5DYX A;  1WEP A;  4KV1 A;  2R0Y A;  5EU1 A;  2MD8 C;  3P1C A;  4J1P A;  4Q0O A;  4MEN A;  1N87 A;  5DKH A;  4A4B A;  3O35 A;  5E9L A;  4A0C D;  2YEK A;  3JVL A;  2YW5 A;  4XUA A;  2JRJ A;  3UV5 A;  3RCW A;  2ZET C;  2LGL A;  5FG5 A;  3MB4 A;  5J0D A;  4O64 A;  5LCW B;  3Q2F A;  3ZVZ B;  5A83 A;  4CUP A;  4TS8 A;  5F63 A;  5FH8 A;  5B79 A;  3DAI A;  3PUR A;  4O71 A;  2LV9 A;  2NAA A;  4N4I A;  1K2F A;  1VD4 A;  4QB3 A;  4UYF B;  4YYG A;  5D1M B;  3RPG B;  2FUU A;  2LGV A;  3O70 A;  4KV4 A;  5HCL A;  4GNG A;  1WUM A;  2G4A A;  3QZV A;  5L8T A;  1T1H A;  5C87 A;  2RNX A;  1WEU A;  4PTB A;  4LDF A;  4LK9 A;  3LQI A;  3HMF A;  4A9K A;  4YYK A;  4TT4 A;  5DFB A;  5F1H A;  5IGK A;  4QSP A;  5CUB A;  4YC9 A;  5D7X A;  5KU3 A;  5IBN A;  2YHN A;  3N9Q A;  4LKA A;  4Z6H A;  5LJ1 A;  4UYE A;  2LXP C;  2XEU A;  4BW3 A;  5DIN A;  2RFJ A;  5D24 A;  4QEU A;  4CFL A;  2H0D B;  5DYA A;  3KQI A;  5FG6 A;  4J0S A;  4HXR A;  5COI A;  2G43 A;  1WE9 A;  2MA5 A;  4N4F A;  2OSS A;  1WEV A;  4NR5 A;  1FP0 A;  3PHD A;  5D3S A;  4NQN A;  2YU4 A;  5EK9 A;  4WZ3 B;  4TZ2 A;  3C6W A;  4ALH A;  3U5P A;  4MVT A;  5CRZ A;  5IGN A;  5D3R A;  1X4I A;  2DX8 A;  2YEL A;  2M85 A;  4V3K C;  5F1L A;  3O34 A;  5FE9 A;  1WIM A;  4QEW A;  5AME A;  4A9J A;  4N4G A;  3O7A A;  2G6Q A;  5CQ5 A;  4XUB A;  2OXQ C;  3LRQ A;  2YQL A;  4LYW A;  5FE7 A;  5FFY A;  3I2D A;  4YAB A;  2VPD A;  4MR3 A;  4W4U A;  5JG6 A;  3GG3 A;  4OUF A;  3RPG C;  2IDA A;  5CQT A;  4NR8 A;  5KTU A;  4LYS A;  5EWH A;  1JSP B;  5AIT A;  3ZYU A;  4HXL A;  2L5E A;  2VJE A;  5KH3 A;  4C67 A;  5TDR A;  2KGI A;  4QSW A;  5D1L B;  4QUT A;  5CUG A;  4NUE A;  5ENJ A;  1ZS5 A;  5B77 A;  2LXH C;  5ENE A;  1N72 A;  4OGJ A;  5LJ2 A;  4UYD A;  2K17 A;  5H85 A;  2RNY A;  5DX4 A;  5FE5 A;  3DPL R;  5I7Y A;  4NRB A;  5HEL A;  5EIS A;  5EPS A;  5DYC A;  4TYL A;  4YYJ A;  5A85 A;  4PKL A;  3I3J A;  4YY4 A;  2C2L A;  5CQ8 A;  3UV2 A;  1WFK A;  3L1Z B;  4CA1 A;  3QZT A;  2DVS A;  3ASL A;  5DLX A;  5I7X A;  4HBW A;  5HQ7 A;  5F3A A;  2YSJ A;  4O72 A;  1HYI A;  4CL9 A;  5EPR A;  4Z6I A;  5EA1 A;  5CUE A;  5CQ7 A;  5EI4 A;  2HDP A;  3JVK A;  4QSX A;  5D25 A;  4IOR A;  4ZQL A;  1WEW A;  2R0V A;  4BW1 A;  5FE0 A;  5LVQ A;  3SOW A;  4CLB A;  4YYD A;  4BW2 A;  5A5O A;  2VPG A;  3G0J A;  1Z6U A;  5A5N A;  2PNX A;  4MEP A;  4O78 A;  4YH4 A;  2DVQ A;  5FE6 A;  5TB6 A;  4YYM A;  4BBQ A;  5HFR A;  1HYJ A;  2KWO A;  3ZNI A;  4QSU A;  5LKX A;  2LQ6 A;  2KYU A;  4IR3 A;  2KWJ A;  4QSV A;  5KTX A;  3NG2 A;  4Z1Q A;  3SVF A;  4LRG A;  1JM7 A;  4TKP B;  1JM4 B;  4GNE A;  5CQ6 A;  4O7E A;  2M3H A;  3P1F A;  4N3W A;  5II1 A;  2MNY A;  4O70 A;  1Z2Q A;  5D3T A;  5LJ0 A;  4QST A;  2ECG A;  4F52 B;  4NYV A;  3MQM A;  4CUT A;  4MEQ A;  4O7C A;  4A49 A;  5FB0 A;  3O37 A;  5H9M A;  4QR3 A;  2LRI C;  4HXK A;  2ECW A;  3T6R A;  3N9L A;  5HEN A;  1WEN A;  1F62 A;  5I1Q A;  4NYX A;  4C9Z A;  2YUC A;  2DKW A;  5FE4 A;  2VPB A;  5L97 A;  5D3L A;  2R0S A;  3FKM X;  4PY6 A;  3HCS A;  4S3O B;  3NXB A;  5E9V A;  2CKL B;  4FO9 A;  2KWN A;  2YUR A;  3LJW A;  5IGL A;  2MIQ A;  4TZ8 A;  4C66 A;  3IHP A;  2KIZ A;  2VNF A;  2YYN A;  4XY8 A;  2F6N A;  1FBV A;  5EYA F;  4MEO A;  1VFY A;  4WA6 A;  5D3J A;  4YYH A;  3AAD A;  4A9F A;  2ECV A;  2I50 A;  2VP7 A;  3MXF A;  5DKA A;  4CUR A;  3UVD A;  1WEM A;  4YYI A;  4B7Y C;  1E6I A;  4LZR A;  3ZVY A;  5BT4 A;  4WIV A;  4R2Y A;  5EPB A;  2L84 A;  5CUC A;  4YH3 A;  4FLP A;  5LKT A;  5E9M A;  4WZ0 A;  2YHO A;  2KU3 A;  4A9I A;  2YQM A;  5ENF A;  4PCI A;  3ZYQ A;  5CUD A;  5B78 A;  4R8P K;  5C8G A;  4L7X A;  1X0J A;  3N9N A;  4FK5 A;  4A4C A;  1DVP A;  4WHW A;  1Z60 A;  2MD7 B;  4CCG X;  5L98 A;  4YBS A;  5LKZ A;  3ZPV 1;  5ENC A;  3L1X A;  3IU5 A;  3HME A;  4J3I A;  4BJX A;  2Y1N A;  5CFW A;  2ECI A;  5I86 A;  4FJC A;  5C7N A;  5KH9 A;  2K1J A;  2YYR A;  5KH7 A;  5AIU A;  5L96 A;  5FH7 A;  2F42 A;  2MUM A;  3FL2 A;  5DBM A;  3HTK C;  4RVR A;  3UW9 A;  3UVW A;  1ZBD B;  1EQF A;  4QBM A;  2VJF B;  5EWV A;  1G25 A;  2I8N A;  4NUC A;  5D3H A;  5BT5 A;  4QSS A;  1X4U A;  4Z1S A;  4UIU A;  2QIC A;  4S3O C;  1LDJ B;  4GND A;  4IC2 A;  2L43 A;  4YAT A;  4NR7 A;  2YRE A;  3EB5 A;  4LZS A;  4UIX A;  2G45 A;  4L58 A;  5FE3 A;  4XYA A;  2CSZ A;  2YSM A;  5FG4 A;  4UIV A;  4B86 C;  5CQ3 A;  5CGP A;  4GPJ A;  5DYU A;  5HQ6 A;  5FER A;  4NXJ A;  2D82 A;  5C11 A;  4DON A;  4QF3 A;  2JMJ A;  1WGM A;  3K2J A;  5ENH A;  1MM2 A;  2D9E A;  2MNZ A;  2DVR A;  4UI9 B;  5K29 A;  3P1E A;  2FSA A;  5DFC A;  4ZC9 A;  4NRA A;  5EV9 A;  4O76 A;  3U5N A;  4ZDT A;  4QR5 A;  1JM7 B;  4BW4 A;  5KTW A;  2M6M A;  4LJN A;  4IR6 A;  5FE8 A;  5ENG A;  3N9P A;  5FB1 A;  3O33 A;  2Y1M A;  3HCU A;  2L75 A;  5IID A;  4J0R A;  2H60 A;  3HMH A;  3P1D A;  5G0F A;  4QR4 A;  2MT5 A;  4NUD A;  5H1T A;  4O77 A;  4N4H A;  2L80 A;  3Q2E A;  4I7B A;  3MUK A;  3KNV A;  3SOU A;  4NRC A;  3AQA A;  2YEM A;  5E3G A;  5E3D A;  5LKU A;  2HYE D;  2KFT A;  4O7A A;  2E7O A;  2E6S A;  4QC3 A;  4CFK A;  4HBY A;  3L11 A;  4UIY A;  5A7C A;  5D26 A;  5J3X A;  5FEY A;  4UYH A;  5CP5 A;  4YAD A;  5JI8 A;  4QY4 A;  3V43 A;  5IGM A;  5IG6 A;  5I29 A;  2ECJ A;  4YY6 A;  4O7B A;  4MR6 A;  2JMD A;  4GNF A;  2YW8 A;  5F60 A;  5TAB A;  4AYC A;  5F62 A;  2CSY A;  5EGU A;  4UP0 A;  2RO1 A;  4HXS A;  4TQN A;  4LYI A;  5HEM A;  5AMF A;  5ENB A;  5CU8 A;  4HXM A;  3ZPV E;  4QSQ A;  1V87 A;  2ECN A;  5DW2 A;  5FDZ A;  4YK0 A;  4CUQ A;  4QYL A;  3UV4 A;  5HRX A;  5I83 A;  2JMI A;  3SHB A;  5B75 A;  5I3L A;  4QEV A;  5A5Q A;  2RNW A;  5II2 A;  1LDK C;  4HXP A;  5E7D A;  4UIT A;  3P5O A;  5AD2 A;  4YBT A;  4QYD A;  5DY7 A;  4WHU A;  5D3N A;  3MHH A;  5D1K B;  5D3P A;  2E3K A;  5C89 A;  2KR4 A;  1E4U A;  5A81 A;  2NXB A;  3ONI A;  5CRM A;  5LVR A;  2EOD A;  2QJ0 A;  3U5L A;  2C2V S;  3KV5 A;  2DVV A;  5E74 A;  5L8U A;  5EVA A;  5BT3 A;  4O75 A;  4PPE A;  4A9E A;  2I7K A;  3S91 A;  2DAT A;  5B8D A;  4HXO A;  1WES A;  5KHM A;  5F25 A;  4O7F A;  2YQD A;  5F2P A;  2LSP B;  1VYX A;  1WEE A;  5A82 A;  4NYW A;  2L5U A;  5HRW A;  3DQV R;  4Z93 A;  3M63 A;  3RTR B;  5FFV A;  3HCT A;  2YT5 A;  4ALG A;  2LGK A;  3N9M A;  4BHW A;  2VPE A;  5E9K A;  5I40 A;  2XB1 A;  2PUY A;  5CY9 A;  5L99 A;  5F61 A;  5FH6 A;  3TLP A;  2R10 A;  2KRE A;  2VJE B;  5ETB A;  3N9O A;  4HBV A;  5G04 B;  3U5O A;  3SOX A;  1WEO A;  5CS8 A;  2YDW A;  3JVJ A;  4TTE A;  5ACY A;  4Q0N A;  2ECT A;  5C13 A;  2K4D A;  3LQH A;  4MR5 A;  4A9N A;  4A9O A;  5HLS A;  2N9G A;  1XWH A;  5FFW A;  3GV4 A;  3S92 A;  5DLZ A;  5ETD A;  2EGP A;  5E9I A;  2BAY A;  5DFD A;  5JWM A;  5G4R A;  5H1V A;  3JVM A;  2CT2 A;  5DKC A;  5E0R A;  1WUG A;  4TT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...